(data stored in SCRATCH3701 zone)

EMBL: CP001853

ID   CP001853; SV 1; circular; genomic DNA; STD; PRO; 1942198 BP.
XX
AC   CP001853;
XX
PR   Project:PRJNA42883;
XX
DT   23-FEB-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Bifidobacterium animalis subsp. lactis BB-12, complete genome.
XX
KW   .
XX
OS   Bifidobacterium animalis subsp. lactis BB-12
OC   Bacteria; Actinobacteria; Bifidobacteriales; Bifidobacteriaceae;
OC   Bifidobacterium.
XX
RN   [1]
RP   1-1942198
RX   DOI; 10.1128/JB.00109-10.
RX   PUBMED; 20190051.
RA   Garrigues C., Johansen E., Pedersen M.B.;
RT   "Complete genome sequence of Bifidobacterium animalis subsp. lactis BB-12,
RT   a widely consumed probiotic strain";
RL   J. Bacteriol. 192(9):2467-2468(2010).
XX
RN   [2]
RP   1-1942198
RA   Garrigues C., Johansen E., Pedersen M.B.;
RT   ;
RL   Submitted (31-DEC-2009) to the INSDC.
RL   Physiology, Chr. Hansen A/S, Boge Alle 10-12, Horsholm 2970, Denmark
XX
DR   MD5; 7faf852cd421fce4281ccfde3ea17729.
DR   BioSample; SAMN02603131.
DR   EnsemblGenomes-Gn; BIF_00102.
DR   EnsemblGenomes-Gn; BIF_00612.
DR   EnsemblGenomes-Gn; BIF_16SrRNA03.
DR   EnsemblGenomes-Gn; BIF_16SrRNA06.
DR   EnsemblGenomes-Gn; BIF_16SrRNA09.
DR   EnsemblGenomes-Gn; BIF_16SrRNA12.
DR   EnsemblGenomes-Gn; BIF_23SrRNA02.
DR   EnsemblGenomes-Gn; BIF_23SrRNA05.
DR   EnsemblGenomes-Gn; BIF_23SrRNA08.
DR   EnsemblGenomes-Gn; BIF_23SrRNA11.
DR   EnsemblGenomes-Gn; BIF_5SrRNA01.
DR   EnsemblGenomes-Gn; BIF_5SrRNA04.
DR   EnsemblGenomes-Gn; BIF_5SrRNA07.
DR   EnsemblGenomes-Gn; BIF_5SrRNA10.
DR   EnsemblGenomes-Gn; BIF_tRNA01.
DR   EnsemblGenomes-Gn; BIF_tRNA02.
DR   EnsemblGenomes-Gn; BIF_tRNA03.
DR   EnsemblGenomes-Gn; BIF_tRNA04.
DR   EnsemblGenomes-Gn; BIF_tRNA05.
DR   EnsemblGenomes-Gn; BIF_tRNA06.
DR   EnsemblGenomes-Gn; BIF_tRNA07.
DR   EnsemblGenomes-Gn; BIF_tRNA08.
DR   EnsemblGenomes-Gn; BIF_tRNA09.
DR   EnsemblGenomes-Gn; BIF_tRNA10.
DR   EnsemblGenomes-Gn; BIF_tRNA11.
DR   EnsemblGenomes-Gn; BIF_tRNA12.
DR   EnsemblGenomes-Gn; BIF_tRNA13.
DR   EnsemblGenomes-Gn; BIF_tRNA14.
DR   EnsemblGenomes-Gn; BIF_tRNA15.
DR   EnsemblGenomes-Gn; BIF_tRNA16.
DR   EnsemblGenomes-Gn; BIF_tRNA17.
DR   EnsemblGenomes-Gn; BIF_tRNA18.
DR   EnsemblGenomes-Gn; BIF_tRNA19.
DR   EnsemblGenomes-Gn; BIF_tRNA20.
DR   EnsemblGenomes-Gn; BIF_tRNA21.
DR   EnsemblGenomes-Gn; BIF_tRNA22.
DR   EnsemblGenomes-Gn; BIF_tRNA23.
DR   EnsemblGenomes-Gn; BIF_tRNA24.
DR   EnsemblGenomes-Gn; BIF_tRNA25.
DR   EnsemblGenomes-Gn; BIF_tRNA26.
DR   EnsemblGenomes-Gn; BIF_tRNA27.
DR   EnsemblGenomes-Gn; BIF_tRNA28.
DR   EnsemblGenomes-Gn; BIF_tRNA29.
DR   EnsemblGenomes-Gn; BIF_tRNA30.
DR   EnsemblGenomes-Gn; BIF_tRNA31.
DR   EnsemblGenomes-Gn; BIF_tRNA32.
DR   EnsemblGenomes-Gn; BIF_tRNA33.
DR   EnsemblGenomes-Gn; BIF_tRNA34.
DR   EnsemblGenomes-Gn; BIF_tRNA35.
DR   EnsemblGenomes-Gn; BIF_tRNA36.
DR   EnsemblGenomes-Gn; BIF_tRNA37.
DR   EnsemblGenomes-Gn; BIF_tRNA38.
DR   EnsemblGenomes-Gn; BIF_tRNA39.
DR   EnsemblGenomes-Gn; BIF_tRNA40.
DR   EnsemblGenomes-Gn; BIF_tRNA41.
DR   EnsemblGenomes-Gn; BIF_tRNA42.
DR   EnsemblGenomes-Gn; BIF_tRNA43.
DR   EnsemblGenomes-Gn; BIF_tRNA44.
DR   EnsemblGenomes-Gn; BIF_tRNA45.
DR   EnsemblGenomes-Gn; BIF_tRNA46.
DR   EnsemblGenomes-Gn; BIF_tRNA47.
DR   EnsemblGenomes-Gn; BIF_tRNA48.
DR   EnsemblGenomes-Gn; BIF_tRNA49.
DR   EnsemblGenomes-Gn; BIF_tRNA50.
DR   EnsemblGenomes-Gn; BIF_tRNA51.
DR   EnsemblGenomes-Gn; BIF_tRNA52.
DR   EnsemblGenomes-Gn; EBG00001007086.
DR   EnsemblGenomes-Gn; EBG00001007087.
DR   EnsemblGenomes-Gn; EBG00001007088.
DR   EnsemblGenomes-Gn; EBG00001007089.
DR   EnsemblGenomes-Gn; EBG00001007091.
DR   EnsemblGenomes-Gn; EBG00001007092.
DR   EnsemblGenomes-Gn; EBG00001007093.
DR   EnsemblGenomes-Gn; EBG00001007094.
DR   EnsemblGenomes-Gn; EBG00001007095.
DR   EnsemblGenomes-Gn; EBG00001007096.
DR   EnsemblGenomes-Gn; EBG00001007097.
DR   EnsemblGenomes-Gn; EBG00001007098.
DR   EnsemblGenomes-Gn; EBG00001007099.
DR   EnsemblGenomes-Gn; EBG00001007100.
DR   EnsemblGenomes-Gn; EBG00001007101.
DR   EnsemblGenomes-Gn; EBG00001007102.
DR   EnsemblGenomes-Gn; EBG00001007103.
DR   EnsemblGenomes-Gn; EBG00001007104.
DR   EnsemblGenomes-Gn; EBG00001007105.
DR   EnsemblGenomes-Gn; EBG00001007106.
DR   EnsemblGenomes-Gn; EBG00001007107.
DR   EnsemblGenomes-Gn; EBG00001007108.
DR   EnsemblGenomes-Gn; EBG00001007109.
DR   EnsemblGenomes-Gn; EBG00001007111.
DR   EnsemblGenomes-Gn; EBG00001007112.
DR   EnsemblGenomes-Gn; EBG00001007113.
DR   EnsemblGenomes-Gn; EBG00001007114.
DR   EnsemblGenomes-Gn; EBG00001007115.
DR   EnsemblGenomes-Gn; EBG00001007117.
DR   EnsemblGenomes-Gn; EBG00001007118.
DR   EnsemblGenomes-Gn; EBG00001007119.
DR   EnsemblGenomes-Gn; EBG00001007121.
DR   EnsemblGenomes-Gn; EBG00001007122.
DR   EnsemblGenomes-Gn; EBG00001007123.
DR   EnsemblGenomes-Gn; EBG00001007124.
DR   EnsemblGenomes-Gn; EBG00001007125.
DR   EnsemblGenomes-Gn; EBG00001007126.
DR   EnsemblGenomes-Gn; EBG00001007127.
DR   EnsemblGenomes-Gn; EBG00001007128.
DR   EnsemblGenomes-Gn; EBG00001007129.
DR   EnsemblGenomes-Gn; EBG00001007130.
DR   EnsemblGenomes-Gn; EBG00001007131.
DR   EnsemblGenomes-Gn; EBG00001007132.
DR   EnsemblGenomes-Gn; EBG00001007133.
DR   EnsemblGenomes-Gn; EBG00001007134.
DR   EnsemblGenomes-Gn; EBG00001007135.
DR   EnsemblGenomes-Gn; EBG00001007136.
DR   EnsemblGenomes-Gn; EBG00001007137.
DR   EnsemblGenomes-Gn; EBG00001007138.
DR   EnsemblGenomes-Gn; EBG00001007139.
DR   EnsemblGenomes-Gn; EBG00001007140.
DR   EnsemblGenomes-Gn; EBG00001007141.
DR   EnsemblGenomes-Gn; EBG00001007142.
DR   EnsemblGenomes-Gn; EBG00001007143.
DR   EnsemblGenomes-Gn; EBG00001007144.
DR   EnsemblGenomes-Gn; EBG00001007145.
DR   EnsemblGenomes-Gn; EBG00001007146.
DR   EnsemblGenomes-Gn; EBG00001007147.
DR   EnsemblGenomes-Gn; EBG00001007148.
DR   EnsemblGenomes-Gn; EBG00001007149.
DR   EnsemblGenomes-Gn; EBG00001007150.
DR   EnsemblGenomes-Gn; EBG00001007151.
DR   EnsemblGenomes-Gn; EBG00001007152.
DR   EnsemblGenomes-Gn; EBG00001007153.
DR   EnsemblGenomes-Gn; EBG00001007154.
DR   EnsemblGenomes-Gn; EBG00001007155.
DR   EnsemblGenomes-Gn; EBG00001007156.
DR   EnsemblGenomes-Gn; EBG00001007157.
DR   EnsemblGenomes-Gn; EBG00001007158.
DR   EnsemblGenomes-Gn; EBG00001007159.
DR   EnsemblGenomes-Gn; EBG00001007160.
DR   EnsemblGenomes-Gn; EBG00001007161.
DR   EnsemblGenomes-Gn; EBG00001007162.
DR   EnsemblGenomes-Gn; EBG00001007163.
DR   EnsemblGenomes-Gn; EBG00001007164.
DR   EnsemblGenomes-Gn; EBG00001007165.
DR   EnsemblGenomes-Gn; EBG00001007166.
DR   EnsemblGenomes-Gn; EBG00001007167.
DR   EnsemblGenomes-Gn; EBG00001007168.
DR   EnsemblGenomes-Tr; ADC85995.
DR   EnsemblGenomes-Tr; ADC85996.
DR   EnsemblGenomes-Tr; BIF_16SrRNA03-1.
DR   EnsemblGenomes-Tr; BIF_16SrRNA06-1.
DR   EnsemblGenomes-Tr; BIF_16SrRNA09-1.
DR   EnsemblGenomes-Tr; BIF_16SrRNA12-1.
DR   EnsemblGenomes-Tr; BIF_23SrRNA02-1.
DR   EnsemblGenomes-Tr; BIF_23SrRNA05-1.
DR   EnsemblGenomes-Tr; BIF_23SrRNA08-1.
DR   EnsemblGenomes-Tr; BIF_23SrRNA11-1.
DR   EnsemblGenomes-Tr; BIF_5SrRNA01-1.
DR   EnsemblGenomes-Tr; BIF_5SrRNA04-1.
DR   EnsemblGenomes-Tr; BIF_5SrRNA07-1.
DR   EnsemblGenomes-Tr; BIF_5SrRNA10-1.
DR   EnsemblGenomes-Tr; BIF_tRNA01-1.
DR   EnsemblGenomes-Tr; BIF_tRNA02-1.
DR   EnsemblGenomes-Tr; BIF_tRNA03-1.
DR   EnsemblGenomes-Tr; BIF_tRNA04-1.
DR   EnsemblGenomes-Tr; BIF_tRNA05-1.
DR   EnsemblGenomes-Tr; BIF_tRNA06-1.
DR   EnsemblGenomes-Tr; BIF_tRNA07-1.
DR   EnsemblGenomes-Tr; BIF_tRNA08-1.
DR   EnsemblGenomes-Tr; BIF_tRNA09-1.
DR   EnsemblGenomes-Tr; BIF_tRNA10-1.
DR   EnsemblGenomes-Tr; BIF_tRNA11-1.
DR   EnsemblGenomes-Tr; BIF_tRNA12-1.
DR   EnsemblGenomes-Tr; BIF_tRNA13-1.
DR   EnsemblGenomes-Tr; BIF_tRNA14-1.
DR   EnsemblGenomes-Tr; BIF_tRNA15-1.
DR   EnsemblGenomes-Tr; BIF_tRNA16-1.
DR   EnsemblGenomes-Tr; BIF_tRNA17-1.
DR   EnsemblGenomes-Tr; BIF_tRNA18-1.
DR   EnsemblGenomes-Tr; BIF_tRNA19-1.
DR   EnsemblGenomes-Tr; BIF_tRNA20-1.
DR   EnsemblGenomes-Tr; BIF_tRNA21-1.
DR   EnsemblGenomes-Tr; BIF_tRNA22-1.
DR   EnsemblGenomes-Tr; BIF_tRNA23-1.
DR   EnsemblGenomes-Tr; BIF_tRNA24-1.
DR   EnsemblGenomes-Tr; BIF_tRNA25-1.
DR   EnsemblGenomes-Tr; BIF_tRNA26-1.
DR   EnsemblGenomes-Tr; BIF_tRNA27-1.
DR   EnsemblGenomes-Tr; BIF_tRNA28-1.
DR   EnsemblGenomes-Tr; BIF_tRNA29-1.
DR   EnsemblGenomes-Tr; BIF_tRNA30-1.
DR   EnsemblGenomes-Tr; BIF_tRNA31-1.
DR   EnsemblGenomes-Tr; BIF_tRNA32-1.
DR   EnsemblGenomes-Tr; BIF_tRNA33-1.
DR   EnsemblGenomes-Tr; BIF_tRNA34-1.
DR   EnsemblGenomes-Tr; BIF_tRNA35-1.
DR   EnsemblGenomes-Tr; BIF_tRNA36-1.
DR   EnsemblGenomes-Tr; BIF_tRNA37-1.
DR   EnsemblGenomes-Tr; BIF_tRNA38-1.
DR   EnsemblGenomes-Tr; BIF_tRNA39-1.
DR   EnsemblGenomes-Tr; BIF_tRNA40-1.
DR   EnsemblGenomes-Tr; BIF_tRNA41-1.
DR   EnsemblGenomes-Tr; BIF_tRNA42-1.
DR   EnsemblGenomes-Tr; BIF_tRNA43-1.
DR   EnsemblGenomes-Tr; BIF_tRNA44-1.
DR   EnsemblGenomes-Tr; BIF_tRNA45-1.
DR   EnsemblGenomes-Tr; BIF_tRNA46-1.
DR   EnsemblGenomes-Tr; BIF_tRNA47-1.
DR   EnsemblGenomes-Tr; BIF_tRNA48-1.
DR   EnsemblGenomes-Tr; BIF_tRNA49-1.
DR   EnsemblGenomes-Tr; BIF_tRNA50-1.
DR   EnsemblGenomes-Tr; BIF_tRNA51-1.
DR   EnsemblGenomes-Tr; BIF_tRNA52-1.
DR   EnsemblGenomes-Tr; EBT00001532226.
DR   EnsemblGenomes-Tr; EBT00001532227.
DR   EnsemblGenomes-Tr; EBT00001532228.
DR   EnsemblGenomes-Tr; EBT00001532229.
DR   EnsemblGenomes-Tr; EBT00001532230.
DR   EnsemblGenomes-Tr; EBT00001532231.
DR   EnsemblGenomes-Tr; EBT00001532232.
DR   EnsemblGenomes-Tr; EBT00001532233.
DR   EnsemblGenomes-Tr; EBT00001532234.
DR   EnsemblGenomes-Tr; EBT00001532235.
DR   EnsemblGenomes-Tr; EBT00001532236.
DR   EnsemblGenomes-Tr; EBT00001532237.
DR   EnsemblGenomes-Tr; EBT00001532238.
DR   EnsemblGenomes-Tr; EBT00001532239.
DR   EnsemblGenomes-Tr; EBT00001532240.
DR   EnsemblGenomes-Tr; EBT00001532241.
DR   EnsemblGenomes-Tr; EBT00001532242.
DR   EnsemblGenomes-Tr; EBT00001532243.
DR   EnsemblGenomes-Tr; EBT00001532244.
DR   EnsemblGenomes-Tr; EBT00001532245.
DR   EnsemblGenomes-Tr; EBT00001532246.
DR   EnsemblGenomes-Tr; EBT00001532247.
DR   EnsemblGenomes-Tr; EBT00001532248.
DR   EnsemblGenomes-Tr; EBT00001532249.
DR   EnsemblGenomes-Tr; EBT00001532250.
DR   EnsemblGenomes-Tr; EBT00001532251.
DR   EnsemblGenomes-Tr; EBT00001532252.
DR   EnsemblGenomes-Tr; EBT00001532253.
DR   EnsemblGenomes-Tr; EBT00001532254.
DR   EnsemblGenomes-Tr; EBT00001532255.
DR   EnsemblGenomes-Tr; EBT00001532256.
DR   EnsemblGenomes-Tr; EBT00001532257.
DR   EnsemblGenomes-Tr; EBT00001532258.
DR   EnsemblGenomes-Tr; EBT00001532259.
DR   EnsemblGenomes-Tr; EBT00001532260.
DR   EnsemblGenomes-Tr; EBT00001532261.
DR   EnsemblGenomes-Tr; EBT00001532262.
DR   EnsemblGenomes-Tr; EBT00001532263.
DR   EnsemblGenomes-Tr; EBT00001532265.
DR   EnsemblGenomes-Tr; EBT00001532266.
DR   EnsemblGenomes-Tr; EBT00001532267.
DR   EnsemblGenomes-Tr; EBT00001532268.
DR   EnsemblGenomes-Tr; EBT00001532269.
DR   EnsemblGenomes-Tr; EBT00001532270.
DR   EnsemblGenomes-Tr; EBT00001532271.
DR   EnsemblGenomes-Tr; EBT00001532272.
DR   EnsemblGenomes-Tr; EBT00001532273.
DR   EnsemblGenomes-Tr; EBT00001532274.
DR   EnsemblGenomes-Tr; EBT00001532275.
DR   EnsemblGenomes-Tr; EBT00001532276.
DR   EnsemblGenomes-Tr; EBT00001532277.
DR   EnsemblGenomes-Tr; EBT00001532278.
DR   EnsemblGenomes-Tr; EBT00001532279.
DR   EnsemblGenomes-Tr; EBT00001532280.
DR   EnsemblGenomes-Tr; EBT00001532282.
DR   EnsemblGenomes-Tr; EBT00001532283.
DR   EnsemblGenomes-Tr; EBT00001532284.
DR   EnsemblGenomes-Tr; EBT00001532285.
DR   EnsemblGenomes-Tr; EBT00001532286.
DR   EnsemblGenomes-Tr; EBT00001532287.
DR   EnsemblGenomes-Tr; EBT00001532288.
DR   EnsemblGenomes-Tr; EBT00001532290.
DR   EnsemblGenomes-Tr; EBT00001532292.
DR   EnsemblGenomes-Tr; EBT00001532293.
DR   EnsemblGenomes-Tr; EBT00001532294.
DR   EnsemblGenomes-Tr; EBT00001532295.
DR   EnsemblGenomes-Tr; EBT00001532296.
DR   EnsemblGenomes-Tr; EBT00001532297.
DR   EnsemblGenomes-Tr; EBT00001532298.
DR   EnsemblGenomes-Tr; EBT00001532299.
DR   EnsemblGenomes-Tr; EBT00001532300.
DR   EnsemblGenomes-Tr; EBT00001532301.
DR   EnsemblGenomes-Tr; EBT00001532302.
DR   EnsemblGenomes-Tr; EBT00001532303.
DR   EnsemblGenomes-Tr; EBT00001532304.
DR   EnsemblGenomes-Tr; EBT00001532305.
DR   EnsemblGenomes-Tr; EBT00001532306.
DR   EnsemblGenomes-Tr; EBT00001532307.
DR   EnsemblGenomes-Tr; EBT00001532308.
DR   EuropePMC; PMC2863482; 20190051.
DR   EuropePMC; PMC2937518; 20805404.
DR   EuropePMC; PMC2976271; 20851982.
DR   EuropePMC; PMC3145055; 21484167.
DR   EuropePMC; PMC3318781; 22307308.
DR   EuropePMC; PMC3697524; 23645200.
DR   EuropePMC; PMC4335975; 25515139.
DR   EuropePMC; PMC4908950; 27379055.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001853.
DR   SILVA-SSU; CP001853.
DR   StrainInfo; 376260; 0.
XX
CC   BB12 can be acquired from Chr. Hansen Culture Collection (CHCC):
CC   Chr. Hansen A/S, Boge Alle 10-12, DK-2970 Horsholm, Denmark,
CC   E-mail: dkmbp@chr-hansen.com.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1942198
FT                   /organism="Bifidobacterium animalis subsp. lactis BB-12"
FT                   /sub_species="lactis"
FT                   /strain="BB-12"
FT                   /mol_type="genomic DNA"
FT                   /note="CHCC544"
FT                   /db_xref="taxon:552531"
FT   gene            325..1674
FT                   /locus_tag="BIF_00469"
FT   CDS_pept        325..1674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00469"
FT                   /product="Maltose/maltodextrin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84507"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5X5"
FT                   /protein_id="ADC84507.1"
FT                   /translation="MRKGSKMNRTVKATVGLVAIAAMSLTGLAACGGSSADDGKGKVYF
FT                   LNFQPEAADQWVALAKKYTDKTGVQVKVQTAASGTYEQTLKSELAKSDAPTIFQVNGPV
FT                   GYQNWKGYTADLKDTGIYNELNNKDIALKDGDKVVGIPYVMETYGIIYNKDLLKKYTEL
FT                   PGAKIKDVKEIDSFDKLKEVADDMQAKKDQLGIKGAFTSAGFDSSSDWRFKTHLANIPL
FT                   SYEFKEDGVTTQPETIKGTYLPNFKNIFDLYLKDSTTAPSQLSSKTGDDANSEFALGEA
FT                   AFYQNGTWAWTDLQKAGMKPDQVGMLPIYIGAKGEENQGLATGSENYLCINAKASEADQ
FT                   KASKDFLNWVVTSDEGIKALSEDMGFTTPFKTFDKVKSDNPLVEEAVEDSNSGKEQVAW
FT                   NFTMMPSEEWKNQLGQAMLAYAQGNGSWDDVQKAFVDNWKTEYDNAHANQ"
FT   gene            complement(1920..3263)
FT                   /locus_tag="BIF_02145"
FT   CDS_pept        complement(1920..3263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02145"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84508"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5X3"
FT                   /protein_id="ADC84508.1"
FT                   /translation="MIEKLNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGP
FT                   GLRQIRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCS
FT                   RSWSDDPEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGM
FT                   LLLEQADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQ
FT                   VLREWMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTRV
FT                   RCRLQRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDA
FT                   YQRVIHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRH
FT                   PRSSNGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            complement(3260..4651)
FT                   /locus_tag="BIF_00889"
FT   CDS_pept        complement(3260..4651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00889"
FT                   /product="Type I restriction-modification system
FT                   methylation subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00889"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84509"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5X7"
FT                   /protein_id="ADC84509.1"
FT                   /translation="MRATGRRRAGAPRIPATIGVCRKGDVMSISASEKPLSKVFTSDYR
FT                   FTIPSFQRSYSWHDAQMRQLVNDVMDACALHDGPYFLGSLILVHDERGMHQVIDGQQRL
FT                   VSLSILFSILLALEEDPQLTSSLEGLLMEAGDKLRGINAEPRLTLREQDEGFFREYVQQ
FT                   GDLEALFDLRETDIHTQAQRNIQGNTRCAYDILARMQDDERRQFAQYLVNDVMFVIVTT
FT                   DDISGAYRIFDVMNMRGMPLTPSDVFKAKVVSSISPAARDAYARYWDEIMEPMGDDTER
FT                   IERFFKDLDLIATKTPLCESLIADFMDHVLERYMRKGEGIEYIDEVLRPYAIANEIIHR
FT                   PGESLLPDDVVDLLIGLNDYPSKDWHPVAMWVLVHSLKGLDDPDTVVFERQTADHGREH
FT                   QVKVHDAQRLRDVLASLDRVTGTDCLNGKSELERRTRASTIVRDLNKGALLKLVCKGRA
FT                   SSLLV"
FT   gene            complement(4721..5569)
FT                   /locus_tag="BIF_00888"
FT   CDS_pept        complement(4721..5569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00888"
FT                   /product="O-acetyltransferase (cell wall biosynthesis)"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00888"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84510"
FT                   /db_xref="GOA:D3R5X8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="InterPro:IPR039369"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5X8"
FT                   /protein_id="ADC84510.1"
FT                   /translation="MIVNRLLHSNVISFSFERAFVWYCKRFHRTEYTNLRRLECSGMPW
FT                   IAIRASSDILEPENESRTQGTTNAMTNGTSADTREYERMLSGELYIADDPYLKEHSLKR
FT                   RRLVQEINRSDYDEFDKREALFRELFGSFGEGSYIEPPFRADYGCNTYIGRNFYANTDC
FT                   IFLDVARIDIGDNVFCGPRVSLLTPYHPIDAQVRNEQLEGGKPISIGNDVWFGGNVTVC
FT                   PGVTIGDDVVIGAGSVVVKDIPSHCIAVGNPCRPIRAITDADHEQWQRKAREYRAWKEG
FT                   I"
FT   gene            5496..5786
FT                   /locus_tag="BIF_01820"
FT   CDS_pept        5496..5786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84511"
FT                   /db_xref="GOA:D3R5X9"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5X9"
FT                   /protein_id="ADC84511.1"
FT                   /translation="MQYQTNALSKEKDMTLLWSSLFTIIVVGLALWVLYYIIRAAVSAG
FT                   IKDAYAQMGFIREPDTKEDQLQRRREELQEERVQTIVNSEADRMSGKNGKH"
FT   gene            complement(5854..8553)
FT                   /locus_tag="BIF_00057"
FT   CDS_pept        complement(5854..8553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00057"
FT                   /product="Aconitate hydratase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84512"
FT                   /db_xref="GOA:D3R5Y0"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y0"
FT                   /protein_id="ADC84512.1"
FT                   /translation="MSLRDEQLDVLKVGDKSYDYYRIADLEGVDHLPYSLKVLVENLVR
FT                   NIDGANITDEQVRELLAWDPAADPSHEIQFIPSRVVMQDFTGVPCVVDLATMRDAVKSL
FT                   GGDPEVINPQVQSDMIIDHSVQIDAYGVENAVEINMDIEYQRNGERYRFLRWGQQAFEN
FT                   FRVVPPGTGIIHQVNIEYLAQVVMRKELSKGTTLAYLDSCVGTDSHTTTVNGLGVLGWG
FT                   VGGIEAEAAMLGQPISMLVPRVVGFKLTGSIPEGVTATDVVLTITDLLRRHGVVGKFVE
FT                   FYGEGIASVPLANRATIGNMSPEFGSTCGIFPIDEVTLDYLRLTGRSEEQVALVEAYAK
FT                   ANKLWHDVNDPNFVEPSYSEYLELDLSTVVPSIAGPKRPQDRIELSHAKTTFEQTLPGY
FT                   ITEKTNGNPVPVSTDFRGDFELTNGDVAIASITSCTNTSNPSVMIAAGLIARNAVAKGL
FT                   KPKPWVKTSLAPGSQVVADYLKQAGLQDDLDRLGYELVGFGCATCIGNSGPLLPEISEA
FT                   INANDLTVTAVLSGNRNFEGRISPDVKMNYLASPPLVIAYALAGTMDFDFEHEALGKDP
FT                   EGNDVYLKDIWPTNAEVEQVVSGNVSREMFLNDYASVFEGDSRWKGLDVPEGELFAWNP
FT                   ESTYVRKQTFFDGMSATPAPVEDIRDARVLALLGDSVTTDHISPAGAFKASSPAGKYLV
FT                   EHGVEPKNFNSYGSRRGNHEVMVRGTFGNIRLRNMLLASVGEEVRPGGYTYDFLAMKPT
FT                   TIYEASRDYIDNGVPLVVLGGKEYGTGSSRDWAAKGTAMLGVKAVIVESFERIHRSNLI
FT                   GMGVLPLQFPEGESAESLGLDGTETYSITGITELNNGVTPKSVHVEATHKDGSKTEFEA
FT                   VVRIDTPGEADYYRNGGILQYVLRNLMK"
FT   gene            complement(8621..11209)
FT                   /locus_tag="BIF_00241"
FT   CDS_pept        complement(8621..11209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00241"
FT                   /product="Cation-transporting ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84513"
FT                   /db_xref="GOA:D3R5Y1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y1"
FT                   /protein_id="ADC84513.1"
FT                   /translation="MSRLANMSDSANAQQSVSMTGAQGGDDHAHMPDVTEKGLTAAEVR
FT                   DRVERGQTNEVKSSTSRSLADIVRANVFTLFNGIIFTAMVMVLITGSWKDAVFGLVILI
FT                   NTGIGIVTELRAKRTLDKLSILIASDYLVRRDGKDVDVPHNGIVLGDCLWIRSGEQIPC
FT                   DAEILHTWGLELDESMITGESRTVRKQEGETVYSGSTAVSGMALVKVTAVGAHSYAATL
FT                   TAQAKVYKKNVSDLNKGINTILKFMTFLVVPLCMLLIVTQMRTVGGWHNAIATGEWRQA
FT                   VVSSVAGVVGMVPEGLVLLTSLNFALAAIRLARKNTLVQDLDSVETLARVDALNLDKTG
FT                   TITDGGIVYDDFIALPGCRNKQHAMQALYDLANEESPNGTGRAVLEGLGKQGFSGSAGL
FT                   VRVPFSSARKWSAVAFHGLPDEGQNGVWYMGAPEVLLSGFDGEYQQILAQVNEYANNGN
FT                   RVLLIAHVPGGDVPADFETNPQLERTAVPVAIVLCSEHIRSDAEPTLRWFREQGVRCRV
FT                   ISGDNPVTVGAIAAKVQLTGERKPVAMDARELPKNVDELARVLEGVDVLGRVLPEQKKA
FT                   IVQALHTQDHVVAMTGDGVNDALAIKEADLGIAMGNAAPATKAVAEVVLVDSKFSHLPD
FT                   VVARGRQVMANMERVASLFVTKTAYSALISLGVVLMGIPFPYLPRHISYIGALTIGAPA
FT                   FFLALAPNTRRYIPGFLRRVVAFSVPCGIATGLSVLLSAWFIPRFMHWNVFTSEQQLFW
FT                   LRSMCATVLFLMGIYVLSRVSKPLNSWRGWLVLAFAAAGVIGACIPFIARFFAFGLPAG
FT                   RAVWILLLQMAVATVLFVISIWVFSRFLPKWMREAGRETGINGASHNTNG"
FT   gene            complement(11240..12166)
FT                   /locus_tag="BIF_00688"
FT   CDS_pept        complement(11240..12166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00688"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84514"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y2"
FT                   /protein_id="ADC84514.1"
FT                   /translation="MRGESAYLPAVPCRCGLVSMARRGHRHESVLAFAETCCFRHIAAL
FT                   WRYTDEKMPVLSSYLRQSALIWRNRTPICVVLSQICADMTKSRYAICITAPELRLGEMG
FT                   TGSAAGGRNMARRTKRLAAIACAVAALALMAGCTPKGAAVGDTQNNETYEHNHNENTGA
FT                   RLDVAVIGSPHGGADELVMRSLATKEFKASYTGVQQYSADPQRAADFARKAVSDAVSRH
FT                   PKVIVISGLTFHDDESQWNTALANARNAGIPVVLLNPADVPGDTKLFAATFVVNDRMMD
FT                   AQPMGEALRSVIFDHPHEREIVVSTRS"
FT   gene            complement(12163..13473)
FT                   /locus_tag="BIF_01331"
FT   CDS_pept        complement(12163..13473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01331"
FT                   /product="tRNA (Uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01331"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84515"
FT                   /db_xref="GOA:D3R5Y3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y3"
FT                   /protein_id="ADC84515.1"
FT                   /translation="MEATVDIERYADQGRCVAHIDGRVVFVRFALPGERVRIELDEPTN
FT                   RNDRFWTGEVVEVLEPSPDRVEPLWPLAAPLAMGGGAGGADLIHVSLEGQERWKEATLK
FT                   DVMKRLGHVDLDDVPVYAMPGDEQAHGLHWRTRIEMVTDDEGRPSMRRRGTHVRVPIDT
FT                   MPLATRAVLEVAEMNGVWDGNLPENAQIRIAVPEPRVDAEQIADPEALRKAIGRNYAIM
FT                   VDGKVRHGSRALKETIMVDGKPFEYTVDAGGFWQMHREAPMVLPQYVIDQIRETPGDRA
FT                   PRNGRNLVIWDLYSGSGLFTLPLATLLDDRAKLVSIEGAKDAVANARRNLRNAGIHTVQ
FT                   ALCGDVLHTLDKDIDPQRAHPDIVVLDPPRAGAKAKVCHKIANSGAPIVVYIACDPASL
FT                   ARDTATLTEHGYRIHSIAAFDIYPQTHHVETVAVFVK"
FT   gene            complement(13587..14357)
FT                   /locus_tag="BIF_01330"
FT   CDS_pept        complement(13587..14357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01330"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84516"
FT                   /db_xref="GOA:D3R5Y4"
FT                   /db_xref="InterPro:IPR016566"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y4"
FT                   /protein_id="ADC84516.1"
FT                   /translation="MSNQNERHASNTRPARARSGMAALANAGENDEFSVIAAIGGVRGV
FT                   VESMLPGLLFVVLFICTSDLRMTVIASAALAVVQVVVRLIQRQSVMGALGGLVAVGICL
FT                   FWAWKSGEARNYYMYGFITNAAYIVLLLVSMAVRVPGLGFLVEFIRSLPTEHFKAWLSG
FT                   WRSDRALYKAYARITWLWIGLFALRLIVQVPLYMTNQVGWLGTTRLVMGIPFWALAIWI
FT                   SYLIVADPLHRHRMLEKERESTSTEGGDAHPTAQ"
FT   gene            complement(14426..15310)
FT                   /locus_tag="BIF_01329"
FT   CDS_pept        complement(14426..15310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01329"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01329"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84517"
FT                   /db_xref="InterPro:IPR022183"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y5"
FT                   /protein_id="ADC84517.1"
FT                   /translation="MVYVLHGGMMGLFGFGRKKKKQQDDERLAEAVDSRTEDVAVEDSE
FT                   DDEQTEVLEGARTEVGVDYEGRGETVGPWDVDDANAPDYDEYLSLGAYYLPFVQGIQLR
FT                   IKANNATHEIVGATMTIGNSSLEVEAFAAPKTMGLWDDVREDLLASNPEAEAVDGIFGT
FT                   EVKLPVKLPNGKTAHTRIVGVDGPRWMLRGIFSGKAASDPDGTETKILNDAFAQIVVER
FT                   GDEPLSPRDPIPMARPLTPNERRALAAQEEDGDLAGDDHSKIPGRPDGPLSTDQQVEQQ
FT                   TTLRRGPMFSEVR"
FT   gene            complement(15417..16277)
FT                   /locus_tag="BIF_01328"
FT   CDS_pept        complement(15417..16277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01328"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01328"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84518"
FT                   /db_xref="GOA:D3R5Y6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y6"
FT                   /protein_id="ADC84518.1"
FT                   /translation="MALTITTSNLNGIRAAKRKGFDHWAKAHTPNVWCMQETRAPQEII
FT                   ADIYGELAADYVHAGKIASPEELHTLVDVCRIKGRAGVGMISDMPVLETRVGLPGLEED
FT                   VDSGRWIEADVRTEQGYVITVVCVYVHAGGLVDDPKEAQKYRFLDTMTERMQQLQDEAA
FT                   SGGRQAVVCGDFNIAHNPIDLKNPKSNENNNGYFPRERAYMDKWIDQMDYVDVMRDLAG
FT                   DIQGPYTWWSQRGRAFDNDSGWRLDYQFATPELAQQARGFVVDRASSYDSRWSDHAPLT
FT                   ISYDV"
FT   gene            16222..16350
FT                   /locus_tag="BIF_02144"
FT   CDS_pept        16222..16350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02144"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84519"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y7"
FT                   /protein_id="ADC84519.1"
FT                   /translation="MRLAARMPFRFEVVIVKAMLKAYQRAQHMVLANRFHAVFHIS"
FT   gene            16445..17125
FT                   /locus_tag="BIF_01327"
FT   CDS_pept        16445..17125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01327"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84520"
FT                   /db_xref="GOA:D3R5Y8"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y8"
FT                   /protein_id="ADC84520.1"
FT                   /translation="MDMTKPTDSPAAKLPMPRGFKLFIALAVLMVVGAAISLFDKSEFY
FT                   ADVFIEISVFCVFLAGFFTNTRTLQFAYLVGANIYVIVCLGAFSTVFFTKMNQGVGVLL
FT                   IIQIIFSCLNLVPIIIYHLTDREFFYTYQRQLIYPTLFFVFVLLGHLPGGDVLTSEVSH
FT                   EIFSLIIFAQAFEIMDAIHKVGKAHHMAAYAINTQPLGTKLVPDTDDADDSEGSLDEPE
FT                   DVEE"
FT   gene            complement(17385..19448)
FT                   /locus_tag="BIF_02143"
FT   CDS_pept        complement(17385..19448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02143"
FT                   /product="OppD"
FT                   /note="Oligopeptide transport ATP-binding protein; OppF"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02143"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84521"
FT                   /db_xref="GOA:D3R5Y9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Y9"
FT                   /protein_id="ADC84521.1"
FT                   /translation="MSAQETSMTNETQSNQETIEEKIEDMQHEVGPLLEVKDLQVDFTT
FT                   DEGKPIHAVRNSSFSVYPGQWVAIVGESGSGKSTSAMACLGLLPGTGHVVGGSIKLEGQ
FT                   EISQYSPKQFASIRGSKMGLVPQDPMSNLNPVYRIGTQVKEALTANHMDVAHEKRSNLS
FT                   KALAQADITIKSEGDETFLGSKELPELLEAAGQALVKAGVEGGKYEKRMAYFREEWVPG
FT                   SETRWRVADDLIKSGVKDDDAWYIAKKYVTGSTMTDRIAGLLDEAGLPDAATRARQYPH
FT                   EFSGGMRQRALIAIGLACRPELLIADEPTSALDVTVQKRILDHLQELTNSLGTAVLFIT
FT                   HDLGLAAERAQHIVVMYKGQVVESGPSLEVLQNPQHPYTKRLVAAAPSLASQRIISVEE
FT                   KGEDATSLMDHKVDEDKLEHSDVIIDVDHLTKEFKLPRRREMFKAVDDVSFKIRRGTTL
FT                   AIVGESGSGKSTVANMVLRLLEPTSGKVLYNGQDIQEFKGKSLLDFRRHVQPVFQNPYG
FT                   SLDPMYSIYRSIEEPLRIHKIGDKKSRLNRVKELLDMVELPESVMARYPNELSGGQRQR
FT                   IAIARAMALNPDVIVCDEAVSALDVLVQDQVLHLLNDLQAKQGLTYLFITHDLAVVRQI
FT                   ADDVVVMQHGKLVEHDTTDEVFLHPQQQYTKDLLDAIPGGKLELGLNLEDKA"
FT   gene            complement(19445..20464)
FT                   /locus_tag="BIF_00040"
FT   CDS_pept        complement(19445..20464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00040"
FT                   /product="OppC"
FT                   /note="Oligopeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84522"
FT                   /db_xref="GOA:D3R5Z0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z0"
FT                   /protein_id="ADC84522.1"
FT                   /translation="MSICSTRRLTRASATCEGGRDMTDITNKPLPGQERFVAPLDETPL
FT                   LSVDNVDESAPATSMWADAWRTLRKNPMFIISGIVILFILFVAIFPGVFTRTNPNYCNL
FT                   ENSLDGSQPGHPFGFDLQGCDVYARVVYGARTSISVGVLTTIIVVAVGTLIGAIAGFFG
FT                   GWVDAVLSRLVDIFLAIPMLLGAIVVLQMFRTSSSIWKVVLVLALFGWVSTARIARGAV
FT                   LSSKNLEFNTASTALGSTPMRNLFRHILPNSVAPIIVIGTTSLGSYIVSEATLSFLGIG
FT                   LPPSVVSWGGDISKAQTVLRTDPMVLFYPSLALAITVLAFIMMGDAVKDALDPKSRTA"
FT   gene            20670..21596
FT                   /locus_tag="BIF_02142"
FT   CDS_pept        20670..21596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02142"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84523"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z1"
FT                   /protein_id="ADC84523.1"
FT                   /translation="MTERDRGVAHALGTGGAHVVLCDVRRDFGTGQANDVRHGNRPEHH
FT                   GRQQQVEEARVRARRHREDVSLDAEEVLADEAGDEGRHRDEQQRDDQDDRIVPLAFLEA
FT                   GDCAEHAAEDRLEAERHEGELQGDRERPAYLVDHWLAGECVAEVQRQCVLQEQQILDNK
FT                   RLVQIVFTADLGCDGLIDWLVAEHRLDWIAWQREYERVYQQCCTKNHGDHLQNTSQKIL
FT                   AHRFLLANSMPVQRGELDTPAVASVIQFVPSLPHALTYVEKKMPHMGYGRCGPPRKSQW
FT                   PSACNRNTEANGFALFPWMVAHVLTQL"
FT   gene            complement(21631..23271)
FT                   /locus_tag="BIF_00737"
FT   CDS_pept        complement(21631..23271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00737"
FT                   /product="OppA"
FT                   /note="Oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00737"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84524"
FT                   /db_xref="GOA:D3R5Z2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z2"
FT                   /protein_id="ADC84524.1"
FT                   /translation="MKKKTLGLIAGICSLGMMLSLSACGSNGGSSAKGSGDNIITAYNS
FT                   EPQNALIPGDTNETGGGKVGQLLFANLIAFNAKGEAENEVADSIKPNADSTQYTITLKD
FT                   GWKFTDGTPVTAESFTKAWSYVANAKNAQKCSSFFSSIKGYDKLQDANSLKGDEQLEGL
FT                   KVKDDKTFTVDLNAPDSVFPVKIGYLAFAPLPESFYKDPKAFGEKPVGNGMYKLDSWDH
FT                   GKQIVLSKNADYKGSQKVANNGVTFKIYTSPDSAYADVQAGNLDVMDTVPASNTKTFQS
FT                   DPDVEPYNKAGSVIQTFTIPADLDHWKTGTEEGQLRRQALSMAINREQIVEKVLNGIGT
FT                   VATDFTAPVIPGYSKDLKGSDNLKYNPTKAKELWAKADAISKYDGKLTFSFNADGGAQP
FT                   IYEAVVNQVNNTLGIQASINPMPTFQEFRDAISNRTIKGAFRTAWQPDYPSAENYLYQL
FT                   YDTAAANGHGSNDGDYSNKDVDKLLDQAASATDQETAIKYYHDAEEILLEQLPAFPLYY
FT                   SNADGVAAKGVKNFQMDWQNQPIYEEMSK"
FT   gene            complement(23548..24483)
FT                   /locus_tag="BIF_00736"
FT   CDS_pept        complement(23548..24483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00736"
FT                   /product="Integrase/recombinase (XerD/RipX family)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00736"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84525"
FT                   /db_xref="GOA:D3R5Z3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z3"
FT                   /protein_id="ADC84525.1"
FT                   /translation="MDAQVLMERFIEYLRSNRGLSEHTCMAYRGDILQCLEALDAFGRG
FT                   NPDDVTLDDLRMWMGRMAHTVGKTSLARKTIAVRSFFTWAYEHGMLAHNPAHALRTPKI
FT                   DRNLPAVLNEDQAERLMDTVDAEAGEKNAGKSKDDALNAHAKALRDCAMLELLYATGMR
FT                   VGELVGLDMGSFDWSNRTVRVLGKGNKTRVIPFGAPAQQAVEHWLHGGRPVFANGNSGN
FT                   AVFIGVRGCRIDQRVVRQVVHEQAEQAGVPDISPHALRHSAATHMLDGGADLREVQEML
FT                   GHSSLQTTQRYAHVSIEQLKDRYRQAFPRA"
FT   gene            24545..25528
FT                   /locus_tag="BIF_01800"
FT   CDS_pept        24545..25528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01800"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84526"
FT                   /db_xref="GOA:D3R5Z4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z4"
FT                   /protein_id="ADC84526.1"
FT                   /translation="MQTTLIHDHIRLIWSGRAVKMKGPAPFCGADIAPCHAHMQIGASH
FT                   PSDTGRRKPGGKVSMSKQARTVTNPDDPVVARAVDLVKTYGDTDSQVTALNHVSVEFQR
FT                   GELTAIMGPSGSGKSTLMHCMAGLDVPTSGQVFVEDLEVSSMKQKQLTQLRRKEIGFIF
FT                   QSFNLVPTLTAEENILLPLQIAHRPVDRDWFRKVVGVVGLENRLDHRPSQLSGGQQQRV
FT                   ACARAMMERPSVIFADEPTGNLDSRSSREVLGFLRQCVQDYGQSIVMVTHDPRAASFAD
FT                   RVLVLSDGSITQDMDHPTYDDILAVFAEHDDPDNGPVDVEPAAREA"
FT   gene            25536..28370
FT                   /locus_tag="BIF_00002"
FT   CDS_pept        25536..28370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00002"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84527"
FT                   /db_xref="GOA:D3R5Z5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z5"
FT                   /protein_id="ADC84527.1"
FT                   /translation="MFRIGLRDTKAHFRRFIMSIIAIALGVAFVVGSFCFREMLNDQVS
FT                   QMMGSNSDADVYVRGATEEKQEPGGSVTSYNSTYNEISTSIIPDIENVDGVASADATMQ
FT                   LGNAVLLDHNGDALTTVGAPTLVIGVDQDAPWRSAHFVSGEYPQTDDEVALLEDTADKA
FT                   GLKTGDTAKLIVDGEAREMTVSGVFTSPSTQLGAILILARPSFVQHVLQEEGEDTSSIQ
FT                   FIGVYGSKTTPLDEEAQQQLADRINKALPKSADAHAVTGDSVRDDATKSIQDQLGFIQP
FT                   LILIFAAIALFVGAFIIANTFTMIVRESMRGYALLRSVGASPLQVFASVLIQAVILGLV
FT                   GSGIGVLLGWGLLELIAKGMTQSGMPLSGSPTPSATDVIVGVIVGVIVTIIGATLPAKT
FT                   AATAPPIQAMNETVNPEKPVRARGWIGIAMVAVGAAFWVLCYLDADKRVDWQWLKDLGS
FT                   GWTLGLGAAFVVIGAIVCAPAFVAPAAKVLGWIPSKAFPVTGKLATRNIGRAKRRTANT
FT                   AAALFIGVAIVSCLGVVASSMKTSVSDLVDNNVNADYVVMAASMTQPISTKAVDAVEDT
FT                   EGVGASSAVSMLPTVKVTNATKTIMPTTSKVDLFTKIAPVERQDGDAAKAIENGEAVIG
FT                   RTVANDEHWKIGDTIDLKSENTSVDEQATKQAYEAYQKKIESQVTALQQEAQRLASSGD
FT                   VSGAQSKAKEAESIVKQAQNTDPKQFVKMKTETKKEQVKIGAIVDDALYSDGIMISLPT
FT                   AERLTSKDMMMVTQMYVQAKPGANIERLGKNLEKAVKPFYTISVLTRDEFKSSMSSMIN
FT                   SMLAIIYALLALSIIIAIFGIVNTLALNVSERTKEIGLLRAIGTSNGQVRGMLAIEAVI
FT                   LSVFGTLVGIVVGVAAGVVIRIAYESQGMTTLTIPWDQLVLFLIVAILVGLIASISPAR
FT                   RALKHPVLNAVASE"
FT   gene            28446..28751
FT                   /locus_tag="BIF_02140"
FT   CDS_pept        28446..28751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84528"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z6"
FT                   /protein_id="ADC84528.1"
FT                   /translation="MSAQRCMLGGHRFREGARMRLPERIPVGARVVVRITDGVDEYTGR
FT                   HQYRDYVGHVRAWDGRTLQLTRDAAANGSRPAQDVDISATDIAILKPVPERPAARR"
FT   gene            complement(28767..29876)
FT                   /locus_tag="BIF_00146"
FT   CDS_pept        complement(28767..29876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00146"
FT                   /product="Arogenate dehydrogenase"
FT                   /EC_number="1.3.1.43"
FT                   /EC_number="1.3.1.12"
FT                   /note="Prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84529"
FT                   /db_xref="GOA:D3R5Z7"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z7"
FT                   /protein_id="ADC84529.1"
FT                   /translation="MVERDMHEETIKQWDRDNAGEPQIAPEGIECPKHVAIVGLGLIGG
FT                   SLARRLRESGCHVSAWNHRDHPYANARAAGIDCKDTLEELVAEEPDVLMLCNPLVAMPQ
FT                   VLQTIKPIINPQKTTLSDVGSVKGPVRTQVSEVGLLDCYVGAHPMAGNEHSGWVAADPT
FT                   LFDDALWAVTFGLHTQYRRVVQIAGMITRGVRNTMIVIDDVTHDREASLISHMPHVLST
FT                   ALINEMTSDANNAIASALSAGSWRDMTRVALTDPDRTRAMVVENAHNVEELLHRMIDWL
FT                   SEFANALHEEDETEIRHFFAEGQPYRDYKAQINAGKVSDSTETIFQSLRIDPEHWREQL
FT                   LKSAQRGEYIVRFTSGHRLIAEQHPSIRS"
FT   gene            complement(29870..30997)
FT                   /locus_tag="BIF_00702"
FT   CDS_pept        complement(29870..30997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00702"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00702"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84530"
FT                   /db_xref="GOA:D3R5Z8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z8"
FT                   /protein_id="ADC84530.1"
FT                   /translation="MRESMTRQSTRIHYLGPQGSFTHQAAIESAAEASRRLHMDVADFE
FT                   FVACDTVPQILHAVELGQGWGTIAWENNVEGFVVPNLDLMMDAADAAGFLRVGVNVRFD
FT                   AFVTERTYRHACEQYASEIAVDDAQIPARDNANAYGAASTPPTIDELAIRDCTAVCAHS
FT                   HGLAQCRRFAREHGLKPVPAASNAAACRDLQDFQIALGPSICANIYGLHRVAANVGDFD
FT                   GARTEFLTIAPRSQVVERLRIPRSDPKTEFESVIAFIPLVTGPGVLANLLDVLRDAQLN
FT                   MVSLISRPVKGRDGTYSFLATLDAAPWDERFVNALVEICEHGDWVRTLAVYPRDERNYP
FT                   TVSEWMLPAGGVRFEGEPHMANWRESADVRKELLW"
FT   gene            complement(31008..31697)
FT                   /locus_tag="BIF_02139"
FT   CDS_pept        complement(31008..31697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02139"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02139"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84531"
FT                   /db_xref="GOA:D3R5Z9"
FT                   /db_xref="UniProtKB/TrEMBL:D3R5Z9"
FT                   /protein_id="ADC84531.1"
FT                   /translation="MAVRIGTSGAPSSVAPTRSRTTSDAGDAHVIGMEGGASRPPSHMH
FT                   ICACPEIPRDAYDGAMSQNTNVTEYVTAGDDAQESALPWSYRQRPWLRYLIDVVSGAAL
FT                   GIVGTFAHRMGAAQNIPYGLVLALLLVALGAWSARSRDGVAGFALYFIASTTVLYFLAL
FT                   RSGDVLIAAGFASDSLPFWSQHAGYSWLFGVVVVQLLLLVFPRRFFSMPTRRVGRRKSE
FT                   NDSGTDD"
FT   gene            complement(31627..33558)
FT                   /locus_tag="BIF_01335"
FT   CDS_pept        complement(31627..33558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01335"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84532"
FT                   /db_xref="GOA:D3R600"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D3R600"
FT                   /protein_id="ADC84532.1"
FT                   /translation="MAVRGDIRNVAIVAHVDHGKTTLVNAMLQQSHVFNEREEVPDRVM
FT                   DSNDLEREKGITILAKNTAVEYTGPLAEKYGHPEGITINVIDTPGHADFGGEVERGISM
FT                   VDGVVLLVDASEGPLPQTRFVLRKALEAKLPVILCVNKVDRPDARIEEVVGEASDLLLG
FT                   LAQDVIEEGVDLDLDSLLDLPVIYCAAKVGYASENQPADGQLPDNDNLEPLFDAIIKNI
FT                   PAPEYEPGAPLQAHVANIDSSDFLGRLGLVRIYNGTLEKGKTYGLSRVDGSIENFRVSE
FT                   LLRTQGLDRLPVESAGPGDIVAVAGVNDIMIGETIVDPNDPRPLPLIHVDDPAISMTFG
FT                   TNDSPLAGTEGKDHKLTARMIKDRLDRELIGNVSIKVLPTDRPDAWEVQGRGELALAVL
FT                   AEQMRREGFELTVGRPQVVTKTIDGQLCEPMENTTIDVPEEYMGTVTQLMAARKGRMDS
FT                   MSNHGSGWVRLQFTVPSRGLIGFRTALLSSTRGTGISSSIAAGYAPWAGEIVTRQNGSM
FT                   VSDRQGVATPYAMQRLQARGNFFVEPQSPVYEGQVVGINNKPDELDVNITLAKHMTNMR
FT                   SSTADVLETLTPPIKMSLEESLDFANEDECVEVTPESIRVRKIILGREDWYKWRAKQRR
FT                   ANAQQNNK"
FT   gene            33463..33591
FT                   /locus_tag="BIF_02138"
FT   CDS_pept        33463..33591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02138"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84533"
FT                   /db_xref="UniProtKB/TrEMBL:D3R601"
FT                   /protein_id="ADC84533.1"
FT                   /translation="MGLLKHGVDQRGLAMVDVSYDCNISNIAANSHSKPLLIIPMM"
FT   gene            complement(33912..35390)
FT                   /locus_tag="BIF_01334"
FT   CDS_pept        complement(33912..35390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01334"
FT                   /product="Transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01334"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84534"
FT                   /db_xref="GOA:D3R602"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R602"
FT                   /protein_id="ADC84534.1"
FT                   /translation="MHRHRIQHRTEQREHREKKPRSAMTTAELGLGAATPIDGPSPERE
FT                   PLANAEATTLTRNERLDRLPFNKAHRKLLMASGIGWAFDAMDVGLVSFVVTAIAADPHF
FT                   NLDATQKSWVLSIGFIGMAIGAALGGFLADKLGRKTVFTATMIVFGLANGAMAFSWTLL
FT                   ALLAARFVIGLGLGAELPVASTLVSEFSPAKQRGRITVLLESFWAVGWILAAMIGYFVI
FT                   PNTGDWGWRWALLIGAIPLLYAIVARRHLPESVRFLEARGDNERAEASVRYFEQASGVA
FT                   AVPSKPARKLGRIRMRELVGRKYLGITLAIWATWFFVNFSYYGAFTWMPSLLADQFGSL
FT                   TKSFGYTLAISIAQLPGYFLAAFLVERWGRRKTLSVFLAVSALAAFLFSQSATVAQVLC
FT                   FGMLLSASNLGAWGVMYAVTPEIYPTRMRSTAAGAAAAVGRIAAIVAPLLVPWFLTMSG
FT                   GNKSVAFIVFAVAFVLACVAALFLPERTGESLED"
FT   gene            complement(35383..36276)
FT                   /locus_tag="BIF_02137"
FT   CDS_pept        complement(35383..36276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02137"
FT                   /product="Phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02137"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84535"
FT                   /db_xref="GOA:D3R603"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R603"
FT                   /protein_id="ADC84535.1"
FT                   /translation="MICLGWMQPGMLPCHRDACEADESDRRGMGYGNVSERRFAPPQIG
FT                   VTSVILALESETHGHARRRLWLPLVQRTREPFKGMWALPGGRLQANRSLEESAFATLAS
FT                   TTDLHPTYLEQLYTFGDPMRSSNGIPMVSVCYWALLDHADLGTEPGTAGNAHNVRWFPV
FT                   DDLPELAFDHTTIVEYALWRLRHRMDAPNVVRQLIAEPFTLGQLHDVVEAVLGEEIDLA
FT                   NFRRKMLASHTLEDTGEVAREGRRRPAALYHFADHAEEEGFAFFAEHVAGNPHGACEAL
FT                   QVNTPDDALSALMPHA"
FT   gene            complement(36393..37241)
FT                   /locus_tag="BIF_01332"
FT   CDS_pept        complement(36393..37241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01332"
FT                   /product="ParA"
FT                   /note="Chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01332"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84536"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R604"
FT                   /protein_id="ADC84536.1"
FT                   /translation="MNDMPTDLLGREYETFPVPEPLRQHGPARVIAMCNQKGGVGKTTS
FT                   SINIAGALAQYGRRVLIVDFDPQGAATVGLGINANALENTIYTALFNPRMDVHEVIQHT
FT                   KFDGLDIIPANIDLSAAEVQLVTEVGREQILASVLRPIINEYDAIIIDCQPSLGLLTVN
FT                   ALTAADGVIIPVAAEFFALRGVALLMQSIEKVQSRINPSLEIYGVLVTMFTRTLHSDEV
FT                   LQRIYEAFGDKVFHSVISRSIKLPDANVAAAPITFFAHNHKTAKEYREVAREMIYRDIV
FT                   A"
FT   gene            complement(37345..38274)
FT                   /locus_tag="BIF_01849"
FT   CDS_pept        complement(37345..38274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01849"
FT                   /product="Integrase/recombinase (XerD/RipX family)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01849"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84537"
FT                   /db_xref="GOA:D3R605"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D3R605"
FT                   /protein_id="ADC84537.1"
FT                   /translation="MAMNGELPMLEARFLAHIDVERGLSAATVQAYENDIDQYVRWLGE
FT                   QGIAKAASITSNDVEDFVAAQSKSGTSAVSLARRLASIHMFHRFMQSERVVADDVSQSV
FT                   RPPKSAETLPEVLTVDEVQRLLDAARHDDASEAVSMRDSALLELMYATGCRVSEAVGLD
FT                   FTDVDMDAQVVRLTGKGAKQRLVPFGTYAANALRAYVEHARPELENKAKGERERSAIFL
FT                   NKRGKRLTRQSVWEIIKHAGALAHVSKPLHPHTLRHSFATHMLQGGADVRTVQELLGHA
FT                   SVKTTQMYTHVSQDTLIETYITSHPRAK"
FT   gene            complement(38660..39043)
FT                   /locus_tag="BIF_00765"
FT   CDS_pept        complement(38660..39043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00765"
FT                   /product="LSU ribosomal protein L20P"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84538"
FT                   /db_xref="GOA:D3R606"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:D3R606"
FT                   /protein_id="ADC84538.1"
FT                   /translation="MARVKRAVNAHKKRRTVLERAKGYRGQRSRLYRKAKEQLLHSFNY
FT                   NYRDRKARKGDFRKLWIQRINIAVRNEGITYNRFIQGLRLAGIELDRRALAELAVNDPD
FT                   TFKTIVEQAKAALPEDVNAPVNA"
FT   gene            complement(39093..39284)
FT                   /locus_tag="BIF_01848"
FT   CDS_pept        complement(39093..39284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01848"
FT                   /product="LSU ribosomal protein L35P"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01848"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84539"
FT                   /db_xref="GOA:D3R607"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D3R607"
FT                   /protein_id="ADC84539.1"
FT                   /translation="MPKMKTKTAAAKRVRLTATGKVMHAGSGMRHNLEHKSARKRRALK
FT                   RDDVLQTAQAKKMKGLLG"
FT   gene            complement(39328..40029)
FT                   /locus_tag="BIF_00766"
FT   CDS_pept        complement(39328..40029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00766"
FT                   /product="Bacterial Protein Translation Initiation Factor 3
FT                   (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00766"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84540"
FT                   /db_xref="GOA:D3R608"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:D3R608"
FT                   /protein_id="ADC84540.1"
FT                   /translation="MTSRGPRHNMRNGVIISDEPRINDEIRVSQVRLIGPNGEQVGVIA
FT                   TSVALNLAKEANLDLVEVAPNAKPPVAKLIDYGKFKYNEKIKQREARRNQSTAEIKEIR
FT                   FRLKIDDHDFEVKKGHVERFLNAGDKVKVTIMLRGREQSRPIGGVEMLQRLAEEVSDLG
FT                   TVEHAPKQEGRNIIMTLAPKGKKVHTQSEQRRRGAESRAERQARQAARLAAKQEAKAEE
FT                   AKEAQAAIDNE"
FT   gene            complement(40026..40187)
FT                   /locus_tag="BIF_02136"
FT   CDS_pept        complement(40026..40187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02136"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84541"
FT                   /db_xref="UniProtKB/TrEMBL:D3R609"
FT                   /protein_id="ADC84541.1"
FT                   /translation="MGNPPGNLSWFRVTARQVRRPICMGMRKRRLELHVYRMYEVFEGR
FT                   FAAAMARV"
FT   gene            40382..41260
FT                   /locus_tag="BIF_00939"
FT   CDS_pept        40382..41260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00939"
FT                   /product="Predicted thiamin pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00939"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84542"
FT                   /db_xref="GOA:D3R610"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:D3R610"
FT                   /protein_id="ADC84542.1"
FT                   /translation="MSIRVRGRWRSCTPIPGSALPRITMGAGIICVARQRKSPASQAEG
FT                   VTTNTASRICVVFGAGEYYTRPYSLPEHAFVVAADGGYAHARELGVHVDVVVGDFDSTE
FT                   DLATESTSDPGMRTLRLPPEKDDPDMLSALKVGWRHGSREFHIYGGLGGRVDHTISDIQ
FT                   QTAIVASHGGIAYLHGDGRIVTAISDAALHFAAHEVADTQYVSVFAHSDSVRDVTERGL
FT                   KYRLDHATLSNLQVNGLSNEFIDGDAAQIAVGGGIAIIVFDDRAPLPELVGATPHGTLG
FT                   EPSTHVTDALA"
FT   gene            complement(41338..41430)
FT                   /locus_tag="BIF_02166"
FT   CDS_pept        complement(41338..41430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02166"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84543"
FT                   /db_xref="UniProtKB/TrEMBL:D3R611"
FT                   /protein_id="ADC84543.1"
FT                   /translation="MPILPALLDFKPPLARRKPLELLANDYVSH"
FT   gene            41458..42549
FT                   /locus_tag="BIF_00940"
FT   CDS_pept        41458..42549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00940"
FT                   /product="Glyceraldehyde 3-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84544"
FT                   /db_xref="GOA:D3R612"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R612"
FT                   /protein_id="ADC84544.1"
FT                   /translation="MHPPASPRENYMTVKIGINGFGRIGRLAFRRIFELQEKGGEAADI
FT                   EVTAINDLTSPAALAYLLKYDSTHGVFKHVDGTPVDVKSTDTAIVVDGKEYPVYAERDA
FT                   RDLKWVANDGVEFVLECTGFYTSAEKSQAHLDAGAKKVLISAPAKDETTPTVVFGVNHD
FT                   ILKKDDNIVSAGSCTTNSMAAMVKLLNDKWGIKAGFMTTIHAYTGTQMILDGPRGNKSG
FT                   RALRAAAINTIPHSTGAAKAIGKVVPEVNGKLQGHAQRVQVPDGSITELFTVLEKDATV
FT                   DEINAAFKDAFADCAYYGYNDDEIVSGDIVGDTHGGVFDPTQTDVNTVDGVTMARTVAF
FT                   YDNEYGFTSNMVRTLEYFAEISE"
FT   gene            42972..43481
FT                   /locus_tag="BIF_00421"
FT   CDS_pept        42972..43481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00421"
FT                   /product="Regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84545"
FT                   /db_xref="GOA:D3R613"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D3R613"
FT                   /protein_id="ADC84545.1"
FT                   /translation="MGKKKRRAAATPAIKQLEDTKVTFTTHEYEHSNDDADGYGLEAAR
FT                   KLGYDERQVFKTLMADTGDERVIGVVPVNGHMSLKELAHAVGAKKAEMADPKVAMRESG
FT                   YVVGGISPLGQKTQHRTVLDESALEFDEILVSGGKRGLSLGVNPHDLLAVLDATTAPIA
FT                   TQKKSY"
FT   gene            complement(43690..44688)
FT                   /locus_tag="BIF_00898"
FT   CDS_pept        complement(43690..44688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00898"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00898"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84546"
FT                   /db_xref="GOA:D3R614"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:D3R614"
FT                   /protein_id="ADC84546.1"
FT                   /translation="MMRRKAGMTKRIILANPRGFCAGVDRAIQSVQTILNTAAPREDDL
FT                   PPVYVRRQIVHNRHVVDELAEQGAVFVDELSEIPQAAAQAGIPVVFSAHGVSPQVVREA
FT                   NELGMSVVDASCPLVSKVHREVLRFVREGYEIVYIGHRGHDEAVGVIGESPEHVHLIEH
FT                   ERDVDDLDFSPDQKLVLLSQTTLSVDETTGTIAALQRRFPWIELPPSSDICYATSNRQA
FT                   AVKLVAEQADAMVIVGSANSSNSVRLMEVANEALGGRGTAHRVDDADELDSAWFEGVSA
FT                   VGVSSGASVPDELVQGVIDALQRLGFTEVDTVETIEENMHFVLPAALRKRG"
FT   gene            44757..45749
FT                   /locus_tag="BIF_00899"
FT   CDS_pept        44757..45749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00899"
FT                   /product="Aldose 1-epimerase"
FT                   /EC_number="5.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00899"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84547"
FT                   /db_xref="GOA:D3R615"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:D3R615"
FT                   /protein_id="ADC84547.1"
FT                   /translation="MGTRLNNEAINDDWSPMSALPPRTGQQFSISHGDYTAVIAQLGAT
FT                   LRVFRYQGDDVTVSTGPDDVVTCCVGRVLVPFPNRLEHGSYDFDGAHYQLPINEPERDN
FT                   AIHGFGMNYYWQLERLTEDSVTLSWRVPLTEGYPFSLQVFITYTLSNSGMRIDCDAVNN
FT                   GDGPAPWAMAVHPWFSNGEDAHGNAIDAVTSRCSVQIPANTHVLTNGNLIPTGTEPVDG
FT                   TKFDFRTAALLDRQPYDDALTDLTHAADGTVTAVFTRPDGRQVAIIGDESITSFQVCTG
FT                   TGFPEAIHPTGVAVEPQTAYANTFRTGIDLIEIAPGDTAHTTIRYQVLQ"
FT   gene            45781..45900
FT                   /locus_tag="BIF_01763"
FT   CDS_pept        45781..45900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01763"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84548"
FT                   /db_xref="UniProtKB/TrEMBL:D3R616"
FT                   /protein_id="ADC84548.1"
FT                   /translation="MTIVPCAKCMHPATSGRHATMHKAYDGFRKGVHYGYART"
FT   gene            complement(46081..46392)
FT                   /locus_tag="BIF_01079"
FT   CDS_pept        complement(46081..46392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01079"
FT                   /product="ECF-type sigma factor negative effector"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01079"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84549"
FT                   /db_xref="UniProtKB/TrEMBL:D3R617"
FT                   /protein_id="ADC84549.1"
FT                   /translation="MSKGISQPLDEHDEPVSLDDLHNSNDASAPQVEGECFDPSSCCDA
FT                   REQVMIAAMKAYLRPQQAPECLYERLKMTLDKCCGEVITEHTVVTSHTIIHHTHRQGL"
FT   gene            complement(46389..47327)
FT                   /locus_tag="BIF_01078"
FT   CDS_pept        complement(46389..47327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01078"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01078"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84550"
FT                   /db_xref="GOA:D3R618"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3R618"
FT                   /protein_id="ADC84550.1"
FT                   /translation="MQQILREELACCGLQRQRHGSPLFRLNSTVRRACARAANTRRTLA
FT                   VFAPPAGFQISFTSYRTMEGVSETSENEHETMQEKRARFEKLAMPAVNALYRQAMKFTN
FT                   NPEDAQDLVQDTFERGFKAFDTFKPGSNFEAWMTTIERNAFFNQYAKAKRRPQRANDST
FT                   GEYDDWDIFAASEHTSQGLQSAEQQYLEAFAPEEIMAALDRLPPERRQVFIDAAIDGKS
FT                   YQQVADEQGIKIGTVMSRLNRARTQLRKELAEYAAARGYGKSTKTSRGTSTAKAKRGNK
FT                   TEANSVETNSNETRDDAREKELVGAHGKARQ"
FT   gene            47271..48821
FT                   /locus_tag="BIF_01077"
FT   CDS_pept        47271..48821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01077"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /EC_number="6.3.2.7"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01077"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84551"
FT                   /db_xref="GOA:D3R619"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3R619"
FT                   /protein_id="ADC84551.1"
FT                   /translation="MSLSLQSAARELFAENLLHEIITPHMWTMNAASVENNEVPFTAIT
FT                   YDTRTVTPGSLLVCKGNFNPKYLEQANKLGMAAYVATNDYSAYTDAPGLIVSDDKKALS
FT                   ILAQAYYDHPERQLTLIGITGTKGKTTTAYYTHAIINALSGNTTALFSSVDNCVDGMHY
FT                   VESDLTTPESLDAVRMMREAVNNGMKYLVMEVSSQAYKVNRVYDFHFDVAAFLNISPDH
FT                   ISPIEHPSFENYLWCKRQIIRNADMLVLGERSDHEQLLLEDAELNRVPVSTFALADSPA
FT                   QSDIADVTCAPTNMEHTAFDYFVDGERLGSLTLAMEGDFNYANAAAALAIAHDIGMDVS
FT                   DPRALASLADVRISGRMEEMHDSRSNTLAIVDYAHNFASVNALLDFVEQRYGAEHPHIT
FT                   LITGSAGNKAYDRREGIVKAAQDRVQKLILTAEDTDTEPIEQICSEMANNVTNEDLDVQ
FT                   TILDRAEAVKHAVDEARAADGGLSILLLIGKGDEQWIKDRNIHTPYEGDSQIIRRLFA"
FT   gene            48749..49921
FT                   /locus_tag="BIF_00925"
FT   CDS_pept        48749..49921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00925"
FT                   /product="Cell wall biosynthesis-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00925"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84552"
FT                   /db_xref="GOA:D3R620"
FT                   /db_xref="InterPro:IPR003447"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:D3R620"
FT                   /protein_id="ADC84552.1"
FT                   /translation="MDQGPQHPHAIRGRLADHPTSVRLIRMRRAYNGNRRLGKEHMIII
FT                   ERVTPATMEEEASKHNIELPIEQTSVWADFQADINGRRPWGCLLIRRDTELVAVISLID
FT                   METHGYHYLRSVHGPVWASKPNEELEEQMIAALADYVKRNDKRVAFLRIDTWTSKGTFP
FT                   VLSTVPYNETVVLDITGDDEEILARMKKRGRRDVRKALRESPAVIADETELATRDFSDY
FT                   YAVMVETAHRDGFNPAPMSDYTDMIKALGPEHCRVFAGRIDGKVVAWSIVTVHGKTGVY
FT                   YYASMLTSVRREHVPDKLLYFVACALGKQGCTKLDLMGIGNDFAPSLKSLNEFKTKFAP
FT                   ETTQIAAGRDIPIKKAFYRMLRMMQSVRKALKPKPHGNAEKVRAKESAAK"
FT   gene            complement(50157..51749)
FT                   /locus_tag="BIF_02001"
FT   CDS_pept        complement(50157..51749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02001"
FT                   /product="Folylpolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /note="Dihydrofolate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02001"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84553"
FT                   /db_xref="GOA:D3R621"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3R621"
FT                   /protein_id="ADC84553.1"
FT                   /translation="MYTYAGRVLMSDNQMSVRDVERDIMNRPSERNTTNLDLKRMRMIL
FT                   DLLGNPQDSFRIIHITGTNGKGSTARMAEAICRAYGMRTGLYTSPHLEHVSERIVIDGQ
FT                   RLSDDDFVELWNQVKDFVALVDKKMDEEGAPRMSFFEVLTAMAIWKFADAPVDVAIVEV
FT                   GMGGRWDATNVLDADAAVIGPIDMDHMAWLGDTVEQIAQEKVGIIKPGCTAIIGRQPHE
FT                   SEVMPIIEQAAAENHATIIRDGYEAEVVSRMPAVGGQMVTLRMPNGTYADVPVDKFGEH
FT                   QAHNALAALCACEVVIPVSGALDGDLVAEALSSVKIPGRIEQVRSSPTIIIDGGHNVNA
FT                   AEALRAAIEENYDFTQLVAVVAMMEDKQVEEYLGVLEPIVSELIVTENSWTDRVMPADK
FT                   LAEIARGVFGPERVTCIPSLPDAIQEAVNRVDADDELGVGYGHGVLICGSFVTAGDARM
FT                   LLKESVHPDLTKPKAERVHQVAVDPEYRQKAQEADAAEIDYETDANPDFDVDDVLGLKK
FT                   LAEDGESGDIESE"
FT   gene            51740..52483
FT                   /locus_tag="BIF_00156"
FT   CDS_pept        51740..52483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84554"
FT                   /db_xref="GOA:D3R622"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3R622"
FT                   /protein_id="ADC84554.1"
FT                   /translation="MYTNLVHSMHLPDLPPPAHAIVFPTWLSAGLGGRIDDDAGMTTKT
FT                   SEATDRHGRYTLGIVDNDPLVAEAPRSSFERFHAPLEVIWALTDPEDALVHCLHAKGRP
FT                   DVLLTDIDMPRLSGLGLFHELQTRKLPITVIGISAFPNIAEEPGLVILPKESAVEEIVQ
FT                   LAGMLRRDDDLTRWFPTPTKPNPLSPSELHALTHYSEGLTTTAIAHTMHVSESSMKTFA
FT                   KRAYEKLDAHSRTEAIAICVRNGWI"
FT   gene            52485..53639
FT                   /locus_tag="BIF_01069"
FT   CDS_pept        52485..53639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01069"
FT                   /product="Sensory Transduction Protein Kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01069"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84555"
FT                   /db_xref="GOA:D3R623"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3R623"
FT                   /protein_id="ADC84555.1"
FT                   /translation="MTEILSADSPTKPKPLTKLVAHLRAHPFIIAGTLFCVAVLVFEWL
FT                   TYWPDLNGFETALSTLIPVLTLGVAIMPVPFSLSIIVVEVLRGIFYIFPVVHSGPTVYY
FT                   SVWLALIVIGYEMPAKYAIPITVIAALDTMVDNAIFQVPFDANDIGFAATFLLDGFAGL
FT                   AIRRNKEFARLRYEQREQAKQIHLVRTLHDDIGGSLSYALLLCRNAQAETDPDTLRTSL
FT                   ETITQTVESTLADLRTNIITPLSASTPASTAISRNVDESTTTGSCARLCQNVLRQPALL
FT                   EQAGFNGTIHVSGEATDESANLVNICLTEICNNILKHGTHSYVVRIRFGERTTLVASNE
FT                   IAAGEAQPDSAHHGLEMLESRLHDLGAAMTVSEEDGIWTLAIER"
FT   gene            complement(53652..54452)
FT                   /locus_tag="BIF_01068"
FT   CDS_pept        complement(53652..54452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01068"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84556"
FT                   /db_xref="UniProtKB/TrEMBL:D3R624"
FT                   /protein_id="ADC84556.1"
FT                   /translation="MSAMRRIFAKIAAVICVCMVVGGCSVRDGMAGAFGMRIVSPESAE
FT                   LDDVIAAIALNPSSKKFETVDKGYVALVHSNGRAEYIQTEGMLQQHIVWNGTGVFFQDQ
FT                   KRDYLISNEHCKGYVKDRQEAFGTQWALVSVANDAGLTVGDQLTVFLESGAIETVNTTT
FT                   SHIDHQHFHLPDSLGNDSYPLSRTLLTKGTGGFATVIAVPEDGRNRCKILVYKLYESDI
FT                   QNLDSVYAIDTDGRLNEMLSGTTDYLSTDFAPNPRMHWKAPDAN"
FT   gene            54558..56243
FT                   /locus_tag="BIF_00643"
FT   CDS_pept        54558..56243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00643"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84557"
FT                   /db_xref="GOA:D3R625"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3R625"
FT                   /protein_id="ADC84557.1"
FT                   /translation="MFGSRHWRPAVHDEQIRARDYHVGQRISHAQTVEKRAAMSEVITE
FT                   QDKEYEAREQAAAPGDDQPMNDRVNNRSLRPRSDAFVDFMSSGWDNNEPEIERLESASY
FT                   IPARLQVLSEAFPGERLVIPAGQPKVRNNDCDYAFRPDSAFSYYTGLGQDYEAGAVLVL
FT                   DPNEDGTHTPMLFVAPRADHYTQDFFKDPHYGEYWVGPRAGLKELEAMTGIETHDIAQL
FT                   DDMLGKDVGTENGAVQLRVIRETDPQITAIVNELREGHGFPDEADNTVRDDKLHEFASE
FT                   ARMEKDDFEVREIRRAVDATKHGFDNILKKLPSALGKPRSERILEGAFNAVSREEGNEV
FT                   GYDTIIASGAHAPILHWIRNTGTVNDGELLLIDAGVEVDSLYTADITRTFPTNGKFTDF
FT                   QKKLYQAVLDSQQAGFEAAKPGATYSDIHHACMRVIAERLHDWGILPVDVEESLSPEGQ
FT                   QHRRWLACGVAHHLGLDVHDCAQARYESYQGAKITPGMVFTIEPGLYFREDDLMIPPEY
FT                   RGIGIRIEDDVLMTEDGPEWISAGIPKQIDDVEAWMAQMADTNN"
FT   gene            56165..56794
FT                   /locus_tag="BIF_00642"
FT   CDS_pept        56165..56794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00642"
FT                   /product="Phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84558"
FT                   /db_xref="GOA:D3R626"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D3R626"
FT                   /protein_id="ADC84558.1"
FT                   /translation="MDLRRHPEADRRRRGLDGADGGHQQLSQSLERSIMPTPDFILELR
FT                   ERIGHMPLWLIGVTGYVRRDDGLVLLEQRTDNGKWTLVTGINEPGEEPADTVAREAKEE
FT                   TGVDVIVTDLVSVKSDRRMITYANGDQAQYMDHLFLCEVAPGGNGEPVVGDDESMRVGW
FT                   FALDDLPEPLSDSTRERIAYVQRYLRHRAEGSARAQFAFDGVIEHL"
FT   gene            complement(56817..56921)
FT                   /locus_tag="BIF_02167"
FT   CDS_pept        complement(56817..56921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02167"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84559"
FT                   /db_xref="UniProtKB/TrEMBL:D3R627"
FT                   /protein_id="ADC84559.1"
FT                   /translation="MSDMRDANPDSGAVCYFLPNHYSDRCPVEFGSIH"
FT   gene            57026..58252
FT                   /locus_tag="BIF_01893"
FT   CDS_pept        57026..58252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01893"
FT                   /product="Transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01893"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84560"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R628"
FT                   /protein_id="ADC84560.1"
FT                   /translation="MNAEGGAMNSRTTTEQQTLSEYNRARTLQYLHHHGIASRAQIAKA
FT                   LHLTPAALSKISNHLLASGAIVETGALEGKGNRRSIGLAVNARAFQVLGVKFARSLIEI
FT                   GLFDLAGKPSFIRELPTVENTTIPQAIESLHAEIRRLLAEHPHILAIGMAVPGPYLRDR
FT                   GHTAVVSSMGQWRQVNFRAEFEHAFDVPVIIEQDARAGALAQYLFDPNPANENLAYYLL
FT                   GEGIGLGVIDHGTVINGSLGAATEIGHVSIDVNGKACDCGNVGCLERYCSAVAIHEAML
FT                   GNGMLATDSRLTHREACAELFARAQSGDGQARELVERIGTFVGYGCVTICNAFNPSRIV
FT                   IGDIVAQAGEPLLQRVREVVGERVIPEITQSTQIELSALPTDAAVTGAAAVAITYILDH
FT                   PSQFFASGT"
FT   gene            58315..59211
FT                   /locus_tag="BIF_00330"
FT   CDS_pept        58315..59211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00330"
FT                   /product="Fructokinase"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84561"
FT                   /db_xref="GOA:D3R629"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3R629"
FT                   /protein_id="ADC84561.1"
FT                   /translation="MSKPIVVSLGELLWDMLPTGKRAGGAPVNFAYHATNNGCEAYAVS
FT                   AVGEDELGDELAIAAEKAGIHAVLQRNAWPTGTVEVALKNGIPEYTIVENVAWDHISYT
FT                   RQLIDIVEQADAVCFGTLAQRSPESHDTIIELLKHTKDGALKFFDINLRGDMYSKELIE
FT                   EMLSYANVFKINDEELLLMRGMFGIENTSDEEACKWFIEQFDLRYLILTGGATFSTIMS
FT                   NDGEVSTLATPHVTVADTVGAGDSFSGTFTGRILNGDSLGLAHRAAVNTAAFVCTQEGA
FT                   WPTYPAEITDYLAEIGK"
FT   gene            59298..59777
FT                   /locus_tag="BIF_00331"
FT   CDS_pept        59298..59777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00331"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84562"
FT                   /db_xref="GOA:D3R630"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D3R630"
FT                   /protein_id="ADC84562.1"
FT                   /translation="MRIVLQKVSHAGVTVTDEAIGELDTTFTEQTIAAGYVLLVGVSDA
FT                   DGTRQIDWLAHKISNLRVFEDEQGKMNLSIHDVGGSILSISQFTLFADTRKGNRPSFVR
FT                   AGKPEHAERVWLEFNEALRAQGLQVKEGRFGAHMNVSLVNDGPVTILFDTEELGI"
FT   gene            complement(60050..61150)
FT                   /locus_tag="BIF_01229"
FT   CDS_pept        complement(60050..61150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01229"
FT                   /product="DNA integration/recombination/inversion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01229"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84563"
FT                   /db_xref="GOA:D3R631"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3R631"
FT                   /protein_id="ADC84563.1"
FT                   /translation="MSYTVGKYETKKCVKWEVRYRTPGGRTTRKRGFLRKMDAEAWAAE
FT                   NVEIAKAKGTFITQSAGNTPVAELWQSWIETKRTRCKPSYMESLGGAWNKHVGPQWGAR
FT                   KVGSIRHDEVQEWVNKLAGEYSASVVIRARDMLKGLLKAAVKNRLIASNPADDITVPRK
FT                   KRKDHVYLTAEQLMALADEAGWRRPAVLALGTTGMRWGELVGLRVRDLDAKGHRLRIER
FT                   NAVEVKGEVVIGTPKTYEKRTITYPAILEPMLVEMAQGRDGDEPLFVDQQGKMLRRTHG
FT                   PNSPSSWFYWAKKRALGDVLARKMTVHDLRHTAASLLVSAGANVKVVQRQLGHESAAMT
FT                   LDTYADLFDADLDVVRVEMDSIFPAA"
FT   gene            complement(61363..62025)
FT                   /locus_tag="BIF_01230"
FT   CDS_pept        complement(61363..62025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84564"
FT                   /db_xref="UniProtKB/TrEMBL:D3R632"
FT                   /protein_id="ADC84564.1"
FT                   /translation="MHMETREIAPLLDRRVKIYDRSLNMSTVVDIAEDVDAPARFSVTD
FT                   IPVEGKEGLMLALDINYSGFPRDEYDVIGMRLYSTDPARTWIINANLLRALRIEDCKNY
FT                   AVSLVLLRYRPGTPISDFDYMPYNFWNDLHYVAQAREESGSLDLKAFARLYSVATKIMK
FT                   NPREVLAGGFGVSKPAVAKWAAKARAEGLYTAYTPAEKDRLRAAEIKALNEPIPDNE"
FT   gene            62132..62338
FT                   /locus_tag="BIF_01231"
FT   CDS_pept        62132..62338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01231"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84565"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D3R633"
FT                   /protein_id="ADC84565.1"
FT                   /translation="MATDTPKTTTRELLDIKQVAERIGMSATTIYHKRRTHKDEVPPAI
FT                   RIGRKLFWRPKDVDQWIDNRPTV"
FT   gene            complement(62473..62610)
FT                   /locus_tag="BIF_02168"
FT   CDS_pept        complement(62473..62610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02168"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84566"
FT                   /db_xref="UniProtKB/TrEMBL:D3R634"
FT                   /protein_id="ADC84566.1"
FT                   /translation="MPVVGDLLFGHGVLLSVVVRVLFGVCVEVGLPVAYGACVLDAAGS
FT                   "
FT   gene            62578..62814
FT                   /locus_tag="BIF_01232"
FT   CDS_pept        62578..62814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01232"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84567"
FT                   /db_xref="UniProtKB/TrEMBL:D3R635"
FT                   /protein_id="ADC84567.1"
FT                   /translation="MTEQQITDNRHALVESLPPQFTREQLAAATNTTTTLWALKEDRHA
FT                   GPKCTHTVNGQTWYARDDFAAWLYRQPATPDGR"
FT   gene            62819..63010
FT                   /locus_tag="BIF_01892"
FT   CDS_pept        62819..63010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01892"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01892"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84568"
FT                   /db_xref="UniProtKB/TrEMBL:D3R636"
FT                   /protein_id="ADC84568.1"
FT                   /translation="MNTTQEALKELHRDIARMFDTLIAHVGDDTAAWHQAALLSMIDGR
FT                   IVAILATTTSKEENRWDR"
FT   gene            63007..63189
FT                   /locus_tag="BIF_02000"
FT   CDS_pept        63007..63189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84569"
FT                   /db_xref="UniProtKB/TrEMBL:D3R637"
FT                   /protein_id="ADC84569.1"
FT                   /translation="MISDSLARSPLVRFTPDELAYVGDGIPRTAGGKPLPWVWDFLTDT
FT                   QRAQLEEEQKAHKWE"
FT   gene            63120..64382
FT                   /locus_tag="BIF_00596"
FT   CDS_pept        63120..64382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00596"
FT                   /product="Zinc metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84570"
FT                   /db_xref="GOA:D3R638"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R638"
FT                   /protein_id="ADC84570.1"
FT                   /translation="MGLPHRHTTRTTRRRTESTQMGVEVAANPQQQAIADALWDNVEKQ
FT                   ARAQHDGRRIALTRACDVKVERPVFLHNPLVPTKVLTLIAGRAGVSKSTLSIDIAAKAT
FT                   LGKLTGDWQHQPVTVAFAAIEDDMGMQKARLQAAGADMNRVLFLTVDDTRDGNTVSTGL
FT                   QLPDDTATLRDTLREHDVKLLVIDPITSCIDGNTDKRDDVRRSLDPLAATAQELGIAII
FT                   GILHFNKGGGYASDKVSGSHAFRDTVRSLILVAKDDETGECVVTLDKSSYTPQQGASYK
FT                   YTLAPRFITDDDGERMEVPIIAGFTPTDTNVNEVINRNVTGGDTTGRAADNEVADWLTA
FT                   YLAENGPTNCKQIAADAKDAEGYTFKQLQHARERLTSPRVIARKDPTYTGRGRRSLWEL
FT                   EQPECTSTYYAPSTHGVKYGA"
FT   gene            64569..64892
FT                   /locus_tag="BIF_00595"
FT   CDS_pept        64569..64892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84571"
FT                   /db_xref="UniProtKB/TrEMBL:D3R639"
FT                   /protein_id="ADC84571.1"
FT                   /translation="MGRKNSHPHQPPHKERHMNQQPHADIDYDPNADTILSAHDWAINT
FT                   DMTVTEYATNIQAFRNETLQDWEATTPDELRHMADHIRHDYADTLDAIANQWEQHNQGD
FT                   TTP"
FT   gene            64889..65077
FT                   /locus_tag="BIF_00594"
FT   CDS_pept        64889..65077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84572"
FT                   /db_xref="UniProtKB/TrEMBL:D3R640"
FT                   /protein_id="ADC84572.1"
FT                   /translation="MNDIYQLPALNRTIDALHLDDDRHAAQITAARLIAEQLDYSDKPT
FT                   ATLCAAYVRLLHDLTTQ"
FT   gene            65100..65336
FT                   /locus_tag="BIF_01891"
FT   CDS_pept        65100..65336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01891"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01891"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84573"
FT                   /db_xref="UniProtKB/TrEMBL:D3R641"
FT                   /protein_id="ADC84573.1"
FT                   /translation="MGKPQEQPDMIHTGDTHYEQARAHRIAHDLLTAAAQALMHGTPPH
FT                   YPRLNRADPYSDAVTATILHQLATTTTTTKEEQ"
FT   gene            65333..65650
FT                   /locus_tag="BIF_00410"
FT   CDS_pept        65333..65650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84574"
FT                   /db_xref="UniProtKB/TrEMBL:D3R642"
FT                   /protein_id="ADC84574.1"
FT                   /translation="MNPIIYADMHEHRLGLSFIAAQYDDTGIEAMLDQSNTIDFTSPDE
FT                   LDALADYARHELADWLEECARQYRNATQPTDNTDTEDTTMHRNPTHPYTGTPQPNRTTM
FT                   G"
FT   gene            66054..67829
FT                   /locus_tag="BIF_00409"
FT   CDS_pept        66054..67829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00409"
FT                   /product="Phage Prohead Protease"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84575"
FT                   /db_xref="GOA:D3R643"
FT                   /db_xref="InterPro:IPR006433"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D3R643"
FT                   /protein_id="ADC84575.1"
FT                   /translation="MYPHMYYKTNDSHIYVKSDSLGDGLEEGDFKAYVSTWTRTPDCYG
FT                   DVVAKGAFSQTLRKWDMSGSCIPVLYGHNETDPDYNIGYVKSAIEDDHGLLVTGHLDID
FT                   TNAKAAQVYRLLKGHRLSQMSFGYTIERKAQAQSAKGMANELQAVNLLEVSIVPHGANK
FT                   DTSIEAVKSESAYPSNLEPLFKTIDTTIKYAKNGYENMSTKQDLLDAKGKLSQIANNSV
FT                   GRMLSDAELEEVTHLKGVVADCVEKLRRDGDITGDVDQWLHDITSPKRVSPYSTKSYLD
FT                   LSKLTKSIPETMRKDINERHVKGIDMASITGAMFTPTPIVNSIPIHDQGGEMPIGIVNY
FT                   IPAGVVHTDEYDYLMETTQEDAGTAAVVEKGETKPTFKLGLKKVRNQLKVIAVVSDPVD
FT                   KYTWQSSQGVVDYVGERLTREIMRTFENEIINGDGTAGHLLGLNHVEGIKSQAFSSDAV
FT                   TTAINAAAQIEQYGITCAMFVLPAVDWVEIATTKDTLGHYINDPIVDVQNKQLWGVPVV
FT                   ADAYLESGTGYAIGTNTVQIMTDGNLETATNTSEGFRTNTVISRVEGRFSFDVLKPHGI
FT                   VKFATKAAAKSTPTK"
FT   gene            67826..68062
FT                   /locus_tag="BIF_01890"
FT   CDS_pept        67826..68062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84576"
FT                   /db_xref="UniProtKB/TrEMBL:D3R644"
FT                   /protein_id="ADC84576.1"
FT                   /translation="MRGHAMSDREPRYRNTQVLEGNAGADYTQPAYARYATRVKPDAGP
FT                   YDPVNRDDPERTIIIRDRVLLTGDYLNPIVDNL"
FT   gene            complement(68553..68672)
FT                   /locus_tag="BIF_02169"
FT   CDS_pept        complement(68553..68672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02169"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84577"
FT                   /db_xref="UniProtKB/TrEMBL:D3R645"
FT                   /protein_id="ADC84577.1"
FT                   /translation="MSLIIQKGPIGFDGDLFALEKHAENAGSTRDVLCNKNKC"
FT   gene            complement(68804..70534)
FT                   /locus_tag="BIF_00293"
FT   CDS_pept        complement(68804..70534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00293"
FT                   /product="DppD"
FT                   /note="Dipeptide transport ATP-binding protein; DppF"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84578"
FT                   /db_xref="GOA:D3R646"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R646"
FT                   /protein_id="ADC84578.1"
FT                   /translation="MSDELERTGSMGDNLVDIKGLSVSFVTDAGPIKAIDGVDFTIPRK
FT                   TVVGVVGESGSGKSVTARSIIKLLPETATTGGAIYIRTAQDGAEGFDVLTMSGKDLQQV
FT                   RGGAAAMVLQEPNSVLNPVYTIGRQIEEGLRAHGLTDKKQLRAKSIEILEKVGIPDAAT
FT                   RIDYYPHQFSGGQKQRIVIAMALVLNPGLILADEPTTALDVTVQAEILDLLRLARDEFG
FT                   ASVLIITHNMGVVADLADQVVVMYRGHVVEHGSVEQIFYNPQADYTKRLLAAVPRIGQQ
FT                   LMVRDAAGHVIERSVDWREEPVVVKAEHMDITYPGQMQPDFKAVDDVSFEIHKSEVLGL
FT                   VGESGSGKSTTGRAIAGLQRISAGSLNVLGMEMRDFKERKFKPLREQIGFVFQDPGSSF
FT                   DPLMTILENVAEPLIVHGRYKTVSQAKQYVGELLEMVQLPRAYMNRFPHELSGGQRQRA
FT                   SLARALALKPSLLIADEPTSALDVSVQAKVLELFKTLQAEIGFACLFITHDLAVVDMLA
FT                   DRIMVMHKGRIVEHGDASQIMQHPSDPYTRKLLASLPVPDPREQAAHREELRKLLAEEA
FT                   "
FT   gene            complement(70524..71741)
FT                   /locus_tag="BIF_01148"
FT   CDS_pept        complement(70524..71741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01148"
FT                   /product="DppC"
FT                   /note="Dipeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01148"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84579"
FT                   /db_xref="GOA:D3R647"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R647"
FT                   /protein_id="ADC84579.1"
FT                   /translation="MSESTETRVGVPGDARLENPNIEKPQSWFAKLPVVRDLKIAVGWQ
FT                   KGMLVTGLVLTGFFLLVAVFAPWIAPYGYAQIKGDDGVAFPTQAAPSREHIWGTTVGGF
FT                   DVFSRTVWGARTAVIAIVVAVLLSIFAGVFLGLVSGYFGGWVDRVFVVIADAVYSFPSL
FT                   LLAILMAIMISGGQSSLWGGILASGISITVVYIPQYFRTIRAEVIRIKDSAYIESAKVV
FT                   GASTWRIMSKHLLKNSTRTLPVILTLNSSEAILTLAGLGFLGFGIEPTAAAEWGYDLNR
FT                   SVADVTSGIWWTAVFPGLAIVLIVLGITLIGESLNDLADPRLRARKSAGEVVGSIEDTS
FT                   VDSPDSGPISQAVVEQEYAAIKDATEKPADLGEDVNEYLVTQDPETAVVNKDVPDESEG
FT                   VIDNER"
FT   gene            complement(71743..72918)
FT                   /locus_tag="BIF_01149"
FT   CDS_pept        complement(71743..72918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01149"
FT                   /product="DppB"
FT                   /note="Dipeptide transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01149"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84580"
FT                   /db_xref="GOA:D3R648"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R648"
FT                   /protein_id="ADC84580.1"
FT                   /translation="MRSFRDAPGIDCSRPVVQFIPALFQGDPVSQAIASPADSAPSKPT
FT                   AHKNRLSAGFFRFILGRFLLIIPTVFILVTIVFFVMRATGDPISAPMGGRLTPEELQRR
FT                   IHGAGYDRPLIVQYFDYLGGLLHGDLGRTLTDNQPVISVLTRYGAATLELALLSLVVAL
FT                   LVGIGFGRIAAKHRDRAQDAGIRMFAILCYATPVFFLGLVLKLIFSVGLGVLPSSGRSS
FT                   LQSEMQFSRLVSPTGLYIVDALQPGDMKVLGDVLMHAILPALALGLLTAGVFIRLVRTN
FT                   VISTYNAGYIEAARSRGVSEKRLMSKHAWRPALIPIITVMGMQIALLLAGAVLTETTFE
FT                   WKGLGFMLSNYLKARDFVAVQGIVILIAIIVSVVNFIVDVISALIDPRVRY"
FT   gene            complement(72942..73526)
FT                   /locus_tag="BIF_01150"
FT   CDS_pept        complement(72942..73526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01150"
FT                   /product="Dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84581"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R649"
FT                   /protein_id="ADC84581.1"
FT                   /translation="MNTLKAYTDNGKPDAAKAKKTLSDAGVATPVDLKLQYNGDHYGSS
FT                   SADEYAAIKSQLEADGLFKVDLQQTEWTQYNKERVVTDDSDGSYPVYQLGWFPDYSDPD
FT                   NYLSPFFRDGNFVNNGYSNKKVNDAIVAQAGEKDEAKREGMLKDIQKTETDDLSTLPML
FT                   QGNQVAVTGSNVSGVVLDPSFRFRYASVVKN"
FT   gene            complement(74462..74566)
FT                   /locus_tag="BIF_02170"
FT   CDS_pept        complement(74462..74566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84582"
FT                   /db_xref="UniProtKB/TrEMBL:D3R650"
FT                   /protein_id="ADC84582.1"
FT                   /translation="MNAKKIIAAIASVAALALGERLRRREGRRRQCRG"
FT   gene            complement(74796..76178)
FT                   /locus_tag="BIF_01151"
FT   CDS_pept        complement(74796..76178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01151"
FT                   /product="Hypothetical protein"
FT                   /note="FtsQ; Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01151"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84583"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="UniProtKB/TrEMBL:D3R651"
FT                   /protein_id="ADC84583.1"
FT                   /translation="MARRTVSSSGHSPDSQRQEPQWPRGRSVRSAGSGNRAVRSRRDMP
FT                   ESPTRDNTAAVRDDEQPPTQSQSFEEYPKAMRGRQARSGRSAKAARSVRAGKERRVRGG
FT                   QSRTVEPRTATSGTHDAERQSASGESTQVSSGPNDSAKRPRYRFRKLVRKRRRESERTA
FT                   RTAQSSQSKAVSAPGSFVDARALESEDLVARTLDESAGTIGVATRPKVVDFKERQRERK
FT                   TANLRVLAMRIGIGAVVFALVIALIWLLFFSPALRLRQDRITVMGANEWVNRTQILDIA
FT                   KQQAGKSLLIVSDKSVEQQLDDIPGVSSSRATKKFPNGLEVEVTAQRPAAMLKVAGKDG
FT                   LTAVDNQTRVLNSVTNQAVKGIPVIEVKNIDDALGQRSVRAAVTILDAMPESWRTRVTA
FT                   VSANTQDSVTTTLDNGITIVWGDSAELKLKMAIVDKIMNDPNVIGDKKQINVSAPGRPI
FT                   IK"
FT   gene            complement(76210..77964)
FT                   /locus_tag="BIF_00646"
FT   CDS_pept        complement(76210..77964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00646"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84584"
FT                   /db_xref="GOA:D3R652"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3R652"
FT                   /protein_id="ADC84584.1"
FT                   /translation="MWTTDRSPRSGCPRKCPDCWRIRPACAHMVSMRGSMAFVMRRTVW
FT                   PVRSFPSPMRESEAMLHGTAEHRARSLKVKESIVLDPTVAQFGEDLRAADLGNTHFIGI
FT                   GGAGMSVLAEMLHEQGVPVDGSDREPGAKTERLESLGIPVQFTQRAENVQDAQVVVYSS
FT                   AIKPDNPEIVAAVANGAQLVHRSDILALLMNGKHAVTVAGAHGKTTTSSLLAHILMHAG
FT                   TGELADPSYAIGGSIQGPDGTTLDGGHAGKGTVLVAEADESDGSFAKYHPDIEIITNAE
FT                   ADHLDHYHTEENYHAAFADHVTHARRAVIMCVDDAGALAVLRSLAPEDARKVIAYSTHT
FT                   ADELGDLNGATFVHIASEHESANSGTENFVIDIPAALVGADVALPVSLRIPGLHNARNA
FT                   TAAILAAVLLGMDAERAAVAAGTFLGANRRFQIRGTVSDITVVDDYAHHPTEITALLKA
FT                   ARRRYPDSQLHVLFQPHLFSRTQFFAQEFADALSLADDVIVTGIFPAREKQSDFPQVTP
FT                   NTIVDNAHGDGSYEIEAVDDMSLAAQMLAMRAQPGDVIFTVGAGDITRMGPVILHVLEA
FT                   HYGNAQQD"
FT   gene            complement(79031..80413)
FT                   /locus_tag="BIF_01048"
FT   CDS_pept        complement(79031..80413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01048"
FT                   /product="FtsW"
FT                   /note="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01048"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84585"
FT                   /db_xref="GOA:D3R653"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D3R653"
FT                   /protein_id="ADC84585.1"
FT                   /translation="MDMPKPERQPRSMRSAQDGKSSGAIPSVKPLVRRSRRSGAPQPWT
FT                   VTHDDPATAARIASKRPSPQFGMIDFAGEYKGWRVLLNPLGCYYGFIVAVGILTVFGII
FT                   MVFSSSSVDMVAAGSSPWAKALNQVGFSVVGLVLALVAAHCKGRTLKWLALPMYLVSVA
FT                   VQVFTFFFGIDVGGNRGWLRIAGIQFQPAEFMKFTICLWFPLVMISMMRLKPGIRQSWK
FT                   AWDLGDWGRTFGLYVLGLGSVLLGKDLGTALVIILIGLMAIVASGFPMKYVGLVGIAAV
FT                   VGVAILTVFSSNRMSRIMATYTGCTADNIDVCYQATHSNYALASGGLLGVGLGNSREKW
FT                   NYLPAAHNDFIFAIIGEETGFVGAALVVLLFVVIAWCLVAVAMQMHNRYASVALLCFMM
FT                   WIVGQALINIAVVVEILPVMGVPLPFVSAGGSSMIFCLMAAGACVSLMRAQPQIGAAHS
FT                   RA"
FT   gene            complement(80394..81839)
FT                   /locus_tag="BIF_00509"
FT   CDS_pept        complement(80394..81839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00509"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84586"
FT                   /db_xref="GOA:D3R654"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3R654"
FT                   /protein_id="ADC84586.1"
FT                   /translation="MSNQEFNAAGKCVVVAGLGISGRSMAKILRDAGATVIGVDEKLEA
FT                   ADLHSFDDIDWDEVDLVCTSPVFNPRTPFIVEAQSRGIEVISEVELAWRMRVPSERTGS
FT                   PAPWIGITGTNGKTSTTEMTSEMLKACGYTAPAVGNIGNALSAAALDPVNDVLCVELSS
FT                   FQLHFTYSLELDCAAITNIAADHLDWHGGMANYATDKSKVFDGAKRVIAYNAQDARVSE
FT                   LARTAQTAEGCEHIGFTLGEPVSGQIGIKDGWIVDMSGLCGGQTGEAYALAPIADFTHL
FT                   AEPDGTIYPHLLADALTALILVVGLGADVATALNALKRFAPGGHRIQTVAELASPEGTI
FT                   RFVDDSKATNAHAARASLNSFAPGSVVWIAGGLSKGATFEELVEQERNRLKAVVVIGID
FT                   QKPMLEALKAKAPELPLTVIDPADNATVMERAIDAAADFAEPGDVVLLAPACASMDQFK
FT                   SYADRGDQFAAQAKRWVNGHAEA"
FT   gene            complement(81941..83047)
FT                   /locus_tag="BIF_00379"
FT   CDS_pept        complement(81941..83047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00379"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84587"
FT                   /db_xref="GOA:D3R655"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D3R655"
FT                   /protein_id="ADC84587.1"
FT                   /translation="MIALIIGILTSLIITLVGTPLLIRIVHKLNYGQYIRQDGPKSHQV
FT                   KRGTPTLGGVVIVLAVVLGWCASALYRFCTTGARPTWAAILALFAMVSMGVLGFIDDFA
FT                   KVRKKQNEGLTVGGKFFGQVVFATIFAVLALIVPTRSGFPVAQAGMSFIEKPFLSFEFA
FT                   GRIVAIILFVIWVNFLMAAWTNAVNLSDGLDGLCAGSSMIAFVGYAIIAMWQMYHLKGQ
FT                   AHSGFTYAVSDPLDLGIIACCAAVACLGFLWYNCNPASIFMGDTGSLALGGLFAALSII
FT                   THTEFLAMIIGGLFVVETLSDVIQVGYFKATHKRVFKMAPIHHHFELCGWSESKVVVRF
FT                   WIVELMFVITGLIIFYGNWVGLSGLWHH"
FT   gene            complement(83099..84589)
FT                   /locus_tag="BIF_00378"
FT   CDS_pept        complement(83099..84589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00378"
FT                   /product="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
FT                   ligase"
FT                   /EC_number="6.3.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84588"
FT                   /db_xref="GOA:D3R656"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3R656"
FT                   /protein_id="ADC84588.1"
FT                   /translation="MMRMTLAQMVQAVHGSAEHCDCDDLETVTATSVVTDSRQVVDGAL
FT                   FVAIAGEHVDGHDFVDAAARQGAAAALVEREIKSAPIAQIVVPDTVAALGALAKANLEA
FT                   RKAIDEPFTIIGITGSVGKTTTKDLLHALLSTQGETVAPKGSFNNEIGLPLTALKVGER
FT                   TRYLVAEMGANHIGEIARLTKIAPPDIAVVLKVGVAHLGEFGSVERIAQAKSEIVRGEA
FT                   PNAITVLNADDERVAAMSGIAKGDVFWFGIDKAQAHDIDGYMAADDIALDDLGHPVFEL
FT                   VSSQGVEQRVSLGIGGRHNVMNALAAASVAKLLGMPLERIAQVLADTRRISPHRMAVSE
FT                   VERDGARFTLIDDSFNANPDSMRAGIDGLMAWRSQEDQQPYRVAVLGSMLELGSDEHNL
FT                   HRTIGAYALDGGVDALICVGGGDDASLNALAQDIADGGTEAKDADDMRPVRAVKTTQQA
FT                   DDLIRALNAEHPDMLVLLKGSHASGLSALATQWAAEAE"
FT   gene            complement(84627..85529)
FT                   /locus_tag="BIF_00314"
FT   CDS_pept        complement(84627..85529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84589"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="UniProtKB/TrEMBL:D3R657"
FT                   /protein_id="ADC84589.1"
FT                   /translation="MVRQGVHMSSLSEAATHRTTLGMLADRYGYELSPKFSRAVTVTSL
FT                   ASDIDSVTAGSLFMPGKRIDAARVAAASRKGAYAVMLPKSMRSSDLEADIPLVYADPTP
FT                   REIGQIASNMTGNPAGTLAVFAIAGINDDQIHANVEMLSQFLHMLGNPVGTICAGDSQS
FT                   LDRFLDLRYPMDILSMQRVLSVCAEDGAAAVILALDDNTLQPDALQSVGADVIGYDGVA
FT                   NPMAGQDLVEQACERYGCGIDEGTHIAFRTDETDQMAVQADFGLDKVRSLSLAIAMVMA
FT                   AGVKKANIRSALRVSRELH"
FT   gene            complement(85523..87319)
FT                   /locus_tag="BIF_00315"
FT   CDS_pept        complement(85523..87319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00315"
FT                   /product="Division specific D,D-transpeptidase"
FT                   /note="FtsI; Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84590"
FT                   /db_xref="GOA:D3R658"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D3R658"
FT                   /protein_id="ADC84590.1"
FT                   /translation="MKGLKAKWNGASQLMRRTIVITVVMAVLAVCCLGKLVYIQLIEGP
FT                   QLAMAAQQSRTLKVTLQAKRGKIMDTNGVVLAQSVERYTIIGNPDAAQTFEPTACTAAT
FT                   KPYCQQLDGKPLTTTGVAAVSQLLAPLLGMSASEIGGKLSGTGQYAVLKKDVTPEVKRK
FT                   ISQLYLGGIVYSELSNERLYSNGTLMGALLGGVNAEGEGVAGIEQLQNKTLTGTDGYQV
FT                   YQQGNGGEEIPGTMTDSKEAVDGSNVTLTIDRDVQWRVEKILADAQEKYKARWGIGVVE
FT                   DVRTGEIIALADTDKIEAGSGDAKVQVARSVNQVFEPGSIGKVFTMGGLLQEKLHHMGD
FT                   RFTVPDSITLEGQTYKDSFNHGAERWTLAGVLEQSSNVGTIQASDNFPDDKRYEYLSKF
FT                   GIGQPSSLHLPGESQGVLTPANAWDGRTRNTVLFGQGYSTNALQLTNAIAVVANKGVMK
FT                   PQSIIKSVTASNGREEKVNPGESKRVVDESVANELLNAMESVAEHYQKFAGVSGYRVAS
FT                   KSGTAEIVGDDGKLSSLISDYTAIIPADNPRYVVTVVLRDPEGNYGGLTAGPVTAEIGQ
FT                   FLMQKYEVPASTPRKDAIPVEW"
FT   gene            complement(87316..87900)
FT                   /locus_tag="BIF_01361"
FT   CDS_pept        complement(87316..87900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01361"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84591"
FT                   /db_xref="GOA:D3R659"
FT                   /db_xref="UniProtKB/TrEMBL:D3R659"
FT                   /protein_id="ADC84591.1"
FT                   /translation="MSAEHMATGAVPRRGGDNMAVPMRSTRSNVSPAGRQSDPALKRPH
FT                   LHVVESGEHHAKETGHGAHVASTVIAWTRSRPRPWLHTTIAILFLVLCWIGTLMLRTQM
FT                   VENSFESSQVEQNITMLRQDVEDNQAKLSNLEATLPDRAQKLNMVPASGSLTIDLNGYQ
FT                   PPKDEKATTGESAEQQATSNQHDTSQGGATE"
FT   gene            complement(87848..88909)
FT                   /locus_tag="BIF_01362"
FT   CDS_pept        complement(87848..88909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01362"
FT                   /product="MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="S-adenosyl-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01362"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84592"
FT                   /db_xref="GOA:D3R660"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3R660"
FT                   /protein_id="ADC84592.1"
FT                   /translation="MTDFSQIHKPVLLQECVDLVTPALHASDSVAVDCTLGLAGHTIAF
FT                   LKAAPNATVIGIDRDEEALDKATARIAQEGLSARFVPVHAAFDQFDEVLRAQGVSRVQA
FT                   VFMDLGLSSLQIDERERGFSYAHDAPLDMRMDTSQALTAREILATYDADRLAHIFKEYG
FT                   EERFSKPIAKRIVQQRQSSPLETSSQLTALVDAVIPAARRGSGNPAKRVFQALRIEVNG
FT                   ELDKLRRTLPQIGLHLAVGGRLVVESYHSLEDRTVKNFMAQGLRVDAPADMPVIPPDMQ
FT                   PFFKALTKGAVKADAGEIAYNPRSASVRLRAVELTRPLPQRWVHAFELESQGSEDGVRG
FT                   AHGHRRRTQARRG"
FT   gene            complement(88909..89454)
FT                   /locus_tag="BIF_01363"
FT   CDS_pept        complement(88909..89454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01363"
FT                   /product="MraZ"
FT                   /note="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01363"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84593"
FT                   /db_xref="GOA:D3R661"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D3R661"
FT                   /protein_id="ADC84593.1"
FT                   /translation="MSGGVEWRDEEFACVLIGGAMTDEPVEPDSSAPVVPPLLLGTYNP
FT                   KIDAKGRMAIPAKMRAQLGEGMVMARGQERCVYLLPQSEFRRIAAQIQRVSVGNKAARQ
FT                   YLRVFLSGAVDQDTDKQGRVVVPQMLREYADLGDDIVVIGVGTRAEIWNRKAWEQYLSD
FT                   NEPEYSDIADDVLPDLEF"
FT   gene            89736..92009
FT                   /locus_tag="BIF_01364"
FT   CDS_pept        89736..92009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01364"
FT                   /product="ATP-dependent DNA helicase rep"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01364"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84594"
FT                   /db_xref="GOA:D3R662"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R662"
FT                   /protein_id="ADC84594.1"
FT                   /translation="MYGNMSQYSSQIQEEQQVVDRAYGRLDDLRTQARERLSDVRAAGS
FT                   HGSPTQRTERDSFATMYEDRLTQLRAVEDRLVFGRLDDESGNRRYIGRIGLSDENHEPM
FT                   LTDWRAEAARPFYEATPSHHGDIVMRRHITLHFREVVGIEDEVLDVHSPHVNTASEQGT
FT                   LTGEGALLASLGSRRTGKMTDIVATIQGEQDRIIRAALRGAVIVQGGPGTGKTAVALHR
FT                   AAYLLYTHRRMLDRSGVLVVGPSEEFLHYIDQVLPSLGETGVVSRTIGELIPGMVAERH
FT                   DEPHVAQLKGERRMANAIANAVAARERVPANLPTVYFNGIPVTMRAADVTEAIAAARRT
FT                   RQPHNKARETFVNEMLERMRSQYIEQLDYTPEAAEVSDFMSQLRLSDPIRIALNLAWLP
FT                   MDAKWMLDQMLSKPAQLKRYAPWLTEAQVRMLTRERGAAFTRSDIPLLDEAMELLGPDP
FT                   RDAARAAARNAKREEEERFAADTLAQNGIGSGIVNSKMLVDHMNGGDAELVAQRAAADR
FT                   EWTYGHIVVDEAQELTAMDWRMLIRRCPSRSFTIVGDVAQTSALGGTRDWKKTMTPLFG
FT                   EHNWSLNELTINYRNPQEVSNLASSFAEREGLYISTVKAIRSIPDSVQRLVVDDDTTMY
FT                   DELSFHAASLAKEFIDSDGNGRVAVIVPQEIKDAARSAISRRFKRIADTSQMHIEDSQL
FT                   LVCDAQSVKGLEYDAVIVAQPGLIAQEAPSRLAAAADLYVALTRPTQRLLIVRTREDEN
FT                   LLTL"
FT   gene            92011..93222
FT                   /locus_tag="BIF_01365"
FT   CDS_pept        92011..93222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01365"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01365"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84595"
FT                   /db_xref="GOA:D3R663"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029015"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R663"
FT                   /protein_id="ADC84595.1"
FT                   /translation="MGSMPKALLLENIHPLAAESLRAHGFEVETRKGALSERELIDALE
FT                   GVDVLGVRSKTTVTRAVIDARPTLTAIGCFCIGTNQVDLNHAAKNGIAVFNAPYSNTRS
FT                   VVELVICDIICLMRRIPAHTHHMKHGVWDKSASGSHEVRGKTLGIIGYGNIGSQLSVLA
FT                   EALGMSVIFYDLEEKLALGNARRCETLHELLNEADAVTIHVDGRKSNTGFFGEKQFSQM
FT                   KQNAIFINASRGFVVDLDALKEHLDSGHLSGAAIDVFQNEPKKTGDPFSTPLADEDNMI
FT                   LTPHIGGSTLEAQENIAQFVSQRLEDYWFKASTMLSVNLPQITTGPCKGAARIAHLHAN
FT                   LPGVLAKVNQVLGEQDINISAQALGTEGEIGYVVTDVTKCPDEVTIDALDAITGTIRTR
FT                   VIES"
FT   gene            complement(93271..93786)
FT                   /locus_tag="BIF_02171"
FT   CDS_pept        complement(93271..93786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02171"
FT                   /product="Putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02171"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84596"
FT                   /db_xref="GOA:D3R664"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D3R664"
FT                   /protein_id="ADC84596.1"
FT                   /translation="MTRHALIYSGQCEHGPWARYSWSMHCPFCQNPDTKVIDTRISDDG
FT                   HSIRRRRECPNCGARFSTLETTMLLVKKRSGNVEQFDRNKVIAGVRKACQGRPIHEDDL
FT                   KRLGQQVEEDLRARGVAQVPSDEVGKAILRPLKDLDEVAYLRFASVYQNFEDLEDFQHA
FT                   IDALRDSE"
FT   gene            complement(93812..94243)
FT                   /locus_tag="BIF_02172"
FT   CDS_pept        complement(93812..94243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02172"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84597"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D3R665"
FT                   /protein_id="ADC84597.1"
FT                   /translation="MFERIDIVEQMCEYGLQLLEHLFEGVVMRSKSIVQVQAKTVSERY
FT                   RNSFLRAHHRVLAVVVTISACFALCCVTAGARESDAVVEAASSEVVHYTVQPGDSLWSI
FT                   ASRFPGDSSSAYQRVERLKQVNNLRGGSLRAGQHLVIPL"
FT   gene            94300..94995
FT                   /locus_tag="BIF_00542"
FT   CDS_pept        94300..94995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00542"
FT                   /product="LexA repressor"
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84598"
FT                   /db_xref="GOA:D3R666"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D3R666"
FT                   /protein_id="ADC84598.1"
FT                   /translation="MSNLDAPTPAGSRPSLESLTKRQLQVLDAIRKLLEEQGFAPSLRE
FT                   IGKAANLKSTSSVQHQLHALESKGFIRRDPNKGRAIELVETQDGTSGGNPIVPFDGMDL
FT                   EPSDFLDVPLVGAIAAGQPITAEQHVEDVMRLPVRLTGTGNLFMLEVKGDSMIDAAICD
FT                   GDFVVVREQHNAENGDIVAALLDDEATVKTFRQEHGHTWLIPHNPNYAPIDGTHAQIMG
FT                   KVVTVLRKI"
FT   gene            complement(95378..96322)
FT                   /locus_tag="BIF_00383"
FT   CDS_pept        complement(95378..96322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00383"
FT                   /product="CzcD"
FT                   /note="Cobalt-zinc-cadmium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84599"
FT                   /db_xref="GOA:D3R667"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D3R667"
FT                   /protein_id="ADC84599.1"
FT                   /translation="MGGEMAHEHSHAPVNGTEGHFKRLIVTLALTATILVAEVVGAALT
FT                   GSLALLVDAGHMTTDVAVLTASTVTAALMRRKPDKSKTWGWARLEIITAAGGGLVLMFV
FT                   GLYALIEAVLRLTGVESESVHDVRLLLFFGILGLASNIGSMFVLRAQSNDNMNMRAAFL
FT                   EVCNDALGSVAVIISSIVLMCTGWSGFDAIAGALIALLMIPRAYGLLHHAMRVLLEETP
FT                   DGLDLDTVREHLLGVPHVLAVHDLHASVVSTGMPILTAHVIVEPDLTVAQAGEVLRQLQ
FT                   DCTRQHFPVSIAHTTFQLEPEGYSNVDVGQIHE"
FT   gene            complement(96424..97386)
FT                   /locus_tag="BIF_00382"
FT   CDS_pept        complement(96424..97386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00382"
FT                   /product="L-lactate dehydrogenase"
FT                   /EC_number="1.1.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84600"
FT                   /db_xref="GOA:D3R668"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R668"
FT                   /protein_id="ADC84600.1"
FT                   /translation="MVNSPIKPTKLAIVGAGAVGSTLAFAAAERGIAREIALQDIAKER
FT                   VEAEVLDMQHGSSFFPTVSIEGSDDPEVCRDADMVVITAGARQKPGQSRLDLAGATINI
FT                   MKSIIPNMLKVAPNAIYMLITNPVDIVTHVAMKLSGLPASRMFGSGTNLDSARLRFLIA
FT                   QQTGVNVKNVHAYIAGEHGDSEVPLWASATIGGVPMCDWQALPGHEPLDAEARERIHQE
FT                   VKNAAYKIINGKGATNYAIAMSGVDIIEAILKDSNRILPVSSLLSDFHGISDVCMSVPT
FT                   LLNRNGVNSRINTPVSDRELAALKRSAETLRETAAQFGF"
FT   gene            complement(97561..99132)
FT                   /locus_tag="BIF_01184"
FT   CDS_pept        complement(97561..99132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01184"
FT                   /product="HflX"
FT                   /note="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01184"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84601"
FT                   /db_xref="GOA:D3R669"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3R669"
FT                   /protein_id="ADC84601.1"
FT                   /translation="MQFKRKALLTIFENGGRMGNPRYTEDSQTTDSQNVLDGQSQVLLD
FT                   DDHAGWRGEDETWREREGRNELKHVAGLGELEDVTEVEYRKVRLEKVVLVGVWSSREST
FT                   FAQAEESLRELAALAETAGAEVCDGVLQQRSRPDGTSYVGSGKAREIADIVAANDADTI
FT                   IVDADLPPSQRRALEDLTHVKVVDRTAVILDIFAQHATSREGKAQVELAQLQYMLPRLR
FT                   GWGAALSRQAGGRAAGADAGIGSRGPGETKIEMDRRVIRTRIARLRKQIKEMSGTREVK
FT                   RGSRRRYGLPTIAVVGYTNAGKSSLTNRLTGSTELVENALFATLDTAVRRTQTRDGRLY
FT                   AYVDTVGFVRRLPTNLVEAFKSTLEEIADADLIVHVVDASHPDPFSQIDAVNEVLQTID
FT                   GVERLPVITVFNKADLIDDAKRERLHALAPDAHIVSSATGEGVDALRADVESMLVDPDV
FT                   HVEALLPYTEGSLLAKVREYGRLESLEYRDDGIMLQAFVDERLAARIMDVALHETDAPE
FT                   HGEGGE"
FT   gene            99074..99841
FT                   /locus_tag="BIF_01185"
FT   CDS_pept        99074..99841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01185"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84602"
FT                   /db_xref="GOA:D3R670"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3R670"
FT                   /protein_id="ADC84602.1"
FT                   /translation="MPMRPPFSNMVKSAFLLNCKRSYIMVRIVNKTGTANISVFHGNGD
FT                   VMGKSNGTANEQYFSSAPQSADVRKTLEVTLRDHPVTVETSNGVFSAHRVDLGTSVLLR
FT                   HAPMPPLEGTFLDLGCGWGAIALALALESPEATVYAVDVNERAIELARSNAEANGCGNI
FT                   HAGTAAVVPGDVRFDVIWSNPPIRIGKEALHELLMEWLPRLVSDGHAYLVVQRNLGSDS
FT                   LIPWLAEHLGDGYEVGKYASSKGYRVIDVHKLA"
FT   gene            99819..103931
FT                   /locus_tag="BIF_01186"
FT   CDS_pept        99819..103931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01186"
FT                   /product="HrpA"
FT                   /note="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01186"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84603"
FT                   /db_xref="GOA:D3R671"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R671"
FT                   /protein_id="ADC84603.1"
FT                   /translation="MTCISSPSTAQYLNTDYLQKDVMKFEYPDQLPVSAAREAIANAVR
FT                   SSQVVIISGQTGSGKTTQLPKILLELGRGSHGKQIVHTQPRRLAARTVAERLADEMGVR
FT                   LGDEIGYQVRFTDESSPKTRLRVVTDGILLAQIQRDPKLTRYDTIIIDEAHERSLNIDF
FT                   LLGYLTALLPLRRDLKLIITSATIDSAKFQKHFEDALRTEVPVIEVSGRTYPVTICYEP
FT                   LGGTPALMRHVPGFADGTAGDDITNPDAEAMDMPTAVARACTELAILSTHDQGPRDILV
FT                   FASGERDIRDFEQALRHHFGPRAADMRRPDAIEIVPLFARLSAKEQHRVFEPHTHQRIV
FT                   IATNVAETSLTVPGIRYVVDPGTARISRYSKQAKVQRLPIEPISQASADQRSGRCGRIA
FT                   DGIAIRLYSSEDYESRPRFTEPEILRTSLGAVVLHMLSVGVARTAEDITDFGFIDPPDI
FT                   KAVSDGINELTELRAISRKRGVMQLTHTGRQLARIPIDVRLGRMVIEAARSTTPNTLAA
FT                   VLVVVAFLSLQDPRERPEEKREEADCIHNRYADETSDFLTALNIWDRAYGADGEMSSHA
FT                   LRRLCKTEYLHFLRMRQWRDLVSQLRELCRELKFNVGEPIPVSRPPREIRELPISQQAA
FT                   HSLACSWDSQGIHTSMLAGLLSMMGMQVVHEPKASDFTGLKGAARARAMKRAQKMAKND
FT                   YLGARGTHFAIFPASALSKSTPSWVMSTELVQTSRLWARYCAAIDPAWAEPLAGNLTRT
FT                   TYANPHWSASRGSAVAESNVLLYGLPIVQGRTVQWGRINPLEARDFLIRQGLVEGEIQQ
FT                   RFAHDEFIDANRSVIEEAQEESNRTRQVAQTVSDEDLYDFYNEVIPNTVTCVADLAKWW
FT                   KGEFEAHPHLLDFDPSKVERLLDQESVSMEDFPDHWVAVGSDERVIELRLSYVYDTHDP
FT                   ADGVTVHIPLGVLSRISAPQFSWNVPGLRHELIVAMIKALPKALRVQFVPAPDTATKIE
FT                   DWIDSHFQTDPGSGTLDSPAQVDGGVWPDFAHVFTQAAIEVVGAQIHPEVLDGLADKLP
FT                   PYLRMNFVIEQPKPRPKRAHRRRSYDDGVVVLGTGKSLVELQRQFAEQAQESARKIVHR
FT                   QAQKAAEQGQVVAEADLLRKAGATTEAREEMLWRGALDRLRLPAERISSRWLGAEALML
FT                   ASAPYSTTKALADNLQLQTVKRLLPDIAKLSSDEALSEAVDGVKEVFEDAVYEVAKDAI
FT                   EVLRAYAQVDKAVSGKADLPMLSVLQSVREHIATLVHPGFIGATPPDSFRRLPVYLQAD
FT                   MIRLSKAKTDKNRDVRWAWQADEAKQIVDKALEKARKEPAGAKHDELMAKALKARWMLE
FT                   EFYVSLWAQELGTPYPVSVQRIQKALR"
FT   gene            complement(104008..105450)
FT                   /locus_tag="BIF_02012"
FT   CDS_pept        complement(104008..105450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02012"
FT                   /product="Glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02012"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84604"
FT                   /db_xref="GOA:D3R672"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D3R672"
FT                   /protein_id="ADC84604.1"
FT                   /translation="MFIRRSVRIPSVYRCGVHIPSVNACRNIGLKRWGAMDKQQEFALR
FT                   TVEERDVRFIRLWFTDVLGTLKSVAIAPAELEAAFEEGIGFDGSAIEGMTRVSEDDMIV
FT                   KPDPSTFQILPWRGGPQGTARMFCDVLTPEGEPSLSDPRHVLKRSLSKAKEKGFTFYVH
FT                   PEIEFYLFEKQDDWSKSPVPIDQGGYFDHVPRSPGMDFRRATVNMLEQMGISVEYSHHE
FT                   AGPGQNEIDLRYADALTIADNIMTFRTVVKEISLERGIHASFMPKPLADAPGSGMHTHL
FT                   SLFEGDANAFYEAGQEFNMSLTARQFAAGILHHAAEICAVTDQYVNSYKRLWGGNEAPS
FT                   YICWGHNNRSALLRIPQYKPGKGNSARIEFRALDPGANPYLAYSVLLAAGLDGIEKKMT
FT                   LGEPTSDDVWELTDAERQAMGIQPLPESLDEALKIMEKSDFVADVLGEHLFEFFLRNKR
FT                   KEWEEYRSQVTPFELKKYLAKL"
FT   gene            complement(107049..107777)
FT                   /locus_tag="BIF_00845"
FT   CDS_pept        complement(107049..107777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00845"
FT                   /product="1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00845"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84605"
FT                   /db_xref="GOA:D3R673"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010188"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D3R673"
FT                   /protein_id="ADC84605.1"
FT                   /translation="MSLTLLPAVDVRDGKAVRLRQGESGSETDYGSPLDAARTWVDAGA
FT                   QWIHLVDLDAAFGTGDNRAQLREIVRQLGDKVNIEMSGGVRDDASLDAALDAGAARVNI
FT                   GTAALENPEWTARVIDKYGDKVAVGLDVRGHTLAARGWVKEGGGLFETMRFLDDAGCSR
FT                   YVVTDVTRDGMMSGPNIDLLREVAERTDARVTASGGISKLDDLRAIKELLPLGVDSAIL
FT                   GKSLYAGAFTLEEALAVANA"
FT   gene            complement(107825..108502)
FT                   /locus_tag="BIF_00844"
FT   CDS_pept        complement(107825..108502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00844"
FT                   /product="Imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00844"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84606"
FT                   /db_xref="GOA:D3R674"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3R674"
FT                   /protein_id="ADC84606.1"
FT                   /translation="MHGAQEESEIMKSVVVFDYGFGNVRSMMRALANQDLDVTLTSDYR
FT                   KALEADGLVVPGVGAFGACMQGLRKVNGDNVIYDRLRAGRPVLGVCVGEQIMFTRGTEH
FT                   DLDTPGLQLIDGEVSRLDADVVPHIGWDTVDAPEGSVLLNGVEGERFYFVHSYAAFTAA
FT                   PADLTQFDIDLGDAEQKVAFCDYSRSHFVASYERGPLFATQFHPEKSAQAGARLLANWA
FT                   AVL"
FT   gene            complement(108503..109255)
FT                   /locus_tag="BIF_00843"
FT   CDS_pept        complement(108503..109255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00843"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00843"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84607"
FT                   /db_xref="UniProtKB/TrEMBL:D3R675"
FT                   /protein_id="ADC84607.1"
FT                   /translation="MMSDDDKRNPNNPDNPGDENDAFWAFESDPDLAREMESLNQELAN
FT                   LEQNASTDDAGESATGESEDGNAPEDVSDEFSQIMNANAEIGFDDELEGILGNKAKRAI
FT                   LVTRLTSADLLAAFCSLADITAQCIDSREGAVAVLRNLNGDGPEAAAKDLTEVVAGLSV
FT                   LLLVDRADKMTAVPYANGTAEDAELPPPFVLETLAHFVEDLMLGLTTVDALAQQGVRIV
FT                   DSADLDHDHALKIIAEHTNFGRDGSSID"
FT   gene            complement(109252..109854)
FT                   /locus_tag="BIF_00842"
FT   CDS_pept        complement(109252..109854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00842"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00842"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84608"
FT                   /db_xref="GOA:D3R676"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D3R676"
FT                   /protein_id="ADC84608.1"
FT                   /translation="MARTAHIVRQTSESSIDLELNLDGTGKTNIETTVPFYNHMMTALG
FT                   KHSLIDLNIVASGDTDIDAHHTVEDTAIVFGEALRQALGDKRGIRRFADATVPLDEALA
FT                   KAVVDVSGRPYCVCSGEPEGFQYAMIGGHFTGSLVRHVMESIAFHAQICLHMHLIAGRD
FT                   PHHIAEAEFKALARALRFAIEPDPRIQGLIPSTKGAL"
FT   gene            complement(109897..111063)
FT                   /locus_tag="BIF_00143"
FT   CDS_pept        complement(109897..111063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00143"
FT                   /product="Histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84609"
FT                   /db_xref="GOA:D3R677"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R677"
FT                   /protein_id="ADC84609.1"
FT                   /translation="MSEAMIPADLPLRNDLIGEVPYGAPQLDVPVCLNVNENPYPPDHA
FT                   VVRSIVEHVKQVAPTLNRYPDREHIELREAFVRYLKEESGAQLTVEQVWGANGSNEIML
FT                   QLFQAFGGPGRAALGCDPAYSMYPEYARDTFTSWYTTHRKPDFTLDVDHTIDDIDAIQP
FT                   AMVVLTSPNNPTGTELPMTDLKRILEHCQSAQVAGAHDGVHPIVVVDEAYIEFRNPGTP
FT                   SATTLINDYDNLAVSRTMSKAFAFAGARVGYLAASEGIVDCLRIVRMPYHLSAVTQAVA
FT                   LAAFDHRKEQLSQVDHLREIREQTAAWLKEQTYKGQPLEVAPSQSNFLLFGGHFDDRGA
FT                   IFDQMLQRGVLIRVVGPEGWLRVCMGTDEEMRRFREALVESMRAVENA"
FT   gene            complement(111060..112460)
FT                   /locus_tag="BIF_00107"
FT   CDS_pept        complement(111060..112460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00107"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84610"
FT                   /db_xref="GOA:D3R678"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D3R678"
FT                   /protein_id="ADC84610.1"
FT                   /translation="MSQDNYMRIIDLRGKELTRAEMLDAMPRAEMGTDEASEIVQPILD
FT                   NVRENGAAALREYAEKFDHIVPKSFRVPTDVMDAAVACLDPEVRAAIEESVRRARAVAK
FT                   SQVPEDFHTDLAEGARVSERWIPIQRVGLYVPGGKAVYPSSVIMNVVPAQAAGVESLAI
FT                   ATPPSRDNAQGWPNKTILATCAILGVDEVYAVGGAQAIAMFAYGATDLDNPVSPVLCEP
FT                   VDKITGPGNIFVATAKRLVSGIVGIDAVAGPTEIAIIADKTSNPAYVAADLIGQAEHDE
FT                   LAGSVLITDDDQLAEAVQAELNKRVPRTEHSERVATSLSGKQSGIILTDGIEQSIDAAN
FT                   AYAAEHLEVQTADPDAVIAKIRNAGAIFRGNYSPVPLGDYMSGSNHVLPTSGTARFAAG
FT                   LGVHTFMKPVEVIEYDEQGLKELAARVNALAVSEDLPAHGESVLTRFIDDPYNKETITE
FT                   QEEEAGLR"
FT   gene            complement(112717..116283)
FT                   /locus_tag="BIF_00801"
FT   CDS_pept        complement(112717..116283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00801"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00801"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84611"
FT                   /db_xref="GOA:D3R679"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D3R679"
FT                   /protein_id="ADC84611.1"
FT                   /translation="MTNSADFVQLHNHTHYSLLDGASKIPDLVKYTKELGMGAVGITDH
FT                   GNMHGAYEMYTEAVKQDVKPIIGIEAYVTPETARQDKSRVHWGTEAQRRDDVSGGGLIT
FT                   HLTLWAEDDEGLRNLIRASSVANLEGRVMRYPRMDKEVLSTYSKGVICGSGCPSGIVQT
FT                   RLRLGQFDEALRAAGELQDIYGKDNFFIELMDHNLEIERKVTKDLLEIAKKLGAPLLAT
FT                   NDSHYVHEEDAGAQDAMLCINSGSHLDDPDRFKFDGEGYYMRSAQQMRELFRDLPEACD
FT                   NTIEVAERCNVMFDDHEDGAFMPKFPCPEGWDETSLFLKKVEEGLERRYEGNVPAHVLA
FT                   QADYECGVICQMQFPGYFLVVADYIQWAKDHGIMVGPGRGSAAGSMVAYAMGITELDPL
FT                   EHGLIFERFLNPERVSLPDIDVDFDPEGRLKVIEYCGDKYGHDKVAQCVIYGTIKTKQA
FT                   LKDSARIMGYEFSMGELVTKALPPAATGGKDVPLHDIFDPGAKRYAEAREYRELYESNP
FT                   DAKRITDEAMGIEGLIRQTGVHACATIMGSEPITDTSPLLERTDGTVTTTFEYHTCETL
FT                   GLVKMDFLGLSNLTVIGDTLRNIEANGKEPIDHTKIPLDDKETYELLSRGDTLGVFQLD
FT                   SDGMRALLKQLKPDNFNDISALIALYRPGPMSMDSHTNYAKRKNGLQKIEPIHPELAEP
FT                   LKEVLDETYGLIIYQEQVQSAARILAGYSLGKADVLRRAMGKKKPEVLAKEQVPFFEGM
FT                   KEHGYSREAAQAVWDVLVPFSGYAFNKAHSAAYGLISYWTAYLKTHYPAEFMAALLQGA
FT                   STNKDKTALYLGEARRMGIKVLSPDVNESVYAYSAVGDVVRFGLGAIRNVGEKAVADII
FT                   AERQGSHGRYVNFMDFIRRVPLTALNRRLVESLIKAGAFDSIDPNRRALYQIHEAAIDS
FT                   VTDLKRKQATGQFDLFADLDAGADDGEAEALGDVSISVPDVEEWDKKTKLNFEREMLGL
FT                   YVSDHPLSGMQSVLASLRDMSIAQLIDRAPTMPERSQVMVAGLITNVDSRVSKKGNRWA
FT                   IVTIEDMESSIQCLLFGKVYEAHAAELAIDTIVQVRGMVEARDETISLRATDLMVPVIE
FT                   AGEDRPVFVQLPAHALDMQRLEQFSQILSNHPGACEVRLAIVDDNGGVTLMTLGDRFRV
FT                   RRETGLFADIKVLFGANALPMI"
FT   gene            116485..116790
FT                   /locus_tag="BIF_02009"
FT   CDS_pept        116485..116790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02009"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84612"
FT                   /db_xref="UniProtKB/TrEMBL:D3R680"
FT                   /protein_id="ADC84612.1"
FT                   /translation="MTASKPARGRRIAVYVALIPLCALLALPGAIGMVQAIRILLGCDH
FT                   AAGYSTGVRELEAWTSLLFTTPLAVMPTCAMIIFVVLAITEASRGKSPPSSPSRRL"
FT   gene            complement(116770..117723)
FT                   /locus_tag="BIF_00334"
FT   CDS_pept        complement(116770..117723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00334"
FT                   /product="Ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84613"
FT                   /db_xref="GOA:D3R681"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3R681"
FT                   /protein_id="ADC84613.1"
FT                   /translation="MSTIIPAPDALIGKRFDVAVAKMMGISRAKATELIETGQARVIGR
FT                   DIHKSATLQAGDTVEIDVREERREPEPVSNEMTIAYEDDDIVVVDKPVGVAAHASVGWT
FT                   GPTVLGSLIQRGVHITSMGAAGRQGIVSRLDVGTSGLMLVCKSDLAYKEMRRQFSEHEV
FT                   KKTYHALVQGNLKEDKATIEAPIGRAKVSDFRFTVTPAGKEAVTHWDVMERFGEATLAS
FT                   INLETGRTHQIRVHFSSIGHPLVGDPMYGANPRLSQALGLERQWLHAMELEFRHPRTHI
FT                   NTVVTSRYPTDLQHALETERERFAQREHQRLESSRG"
FT   gene            complement(117742..118284)
FT                   /locus_tag="BIF_00335"
FT   CDS_pept        complement(117742..118284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00335"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84614"
FT                   /db_xref="GOA:D3R682"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D3R682"
FT                   /protein_id="ADC84614.1"
FT                   /translation="MLNSKPRRPRVRVAVFACIAIVALGADQLSKYLAQTYLTETDYIQ
FT                   VIPRFLHLTLVHNPGASLGMGANSTWVISLFAIVACCVLVWMAWRTTSMAWTVFLALAF
FT                   AGALGNLIDRVAYAQGFLNGKVVDFLNYGWSVGNVADIFLMIAGIGIIVLILCGVPYRG
FT                   SDERQPADTAAAGHSDN"
FT   gene            complement(118297..119811)
FT                   /locus_tag="BIF_00306"
FT   CDS_pept        complement(118297..119811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84615"
FT                   /db_xref="GOA:D3R683"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:D3R683"
FT                   /protein_id="ADC84615.1"
FT                   /translation="MALLTPKDIREHTFQTVRFKEGYDVDEVDDFLDQVTETVEALGKQ
FT                   AVAGGQSTQALGPDVSALNTKISDLTAQVQSLQQENQSLKAAAAQGAGEQATAQIAQAN
FT                   QAAQAAQAQLKEAESNNQALSTQNEQLKNQIERLSAQVDQLTAQAAQNSDQPDLAKELQ
FT                   EITRQRDQFRADSENLRHELSAAHEQTMRAQQAEAQVKDLTKQLEESKQREEQLRDQVA
FT                   KVEPNTETGSLQKIKSAAAAANSEPERATAMLTLAMQLHDQYVDKGKATAKEITEQAQR
FT                   KYEELISKANDYSNRTRSEADDYNARTREAADAYSAKTRDDADSYSAKTHEDADTYMKN
FT                   KHAEADQYVVDKTNEANTYADQKIAEANNYAAAKTNEADTYADSKAHEADEYAQKKQDE
FT                   GNTYAQQKKSEADQYVVERHDEINAFEAEAKKRADDYSAKTRTAADDYAQQVRENLETQ
FT                   SKVIEGNIQGLKTFETEYRARLTEFLGQLQAQVSDTNNYKDIDKAN"
FT   gene            complement(119940..120230)
FT                   /locus_tag="BIF_00305"
FT   CDS_pept        complement(119940..120230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00305"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84616"
FT                   /db_xref="GOA:D3R684"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:D3R684"
FT                   /protein_id="ADC84616.1"
FT                   /translation="MLSTLFGFFFHIVDLLIEAYIAVLFARMIFDWVLVLAPRWRPTGF
FT                   VATLLRIIYQLTEPPLRFLRRYIKPIPLGRVYFDVSFLVLYFVLVILRILI"
FT   gene            complement(120312..120782)
FT                   /locus_tag="BIF_00304"
FT   CDS_pept        complement(120312..120782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00304"
FT                   /product="Ycf50-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84617"
FT                   /db_xref="GOA:D3R685"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:D3R685"
FT                   /protein_id="ADC84617.1"
FT                   /translation="MAGFMKRTMSYLGMSDVVPEDEDDEVIDEEPESSFDTDRSVTPIP
FT                   AASTQPSTSQRKSVAPFHANINRITTIHPQSYEDAQLVGRALRDGIPVVLNLTDVSQSQ
FT                   AYRIIDFSSGVVFGISGSIERVTERVFLLSPARVDIVAEDTESGMSDNLFEN"
FT   gene            complement(120871..122127)
FT                   /locus_tag="BIF_00177"
FT   CDS_pept        complement(120871..122127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00177"
FT                   /product="FtsZ"
FT                   /note="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84618"
FT                   /db_xref="GOA:D3R686"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D3R686"
FT                   /protein_id="ADC84618.1"
FT                   /translation="MSEIAQTDNFNDTTIIKVVGVGGAGGNAVNRMIAEGLQNVEFVAI
FT                   NTDAKDLLRSDADVKISLSDASSRGLGAGADPEKGAKAAQDHQSEIEEAVKGADMVFVT
FT                   CGEGGGTGTGASPLVARAARQQGALTIAVVTRPFSFEGPQRAASAALGIDNLREEVDAL
FT                   IVIPNDRLLELDDSSIGIVDAFRTADTALLAGVQGITDLLTINPYIHVDFSDITSILQN
FT                   SGTALFGIGAARGEDRAAQAAEIAISSPLLEESIDGASGVLINIAASNDLKLAEVNQAV
FT                   GFVREAAHPEAQIIFGLALDDAYGDEMRVTVIAAGFNDKKKLAQANEDAQAAASAPQRT
FT                   VKPVTKTATASGQPTILTSPIPSTGPVFEEEKKTDEKIVAQQPTPKQRSEYDASSDTSS
FT                   YPYTALGDLGDLDIPEFLQ"
FT   gene            complement(122288..123796)
FT                   /locus_tag="BIF_02173"
FT   CDS_pept        complement(122288..123796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02173"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02173"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84619"
FT                   /db_xref="GOA:D3R687"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D3R687"
FT                   /protein_id="ADC84619.1"
FT                   /translation="MPTTWPSASTTNVHVCRSNRCRWVAPNGPRPCISPRPAVCTDLPC
FT                   INRLRPVCLRLRDAGDFAYEASVRIIHTILCTIRTHERGDMSEQETILNTSRQREASPD
FT                   AKDCADAGARLEPVLAGPLAPIRLGDVMVNTPVMLSPMAGVTNWPFRVLCEEYGPDGLY
FT                   VAEMVTARALVERNPKALRLCRFAPSERIRSLQLYGVNPSIMEQAARFLVDNGMMDHLD
FT                   LNFGCPVPKVTRRGGGSALPWKTDLFTEIVQRVVAVCEPANIPVTAKIRVGLDHEHETF
FT                   LEAGRIAQEEGCSAVTLHARTTAEYYGGHSDWCRIGELVSTLDIPVFGNGDIWGAEDAI
FT                   AMVNETGCAGVAIGRGCQGRPWLFGNIGNAFAGSDVRINPTLGEVGRIIMRHAELLTEF
FT                   YDGDERMAVHDLRKHVAWYLKGFPVGGSTRRAFMECESLKDVREQVDALDPNIEYPERV
FT                   VDQPRGRVRFAKKVHLPYGWLDSRTTTHEERERLFGDDPMDASY"
FT   gene            complement(123672..125588)
FT                   /locus_tag="BIF_01125"
FT   CDS_pept        complement(123672..125588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01125"
FT                   /product="Glycyl-tRNA synthetase"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84620"
FT                   /db_xref="GOA:D3R688"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D3R688"
FT                   /protein_id="ADC84620.1"
FT                   /translation="MAAVPPAASCALATRLMVTKLVNDCASGVCSRTFCAAWRIRSRMG
FT                   SSGATSCRLDVSEFGVVDAVVICTPYSGASQQVRRVRREATLSSISSPDMCIPNVLNTL
FT                   DACCAHACHHPTWAPERAPCVSAANGRVKPCIRPQTVQTRRCIVANSKIDEVVSLAKRR
FT                   GFVFPAGEIYGGTRSAWDYGPLGVALKDNIKREWWRSMVVTRPDVVGVDTSIILPSEVW
FT                   VASGHVSVFNDPLIECLTCHKRHRADKLEESYAEKHNDQLPPNGLKDIVCPDCGTRGNW
FT                   TEPRDFNMMLRTHLGPVEDENSLHYLRPETAQGIFVDFKNVMTSSRSKPPFGIANTGKS
FT                   FRNEITPGNFIFRTREFEQMEMEFFVEPGTDEDWHQYWINARTQWYIDLGVNPENLRHY
FT                   EHPKEKLAHYSKRTVDIEYRFGFQGSDWGELEGVANRTDFDLGAHAKHSGEDLSYFNQA
FT                   TGEKYIPYVIEPAAGLSRSLMAFLVDAYDVDEAPNTKGGVDKRTVLRLDPRLAPVKAAV
FT                   LPLSKKPELQSVAQDLAQDLRLNDWMIDYDESGAIGRRYRRQDEIGTPLCITVDFDTLD
FT                   DQAVTIRERDTMQQERVALTQVADYVAKRINDKRTRVPLKPVSMGGAEWPETVHIAEAG
FT                   GLY"
FT   gene            126209..127903
FT                   /locus_tag="BIF_02010"
FT   CDS_pept        126209..127903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02010"
FT                   /product="Thiamin-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.7.1.49"
FT                   /note="Phosphomethylpyrimidine kinase;
FT                   Hydroxymethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84621"
FT                   /db_xref="GOA:D3R689"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D3R689"
FT                   /protein_id="ADC84621.1"
FT                   /translation="MGRDRSKPRSSTLCGTLRRRKSPPHRSIWPRICHGTACRHTTNES
FT                   GDTMNSFPYPSMRDRFDLRFYFVVGPDDCGNRPILDVVAKALDGGASFIQLRAKTQDVA
FT                   EIVSLANDIAEEIAGHHVEHSVAFVVDDRVDAALEARAKGIKVDGVHIGQDDLDPVVAR
FT                   KLLGPDAIIGLSAKTVDEVREANHLPEGTIDYIGAGPLHMTATKPESMIVDENGDITTL
FT                   NVSSIDEMRTMSKYPLIVGGGVKADDIPMLAKTKADGWFVVSAIAGATDPEQATRRLVD
FT                   DWTAIRGDEKPRYTGRKPAATKLPAVLTIATTDSSGGAGIPADLKTMLANDVFGECVVA
FT                   GITAQNTTGVQAIAAVDPSIVGAQIDSVFDDIRPTAVKIGVIVGVESVKTVARKLRDHQ
FT                   ATNIVVDPVMVATSGSSLAADDTIAEEISSLFPIATVITPNIPEAQVLAQMPIGNQADM
FT                   ETAAVQLAKDYGTCVLVKGGHGVKDADDVLAFPTGAVTWFEGERIANDNTHGTGCTLSS
FT                   AIASYLAQGEDLEDAVRDAKAYLSGALRANLNLGKGHGPMDHAWAMH"
FT   gene            127932..128360
FT                   /locus_tag="BIF_01863"
FT   CDS_pept        127932..128360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01863"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01863"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84622"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D3R690"
FT                   /protein_id="ADC84622.1"
FT                   /translation="MWLSDEQTCPVARLRQRRRHMNSPDRNAVRQEVPVDEHGKPIINT
FT                   VAAVAIAPSGVGAELSEYVAEAVEVIRESGLPNETNAMFTNIEGNLDDVLKAVRDATVK
FT                   LAEQGYRTGVTLKLDIRPGFSGQISEKQQLVDEILTKR"
FT   gene            128434..129492
FT                   /locus_tag="BIF_00490"
FT   CDS_pept        128434..129492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00490"
FT                   /product="Transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84623"
FT                   /db_xref="GOA:D3R691"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R691"
FT                   /protein_id="ADC84623.1"
FT                   /translation="MTTMKEIAQAAGVSVSSVSLVLNGRDSGRINPQLANRIRETAERM
FT                   GYQPNVLARSLRTNRTYMIGFISVEVATTPYAGGMIQGAQDALSSLGYMLLTVNGDTEQ
FT                   ALESEIRALKRYGVDGFLYSAMSNRVMTVPKSLAKFPLVLVDAAEETNRFPSIEPDEFR
FT                   IGYDATTRLIEAGCSRIAYVGCAEPMVAQTGRLAGYRQALMDHGRGFDERLQCDVLNNG
FT                   PALRAVEALFDTEQPNGFFCFNDARAWYVYETAARHGLAVGRDISVVGVDNHRVFAETL
FT                   EPQLTTIELPHYEMGYWAANKLVSMIENRPLNEGDWPHTTAVMPLLDTPSPVKVHCTLI
FT                   EKGSVRDTPTTA"
FT   gene            129554..129766
FT                   /locus_tag="BIF_01864"
FT   CDS_pept        129554..129766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01864"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01864"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84624"
FT                   /db_xref="UniProtKB/TrEMBL:D3R692"
FT                   /protein_id="ADC84624.1"
FT                   /translation="MVVLWRRSQSFDVNRFTLYSENIWNTTTDTDDANGAPLADPSRPA
FT                   PSCAQHGHTVHRPEQCAGAVIYNAA"
FT   gene            129733..131115
FT                   /locus_tag="BIF_00489"
FT   CDS_pept        129733..131115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00489"
FT                   /product="Raffinose permease"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84625"
FT                   /db_xref="GOA:D3R693"
FT                   /db_xref="InterPro:IPR000576"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R693"
FT                   /protein_id="ADC84625.1"
FT                   /translation="MRGSRHIQRSLGSDNEVHIMATTTKVWRNPSYLQSSTGIFLFFCS
FT                   WGIWWSFFQRWLNSMGLNGAEVGTIYSINSLATLILMFGYGLIQDNLGLKRRLVLVISA
FT                   IAALVGPFVQFVYAPLMRTNMMAAALVGSVVLSAGFMAGCSLIEAVTERYSRRFNFEYG
FT                   QSRAWGSFGYAIVALVAGFVFNINPMINFWLGSAFGVGMLIVYLTWYPAEQREALKEAA
FT                   DPNAAPTNPTIKDMLGVLKMPTLWVLIVFMLLTNTFYTVFDQQMFPTYYASLFPNEATG
FT                   NAVYGTLNSVQVFCESAMMGVVPIIMRKVGVRNALLLGSTVMFLRIGLCGIFHDPVSIS
FT                   IVKMFHAIEVPLFCLPAFRYFTLHFNPKLSATLYMVGFQIASQIGQVVFSTPLGMLHDR
FT                   MGDRTTFLTISAIVLAATVYGFFVIKRDDEQVDGDPFIRDSKKLPSLATDEAILSADSE
FT                   DM"
FT   gene            131366..132964
FT                   /locus_tag="BIF_01865"
FT   CDS_pept        131366..132964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01865"
FT                   /product="Sucrose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01865"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84626"
FT                   /db_xref="GOA:D3R694"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D3R694"
FT                   /protein_id="ADC84626.1"
FT                   /translation="MATLPTNIPANGILTPDPALDPVLTPISDHAEQLSLAEAGVSALE
FT                   TTRNDRWYPKFHIASNGGWINDPNGLCRYNGRWHVFYQLHPHGTQWGPMHWGHVSSDNM
FT                   VDWHREPIAFAPSLEQERHGVFSGSAVIGDDGKPWIFYTGHRWANGKDNTGGDWQVQML
FT                   AKPNDDELKTFTKEGMIIDCPTDEVDHHFRDPKVWKTGDTWYMTFGVSSKEHRGQMWLY
FT                   TSSDMVHWSFDRVLFEHPDPNVFMLECPDFFPIRDARGNEKWVIGFSAMGAKPNGFMNR
FT                   NVNNAGYMVGTWKPGESFKPETEFRLWDEGHNFYAPQSFNTEGRQIMYGWMSPFVAPIP
FT                   MEEDGWCGNLTLPREITLGDDGDLVTAPTIEMEGLRENTIGFDSLDLGTNQTSTILDDD
FT                   GGALEIEMRLDLNKTTAERAGLHVHATSDGHYTAIVFDAQIGGVVIDRQNVANGDKGYR
FT                   VAKLSDTELAADTLDLRVFIDRGCVEVYVDGGKHAMSSYSFPGDGARAVELVSESGTTH
FT                   IDTLTMHSLKSIGLE"
FT   gene            133167..133979
FT                   /locus_tag="BIF_02174"
FT   CDS_pept        133167..133979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02174"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02174"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84627"
FT                   /db_xref="GOA:D3R695"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R695"
FT                   /protein_id="ADC84627.1"
FT                   /translation="MAFHSSLRNHTDRPRRQAWRHWPTVVTVVALLLIWQVWVDAAHPP
FT                   VTMVSSPTQIVRSAIISWPTLWPATCMTFIEGVCGFAIACVLGVLLGIGIHCSRTAYAA
FT                   LFPLLTAAQTLPLISIAPLFLIWFGFEPVGKIVIVAVFAIFPIVVQTMRGLAAVPAFYD
FT                   DVAMTCGASRAWTLFHVDLRVAARQIFGGVRVSAAYVFATAATAEYLGARSGLGIWLQA
FT                   AYNSFQTPRIFAATFVIIIMTGLLLLAVHAVERLTIGAPADDDDPDAQ"
FT   gene            133976..135106
FT                   /locus_tag="BIF_00743"
FT   CDS_pept        133976..135106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00743"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00743"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84628"
FT                   /db_xref="GOA:D3R696"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:D3R696"
FT                   /protein_id="ADC84628.1"
FT                   /translation="MNPQICKSEHQFESDHMKSPRHIHRHLTRIIAMLAALPTIFAVTA
FT                   CGSTSSANGGDDGLTKVTFMLSWAPDTNHIGVYVAKNKGYYRQAGLDVNIVAVAQSGAE
FT                   QAVNNGVADFALSNLTNVSTYSTKGTELRQVMQIQQKTSAIWCALASNASITRPRDLDG
FT                   KTFATFGSSESDAVVRRMIQHDGGKGNFDKVTVGTSTFQTLESGRADFGGFYSTWEGVQ
FT                   AKLNGPKLNCFTEPEYGVPGNADSIGIITSDRLIAQNPDLVKRFVQATQRGYEYAYDHG
FT                   DEAADILVKEAPEANLDPEFVRESMKTIIDGQYWGDREQIISGKQTFGLADYQGTQAYF
FT                   DFLAQSDAYTDADGRVVHAAPQSKDLATDEFLKQAN"
FT   gene            135158..136393
FT                   /locus_tag="BIF_00171"
FT   CDS_pept        135158..136393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00171"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84629"
FT                   /db_xref="GOA:D3R697"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D3R697"
FT                   /protein_id="ADC84629.1"
FT                   /translation="MGMTNPQTDIHHIVASMDTGIDDALALALLLAQPNVRLHGVSASY
FT                   GNVLEQPAARNTRAVLSLLGRSDIPVFDGARHPSWAPYFIADAGCAQFHGSDGLGDVST
FT                   GDGDNADFTPTTPGETLASDANGLVTLTAPQIRNLTECGTAISVGGYQVGEKHADLPTM
FT                   PELTIPSGSAHTPTPEKLEFPQESCSQATAGARMIVDAARAFGPDLTILVTGPLTDIDT
FT                   ALTLDPEAVRQARIVFMGGTLTQEGNCYDLVCETNMIQDPEAADRVLRSGADVTMVGLD
FT                   VTHRCLLGSSDITPWNAAHTEASRFLTAIAEFSIRANAASEPIFAAGMPLHDPLAAAVA
FT                   LDATLVGTLDLPMCVETRSGDGTGVRGRTIGNPQGFIDASLCPTHVAVGVDRERFLARF
FT                   TGDIANLLTSLR"
FT   gene            complement(136399..136674)
FT                   /locus_tag="BIF_00374"
FT   CDS_pept        complement(136399..136674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00374"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84630"
FT                   /db_xref="UniProtKB/TrEMBL:D3R698"
FT                   /protein_id="ADC84630.1"
FT                   /translation="MICLAGSACPGQSKRLLFGLFAHTVGNEKYVNVQMTGGDSVEQIV
FT                   DAERERERLLLRSGVDRIVRFRVRETYDCARFIRKLLEAGVPLRKL"
FT   gene            complement(136779..137570)
FT                   /locus_tag="BIF_00373"
FT   CDS_pept        complement(136779..137570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00373"
FT                   /product="Omega-trans-poly-cis-decaprenyl diphosphate
FT                   synthase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84631"
FT                   /db_xref="GOA:D3R699"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R699"
FT                   /protein_id="ADC84631.1"
FT                   /translation="MAFDAVDYKSLSVPAAPFSDPTIIPDFPKNKVPRHVGVIMDGNGR
FT                   WAQQRGLIRTDGHQAAEPVVFDTIAGAIEAGVRYLSLYTFSTENWKRSPQEVRFLMGFS
FT                   RDIIHRRVAQMDEWGVRVRWSGRRPKLWKSVIDELEVAMERTKRNKVIDVVFCINYGGR
FT                   AEIADAAAAIAREVRDGRIKGDRVTEKMISEHLYNPDIPDCDLVIRTSGEQRTSNFLPW
FT                   EAAYAELDFVPELFPDCGRVVLWGSIDRYIHRDRRFGGVKK"
FT   gene            complement(137575..138294)
FT                   /locus_tag="BIF_00372"
FT   CDS_pept        complement(137575..138294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00372"
FT                   /product="RecO"
FT                   /note="DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84632"
FT                   /db_xref="GOA:D3R6A0"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A0"
FT                   /protein_id="ADC84632.1"
FT                   /translation="MALYRDEAVVLRTAKLGEADRIITLLTRDHGKVRAVAKGVRRTKS
FT                   RFGARLEPFMRVDLLLGEGRTFDSVRQAESISAYAGGITGDYATYTAASAMCETAADLL
FT                   PAEHEPAAAQYRLLIAALGALSRHLHDPQAIALSYILRAMSLAGWTIRLDSCVVCGSQD
FT                   VEFFSASAGGAMCPNDHTPDAVRVPVHVFDQLRALEQGDWPQLDMLQTPDPRCENIVRE
FT                   WAQYYLERPIRSLRLLD"
FT   gene            complement(138307..140025)
FT                   /locus_tag="BIF_00144"
FT   CDS_pept        complement(138307..140025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84633"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A1"
FT                   /protein_id="ADC84633.1"
FT                   /translation="MRGEQETDKSIGFSVSKAHEIPERQGFSRTRRLMITLPIFIILLG
FT                   VLVMASNYTRLPADNTPTGQTFATLSPNTEVTFDTREQLPKQGAYKVHEWHQAIDAKQP
FT                   STGDVQRININFREPEGAGDNLPAVMFFHGAGYGTCDNSFGDIATAMSSAGFVTAVIDK
FT                   PVWNTNDTTRDYEGSAVIYEQVINMMRGFRNVNPKGVGLYATSEGAWIASYVVQRDEQV
FT                   AFQVLLSPMVFSARHALAFLAVQDFALVGANEGYQSIVRRVFSLDLPALGLTNADLNTS
FT                   VPAAYRIPTLVAYGAKDVMTAQVQGFKDILEQAHKAGNYNVTLRSYPIANHVLRLGDEA
FT                   MENTPFADDYMRDTVSWVAGTSRGLTQTSEPVAGTPLYQSIAVPLELHSRPAMTWYGIV
FT                   VMGLNLIMMLVSAVLLVVTLIRAIMRRVRHQSHGMGMRKPFARALRFTAIMTAAAGLLF
FT                   LGGFAEVVIAVVQLAWGKAPDSSAGMMYWSWPVTQFACVLVLWAWASMIERIIEIWSQR
FT                   GLLQWPMNRDAWRALVHNDDPIIATSRFGRVFFWILTITLISMLLCFSFWGLFRF"
FT   gene            complement(140041..141243)
FT                   /locus_tag="BIF_00608"
FT   CDS_pept        complement(140041..141243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00608"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84634"
FT                   /db_xref="GOA:D3R6A2"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A2"
FT                   /protein_id="ADC84634.1"
FT                   /translation="MSEPTFRKTGEAAVSESPLHARRKSRRIMVGPVPVGGGAPISVQS
FT                   MTNTKTSDVGATLQQIAELTAAGCDIVRVAVPNQEDADALPKIVAKSPIPVIADIHFQS
FT                   KYVFEAIDAGCAAVRVNPGNIRKFDEVGPQICKAATDAGISLRIGVNAGSLDKELYAKY
FT                   GGPTPEALVASALKEARMFEDVGFHDFKISVKHHDPVTMVETYRLLASKGDWPLHLGVT
FT                   EAGPAWQGTIKSCVAFGALLAEGIGDTIRVSLSAPPVEEVKVGCKILEYLGLRPRKFDI
FT                   ISCPSCGRAQVDVIQLANAVTEGLKGITAPIRVAVMGCIVNGPGEAREADLGVASGNGK
FT                   GRIFIKGEVVETVPEDRIVETLLKYAHEIAATMGENEDGMGTGPVVMPLTGENLHRKPT
FT                   A"
FT   gene            complement(141364..142554)
FT                   /locus_tag="BIF_00605"
FT   CDS_pept        complement(141364..142554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00605"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /EC_number="1.1.1.267"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84635"
FT                   /db_xref="GOA:D3R6A3"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A3"
FT                   /protein_id="ADC84635.1"
FT                   /translation="MEAEHQRVIILGSTGSIGTQALDVINRHRDRFEVAGLAAGGSHVE
FT                   LLAEQAASFHVPLVVVSNPQAEEPLRQALDAKGAHATQIRSGQDEVVALAGAGASVVLN
FT                   GITGSIGLEPSIAALQADSQLALANKESVVAGGHLLFDAQTREHQINPVDSEHSAIWQS
FT                   LRAGTHAEVSKLIVTASGGPFRGWTREQMESVTPQQALNHPTWNMGPVVTINSSTLMNK
FT                   GLEVIEASRLFDVAADNIEVTVHPQSIVHSMVEFCDGATISQASPPDMRLPIALGLSAP
FT                   VRLDDVARGCDWTKASEWTFEPLDNDAFPAVNLARQCLKASEKHTTVLNAANEQAVHAF
FT                   LDGRLAYLDIVPSVAETIEQMDAQLSANPLFESVAEVEELEREARVRANEIIAAKG"
FT   gene            complement(142607..144250)
FT                   /locus_tag="BIF_00606"
FT   CDS_pept        complement(142607..144250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84636"
FT                   /db_xref="InterPro:IPR019932"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A4"
FT                   /protein_id="ADC84636.1"
FT                   /translation="MPRQPTAHSMEGTSMAQEQESSSTSTSIPRVGKHSRGYDPRQVDA
FT                   FVAQAHRLYDEGDPSLTLAGIQNASFAMVKGGYVPANVDAMLDRLKSALCDKQTLAEIS
FT                   ELGRVAWKAQMEESLRELQRHADRDHGARFASGQHKMLSYKRKQVDQLIDDIMDKAAYE
FT                   LSEVTTDGTHPAVGNDPYPNLNAKAIENAAFTVVKGPRGYDQRQVDYYLATCADLLGRL
FT                   ESYQRLNENGSIPASGTVERPASAAPVNGVKPLFANVPQTQGDEPENPATSPSIAADGS
FT                   NAPVQATMGQADSTQGSFDELHAQEEAIFNAGTAAPSPVIPPATISQMPAAPVAAAALP
FT                   FSEDSAPTETIAPVVEDHDTPSASTLGPGTHSASHASLSSIQPITPAPRTIPSYERAVA
FT                   AQTPSTPATQTPSDSNASDDKADNAETVAPTQMKPFVAEQPQTSETLSSLASMVHETSS
FT                   IPQSSSSLDEAKSIFDTLSVPKLTSVSIPDLPMPSSAHTSTESTDQSQNSVETNDDAVR
FT                   RYIRESQMNIDIPDLAFPDAPSGRDSAPRQ"
FT   gene            complement(144269..144418)
FT                   /locus_tag="BIF_02175"
FT   CDS_pept        complement(144269..144418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84637"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A5"
FT                   /protein_id="ADC84637.1"
FT                   /translation="MEESWQMRRLGCGMYANRLESSKTGGRDGGIRNRERNGSVSERIL
FT                   ELGL"
FT   gene            144443..144516
FT                   /locus_tag="BIF_tRNA01"
FT   tRNA            144443..144516
FT                   /locus_tag="BIF_tRNA01"
FT                   /product="tRNA-Val"
FT   gene            144578..145069
FT                   /locus_tag="BIF_01257"
FT   CDS_pept        144578..145069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01257"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84638"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A6"
FT                   /protein_id="ADC84638.1"
FT                   /translation="MTSIFESVSNQLSSLPHLIPSFVRKPNENDERIDDLENQIARLDR
FT                   ESKWCDVELDRRIKELTAEVDSLKRTQHHDRSLRTADRVLAIVFMSLAALILVPMFLTL
FT                   FHVIDPSGETIRWVVFALFAVAGGMGVAITIAHGKLPRTRDSLIVFVCAALLLLVACLL
FT                   "
FT   gene            complement(145192..145608)
FT                   /locus_tag="BIF_01256"
FT   CDS_pept        complement(145192..145608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01256"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01256"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84639"
FT                   /db_xref="InterPro:IPR021412"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A7"
FT                   /protein_id="ADC84639.1"
FT                   /translation="MNQTASDNAEEFGFRQGDLVQEWLWDDDVDDSIREKIEKLTNEDL
FT                   VDEEYDSAVDGAIIWWRDGDDEDELSDTIVDAYAVLGDDGPLWVLTPKPGREGAPSPST
FT                   VQNAAKTAGMNAATPLTVSDDWNGILLRAFGKGR"
FT   gene            complement(145714..146670)
FT                   /locus_tag="BIF_01255"
FT   CDS_pept        complement(145714..146670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01255"
FT                   /product="ATP-dependent endopeptidase Lon"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01255"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84640"
FT                   /db_xref="GOA:D3R6A8"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A8"
FT                   /protein_id="ADC84640.1"
FT                   /translation="MAAKTCPYYGGMSSLNPPESISQVDSDVPGTPGRGHGVFRRLRAR
FT                   WHNRPKRYFIGLFTFLLALCLMLAPSPYVVESPGPTENVLGKADGKEVISVSNATTYPD
FT                   RGELLLTTVNASGVPGYPISNIWALIGWLDPHMNVLPSEAVFPVGQSSEEYDQEAKADM
FT                   DSSMEAATAAGLAYAKRLGAKVSDADVSMHIEDIGGPSAGMMYALGLVDKLTPENETNG
FT                   VTVAGTGTIDKTGKVGAIGGIDLKMIGALQDGATWFLAPEENCDEVVGHVPNGLRDVKV
FT                   STLEEAYTALVKIGKGDADSLPHCTVRRAADHNMAGE"
FT   gene            146775..148433
FT                   /locus_tag="BIF_01254"
FT   CDS_pept        146775..148433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01254"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01254"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84641"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6A9"
FT                   /protein_id="ADC84641.1"
FT                   /translation="MSEDAIRQWLIECFGPVQGEQAFQQLSMLPDALREQLMSQDSSSL
FT                   PSPEQMKQMMQMFMGGNTPMGSMFGMGEPGNAAGTNPAGFHSANAGAPTDAAQSTAQSP
FT                   TADENAAIDVNIAKTIAGQYVNGEDSEQVVTAGEGETMRRAMSEANLWLDTATEFNPVD
FT                   GEASVLTRSSWLNGTIEQWAKFASPVASSMADAMNAVINERLGDQFGGEITGMFAGPIP
FT                   IPIPESMRDPKKLMKQLAKATFSMQLGNAAGALSHEVRGSFDQGLALLKNKAGGLIMQN
FT                   VEEYAKSLEIGVDEVTTFLALHEEAYARLFATVPWLMPRFEALLGKYARGIAIDLDAME
FT                   DELRDVEGLDPDSLSSALNLTNVGMGEDTPEQKDAMRSLETLLALVEGWVDCVLWRAGM
FT                   AHLPHIEQLREMMRRERAVGGPAERTFENLIGLQLRPKRMREAAQLWERITAEQGIEAR
FT                   DAMWSHPDLLPALEPEGNADGMDADSEADATEAKHGDDIDWDAELSKLLDESENGTGEG
FT                   ESTEDADDGDSGDQHGSGDSGDSASEDPDSGTLEQ"
FT   gene            complement(148519..150285)
FT                   /locus_tag="BIF_02176"
FT   CDS_pept        complement(148519..150285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02176"
FT                   /product="Probable DNA helicase II-like protein"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02176"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84642"
FT                   /db_xref="GOA:D3R6B0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B0"
FT                   /protein_id="ADC84642.1"
FT                   /translation="MPPTSDCFAHSQCNHGMHTVQNPMIATLYVRCERAVNRGHRRSST
FT                   HLLQLSPLPWHNGGMSETAQPNAGTDNGAPTIAHSEVEMGTTSPERILATLDDAQRSAA
FT                   LAVDGPVRIIAVAGAGKTRTITRRIAYACASGVWDPTRVLAVTFSVKAANEMRERLDAL
FT                   QVPRGVRASTFHSAALRQMREVWPDICEGPFPDVTEDKSALVAQALYRFNGIRPKEQPK
FT                   QSVYEVGAEIDWCKVSLITAKNYARVCAATHRTPPAGLEPGQFATVYEQYEAEKNSRFE
FT                   IDFNDILLLACHVLDAFPDVAKRIRRQIGWLTVDEYQDVSPLQHLLMTRWLGSNRNICV
FT                   VGDPAQTIYSFAGATSYYLEHFGKEFAPLTADIALNRDYRSVSPIVGYANRVLGGSAQR
FT                   QDYIRLESGRGTGSRVMSRIYETDAAEAQAVARQISRILAQGGNASDCAVLTRVGGQQT
FT                   LVAQALKQANIPYRLRRNMNWQSSALAGTARQETAETSNAGVEQLGVEKGRVTISTIHA
FT                   AKGLEYKHVFVIGLSEGLLPYKPQSDDGDVEEERRVLYVALTRAEDTLHLSFAKRSDSQ
FT                   TTYVRRLSRFLQ"
FT   gene            150300..151757
FT                   /locus_tag="BIF_00526"
FT   CDS_pept        150300..151757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84643"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B1"
FT                   /protein_id="ADC84643.1"
FT                   /translation="MPNVSVAGVRDSEQDNDTDRAVGIEQAVVQDMRGRLFNVYAAYDP
FT                   RGKKRLHARGRAAAVVDRSREFAGLGFGTEHVLAFHAGKEGPEDASVLITTHPDGVARS
FT                   LELLTIDDCSSFGTALGAIHRLRQNFITDAHYPVFTTGQIHAQLTAWIKRLRQAGHVPQ
FT                   EITSRWGGIMETEGLWSFSTRPVHGGFSDGDLIYSGSSITAITNWQDMQINDPARDLAW
FT                   VFAKLDETHRNAVITAYGRVLGNRLDDLIMLRANLWVQMEQVGDFIKALNAGDNDRIME
FT                   FKAQVDRLAHKLGVSARAAHTARPASDAAATSGNAPSTVTVNTLLREDSRTAAPASSAG
FT                   FPDDSTNETDVTGSRSYSQVMDDRTNSHPVAAVDDSTNDSPVLSSETVIIGINDSSSRG
FT                   TQIVREEDFHYADDDTIGDRTDSTASAVAASRSDAETTVIPLLEREERAMRDARAGLEG
FT                   TQGPDSGAGTQAVSTDGSSDDLDRTNG"
FT   gene            151875..152102
FT                   /locus_tag="BIF_01884"
FT   CDS_pept        151875..152102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01884"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01884"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84644"
FT                   /db_xref="InterPro:IPR021456"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B2"
FT                   /protein_id="ADC84644.1"
FT                   /translation="MDIEIGIQNVARTVTFTTDEAAETVTATIDRALEEHKPIVLTDNK
FT                   DRRIIVPADSLGYVIVGSEQRHAVGFGNLG"
FT   gene            complement(152177..153091)
FT                   /locus_tag="BIF_00858"
FT   CDS_pept        complement(152177..153091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00858"
FT                   /product="PHP domain containing protein (TRPH)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00858"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84645"
FT                   /db_xref="GOA:D3R6B3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B3"
FT                   /protein_id="ADC84645.1"
FT                   /translation="MAVTFVYDGTMSEYVMPTRPPQEGWDLHCHTVFSDGTRTPREMVQ
FT                   EAKSLGLHGVAIADHDTTAGWEEAGQASHDLHLPLMRGTEITAQDGNVSVHMLAYLYDP
FT                   RNRHICDLFEKTRRSRVERTKKMVALLAKDYPISWQSVLEQTKEGSRTTIGRPHIADAL
FT                   VAAGVYANRNEAFADAVSTHSKYYIPTPSPSTSEVVRAVEGAGGVSVIAHAADPSRNRV
FT                   LLSNEQIARLADEGLDGLEVWHRGNPEDQRARLLALAQRYHLLVTGGSDWHGAGKPNAL
FT                   GENLTDDATVAEIVRRGAIPLCR"
FT   gene            153141..153905
FT                   /locus_tag="BIF_00859"
FT   CDS_pept        153141..153905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00859"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00859"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84646"
FT                   /db_xref="GOA:D3R6B4"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B4"
FT                   /protein_id="ADC84646.1"
FT                   /translation="MCPAVQVAYGIVNARTYSPGGMNERPRRPEDHMERHPEQPSPPQS
FT                   STTFTDLKPHGWRNGATWTYLVMLLASGVALLVSFVLSAETLQMARHPGQSLGCDVNAV
FT                   LSCSTVAQAWQSEIVKFGELSFPNAFFGIAAESVFVTIAVIGMARMTMPKWFATCTWLG
FT                   SLAALAYSYWLTSQSLFVINALCPWCLVLMFATTIQFMAVSHATVTVQHLPPHASSLRT
FT                   YYRLNIDLMVDAVWIVALITLILVKDGAMLFR"
FT   gene            complement(153929..155002)
FT                   /locus_tag="BIF_00860"
FT   CDS_pept        complement(153929..155002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00860"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84647"
FT                   /db_xref="GOA:D3R6B5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B5"
FT                   /protein_id="ADC84647.1"
FT                   /translation="MPPSPESNTPTGALEVMGVSFLHAGDIASLQSTDLRVFPASLHVY
FT                   AHLSFGCGRVGGMSLPEHMIKAQGTGNDFVMYADRSGEHAPQKQDIIQLCDRHFGIGAD
FT                   GLIRITRPGHVADLDGHDAQKMRKEGVEWFMDYRNADGTLAEMCGNGTRATAQFLVQQG
FT                   MLELEEGDAFKLGTRAGVKRITRMPDNPELGRQLWRVDMGSWSMGAEDEYTVTIPGDTG
FT                   SGKGTFVDMGNPHVVTVVEDAYSTLPVLGELDLTRAPQVSPELPNGQNVEFARIDNLDT
FT                   ERDLGDASMRVYERGCGETMACGTGLCATAIVLRAKTQIDHWRIRIPGGIVRVDVTDDS
FT                   VMLTGAAALTAEFRLLQ"
FT   gene            154953..155729
FT                   /locus_tag="BIF_00547"
FT   CDS_pept        154953..155729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00547"
FT                   /product="Glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84648"
FT                   /db_xref="GOA:D3R6B6"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B6"
FT                   /protein_id="ADC84648.1"
FT                   /translation="MTSSAPVGVFDSGLGGISVVRQIRTDLPHERILYFGDSANAPYGT
FT                   KTPEQVRDLSFRIVEDFVEQGAKAVVIACNTATSSAVQELREHYDIPIIGMEPALKVAC
FT                   DRGHGERQSVIVAATPLTLRERKFAALMHRFEDAHTIHKQPCPRLVEIVERGELDDHDL
FT                   VMRTLHDYFDQYDLAHTDSVVLGCTHFVFYRDYFRELLPNNVAIVDGNEGTARHLEVVL
FT                   ESLGKLAPEEQDGGVILRNSDPGERIAELAQQLLER"
FT   gene            155779..156636
FT                   /locus_tag="BIF_00548"
FT   CDS_pept        155779..156636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00548"
FT                   /product="Phospholipase"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84649"
FT                   /db_xref="GOA:D3R6B7"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B7"
FT                   /protein_id="ADC84649.1"
FT                   /translation="MTHTAHTTGIIDVGGGFRAIFGAGVEDRCLEEDVGFDHCYGISAG
FT                   SANLASYLARQQGRAHTFYTQYAFRKEYASMENYITKRNFCDLDYVYGTLSNSDGENPL
FT                   DYAAFSDNPATFTVVAANGEDGSSRYFDKSDMRQDDYTILKASSAVPVACQPVVIDDVP
FT                   YFDGGIADPIPVQRAIDDGCDRIVVVLTRPVDVAREQQRDVAPARILKRHHPAAAERLL
FT                   NRYRTYNDEVALARRYEQEGKVLILSPESLYGLSTMSKTFEGLERMYRAGYAQAARIRE
FT                   FLDS"
FT   gene            complement(156689..157597)
FT                   /locus_tag="BIF_00217"
FT   CDS_pept        complement(156689..157597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00217"
FT                   /product="Membrane protease protein family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84650"
FT                   /db_xref="GOA:D3R6B8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B8"
FT                   /protein_id="ADC84650.1"
FT                   /translation="MSPSLIGIGVIALVVIVLLCMAIYVVPQQQAYIIERFGKFRSVRF
FT                   AGIHLLIPFVDRIAMKTNMRVSQLNVKLETKTLDNVFVTIVASTQYRVNPDNVAKAYYE
FT                   LRDPQGQLRSYMEDALRSAIPMLTLDDAFARKDSVAADVQQTVGSEMARFGFTVVKTLI
FT                   TAIDPSPAVKSAMDSINAAQREKEATRQHAEAMRIQIETQAAAEAEKVRLQGEGQANYR
FT                   REIADGIVDQIKSLQEVGMDIGAVNNVVLFNQYLDVLRSLSESKNAKTLVMPAATPGGY
FT                   SELFDQMTQAMLTTQESSPQN"
FT   gene            complement(157829..158737)
FT                   /locus_tag="BIF_00455"
FT   CDS_pept        complement(157829..158737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00455"
FT                   /product="Glutamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84651"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6B9"
FT                   /protein_id="ADC84651.1"
FT                   /translation="MSSLFKQLGKAVAAAGAAVMMITAVAACGPSASTPSEAGSASGNT
FT                   QNSTNAKARTLDEIKKSGELRVAVFSDKAPFGYVDKDGKYAGYDIEFAQALADGLGVKP
FT                   VYTSVDPAARVDVLASNKVDVTLANFTETPERAEKVDFSKPYMKVALGIVAPDAAPIKD
FT                   VKDLNGKTLIVAKGTTAETYFEKNHPEIKLQKYDQYADAYNALLDGRGDAMSTDNTEVL
FT                   AWAKANKGYRVDVTEIGDVDVIAAAVQKGNKELLDYINDEIVKLGKENFFHKDFEKTLK
FT                   PVYGDEVNPDDIVVESGVIEK"
FT   gene            complement(158786..159679)
FT                   /locus_tag="BIF_00619"
FT   CDS_pept        complement(158786..159679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00619"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84652"
FT                   /db_xref="GOA:D3R6C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C0"
FT                   /protein_id="ADC84652.1"
FT                   /translation="MTERTDSVATAPADVPALQVTDLLKHYADADRNVFDGISFSVPKG
FT                   KVLVIVGPSGSGKSTLLRAIAGLEPIQGGTIALDGQVIETGKPGNEKSGRAKRPESLRT
FT                   KFGMVFQSYELFPNKDVLGNITMAPMLVQKRKKAEVEREAMELLDRVHLADRAQAKPHE
FT                   LSGGQRQRVAICRALILHPEILLLDEITAALDPEMVHEVLEVVVELADAGQTMLIVTHE
FT                   MQFARAIADRVILLADGQIADRSTNAEQFFTDPQTERAKEFLHSFDFERHRSAQAHERL
FT                   EAFDEDGTGDGQSAHN"
FT   gene            complement(159672..160364)
FT                   /locus_tag="BIF_00617"
FT   CDS_pept        complement(159672..160364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00617"
FT                   /product="GlnP"
FT                   /note="Glutamine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84653"
FT                   /db_xref="GOA:D3R6C1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C1"
FT                   /protein_id="ADC84653.1"
FT                   /translation="MRGGSTMQGANILLEPGVFPRLLQGLWVTIWIAAVSVGLSIPLGL
FT                   LCGWLMTLRNPVIRFVMRVYLDFIRIMPQLALLFIAFYGIARMSNWNMDATASCVFVFV
FT                   LWGGAELGDLVRGALQSIPQIQYETSYMLGLSNWQAFVHVILPQAVRRLLPGAVNLSTR
FT                   IVKTTSLAVLLGVVEVIKVGQQIIDANRFQYPTGTLWVYGVIFLMYFIVCWPLSLVAHA
FT                   LEKRWAND"
FT   gene            complement(160333..161094)
FT                   /locus_tag="BIF_00616"
FT   CDS_pept        complement(160333..161094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00616"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84654"
FT                   /db_xref="GOA:D3R6C2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C2"
FT                   /protein_id="ADC84654.1"
FT                   /translation="MAWRTRNVTHTRLAWRTAQPQPTNTAQTAAKGGPYMFDWAFVAKY
FT                   APFFVNGAWMTLFISVFGIALAILTGIICAAIETARIPVLRQITTVYIEVSRNTPLLVQ
FT                   LYFLYFGLPKMGFVWSAELCAIVGLGFLGGSYMAESMRAGLQSVPQIQRENAYMLGFNT
FT                   WQTLTRVIVPQAVSISTPGIVANVIFLIKESSVVSAIALADVMYMAKDLMGMYYNTYEA
FT                   LFMLIVTYLIILLPISILGTWLERRFDYARR"
FT   gene            complement(161075..161170)
FT                   /locus_tag="BIF_02177"
FT   CDS_pept        complement(161075..161170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02177"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84655"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C3"
FT                   /protein_id="ADC84655.1"
FT                   /translation="MLLIVAFQFECRMAFVNLIMQSQYVSGVAHA"
FT   gene            complement(161161..162528)
FT                   /locus_tag="BIF_00727"
FT   CDS_pept        complement(161161..162528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00727"
FT                   /product="Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00727"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84656"
FT                   /db_xref="GOA:D3R6C4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C4"
FT                   /protein_id="ADC84656.1"
FT                   /translation="MLMEKSLAVQRIHNPHATLLGYARTVRHLPSMPCAVWADVPDGSG
FT                   RKGKRAEQGTRTRREGMAIHFAKVASQIPPNVFERMDRKVLAARGRGVDVIDLSKGNPD
FT                   GFPEEFIREVTRAAVDDPLNARYTPFDGKPAFLEAAANWYRNVHGVELDANRGLFAVEG
FT                   AVDGLADLFSILLDEGDAVAFADPYYPSYHCMANMRGAHEVLLPAKAELGWLPDLDAVP
FT                   ASVWDGVRLLVLNYPNNPTGAQAPLAFFEQAVKLAVEHDFVVVHDFAYAGLGVEEQQHS
FT                   LLEVVAHTPAGSPERECTVEICSLSKMYAMAGWRAGFIAGSERILDVAKNFHYQMGSMI
FT                   TSFVQDAGVAALNSDQTCVGRQAAHYAGRRAIVADGLRELGYDLFDSQGGLYVWMHAPA
FT                   GRSGEEVADDLLDKAGVAVLPGTCFGNVGAQYVRLSLLQPDERLAEAVKRIGTCCC"
FT   gene            complement(162578..163237)
FT                   /locus_tag="BIF_00728"
FT   CDS_pept        complement(162578..163237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00728"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00728"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84657"
FT                   /db_xref="GOA:D3R6C5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C5"
FT                   /protein_id="ADC84657.1"
FT                   /translation="MSETLEILQDNLGKALWDTFFMVGVATLVGVVLGTALAVLLYLTQ
FT                   HRLFTPNHAVNEMVGFVVNAIRSMPFLILLVVLIPLIQLLIGDPYTPTGGAIALSIAAV
FT                   PFFARVAESAFQEVDEGLLEAAISTGAPLRQIIFGAIFPQALPSYIRGIVLTIISLLGY
FT                   SAMVGTIGAGGIGDLAIQYGYNRYETGVLVAIVLLLIVLVQVIQWVGDRIAVRVTH"
FT   gene            complement(163234..164460)
FT                   /locus_tag="BIF_01221"
FT   CDS_pept        complement(163234..164460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01221"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01221"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84658"
FT                   /db_xref="GOA:D3R6C6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C6"
FT                   /protein_id="ADC84658.1"
FT                   /translation="MTETMHRRHEQRGNMGVQNTDSSTIIELNHISVTFREGGRTVEAV
FT                   KDVTMHVREGEIFGIVGFSGAGKSTLVRTINLLERPTEGQVIIDGHDVTDLKGGALREL
FT                   RKKIGFIFQGFNLIDNVTVGRNVEFALKAGGWPKKGRRARVEELLDIVGLAEKADSYPS
FT                   SLSGGQKQRVSIARALANSPRILLCDEATSALDLETTEEILTLLKRINTELGITIVFIT
FT                   HQFDVAKAIFDDVAVMEQGVIVEQGTTFDVFSSPHHPTTQALVERYLGIAIPEQLVPQL
FT                   PPGRLIELRYRDGGAFRPLISEVAQHHDVSINVLHGNVGYFGTQAVGTLIVLVSARQGG
FT                   QQGAQIVQDAIDELAEHVHSWRELSEDLNDDLGHSVDEAFAGEAAADRLIGTYGDVNDV
FT                   RTDNEEVLA"
FT   gene            complement(164470..165429)
FT                   /locus_tag="BIF_01222"
FT   CDS_pept        complement(164470..165429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01222"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01222"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84659"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C7"
FT                   /protein_id="ADC84659.1"
FT                   /translation="MPDAALPTLPGIRSHERKRRPMTIATAFTTLKSKRRTLTRAFAAV
FT                   LAAATLLGTAACGTAQNASAEGIAEPVDGKTTKVTIGVCAGPYGDMVEEVFAPLLKEKG
FT                   YEVSTKVFNDYVQPDKALASGKIDANLMQHGNYLKKFSADNDLDLISLGQTPTLGLGIY
FT                   SNKYHSIDEIADGATVAIANDGSNLARSLGVLQQNKLVTIKDGVDATKASVNDITSNPK
FT                   HLNIKPIDAAQLARSLDTVDVSLVPGNYSWAAGLDPKNALALEQQDDGVIEVFAIAGQN
FT                   KDTHFAKTVRDLLGSDEFRQAIAASKFKDFGKPASWAE"
FT   gene            complement(165481..166536)
FT                   /locus_tag="BIF_01223"
FT   CDS_pept        complement(165481..166536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01223"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01223"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84660"
FT                   /db_xref="GOA:D3R6C8"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C8"
FT                   /protein_id="ADC84660.1"
FT                   /translation="MHCRTGREQRKEGISVKYAILGAGGMGIQYGVLLQEFAHQQVDFV
FT                   DTWTENVEKIREQGGAYVSQDGEGRHLVPINVYYPEEYAGDPDVWIVFVKQHQLPEFLE
FT                   RTAPHFREHQVVFSAMNGYGHFEKLAEYFPKHRIYGGTALIGAYVYGPGDFNFTGGAHA
FT                   KAMNLCAYDEHDVEEDPIERQLFADFQAATLNPTIVRHFLGMCLAKIVFNSVLNTLCTM
FT                   YQIRFGEFASHPAAPILTERLVDEAYGAAEAAGVQLLGTRESEVETIMHTASIAHPLHY
FT                   PSMYQDLTRCRPTEVDYINGYIARLGREHGYACPLHEFVTQEVHLAEHAFAIHHPDIAA
FT                   KAASQSVELAD"
FT   gene            166834..167502
FT                   /locus_tag="BIF_01224"
FT   CDS_pept        166834..167502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01224"
FT                   /product="Arylalkylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01224"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84661"
FT                   /db_xref="GOA:D3R6C9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6C9"
FT                   /protein_id="ADC84661.1"
FT                   /translation="MFLMLVRHATLDDLDALAAVEAACFPPQEAADIDQLANRVESYPN
FT                   HFWLLVNPAEPDNDCFPAQVDDGMLVSFIDGPCVGSPDLTDDMYASTALHADDAPWQMI
FT                   LGVNTAPMYQHRGCASFLMRHVILDSALSHRHGIVLACKEKMLPFYSSFGFIDEGRSQS
FT                   VHGNAVWHQMRLPFTTSADARDDAPGADIRQATITMAMHETTAYMDHERTITSQFPQLV
FT                   "
FT   gene            167750..168322
FT                   /locus_tag="BIF_02011"
FT   CDS_pept        167750..168322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02011"
FT                   /product="DNA polymerase III, epsilon chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02011"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84662"
FT                   /db_xref="GOA:D3R6D0"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D0"
FT                   /protein_id="ADC84662.1"
FT                   /translation="MAMKPASRIPMNYISLDLETTGFSAQNDRITEIGAVKVRDGKIVD
FT                   RFTQLVNPGRRVSARITELTGISNEMLEDQPVIEDILGDFIHWTENDRLVGHNTKFDLS
FT                   FLIANAERVFSDSTRFSVRPIDTMHIDRLLFPSERHRLVDLIQRYGIGDVEEHRALSDA
FT                   TQTYQCLEWQRRYIDTRSADISMRTCV"
FT   gene            complement(168621..168738)
FT                   /locus_tag="BIF_5SrRNA01"
FT   rRNA            complement(168621..168738)
FT                   /locus_tag="BIF_5SrRNA01"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(168853..171909)
FT                   /locus_tag="BIF_23SrRNA02"
FT   rRNA            complement(168853..171909)
FT                   /locus_tag="BIF_23SrRNA02"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(172398..173629)
FT                   /locus_tag="BIF_16SrRNA03"
FT   rRNA            complement(172398..173629)
FT                   /locus_tag="BIF_16SrRNA03"
FT                   /product="16S ribosomal RNA"
FT   gene            174071..174517
FT                   /locus_tag="BIF_02063"
FT   CDS_pept        174071..174517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02063"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84663"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D1"
FT                   /protein_id="ADC84663.1"
FT                   /translation="MQADNGTGIIKDDQEPQRPRQPKRHQPWSSSTVHAIEFSNHHHTP
FT                   TTPTREPRQAVSGSKRKTYTTTPTHATPPPTTHPQTPTNTTPPPACRKPAKPQPPPPTT
FT                   PTKTQTNPQTHKGETTTGDNPHPTFSPDVKGDETHAPNDPNYAG"
FT   gene            174612..174911
FT                   /locus_tag="BIF_02178"
FT   CDS_pept        174612..174911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02178"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84664"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D2"
FT                   /protein_id="ADC84664.1"
FT                   /translation="MPTSRSSPPRSTPAPATAVSPTEEADPTAAITRIRTPQKSHRRCC
FT                   ASNARAELLTPRFVEETRGRVEERKGACDSDETLAAHPGRNTWGNTGGNARGTI"
FT   gene            175060..175134
FT                   /locus_tag="BIF_tRNA02"
FT   tRNA            175060..175134
FT                   /locus_tag="BIF_tRNA02"
FT                   /product="tRNA-Val"
FT   gene            175159..175231
FT                   /locus_tag="BIF_tRNA03"
FT   tRNA            175159..175231
FT                   /locus_tag="BIF_tRNA03"
FT                   /product="tRNA-Gly"
FT   gene            complement(175241..177289)
FT                   /locus_tag="BIF_00493"
FT   CDS_pept        complement(175241..177289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00493"
FT                   /product="Translation elongation and release factors
FT                   (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84665"
FT                   /db_xref="GOA:D3R6D3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035650"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D3"
FT                   /protein_id="ADC84665.1"
FT                   /translation="MRSRLHRARWRVRGGMTHIAHGKETSVKRIVTGIVAHVDAGKTTL
FT                   SEALLYATGTTRRLGRVDHGDAFLDTDAMERARGITIYTEPAVMRVGEAELTILDTPGH
FT                   VDFSAETERTLQALDYAILVVSAADGVQGHTLTLWRLLRRYHVPVFVFVNKMDAPGADR
FT                   ARILEQLHARCSDACIDFTGAADALSERQLDTLAMQSEAAMDEYLETGGIDVRTVRALI
FT                   ADGAAVPVYFGSALKMQGISEFVEGFAFFTREPHYTAEFGACVFKISHDRQGNRLSWIK
FT                   VTGGELTAKMMLPEAGGAEKVDQVRVYSGAKFTTVESVPAGTVCAVTGPAHTFPGEGLG
FT                   AARNAAQPVLRPVLTYTLLPGGNDMHACLQALRELEDEEPLLHVVWQERLQEAHVQLMG
FT                   AVQLEIIEQLMHDRFGLDIAFGPGSILYAETITAPGEGVGHFEPLRHYAEVHVLIEPLE
FT                   RGSGLEFATDVSEDELDRNWQRLIMQHLQETEHPGVLIGAPITDMRLTLIGGRGHLKHT
FT                   EGGDFRQATYRAVRQGLMEAREAGHAVLLEPWYRFRLELPQEMLGRALSDVQRMGGESA
FT                   APQIEDGLAVVEGAAPVSEMRDYAMDVNAYTHGEGRLALMFGGYRECHDEQTVVDGAGY
FT                   DPEADLEHTPDSVFCAHGAGYTVKWYKVPEFCHVPMRRGVGINRLEQ"
FT   gene            complement(177241..178866)
FT                   /locus_tag="BIF_00221"
FT   CDS_pept        complement(177241..178866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00221"
FT                   /product="Arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84666"
FT                   /db_xref="GOA:D3R6D4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004754"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D4"
FT                   /protein_id="ADC84666.1"
FT                   /translation="MRRAHNRPGGTNYLLRSDVGMHAHNRSGLTMADSGQHASNAPAMV
FT                   EGSGAAAAGPRSTVGFVGLFALVVSAMVGGGIFSLPQNMAQHASAGGQIVAWAITGVGM
FT                   WFIVNTFRVLTHVKPHMQDGLYSYARSGFGDFVGFLVAYGYWLCNCFSLVAYGVLIMST
FT                   LDIFMPGTFTNGNNVAATIGSSLILWLMLAVALLGTKTGALINVAGTVCKIIPVIVFVV
FT                   ALAAVFKTGVFLRGFWGLGAQGTPLGFDVHRIGAQVSDSMLVTLWLFIGMEGAVVVSGS
FT                   ARHPRDVSRATTAGYLTVLVLYILVSLLPLGVYSSGQVARMPNPSMSVIMEQCFGQGGS
FT                   IMVNAGVIISVVFAWLVWMIMISQMPLYAARDGIYPRSFLATNRFGAPSTGLVWTAVTC
FT                   QLLLILCHFVNGDAWDVMISITSVMAMPCYLLCCVYLWKIAVREPPAFPSAAARRRALA
FT                   TGVLGTLFSLFLVYSAGLRYLMMACALYAIGLPLLVVARRQRRPGVPLRQLFSHRGWVV
FT                   LSLIVVLGVCGLVYTVHGGVFGVA"
FT   gene            complement(178879..179538)
FT                   /locus_tag="BIF_01108"
FT   CDS_pept        complement(178879..179538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01108"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84667"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D5"
FT                   /protein_id="ADC84667.1"
FT                   /translation="MEAGYCYMECMPSENELTAALMRLCDGPDDHARLHMQARANHGHV
FT                   VTLDCDYDAEGLTATFIEQAADAPKSQRILTTMRADTPSASAARRIAYAYRDLIGTVGN
FT                   PPAVTVDLLEQRIVRIAPIVLPESQLGIAPPVRVAASAEDPCAFELHSADAHAAPNAAL
FT                   LRFHGTAANGFSCATIWRLEDGYASYAMVDYTAGPLNDILVDVLCTLRFYAVRGWV"
FT   gene            complement(179653..179907)
FT                   /locus_tag="BIF_01107"
FT   CDS_pept        complement(179653..179907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01107"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84668"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D6"
FT                   /protein_id="ADC84668.1"
FT                   /translation="MGYRLLTRKVVVMADEKKPHETLKERFDDFKADVDVHKAEHQEKD
FT                   AIKDVERAAKHDAKSDVDLDKAAANVDKAIEREAEAKEG"
FT   gene            180172..181842
FT                   /locus_tag="BIF_01105"
FT   CDS_pept        180172..181842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01105"
FT                   /product="OppA"
FT                   /note="Oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01105"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84669"
FT                   /db_xref="GOA:D3R6D7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D7"
FT                   /protein_id="ADC84669.1"
FT                   /translation="MFHPRFSHPSAHVTAAVASIAALGMLLAGCGTSGGTGSPSAQGSS
FT                   STATTSVITVNNVEPSANLLPGNTNDMASWKVVTQLFEGLVTFSDDGELIYAEAESITP
FT                   NSDASQYTITLRDGLRFSDGQKITAQTYAKAWSFAANAANGQLGAAIFSTIQGYDALQD
FT                   TNGGNDAQLSGLKVVDDHTLQVTLNAPDSSFPYKVGDVAFLPIPESAYADANAFGEHPI
FT                   GNGPYMLKQWNHDSSIQLVPNPKYTGPRTPKNGGVTFELYTDVQTAYADVESGNLDVID
FT                   TIPTSALATYQHENGIQAFNKPGPAFRSFTIPQKLKHFSGEEGRLRRAAISHAVNRANI
FT                   IEKVMYGTATVATDFTAPTIAGYSKSLKGADVLDYNTETARKLWSQADAISPWSGTFRL
FT                   AYSADSGDKQRVEGITNSIKNALGIDAQPYIIPTQKELSSAIHDRTINAAFLQGLQSDY
FT                   PYPEGYLMQAYDSSAADGKGLNNGDYKSTAFDKLIDDAARQTNVDDAISYYHQAEEVLF
FT                   KDLPVIPLWYANVTAAAGEHVQHVGFNYMGVPKYNEITK"
FT   gene            181849..183306
FT                   /locus_tag="BIF_01104"
FT   CDS_pept        181849..183306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01104"
FT                   /product="LmrB"
FT                   /note="Lincomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01104"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84670"
FT                   /db_xref="GOA:D3R6D8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D8"
FT                   /protein_id="ADC84670.1"
FT                   /translation="MGAIANDEMITAKDGQQHSWKSVKLLIATLIVSTLGDGFCGVMMA
FT                   VALPNISETYHVSIATANWVTVGYAIVAATAVMTAATVLARIGLKKLFFWSRVLLIVSS
FT                   LIGLFSLNFPMMLTSRLIQAVGSGLMFPTINTVIIRVVPAKISGRVVSLNSAIIGLGIA
FT                   VAPLLSGVFLTYVSLTSMYVVPLAVGIISILMGAKFMFDVEPRKQHPIDVLSIVLSFVG
FT                   LAALMMGFSELTHRPLFAVPMLIAGVAVLVWFAVRQFHLDVPLLDLHPMKHLYVSLGVL
FT                   MYMAGAMGQQAVLLLLPLYLERACDYTPFVAGCFLLIMTLFYSGSVIVGGKTVDRSGMW
FT                   PVVSSGFLLMVIGLFATFFAAPTKIAWLVVLIGSVVVVGDALINVPDKDVVLEALPDNT
FT                   VPDTSAIFSTGNQIAGSIGSALFVGVLSADVLRQTAEGVNRHAAYANGFQHSILIAAIF
FT                   EVAMLLVSVWYSREMVRHGRAKINQTA"
FT   gene            complement(183413..184111)
FT                   /locus_tag="BIF_00549"
FT   CDS_pept        complement(183413..184111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00549"
FT                   /product="Phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84671"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6D9"
FT                   /protein_id="ADC84671.1"
FT                   /translation="MAILKRFGDIMRANINALLDKAEDPAKMVDQMLLDLNEDLASVKK
FT                   ETASVMAAATNARQQVNDCKADIAKYEAAAKAAVKAGNDDDARKLLATKQQYESTLTSL
FT                   ETAATVAEDNAAKMRQMHDKLVNDINSLQARRAAVHAKVSVANAQQHVNEATEKTAKAS
FT                   RGTAAFERMEEKADRMLNEANATAELNTQASNEDIANKYLAGGSASVDDELARLKAEVG
FT                   VEEQQEAASD"
FT   gene            complement(184114..185415)
FT                   /locus_tag="BIF_00550"
FT   CDS_pept        complement(184114..185415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84672"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E0"
FT                   /protein_id="ADC84672.1"
FT                   /translation="MPRAGAGSGSGRSSSGHDGGSRMSSGHRPSMPGSGRRAGGGGSAG
FT                   FPQSSGSTGSGGFDVGDLFRAAGIGMAGGYNAGRRSTRNRYGRRSMPFPEEIFDAMGQQ
FT                   PNYGRQQTPGPYSAGPFGTGAPGAGQGPFSPAGGPPVAPPTMQTPFGGNNNGGKKPNGG
FT                   LTGLMPLIGILAALVIFLLIFMMPSCSNNEPNRNDYNVTVPESTYNRTKLDSGLPYDSN
FT                   CIDDQLGWFENRTSAAKRLKVFYDKTGIQPYILFAKYNPQLKTDDEKQAWAREWYDDHI
FT                   DNEDTLLFVYFAEQDVDNDVGYMTLVNGKHVSSIMDAQATEIFWTYLDEYWYSDRSTDD
FT                   AIVATFDSTADRIMTKTTTKNDVHKWVIIAVIVIGMLAIGAVITWMLIKRKREHEQYVE
FT                   RMVTTPLEEARDPILEKYDQADHNDQVGQEQKGQ"
FT   gene            complement(185449..185628)
FT                   /locus_tag="BIF_01999"
FT   CDS_pept        complement(185449..185628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01999"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01999"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84673"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E1"
FT                   /protein_id="ADC84673.1"
FT                   /translation="MRGGGSVFALAIAVAIVVRRRAKTPAWSACTLSMYRATMFIVRNK
FT                   TMRQPGSLPAHRLY"
FT   gene            complement(185978..189301)
FT                   /locus_tag="BIF_01997"
FT   CDS_pept        complement(185978..189301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01997"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01997"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84674"
FT                   /db_xref="GOA:D3R6E2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E2"
FT                   /protein_id="ADC84674.1"
FT                   /translation="MVSETPQHVYPKASVGEQSANVAPNPDFPQLEQDVLRYWDTNGTF
FT                   QKSIDENPSGEHSSNEFVFFDGPPFANGLPHYGHLLTGYAKDVVPRYQTMKGRRVNRVF
FT                   GWDTHGLPAELEAQKELGIDSVDQIEQMGIDKFNDACRASVLKYVNEWRDYVHRQARWV
FT                   DFEHGYKTLDIPYMESVMWAFKTLYEKGLAYKGYRVLPYCPKDQTPLSAHELRMDADVY
FT                   QDRQDTTVSVAVKLRDEDDAYAVFWTTTPWTVPTNFAIVVGADIDYVEVRPKEGKFAGK
FT                   KFYFAKALLGSYNKELGEDYEVVRELKGSDMVGWRYYPVFPYFAGEQATAEGGTPGPNA
FT                   YQILTADYVDTTEGTGLVHQAPYGEDDMNTLNAHGIASVDVLDSGCRFTSLCPDYEGMF
FT                   VFDANLPILRNLRAGDGPLAERPESERALLFQEKSYVHSYPHCWRCGTPLIYKPVSSWF
FT                   VSVTKIKPRLLELNQQINWIPENVKDGQFGKWLANARDWSISRNRFWGSPIPVWVSDDP
FT                   KYPRVDVYGSLDELKRDFGDYPRDKDGNINMHRPWIDNLTRPNPDDPTGKSTMHRITDV
FT                   LDCWFESGSMPFAQYHYPFENKEYFEHHFPSDFIVEYIGQTRGWFYLLHVMATALFDKP
FT                   AFKNVICHGIVLGDDGQKMSKHLRNYPDVNGVFDKYGSDAMRWFLMSSPILRGGNLIVT
FT                   EDGIRDTVRQIMLPVWSSYYFFTLYANAANHGDGYDARTLRADEVPGLPQMDRYLLART
FT                   RKLIANVTEHMDNFEISDACDEVADFIDMLTNWYIRNTRDRFWNEDENAFNTLYTVLEA
FT                   FMRVLAPLAPMEAEAVWRGLTGGDSVHLGDWPYLTDPQTGVDTALGKVLVEDGALVEAM
FT                   DKVREIVSSTLSLRKAHKMRVRQPLAKLTVVVDDPSQVDGYDALLKSELNIKAIDYSTL
FT                   DEAAEHGLKIIDELKVNARAAGPRLGKQVQFAIKASKSGDWHADPVTGDPVIETPNGEI
FT                   TLQGDEYDITRRVEEADATARRDSASSILPSGGFVILDLELTGDLIAEGYARDVVRAVQ
FT                   DARKEAGLEVSDRIALTLTVPSGDLPKVEQFRDLICSETLSTSMQVEQGDALGVHVAKA
FT                   "
FT   gene            complement(189295..189624)
FT                   /locus_tag="BIF_00283"
FT   CDS_pept        complement(189295..189624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84675"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E3"
FT                   /protein_id="ADC84675.1"
FT                   /translation="MSRTEGVPGWVIRVSGSHSFPRCWYSGARNQAVIRHQRGAFGRTA
FT                   GRGAARPSRTDGVGPYSRTQAVTRACTPAWQARWYRGGAGVGKQSARSHRPRRKRQILQ
FT                   DEEQW"
FT   gene            complement(189631..189840)
FT                   /locus_tag="BIF_00282"
FT   CDS_pept        complement(189631..189840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84676"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E4"
FT                   /protein_id="ADC84676.1"
FT                   /translation="MQPPTSTRSPNRTRKTCCSSPRTPGSTWKSPSDRWHIVPRTPDQP
FT                   SFVFPCNGPPIEPPHSPGHTTPHA"
FT   gene            complement(189743..189910)
FT                   /locus_tag="BIF_01996"
FT   CDS_pept        complement(189743..189910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01996"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01996"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84677"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E5"
FT                   /protein_id="ADC84677.1"
FT                   /translation="MVSETDKPQADPATGEPEVDAEGCATAHKHKVAEQNEKDLLFESA
FT                   DTWQHMEVPE"
FT   gene            complement(190093..190863)
FT                   /locus_tag="BIF_00228"
FT   CDS_pept        complement(190093..190863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00228"
FT                   /product="Protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84678"
FT                   /db_xref="GOA:D3R6E6"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E6"
FT                   /protein_id="ADC84678.1"
FT                   /translation="MRVVSRKLPLPTVENCRDLGGIHTEQGRMVRPGLLVRSANLHDAR
FT                   HDDLETLAHRGISNVIDLRTDPERDLKPDRLLEDWSFYALPTFRETKALRLQLRDIVTR
FT                   PGTFIEDLYPRLVLDDAAVACWKRMFRLLIDEPGGYLFHCTQGKDRTGIAAALILAALE
FT                   VPEDVIRDDYLQTNLYMSTEMPAFVDTFEALLGPKAHADIDEFLVASPLYFQTYIDATA
FT                   SFGGPVGYLRTAIGLSEADLRALRDFYLTDDASN"
FT   gene            complement(190891..191481)
FT                   /locus_tag="BIF_00227"
FT   CDS_pept        complement(190891..191481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84679"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E7"
FT                   /protein_id="ADC84679.1"
FT                   /translation="MRKRATRRKSPSTKRPTRPTDPPNRPRMRPSRGVHAGRIDTGVRT
FT                   KPLATHRQGASLYAGPARMFPTGQSPPGAPFVRGYSGGIGSGATRTRAALEIGAIMAEQ
FT                   QNIPDTNTHEGLGAVSADQVKQMEQIVSDTDHPYTDPITGKPNEDIPENEVGVSDASKE
FT                   AKQDAAQREELAIDRPEETDNENQWEDPYLEDK"
FT   gene            complement(191420..191632)
FT                   /locus_tag="BIF_01995"
FT   CDS_pept        complement(191420..191632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01995"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84680"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E8"
FT                   /protein_id="ADC84680.1"
FT                   /translation="MVDMSDKMKENFEEIKARIDEHKDDFEDIKKSVGDLTDKLKDVKE
FT                   GWETSRAEKGDKKEVAEHEETHQTH"
FT   gene            complement(191791..193869)
FT                   /locus_tag="BIF_00037"
FT   CDS_pept        complement(191791..193869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00037"
FT                   /product="Multidrug/protein/lipid ABC transporter family,
FT                   ATP-binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84681"
FT                   /db_xref="GOA:D3R6E9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6E9"
FT                   /protein_id="ADC84681.1"
FT                   /translation="MSAAAATVAQTSATDKETLNDDARMPEANGAQGMPREKAKKGTLK
FT                   RLLKYVFTYKVRMVVIIIAIIVSAVAQAGSALFLQALIDRYIMPLVGESVPDWAPLIQA
FT                   LIFMGILYALGTFSAWLYSYLLVGVEQGVMKEIRDEMFEHMQTLPISYFDTHEHGDVMS
FT                   RYTNDTDTLRQAISQSLPQMFASGVSALAALIAMLYLSIPYTVFVLVFTGLLLLLIRVI
FT                   VSRSGRYFVVQQQELGDVNAFVEESVNGQKVIKVFNHEDATQASFDDRNERLYHASASA
FT                   NTYGNVLMPVVGNMGYLLYVLSAIFGGLAALGNWGNLSFSGAAFTIGTIISLLTLSRSF
FT                   VNPIGQVSQQMTMVMMALAGASRIFALMDEPSEQDNGTVTLVNVELASDGRTMTETPKK
FT                   TGHWAWKREASDDGTRSREAAKRLSKRAAEVAEEAHEEAVTSADGRLTLLRGDVRFTDV
FT                   TFGYNPDKPVLHDITWFAKPGQKIALVGATGAGKTTITNLINRFYDIQEGMILYDGINV
FT                   KGIRKPDLRRSLGIVLQDVNLFTGTVMDNIRYGKLDATDDECIAAAKLVNADSFIRMLP
FT                   DGYQTVLSGDGSGLSQGQRQLISIARAAVADPPALILDEATSSIDTRTEEVVQAGMDNL
FT                   MKGRTVFVIAHRLSTVRNSDVIMVLDHGRIIERGSHDELMEEKGEYYQLYTGSLELE"
FT   gene            complement(193866..195839)
FT                   /locus_tag="BIF_01533"
FT   CDS_pept        complement(193866..195839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01533"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01533"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84682"
FT                   /db_xref="GOA:D3R6F0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F0"
FT                   /protein_id="ADC84682.1"
FT                   /translation="MSTTTATDTTPSKAHVIRTLAKSLREYRTASLLSPLFVIVEAVIE
FT                   IAIPTVIAILIDKGISGKSMPDIWKYGGILIACAVVSLCAGFLSGRFAAIGSSGFAKNL
FT                   RHDEFEKVQQFSFANIDRFSTGSIITRLTTDVTNVQNAYQMLIRVGMRAPIMLIVAWIF
FT                   AFRISPQISMVFLACIPVLAVGLFGLIIVVHPIFERVFHTYDELNNVVDENLQGVRVVK
FT                   SFNREDFEGKKFGRISLKIYEQFCKAEKLLSINSPLFNLCMYASLIAIAWVGARQIVAS
FT                   GNNAALGLTTGDLTALVTYAMQIMMAMMMLSMIFVMVIISRASAERICGVLTEESTIRE
FT                   ADEPITTVADGSIDFDHVSFRYSEHSERPVLDDIDLHIRSGQTIGIVGGTGSAKTSLVQ
FT                   LIPRLYDVSSGALKVGGVDVRDYELEALRDEVAMVLQKNVLFAGTIAENLRWGNPYATD
FT                   EEIRHACELAQADGFIQEFPDKYNTYIEQGGTNVSGGQRQRLCIARALLKKPKILILDD
FT                   STSAVDTKTDKLIREAFHHEIPNTTKIIIAQRVASVEESDKIVVMHEGRILDQGTNAEL
FT                   LERCEEYRSIYESQTQQHSQQDLDKESQDLHEEEAEASGFATDYNEDMRTSDVIARQKE
FT                   REREQQAHMAQDIEAIKGGEQR"
FT   gene            complement(195836..196441)
FT                   /locus_tag="BIF_02179"
FT   CDS_pept        complement(195836..196441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02179"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02179"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84683"
FT                   /db_xref="GOA:D3R6F1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F1"
FT                   /protein_id="ADC84683.1"
FT                   /translation="MWHRNIPASKYHGKRRARMDRVQGVNSPGMLRPSLEIKALHNLIG
FT                   RYWNGIVPPDSMMSGANMPIVQYLHEHRDSDVFQYDIERAFSITRSTASRVLGLMEKKG
FT                   LITRSAVDWDARVRKIELTPTASDLVVEIMRAAHQLETTLFTGFTPDEQERFMDDLARM
FT                   RANLVETGLVGSERTAVEPATRTRQDATHQQQKGDEAA"
FT   gene            complement(196505..196603)
FT                   /locus_tag="BIF_02180"
FT   CDS_pept        complement(196505..196603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84684"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F2"
FT                   /protein_id="ADC84684.1"
FT                   /translation="MCAIRDLRAVGRGSLAYVEAVTRDCCTGSLSA"
FT   gene            complement(196645..197211)
FT                   /locus_tag="BIF_01535"
FT   CDS_pept        complement(196645..197211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01535"
FT                   /product="Oxidoreductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01535"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84685"
FT                   /db_xref="GOA:D3R6F3"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F3"
FT                   /protein_id="ADC84685.1"
FT                   /translation="MADKPTIAFVETSLTDGSFEADLAKEIMGIVGDRAEAITIDYEDL
FT                   PLAGEDPEYPLPEAALAVRDKLGNADAVWVVVSEYKKEIPDSLRNLFDWLSLPSTKDEE
FT                   GKNVLDQKPVAISGVGGFEELHPRIMVGDLLEDAGMRLFPVEVGLSVPDEAVETGDWAM
FT                   TGADQEALRTQADDFLTFVSENEVK"
FT   gene            197325..197837
FT                   /locus_tag="BIF_01536"
FT   CDS_pept        197325..197837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01536"
FT                   /product="patch repair protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="DNA mismatch endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01536"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84686"
FT                   /db_xref="GOA:D3R6F4"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F4"
FT                   /protein_id="ADC84686.1"
FT                   /translation="MNKARKGAQWYARTIHCPGDTGGVAQSPSHPESPYARGTRSYTMS
FT                   RIRGKDTSIEKTVRSYLFARGFRFRKNDKRYPGHPDIVLPKYRTIVFVNGCFWHMHEGC
FT                   ESFHMPKSNVEFWAAKLTRNRDRDRRQHEQLRQMGWRVIDVWECELRGDAREARLERLV
FT                   GQIAEGV"
FT   gene            complement(198781..198978)
FT                   /locus_tag="BIF_01993"
FT   CDS_pept        complement(198781..198978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01993"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01993"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84687"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F5"
FT                   /protein_id="ADC84687.1"
FT                   /translation="MRFMQEHIRYMAALHLSGMEGKGKIARIARGLRGTHHFNIGFLHR
FT                   HDSIIPHTSCHRNAFIMVDQ"
FT   gene            complement(198981..199250)
FT                   /locus_tag="BIF_01992"
FT   CDS_pept        complement(198981..199250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01992"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01992"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84688"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F6"
FT                   /protein_id="ADC84688.1"
FT                   /translation="MDGTQLRYCAIWDRKIIHQLQCLAVTSECSISANSRCVCAPERLR
FT                   NKSVPGTRYGSNTGSLIGMYYLSFRPYRAHTRRPNVAASISPFA"
FT   gene            complement(199383..199691)
FT                   /locus_tag="BIF_01991"
FT   CDS_pept        complement(199383..199691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01991"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01991"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84689"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F7"
FT                   /protein_id="ADC84689.1"
FT                   /translation="MHTTLDLSQYNDVTAYADAVHRPVVHVDYLPTPQAVARRVREAVD
FT                   DRHLSMEQLAKDAHVSIQAAYSLRDSGLASLSEARRVFAVLDIHVHAYPVEMVPLSL"
FT   gene            complement(199750..200796)
FT                   /locus_tag="BIF_01990"
FT   CDS_pept        complement(199750..200796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84690"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F8"
FT                   /protein_id="ADC84690.1"
FT                   /translation="MSVLRIPADYDDAFSHMLGFGLASILEDAVEDRICRLWWSGRHTL
FT                   MVETNDEITEMECAHIVRAHAERWHKSQWLNARGSYAGKGKTVATLSPRIGTVAGREEW
FT                   VALERDRRDAIDSLRTTLDERYIGALGEPSYWSLNRTKATPEIQQKFGASLWEMTPRNR
FT                   GNEFVTMRLLKLASIITARTAEKVHSGLFGLTNVDELAGTEDSHTPTGLKVPSRTDNAR
FT                   AWCALFGFSNCPVYRSVHYETSPTAGFIRHDSGGGPSWHVVLPLTEKSWTLAKYRSVIR
FT                   SYALDYVGENALHLDQDSLSDSTVALYAELCRWLRDQGLRYCMLFQRHGTQAKSPEYWL
FT                   LRGQLIRL"
FT   gene            complement(200800..203892)
FT                   /locus_tag="BIF_01989"
FT   CDS_pept        complement(200800..203892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01989"
FT                   /product="ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01989"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84691"
FT                   /db_xref="GOA:D3R6F9"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6F9"
FT                   /protein_id="ADC84691.1"
FT                   /translation="MSRKLFHNERATEMEMNATTPNEMLVELYDLFVESLHQGRKPYLW
FT                   QTRLMREVVNNGQWMKLISAPTGSGKTAVIDVHLFVNALAGLAALDDIPLPKELNHLLK
FT                   SLSLDAVPRRMAVTVNRRGIVDDQYLEASAACARINDVASLDDDTESEILKLIAVGLYA
FT                   RQYSELMDRQWTFDQLAFQCQEQGKVVCSAQRLRGGLDDKADMRVWRYKPLECQILCGT
FT                   PDMIGSRLLFSGYGVSDAAKPIEAALLAYDAVIVVDEAQLSRQFAYTAQQIPRIEACIR
FT                   QGEPLPVSPLQVVVTTATPSGENISNLQDEQSICGVEEADFKIDLELRRRLRTPRPIQV
FT                   LSVDDKQIATCMAKESIALQERLGGVVVCFVNTVPRASEVVRRLREALGKDAGDNAVRA
FT                   FVGPMRDYERDQFVQRLDSTEPLYDAIRGDQSAITQTGLKFVVATQTLEAGIDADFSGM
FT                   ISELAPAASLVQRAGRVNRRGLRPEGPVVICCQNSGKIRGPYMKEDLTAAQMWLESLPV
FT                   EGLTAWSSVLQPPAPAQLERMVLQRLEWWDVENLSHTSEDVFAEHRAAGRPYPADVDLW
FT                   LRDDLADRVTPDVAVVIRTLPQDDYLAQRLLATTPPDSRELFPVTSYAMLDALQNKLKG
FT                   RRAFIMRTNSSENGNAVHLLDGQADSDPTLRSGDVLIVDDGARVFSEGIPMLDPFSKDD
FT                   KHSKKLQDEITSPGDVFNKCQQSMAVLHANREKQPALYEELSEVLRAETDTDETVEAEY
FT                   QGIDVSKYPNLQEALNSCAINNHGFRIAFVDGFIDGDSSDSSVFIVLQSSDAADGDQLQ
FT                   EIGRFNRQGPVLLDGPGSHQESVGSRAELFAAKLGFDSRLVADIRTAGLHHDDGKKDPR
FT                   FQTLLRYRMPNVPAEPLAKSMYRSSSWERAKRIELRLDGWRHEQRSAAECWALDSESLQ
FT                   AHDKELVTRLAGTSHGHGRSMFPMNAQQVIPDAIIQTVSEENGDGSQTIHAIRSAAEEL
FT                   FDAGYWQSIMERTNERYGLWGIAFLETLLRAADVTISMEGR"
FT   gene            complement(203844..205481)
FT                   /locus_tag="BIF_01988"
FT   CDS_pept        complement(203844..205481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01988"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01988"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84692"
FT                   /db_xref="InterPro:IPR019089"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G0"
FT                   /protein_id="ADC84692.1"
FT                   /translation="MTFAIRIHFLLASYQGASEYGEKESFPTPMRLYQAMVSAAHTVFS
FT                   SENSQGMLDKRLNAALEWLESNPPEAIRFPEIVSQSPTSHNAIAYRRKADKAPKAERAR
FT                   SAVMYRTDEQGDMILEWKNGPDDEECSTIADLCWEIPFLGGAGSPVRITVEEGFDFPLP
FT                   DSYMLRPESQSLMEVERARELPCPAPGLHQELMEHYTQANPHPASKIPKDSSTKKDTEV
FT                   RSEKRLQCVHRSTYSPQKQAKSAVQLPWTRMIIIPARVESNASAWNPRDDELTAWCVAL
FT                   HRLLVRRWGTDVSPYLTGRWSTDSMVKRPANNIAIQVLRKDYASLIADQRIAESLPAFI
FT                   LMIPSEMDAGELRKLGTLVRSLANSRIYYSHSKPALRLGNPIPGEGVHLWSKPRDGMHR
FT                   IWSPMPFSVNETQAEKSPAGQSRSWTAECNLAVSIGHVFRNVFRGQIAEKRGRGKYWDL
FT                   IDAVTAGDSFVRILAARTVARPDMGDYVHRMREGFMITASTGLIAFENVIKDEILAIGQ
FT                   SRHFGGGLLIPMDCPESCFTTKGQPKWR"
FT   gene            complement(205500..206807)
FT                   /locus_tag="BIF_01987"
FT   CDS_pept        complement(205500..206807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01987"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01987"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84693"
FT                   /db_xref="InterPro:IPR013403"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G1"
FT                   /protein_id="ADC84693.1"
FT                   /translation="MWPRSFFVCMLIWCCLTMMVRCVSSESISLKHVEKRAMMRKLTVQ
FT                   DLNEAAKIGGSNALTEVTSLAPAAGMGSIVAPAKYTAGNGSTYVYEKRWVNDECVDTVL
FT                   IDSRTSQANRLEDYISRAIEVGHPIFSKMPQVRVRYEMIPGDESSVRYFDDVQLPHRAV
FT                   DAHIRIAEFSESDKVKYMAARNSSLEDLSAMLAISPVTVMFGCWDSTRNKNQLRIPASF
FT                   NGEIYAVLADQTHESPIHRAGARIDPVAAGVHLTKNEAKKIAERIKGTMNDKKLSKFAS
FT                   SGDGSTIVIGAIPPSTDANALDGIAVRSITRTHVLSFSMLRAMRFGKGPEGDEAIRVLL
FT                   AAALINAMVGSNAELHLRENCFLVEADEPKTVLDRRGGKHDDLEMLTLEDADELLAQAY
FT                   AQAQKKAGIDWHGQIITVQGDPAVIESASAADDDDR"
FT   gene            206823..207143
FT                   /locus_tag="BIF_01986"
FT   CDS_pept        206823..207143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01986"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01986"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84694"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G2"
FT                   /protein_id="ADC84694.1"
FT                   /translation="MESNERSITTTSLNEAPEICHAEQQHTAAHENHYCNIRNNTSEKT
FT                   PSYILTHIDIGDCVKTHESGKSISYIHMYTDTTQDPDILVFPNRFSHQTSTQITVGTLT
FT                   SS"
FT   gene            complement(207415..209046)
FT                   /locus_tag="BIF_01985"
FT   CDS_pept        complement(207415..209046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01985"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01985"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84695"
FT                   /db_xref="GOA:D3R6G3"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G3"
FT                   /protein_id="ADC84695.1"
FT                   /translation="MKYAENNAMKRGEGLEDTLPISLICDFIFCPRRAWLEIQGEKIES
FT                   LQMERGFHDHRAVDDANGGRGDTDYRAVNVNHQGWGLSGRLDAVRLNEDNGVIIREYKA
FT                   TPVRRSMDVTHAMRIQLALQAACMEDMGYRVDGTEIFFTSHHRIVPVELRKSDYEEAYG
FT                   SVQEVRKLIECETAPLPFEDDPRCMRCSHAGICLPEERAHNIPEHRIMVKVPDHAVTHL
FT                   ATPGARAYLKSGRMHVSKNGDEITSVPLDSIQALQIHGNVDVSSGLMRELMWRNIPILW
FT                   CSGTGRLMGWSVSSYGPNGETRVAQHVASHEGRLDLAREFISAKIHNQIVLLRRSDKNN
FT                   NVLFDMKHIEKSVVNANRIQDILSLEGQAAALYFSQFHHLISVNKRNEWPWLERMRHPA
FT                   PDPLNALLDYTYSLLLSDCIRAIVSCGLDAHAGFLHSSKRNKPALALDLMEEFRAPIAD
FT                   SVVQTVVNNGEIKRNGFANVMGSVRLRDETRKTLIGAYERRMATELKHPVYAYRASWRR
FT                   IVEIQARMVLGRLEGSLERYRGIRVR"
FT   gene            209109..209591
FT                   /locus_tag="BIF_01387"
FT   CDS_pept        209109..209591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01387"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84696"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G4"
FT                   /protein_id="ADC84696.1"
FT                   /translation="MPPDGSPRRCWPFLNEAPKPRLRRCHPDCGGGVRCRPSMKLRSRD
FT                   FGDDSANTVQSVTIAPSMKLRSRDFGDSVFLSWSVSVLSPSMKLRSRDFGDATPSFASW
FT                   TIAAPSMKLRSRDFGDQVLEDAHYFREDDPSMKLRSRDFGDLYPYAMLCALDASPQ"
FT   gene            209716..210090
FT                   /locus_tag="BIF_01388"
FT   CDS_pept        209716..210090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01388"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84697"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G5"
FT                   /protein_id="ADC84697.1"
FT                   /translation="MFTPLNEAPKPRLRRFRLLPAPLIDLFPSMKLRSRDFGDISGGIR
FT                   PCGWDSLNEAPKPRLRRCVWWKNQPVTEAAPSMKLRSRDFGDSQVNIGGGGLSSLNEAP
FT                   KPRLRRSDSILRRVSNGDPQ"
FT   gene            complement(210659..211930)
FT                   /locus_tag="BIF_01389"
FT   CDS_pept        complement(210659..211930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01389"
FT                   /product="Glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01389"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84698"
FT                   /db_xref="GOA:D3R6G6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G6"
FT                   /protein_id="ADC84698.1"
FT                   /translation="MTAPRVSYAHLLVQPNPRHVRSLVRFFEEGCSAPGTGGFGVEIEH
FT                   LPVHNADDTAVTYGEPNGVEELLRRLRPYYDSAQEYWQDDHLVGLAREGIAISLEPGGQ
FT                   IETSIGILRKPKDLLELHGQFMREATPILDELDFRLVNYGYQPKSSYADIPLNPKLRYA
FT                   AMNEYLGRIGQFGPCMMRASASTQVSIDYTSERDAIDKMRLGTAIGPILAWFFRNTPYF
FT                   EGAPNPWPLCRQRMWDYLDVQRTNVTPGLYDERFSWEDYAADVLSTPLMFADLTHTPEA
FT                   EGASVHGTEFTAFYTTAADLYPDRELNAYEINHVLSTHFNDVRLKNFIEMRHWDSLPIE
FT                   RAELLTQIVSNLFYDVERRTSLESYFSGLTGEDVHAAKAVLQARGGDAKPYDQPMDYWA
FT                   EVLGVGDALADVPGDAKWPEVRQG"
FT   gene            complement(212004..216764)
FT                   /locus_tag="BIF_01467"
FT   CDS_pept        complement(212004..216764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01467"
FT                   /product="Activator of (R)-2-hydroxyglutaryl-CoA
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01467"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84699"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G7"
FT                   /protein_id="ADC84699.1"
FT                   /translation="MAASTRENRAPASGMPTKLEYRTKHEVMMASLVQEPSSISQTLNT
FT                   EPRPLRIGLDIGSTTVKAVVLDDSDSLDATLFADYRRHHANVRATMEGLLRDIRAHLAE
FT                   LGRADEPVRLAITGSGGLALADAVHVPFVQEVIAETRAIDEAIPQADVIIELGGEDAKI
FT                   TYLKPTPEQRMNGSCAGGTGAFIDQMSTLLDTDAAGLNEMAKYYQTLYPIASRCGVFAK
FT                   TDLQPLINDGAAKPDLAASIFTAVATQTIAGLASGRPIHGTVVFLGGPLFFMSELREAF
FT                   RRALDGKVDEFITPTDAHLYVAYGAALAVGEPGQIEHADEYPARSLDDIINALEDLKNL
FT                   PSNTATMPPLFDTAADRDAFNARHHREHVHVGTLEGARGPHFLGIDAGSTTIKATLVND
FT                   DREIVWSSYATNDGSPLTAAIEIVKRIQSELPSDAWIARSCATGYGEGLITTGLHLDEG
FT                   VVETMAHYRGAEMVSPGVTAVIDIGGQDMKYLAVTDGVIDSIAVNEACSSGCGSFLQTF
FT                   ARSMGLTIEEFTQAALASEHPVDLGSRCTVFMNSSVKQAQKEGASIEDIAAGLCYSVVR
FT                   NALYKVIKLRDSGELGSTVVVQGGTFLNDAVLRAFELLTEREVTRPNIAGLMGAYGAAL
FT                   TARMHYDDIADDTDGDTDAAGVHVACIDGVDHTVSSILHGTALDELSMTTERDVCKLCQ
FT                   NHCKLTITTFHDGSRYVTGNRCERGGDAKRKRSDRPNLYDFKYKRAFAYRRLTDKKATR
FT                   GEIGIPRVLNMYENYPFWFTLLTSLGFKVVISGRSNHELFETGIESIASENICYPAKLV
FT                   HGHIKWLLNKGIRTIFYPCVSFEDDLVPESDNHYNCPVVANYPVVIEANMPELRADGIR
FT                   FMRPYFNLSKHSLMVDRIVEEFAWAGVTREEAEAAVAAAYAEDTVFKHDVQQEGVRALA
FT                   YMKEHNCRGIVLAGRPYHVDPEVNHGIPETICSLGMVVLSEDSVSWLDPNDVPALTAYL
FT                   AEDETDPAAHTSEGFRHVNDRKLTTMPLRVMNQWAYHARLYRAAQFVASWPGLELVQLN
FT                   SFGCGLDAVTTDQVSEILADKADVYTMLKIDEVSNLGAAKIRLRSLKAAVEERERNAQR
FT                   AATPAASAGTFRHTGTAAPTPGRQILLDAVMGRQAGGAQQNRQSATMSAYANRVPFGKD
FT                   MRRDYTIVAPQMSPIHFRLVEAAIRASGYKFDVLEHASKTDVETGLKYVNNDACYPAIM
FT                   TVGQLVEAIKSRRYDPDSTALAISQTGGMCRATNYFALIRKALVDAGYPQIPVIAISTQ
FT                   GFVDNPGFTPTVPLLHRAAKSLIIGDLLMKCLYRVRPYEANPGSANRLYERWNVIVRET
FT                   LLNHGMSKTAKMLYGRAYWPYAKLVAKIVESFDALPLRDVERKVRVGVVGEILVKYQPD
FT                   ANNHVVEVIESQDCEAVVPGIIDFMTMRPYINDWNEHNLGTGRNKALYTAFKGVIHTYM
FT                   KPVNDALESSGGKFEKDLPMDQLVAKAQTVTSIGVQAGEGWLLTGEIVELIESGCPNII
FT                   CAQPFACLPNHVTGRGMFGKIRRLYPQANIVSIDYDPGASEANQLNRIKLMIAAAKKNA
FT                   AAGRSSV"
FT   gene            216924..217541
FT                   /locus_tag="BIF_02181"
FT   CDS_pept        216924..217541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02181"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02181"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84700"
FT                   /db_xref="GOA:D3R6G8"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G8"
FT                   /protein_id="ADC84700.1"
FT                   /translation="MIGSRRVWECAMSKERVVAFTDAVLAIIMTILVLDLDKPDPLTWS
FT                   GFGKLWPQFLAYAFSFFWLGSMWVHLHIEWSGVKLVDQPVLWTSITLLFFCSLIPYSTS
FT                   LVAGNVLSWDLAIKIVGIMITLTIWPPAMLVFTLAAAMFLFLKSASAERRMQVKIKKDA
FT                   LANNGMATPDDVAAVGGSAEEYLAAIEAAKQAAKEADEGDKQ"
FT   gene            217538..217939
FT                   /locus_tag="BIF_01468"
FT   CDS_pept        217538..217939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01468"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01468"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84701"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6G9"
FT                   /protein_id="ADC84701.1"
FT                   /translation="MNTALITASIFAMLAGLLHVYIFVMESFLWTSRSTRETFSMGADE
FT                   AEQTKEMAFNQGFYNLFLAIMSIGGAIVLWCGVTVVGVTLMTAGSASMFCAALVLLCTA
FT                   PDKHSAAIKQIFFPALTLIALLVALILFA"
FT   gene            217992..218891
FT                   /locus_tag="BIF_01469"
FT   CDS_pept        217992..218891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01469"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84702"
FT                   /db_xref="GOA:D3R6H0"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H0"
FT                   /protein_id="ADC84702.1"
FT                   /translation="MIADSSTETRCTMSDSNVERPTQRIDMPTTQIPMQQGYAPPSYQA
FT                   PSYQQANYQPESGDGGKRRRRWPVVVAIITVVAIVGGVVGGIIYKNKHDEAYARCQTAV
FT                   SEFSEARKALLDTTSDSPALQKLVRNALGVDKILDAAADAASAAEGTVAQQGCAANATI
FT                   IQLNLVANTLNSATESLRKSTAQIVRGASADTDNTGDESESAASSDTEDVAQAKRNLQE
FT                   AIDQGRALLDTLKQRYADSAVGRQLTAGFEAALDLAQEKFDESGIKDSRYYKAAQATLD
FT                   EATNAVNAWIDRQAQKAD"
FT   gene            complement(218888..219637)
FT                   /locus_tag="BIF_01470"
FT   CDS_pept        complement(218888..219637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01470"
FT                   /product="Anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /EC_number="1.97.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84703"
FT                   /db_xref="GOA:D3R6H1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H1"
FT                   /protein_id="ADC84703.1"
FT                   /translation="MAEAANMNDSANGTWRSTGKPRLHDFAAGETGRGPAIPTPMSNNP
FT                   KPGQWTNRMSHNMIADYKRFLMTDGEGIRCSLYVSGCPFHCVECYNSSIWDFQAGHEYN
FT                   DKLEAQIMDDLAQSFVQGITFLGGEPLLNTGVLLPLARKIRERFGHTKDIWCWTGYTWE
FT                   ELMRDGETQDKLDLLHEIDILVDGRYIKTLHDSLLQFRGSRNQRILDVQESFRQGKPVV
FT                   WAKLHDQERFIPEIYGKERAAGEGDAS"
FT   gene            complement(219979..222453)
FT                   /locus_tag="BIF_01471"
FT   CDS_pept        complement(219979..222453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01471"
FT                   /product="Anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01471"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84704"
FT                   /db_xref="GOA:D3R6H2"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H2"
FT                   /protein_id="ADC84704.1"
FT                   /translation="MQPESQYMSESVLEVSMETQILGDTLSRTVVGDGDDVFEGMFTDR
FT                   VLVEKRDGRVVDFDPVNIVVAVKSAFADLDKEVGPQEERMILDIANQIEGEIRERYNGP
FT                   AKIEDIQNLVEHALIEDHLYEVARTYTNYRLNKDIQRAKATDINEAVSRLVNRDESLVR
FT                   ENANKDSNVYATQRDLLAGAVSKASAFSMLPDAVANAHMKGDIHFHDADYSPFTSMNNC
FT                   SLPDFGDMLKHGFALGNAMMDSPKSIGTASTQITQIIKDIAGAQYGGQTVNRADEMLEE
FT                   YAKRDYVKNLDMAHAMIPDSTPIEVARDMVAGLKAQEPRWLHFENREPLPADEAFDTNA
FT                   PELEQIREIYAKIMTRKAIYDAMQTMEYQINSNRVSNGQTPFVTVGFGLGMSWFAREIQ
FT                   RAILLNRIRGLGKERHTAIFPKLVFTVKHGVNADEGDPNYDLKQLALECATKRMYPDVV
FT                   FYDNIVKITGSFKAPMGCRSFLQGWIDPKTGKDVEDGRMNLGVVTVNVPRIALESHGDV
FT                   ERFWKIFDERMEVAHQALQFRIMRCKQATPVNAPTLFRYGAFGRLETNENVDQLFRNER
FT                   ATVSLGYIGLYEATAVFFGKDWMRDHAWDPEGKDFALSIVRRMNELCKQWSKAEGYHYS
FT                   VYSTPAESLTDRFNRMDRKKFGKVEGVTDHDFYTNSFHYPVWLQPTPMEKLDYEKDFPY
FT                   YASGGFINYCEFPCLQANPKALEAVWDYAYNIGIGYLGTNTPIDHCFVCGFEGDFAPTE
FT                   EGFKCPECGNSDPDKCNVTKRTCGYLGNPVQRPMVHGRHEEIAHRVKHMAGETGHVTLA
FT                   DGETREWFEETK"
FT   gene            222762..224060
FT                   /locus_tag="BIF_00285"
FT   CDS_pept        222762..224060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00285"
FT                   /product="Exodeoxyribonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84705"
FT                   /db_xref="GOA:D3R6H3"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H3"
FT                   /protein_id="ADC84705.1"
FT                   /translation="MVFNNGYQTGYRQGYAPAPAAGPNELPRMAAQTTAENPWPVSMVS
FT                   QKFHSAVERWPAVWMEGQIIEINTRRSGSAYLTLRDNDQDVSMSVLGFGAFAQMARDYK
FT                   QGDRVVVHGKADLYVKSTRLSLRADMIKRVGAGNLQEQINQLRMRLKGEGLFDESRKVA
FT                   LPEFPKNIGLICAPQARAEGDVVMNVNLRWPGVRFTIVHAHVQGEQCPPDIVSAIQQLD
FT                   ADPNVDVIIVARGGGSFEDLMGFSDERVVRATAACATPIISAIGHEDDWTLIDLAADVR
FT                   ASTPTDAAKRVVPDVREQQQLITEGINRMRTFIANRAGNEERLVEGYANRPSLTQPLTM
FT                   LIPHERDIADAVSAMRNGLRRIVDEEQMQVERLAATLRALSPQSTLDRGYAVLQNADGA
FT                   IIDDASQVQVGDELTLTLRRGKVVSQAQAVYDE"
FT   gene            224053..224421
FT                   /locus_tag="BIF_01935"
FT   CDS_pept        224053..224421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01935"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01935"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84706"
FT                   /db_xref="GOA:D3R6H4"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H4"
FT                   /protein_id="ADC84706.1"
FT                   /translation="MSERRTPRKRIPNGRNDMAEDMEITEVSETEPQTASSLSQEERER
FT                   IAQLPYEQARDELIQAVRALENGGLSLEDSMKQWELGEALAQRAQSLLSTIRAKLDAAQ
FT                   QAQAQTANTAGTQSNLES"
FT   gene            complement(224422..225447)
FT                   /locus_tag="BIF_01936"
FT   CDS_pept        complement(224422..225447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01936"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01936"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84707"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H5"
FT                   /protein_id="ADC84707.1"
FT                   /translation="MAMMRKHRVLGAIAGLLALASLCSCALRLLPVDLQTLPYVSVVLA
FT                   ATPWFAIVSVVSLVLALISTRWVTAIVAGVCLAIQVCWQLPFYHNGTPLSGSALSSQSL
FT                   PRADTADAVARLMTCNVYKGHADAAAIVNAVRDNHVEVLALQETTPDFLKRLEEAGISQ
FT                   LLPYSQTSSADGYFGNALFSALPFENPSQTDVDSIASYMPGGTVGFDNGAIPVRFVSVH
FT                   TQSPTEGRFEKWSRSIAELKQLNEHPDTDYILMGDFNSTWDHAVFRDMLGTRFQDAAEV
FT                   SGHGLVFTWPADRKYLPAFAGIDHIVTSKDVTIGQVNSLTIPGSDHRALLATVDVSGLR
FT                   H"
FT   gene            225431..225553
FT                   /locus_tag="BIF_01984"
FT   CDS_pept        225431..225553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01984"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01984"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84708"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H6"
FT                   /protein_id="ADC84708.1"
FT                   /translation="MRIIAIYMLHSLVAGSTALPAIFRFCVPSLADACHERHIR"
FT   gene            225623..225695
FT                   /locus_tag="BIF_tRNA04"
FT   tRNA            225623..225695
FT                   /locus_tag="BIF_tRNA04"
FT                   /product="tRNA-Arg"
FT   gene            225740..226528
FT                   /locus_tag="BIF_00430"
FT   CDS_pept        225740..226528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84709"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H7"
FT                   /protein_id="ADC84709.1"
FT                   /translation="MPRARHAVESLENTPTKEAGMAIEAHCGTLSALTLALPRSCAVPE
FT                   SRGTLPKGMFVAKVAVSAKTKQHLIHAIDGITMLAILRAANTGVEQGRRIPEVLVIGLR
FT                   LADGIEEAPHDIVELIQAQRKSGIVFVCVRNVEFEGAMREEACFVVRRPLSERSGHAPT
FT                   FHEFASAWIPSGEALLEIADAAATTDDLWDSLCSQVIFGSTDFADLDARIVRASRIAQL
FT                   RTQIAKLEGDHARAKTQERRNEAHAKLRKARAQLESLEQL"
FT   gene            complement(226672..227838)
FT                   /locus_tag="BIF_00004"
FT   CDS_pept        complement(226672..227838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00004"
FT                   /product="Aspartate aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84710"
FT                   /db_xref="GOA:D3R6H8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H8"
FT                   /protein_id="ADC84710.1"
FT                   /translation="MKTAAKRQILGNSEQLRAKECHMTGADEQTKDSQRQNMRPPFAKR
FT                   AALARPFMGMRISNEAKRLRAQGVDVINLSLGQPDYGAPEPVREAMRDLYDGRPLPYSD
FT                   SMGLSELREAIARFYRTAHDVEVDPKRIVITEGGSAALLLATALSVDEGDEVIIADPSY
FT                   PSNRELVRSFGGKVVDVPTSAATRFHLDQPLVRQYWSERTRAVMITSPSNPTGTTIAPD
FT                   VLRDVCAYAAHHGAWRIMDETYLDLTDVEADGSRVESALAVDPEAMVCGSFSKFFGMTG
FT                   WRLGWMVVPEFALDAVDNLATNFFLGAHTPSQYAALACFTPQSRAYARSAGRNCWNAGH
FT                   SWWTLSPASDCRWKWCRTERSTRISTSAPPASMRRPSANARCMRPMWR"
FT   gene            complement(227798..228331)
FT                   /locus_tag="BIF_00005"
FT   CDS_pept        complement(227798..228331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00005"
FT                   /product="patch repair protein"
FT                   /EC_number="3.1.-.-"
FT                   /note="DNA mismatch endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84711"
FT                   /db_xref="GOA:D3R6H9"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6H9"
FT                   /protein_id="ADC84711.1"
FT                   /translation="MRSAIRGTGDNGCVGTSADSGDSKYARGTRSYTMSRIRGKDTSIE
FT                   RLVRSYLFARGFRFRKNDRRYPGHPDIVLPKYHTIVFVNGCFWHMHEGCPKFKMPGSNV
FT                   GFWTAKLTRNRERDGAQHEQLRAMGWRVIDVWECELERQSRDARLQSLASQILDAPVEG
FT                   AVENGGETADTGQQ"
FT   gene            228448..230016
FT                   /locus_tag="BIF_00652"
FT   CDS_pept        228448..230016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84712"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I0"
FT                   /protein_id="ADC84712.1"
FT                   /translation="MGLRNRHTQPVYYNELYDIEDFIGTSCLNNDDLHAPTFLWDSSIC
FT                   EESRDDDAERLGTPVAPTDEAETVMTLSMQWYFDSLAAIVPGAQRTGDGIEMPLRDMPT
FT                   FRIDSQALQGVSCVVGNAVASNHWLDAVNNLARALEITAEFLNNCADRDNEGLDFLEDT
FT                   IMQVQVYMDSVARNASPDVAATALRRITDVACSKYFHLNATKMIELLSCTLSFASYDDT
FT                   RVLAYESLERAVDYMRANLDEMDNFDTPSGSSHARNADDGASPNRSDPHAQAAPTDDIA
FT                   QVNEQFEQMMAAEFDADDDLGIVVPHADSDDEMALNLTLDPEAFNRRLHIYAREQFEQA
FT                   VQFLRHDLLRISGDDAAADELLRDHTDMEPLADMLALRLISTKRFHELLSLAIRIERER
FT                   PNQQIMLFPETLVPYQWDSIREIALQGIDNRDELKRIYRERIVEAYDPSDTRALANLNA
FT                   LCSEEGDWDEQVRQIVEEYANGEGRYARNVIYEQMLIAEDMVEEAVEYVEHFPEAKEDL
FT                   ALLLW"
FT   gene            complement(230050..231453)
FT                   /locus_tag="BIF_00664"
FT   CDS_pept        complement(230050..231453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00664"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00664"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84713"
FT                   /db_xref="GOA:D3R6I1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I1"
FT                   /protein_id="ADC84713.1"
FT                   /translation="MAYDEHMTYEQNTQWLEASKHDVTQWAAVMERDADERIIDWDWVC
FT                   SLDFVAGVGAGARLDLVHDEYDAHALLMQDYAIRERLEAILENVTSVFMGDFDRNLDSF
FT                   RLARALAYANRRLNDEITLIMEQGKVRRLWNVERRFERGTAFVVLHGNEDAHANEIVDR
FT                   SAQLAQERAQRRNHAMNQRKAGSQMMQQASLSSFTDDKVLSEESGQTSRPAAPRRSDSQ
FT                   YDWRMAYLPGRDVDAVLGIDIETTGTSAWRDYIIDVGFERMNLQTPAPEGAKARDVYSE
FT                   TDYAADGAYDQSRLSFGVPLRCAEVANPFIAQLTGIDVTKIAGEPIFDEWPRMQQALLE
FT                   RLMQQPYVAHNATFEHRFFMANVEGYAEAYRNGEITILDTMPMSRHWDAGSVPSPGHPH
FT                   GDNTLEAYAKRQGALDGNSHERHLGLEDAHIMLVAMRHHLGTLKVAGEGPWGPAGRGGV
FT                   GGKHTGRRR"
FT   gene            complement(231573..232226)
FT                   /locus_tag="BIF_00531"
FT   CDS_pept        complement(231573..232226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00531"
FT                   /product="Peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84714"
FT                   /db_xref="GOA:D3R6I2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I2"
FT                   /protein_id="ADC84714.1"
FT                   /translation="MFGKKNHVDIELNADVERLLKSAKEGVLPIVEAGEPVLREQCVRY
FT                   DGQLSKHTLHKLIETMHKTMLDAPGVGLAGPQIGLNLAIAVVEDHANGDDDGDPREIAE
FT                   FPFHAIINPVYRPAGEETRSFYEGCLSFDGYQAVRKRYLDIIAHWHDEDGKEHEEHLHG
FT                   WPARIFQHETDHLSGELYIDQAEIRSLTTVENLEDFWAQDPVPTQAAKELGFEL"
FT   gene            complement(232264..233634)
FT                   /locus_tag="BIF_00530"
FT   CDS_pept        complement(232264..233634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00530"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84715"
FT                   /db_xref="GOA:D3R6I3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I3"
FT                   /protein_id="ADC84715.1"
FT                   /translation="MYMPRMFGTDGVRGLANRDLTAQLALDLGDAAVRVLGDDGGRETN
FT                   RHRALIGRDTRVSGDFLSHALAAGMSAGGFDVIDAGIIPTPGVAFLTSVLNVEMGAVIS
FT                   ASHNPMPDNGIKFFARGGFKLPDTKEDEIEAVLGQDWERPTGAGVGRVSHDTTTATNLY
FT                   IDHLVSAIAPEGNEQPLKGLKVVADCANGATSVVAPEALRRAGADVIVINASPDGYNIN
FT                   KNAGSTHPESMQAMVRASGADLGVAFDGDADRCLAADAEGNMVNGDQIMGILARAKKRE
FT                   GKLNHDTLVVTVMSNLGLKLALKEMGIDTVQTNVGDRYVLEEMLRGDYSLGGEQSGHVI
FT                   NREFATTGDGTLTALTLCNEVVKSGKSLKELAADFPQLPQQLINVPNVDKMAAKTNKAV
FT                   LEAVAREEELLGDTGRVLLRPSGTEPLVRVMAEAATQEQADEVTARLAQIVADELAL"
FT   gene            complement(234093..236717)
FT                   /locus_tag="BIF_00521"
FT   CDS_pept        complement(234093..236717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00521"
FT                   /product="Membrane alanine aminopeptidase"
FT                   /EC_number="3.4.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84716"
FT                   /db_xref="GOA:D3R6I4"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012778"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I4"
FT                   /protein_id="ADC84716.1"
FT                   /translation="MPGSNLTRVEAQERKAIITYPIEYTVDLDLTQGPKTFVSTSTIRF
FT                   GAHAGESTFLDLIADSVESVTVNGETLDVNEVFDDDRIDLNNLKEHNEVVVKAVCRYST
FT                   TGEGLHRSVDPSDGNVYLYSQFEVPDARRVYAVFDQPDLKATFKFSVKAPQSWTVLSNM
FT                   PVESTEDLADLTADGTLAGKPAESTKLWHFATTPTMSSYLTAICAGPYAAWHTTYENED
FT                   GRTVPMSQYCRQALKDAFAKDVDYLFDITKKGFAFYAKTWGVPYPYAKYDQIYVPEYNA
FT                   GAMENIGLVTIRDSYVFESKVTDALAERRVVTVLHELAHMWFGDYVTMKWWNDLWLNES
FT                   FAEFTSTLATAEATDWKDAWATFCSGEKSWALAQDQLSTTHPIVAPINDLNDTYVNFDG
FT                   ITYAKGASVLKQLVAYVGRERFFEGISHYLNRHAYSNATLNDLLDELEATSGRDLKTWS
FT                   AKWLEQAGINTISTAVQADADGKITSLTLTQAAPTEFPVLRPHRLAVGFYDEDPQTGKI
FT                   VRTDRIELDVDGEHTTVAQAAGKAKPSLLLANDDDLTYTKLRFDDDSLAFAMANLYRFD
FT                   DALARAVIWLSLWDMTRDGELAATDFIDTTLKMLGTETESTTFRYALAMLSTTVWHYTD
FT                   AKQRNRIAKHVASELFALAKQAKAGSDEQFQLVSAYLTYGVEGDSEFADTVRGLLSGSL
FT                   VFEGLELDNNFRWSIMHALASINAIKQADIDAELKRRDTTENREFAVGTRASLHSKESK
FT                   DWAFDQALHNDELTNSQLGEVARGFSGTHDADLADGYVDAYFEAIDWIWKNKTFHMSEV
FT                   LIGDLYPAYADPAKLVEAGDRWLAAHQDADNALLRMVKANVEASHRTRMVSDFNASIGE
FT                   SAR"
FT   gene            complement(236874..238799)
FT                   /locus_tag="BIF_01983"
FT   CDS_pept        complement(236874..238799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01983"
FT                   /product="Metal-dependent hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01983"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84717"
FT                   /db_xref="GOA:D3R6I5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I5"
FT                   /protein_id="ADC84717.1"
FT                   /translation="MRRESSMATQEAKTTRKRSAGKSATGTKRRSTKSAASQAKSPRTR
FT                   KSTRNTSTRVRKQINVNKPLATSDTQDENRVAPPKYRKGSMRIVPLGGLGEIGRNMNVI
FT                   EYNGHILLIDCGVLFPEEEQPGVDLILPDFNYIKDRLDKVDALVLTHGHEDHIGGVPYL
FT                   LKMRPDIPLIGSKLTLGFVEAKCREHRIEPVMTQVEGRDKLKVGPFNLEFVSVTHSIPD
FT                   ALAVCVRTPAGSLIDTGDIKLDQLPLDHRVTDLVEFGKLGEQGIDLLMMDSTNAEVPGF
FT                   VKPETSIGPALDQVFATATRKIIVASFSSHVHRVQQVVDAAHKYGRKVVFVGRSMVRNM
FT                   AIAADLGYLHLPEDTVIDVKKAKDYPDNKLVYMCTGSQGEPMAALGRIADGNHRDITIN
FT                   EFDTVILASSLIPGNEHGVYKVINKLVQLGARVVNRDNAAVHVSGHCNEGELLYMYNIV
FT                   KPRNAMPIHGENRHLVANGLIAVKTGIEPENVVLAEDGDVVDLYHGKAAIVGSVPCGYI
FT                   YVDGDSVGELTDEELEKRRILGTEGFVSCFAVVDTDAAEVVSGPKVYLNAVAEDESEFE
FT                   KVRHQIVEQLRDAMMTGTKDTHKLQQIMRRTLGGWVSRELKRKPMIVPVVADVAADMNK
FT                   MESYND"
FT   gene            complement(238882..239793)
FT                   /locus_tag="BIF_00297"
FT   CDS_pept        complement(238882..239793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00297"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84718"
FT                   /db_xref="GOA:D3R6I6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I6"
FT                   /protein_id="ADC84718.1"
FT                   /translation="MSDGIMHLLDPAPFGRVLPAMITPMKPNGDVDFDMAQTVAKQLVA
FT                   DGADGLVVNGTTGESPTTHMDEKVELVKAVKEVVDVPVISGAGSNDTAHTVRMVEQTQE
FT                   AGADAVLVVCPYYSRPSQQGIFCHYQAVNESADKPIIVYDVPGRTGVRIALDTYVHLAE
FT                   LDHVKAVKDATGDIAGAVRKRMETGLTWYSGDDALYLPFLSIGAVGIISVVAHAAAKPM
FT                   RELAEAFDRGDIAKAQGLANRIAPVIEAMNGTGFQAVMAKAALKVRGIMECTTMRLPNI
FT                   GPNDEQIEVVRDGLRASGLIPE"
FT   gene            complement(239839..240699)
FT                   /locus_tag="BIF_00298"
FT   CDS_pept        complement(239839..240699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00298"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84719"
FT                   /db_xref="GOA:D3R6I7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I7"
FT                   /protein_id="ADC84719.1"
FT                   /translation="MSPPARRRPSTRTRDARHELLLGADAHNPKGGSMIRVSVVGAKGR
FT                   MGSHVVEAVRAADDTELALALDAGDDLTQITPQNTDVVVEFTVPAVSLNNVLTLVRQGV
FT                   NVVVGTTGWTDEKLDQVRAALAETETIDGRKQSVFIAPNFAISAVLADVFARIAAPYFE
FT                   SAEVIELHHPDKVDAPSGTAIHTAHAIADARKAAGLGEMPDNTQTDDGSRGAVIDGVHV
FT                   HAVRLRGLNAHEEVLLGNAGEQLVIRADSFDRISFMPGVLLAVRKVDSGEFPGLTVGLD
FT                   QFLDL"
FT   gene            complement(240656..242074)
FT                   /locus_tag="BIF_00632"
FT   CDS_pept        complement(240656..242074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00632"
FT                   /product="Tetracycline resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84720"
FT                   /db_xref="GOA:D3R6I8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I8"
FT                   /protein_id="ADC84720.1"
FT                   /translation="MSSKPSNLPKTADGATQAAQGSGSPYARLFRLKGAKAFCLSAAFA
FT                   RLPMSMMSLGIVLALNHLYDNWTVAGAMSAVYILAVAAVTPFYARLFDRFGQVKVGRVA
FT                   LTVQVIVMLAFAFAALARVPIPLLFVLAVVMGATQFSFGALVRTRWTYLLERTDNMDLL
FT                   NTAYALEAAIDEIVFIFGPILAATLATSVHPVSQLFVPTAACAIGGGIFFSLRSTQPPV
FT                   LHAVETVQVNGDDDDVRMARSGFAAQADGSHVAGQRAGVERKHRGMVSQSRRTTRNVLS
FT                   YAGILPLMLAFICFNMSFTTFDVSMTGQMEADHLDRFLGLQLAMIAVGSCIGAFYFGSR
FT                   QHRGSHWRRLIVCLCILTVGFMLMRVTMDIYWVLGIVELLAGLVVSPMFATGNLIVKDT
FT                   VPESQLTEGLSWLTTAGQIGAAMGSLLGGMVLDHIDAHAGVMTTWVYTLAAIPFAVLGW
FT                   YVASRKAQAVDPNA"
FT   gene            complement(242071..242793)
FT                   /locus_tag="BIF_00631"
FT   CDS_pept        complement(242071..242793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84721"
FT                   /db_xref="GOA:D3R6I9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6I9"
FT                   /protein_id="ADC84721.1"
FT                   /translation="MRSDMSDTNNRHDNVASASSTANRDLTLRAMTLGDLQDVARVFDE
FT                   VWPQAAPLTGTPMAYELARYFVLEYMRSATASCVAVTADGEFAGVTLARIDGQPLAFPQ
FT                   TEGMLGDLRQIIDENPIAKMMRSGFDHFRATDHQLELRSGVGQSTQAELLLFMVNPAVK
FT                   GHGVGGALWNALLQGFRANGVHAFYLHTDTSCDYTYYEHHGLQRVAERLRADHPEDNGR
FT                   ADGIRDDMFVYRGEVPAV"
FT   gene            complement(242804..242959)
FT                   /locus_tag="BIF_01982"
FT   CDS_pept        complement(242804..242959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01982"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01982"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84722"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J0"
FT                   /protein_id="ADC84722.1"
FT                   /translation="MFSCQRTRLGVTHATWASGGVRGTAAIGGGETHVTAFHASCIVGE
FT                   YAGGRI"
FT   gene            complement(243004..247140)
FT                   /locus_tag="BIF_00621"
FT   CDS_pept        complement(243004..247140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00621"
FT                   /product="Putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84723"
FT                   /db_xref="GOA:D3R6J1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J1"
FT                   /protein_id="ADC84723.1"
FT                   /translation="MAQSNKPVPSAEQQRIVDADANANVIVVAGAGSGKTFTMTERVIH
FT                   LIHEGVPPEHILGLTFTNKAASELLSRVSKAVLDDARERAREGGPHPARLAFMKPDVRT
FT                   YDAFFQSIVRQYGLLVGFDPQTQPLSVAGARQIIASVVGRHVDEIVQLPVDMGSFGTVV
FT                   DAVGALANNIANSMIGNGCLTVADAIERITQWDAAFRTQILDLLQTDETGLLTGPLADR
FT                   QRGATPKAVKDVLKARKKAEKKGGEYVETPGDKDAVGEAIHADAELAARDLYLVAMKRD
FT                   VLLGLVREFDEEKRRRHMAEYSDFVIAAYQLVERFPSIGAHYRRQFTHVLLDEFQDTST
FT                   TQSALLAALFHVDEPHGTDRSAAVSAVGDPFQSIYAWRGASPGAFRMFINDFHMPAAAE
FT                   PLPMTRTRRNSRVVLQGANNLTKVLRRVEQRPSSANAQEVPVQPLRNVDDGSVEVDEGT
FT                   LAVLGFQTRGQEVDAVTRFVKQSVEQYGDACKPGDSPVAVLFRGKKSMALYEDQLSQVT
FT                   LRDGRPLRVRAVGLSAMLDRPEVQDVLALLKVVGDHTDANALMRLLATPRYALGALDLK
FT                   RLARRAADLNTEYRFRTLVEAGLAPAGTPKREWGALVRQYARNAPNMVYLIDMLLRDDV
FT                   EAQLEAAGLSDEGRAGVMQAVRAMHRVQDEMYQPLAQVIHTAVEALNLDVDLMVASSLR
FT                   TGGAPAPRDAVRAAIDALLETVNTYTSEIAQQQRPTLRGFLTYLDMANGSDMPEAAADL
FT                   GDEPADVVLMTVHQSKGLEWDAVAIVGMQQGAFPSNKGDALRVKALEDRGSKLDWEPPL
FT                   YEETAKSWLESPEAVPVPIRVDAAILPKFPTIPDAGGSDASSLQESAVRALRDIDSVES
FT                   LENDAYGELRALLRDNGVLLDELGEPDAWNLSQKEERGRALHADERRLMYVALTRAKHD
FT                   ALVTYSVGATTSRIPEDNAKESGAPSVFWRELRDSMSCDDSFSQRVELTAFDNQTTAPA
FT                   RPVAATAGNTAVTYDDLESTQPRSLHERGAKRPEGVIVGKGAEQFATLLVDEPYEEPME
FT                   PIDTEQHLPWPSRLSEEMHRTLRKGAAQVVQRMSQNNPTDMPGETAEGDGRSLLERARQ
FT                   LIDNRATLIREGMTADEIEQAVRMRGQRVLAAKDKLTATGLQRNAEAGENATDFALEII
FT                   RPVPQVSTPQAQAGTRFHAWAQRYLEAGVNPEYGISQEAMAREVAHEAEAVEQAERGGR
FT                   PVPREQRDLLIWKQRFLESAWSAREPAAVEQTVSTFVSGIGKRVDAKLDAVFHGGLGDG
FT                   TSGASGDARYTIIDWKTGSRPRNAQQRAGKLAQLDMYRYFWALQKRIPMSQIDAALYYV
FT                   SEKDPAKALVVAPQRSEAEVLAEMRAGVPEPDDND"
FT   gene            complement(247153..251727)
FT                   /locus_tag="BIF_00717"
FT   CDS_pept        complement(247153..251727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00717"
FT                   /product="DNA helicase, UvrD/REP family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00717"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84724"
FT                   /db_xref="GOA:D3R6J2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J2"
FT                   /protein_id="ADC84724.1"
FT                   /translation="MRARRQCMVEHTQEHGVAGMVADDDAPRTNEGARRAIREFLESVH
FT                   NDDRNSKARTLLVSGAPRSGKTQLAVETTLAGLRAGLAAGDDGSTVMLVPNRRVADLYS
FT                   DRIIRELGSSERVRPATTLNALAFQLLEIARSRSGDSAPRLINGAEQDALLRHVIAVHV
FT                   EQHRRGEDGSCETCRLLSAYFEDAGVQAPPARKGVGAAANSSSAGTLDWATIVMDAADA
FT                   NDADEETIADIAANVNAGFIAQLRDVFAHFDEVGALLRLGAMQPTAAARNVEEWTMQVA
FT                   CQAVESEGPAGVRLSLQWRLALALRREYFDLVARRYPGEYRLDPSYLPLAAMRSLTVAG
FT                   AWMPTLLVVDDVQDLTLGGLALLAVLQGLGVHLVLFGDPDEAVQAFRGSYPEYLYARFL
FT                   DPNGPFAADHVSLQAFQHEPATYRDIVASRVSLSIASAEESSLPLAQRPGKLPAVEGSD
FT                   RLRPLDANDPHTKKVLEDGSLNGRLYRSANDELDNIVWQISALHLNDRNVTWNDMAVIC
FT                   HDNADVLRFGERLRGADVPVRYSSVTRPLADEPFVQGLFALIELAQLRAHGLETRSMTL
FT                   AAAAQYVRARVGRIAESLLIDTANMGTNTINAHVRSHRKPTRPMRLNTVNAALSSLEAL
FT                   ARISQTDILDDASATADPDRSALAESVKASALSDLRSQWDALASTVRAAHAAQEQASGI
FT                   VVDDSRLSDTDKVGDGLEFGIDALYLLLAQGDDETLLDVLEALCGDHNEDVRNFNLLWR
FT                   IVGQIADDLGSLPSKAPQYALEAAWKACHVADAWKVQAIFDSPDGRAANDRLDTAMRLF
FT                   NYVQSEGVAPDINAFIDQVRQLQIEADSLASLAPVDEAVTLTTPAGTAGLSWEHVWIPA
FT                   VQQGIWPNLAARNTMFGGEDLVDIALHGSQTRHRNEVGGQLDEVLASEQKGWLVALTRA
FT                   NGTLNVSASQNDDAVPSDFLYAYLPECFTRDDAERPLAERLADASDAGNADSRRNQTET
FT                   SVDTAEHGHSVKESERHAGDETLTASMRGVIALARMTLAHSEESSAEFQDAVAALAALA
FT                   SAGVDEADPRRWPFLRDAPTGARSPGRHERTQSGNSVQSTGTALSLNAGSAQSGASPQA
FT                   MSVPTDPFAPIVLSPSQVDRLWGCAVCARLERDFSGPTPSAVVADFGTLVHDAAQYATE
FT                   HHWDLPQVYEQFVPIQGPHTDTWREQTAQAIADRMFDEYYAPRRIDPLGIEDASERFAA
FT                   LQRDAESKAMLFNIARYFVDSNEAEYIHKTTGAIGTLVESFAECSFEGAFTLRSITDAY
FT                   NHAGDRPKLTVQQMRAILGVLMDGWPVQLADGQEVQINGRIDRLERRRFDNGDEHWRVV
FT                   DYKTGNSFSPAEQFSDLQLVCYQLGLAFNTDGSTTALTGPRPKVSRAELFFVKDQPAPA
FT                   GTATRVESYYQPALMEGGAVTDTGFAARYYMPHMSSLFKMQLPSKAPDGVPEEVWHDLL
FT                   AGAQEGTLWALTMLARVFYAAAAKQADHIVAHPTDAHRGACRHKQVCAACNEAMATVFE
FT                   TEWE"
FT   gene            251864..253444
FT                   /locus_tag="BIF_00451"
FT   CDS_pept        251864..253444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00451"
FT                   /product="MalT regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84725"
FT                   /db_xref="GOA:D3R6J3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J3"
FT                   /protein_id="ADC84725.1"
FT                   /translation="MRCANMVNLPILAQNDQRNAALRWDSLIAGLRASSRAQISIIYIW
FT                   ENPRHRYTASEGAAMTQQVPQPPRLAGYSYVRVLGHGSTATVYLYRQQGIERDVAIKVS
FT                   VEQVDSRIADAFRAEARAMAALSSHPYILSTYDAGVTDDGRYYLVFEYAPGGTLKDVLC
FT                   NHVLDVPQMLSMGVHLASAVATAHRAGIVHRDIKTSNVLITWQRLPTLADFGIAVTAYD
FT                   HSSTGYSLPWAPPETLRTGGAGGEAADIYSLGAVLYASLVGTSPFEYGYHPKTAKELAR
FT                   LIMTQPLPTIQRNDVPTVVHETLAHAMAPNADDRYPSALAFARALQQAQFDLYGHATPV
FT                   NVEGADPYPSSIARRQITERPPAARQRGKHRKAWMVAGFTVALLTLFLAVFMGFVLPGL
FT                   DTHASGNQTVVEGSHGALQNGERPEPTGNEPPGASVVPSPQQLSGTLDENGIAHFHWRN
FT                   PDPREGDTYVWSRIGAATTPGASHVVDSTGFDIPADQTDQAQVCVRVSIVRADRSMSAQ
FT                   PAIACAVRK"
FT   gene            253451..259372
FT                   /locus_tag="BIF_00994"
FT   CDS_pept        253451..259372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00994"
FT                   /product="Hypothetical membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00994"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84726"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J4"
FT                   /protein_id="ADC84726.1"
FT                   /translation="MTESPRNSMHKFSPRRIFRGRGKTWMVPAAMLVIVLAVIAGALVM
FT                   HSVSQRHLQLDDGTVWVTSQADQKAARYNVRLREPDASVTAQSPNFDIAQHGGDVILAE
FT                   PQKASGIDQSTMGTADATATTSTMRTLVGGRTAAIIDADRGEVWVGKADGIAHLSPTTA
FT                   TATMKLGTGGRIAIAADGTVYGLDAHTAKVYTVGAGSNTAHEIVTLNEGEPIAADSFTV
FT                   VDGQPVASSGNRLYFGRSHITVDGVGTLTLQAPPADTDDRSQRGWVAAAAPGALVTMPL
FT                   NEGAKPAIHRTAGTGEAAQPVSVNGCVHGAWSQTARNYATVCSANGEPDMLDLQAITAT
FT                   ANLRLRVNHRLVVLNDIANGNIWNPADSPDVIQIQWKRLDNDTSRQTSTTTDSTSSKHT
FT                   FARECSTKSGQIRAVDDEFGIRAGSNTVIDPLRNDEQTDCSVLRITSVSSPENDSVKAS
FT                   AIYDGRFLQVSAHNPGRATFTYEIGDGRGQSSRATVTLTIAGDQNRTPTRKEQPEETEV
FT                   EQGATYTMNALGGFVDPDGDPLTLVGASVENTDEATVSARPDGELVFHAGSMREGRAAV
FT                   RLQVSDGRNLTEATVYFTIRPPHTLAANIDPVCRTTTPNTAVTVDLSKVVHATSADTPQ
FT                   LTRVDNPERTNVTMRATDMSFTFQSSEPGTYHVPYTIVQGDVEASGLARIDVEPDQEES
FT                   ARPVAANDVALLGADKTAIVEPLANDVDPMGGVLAVTDVRADAKSGIKAGIVGNKRVYI
FT                   TAQTLPSAPVSLDYTVANAQGIATGTIVVQPPALTSADSVPKASDITVPVRTGGIVSVD
FT                   VLDHVSYTGASALALDRNLKTDAGKFRGLAFASSNTVRYQAPSTSGNYPLTYTVTDALG
FT                   NASSAVVTFAVHDSDAESKSAPKPTDVEAQVAAGRKIRIPIRVTGIDTDGDDVQLLGLG
FT                   NNAPKLGRVMETGADYLVYEAFADSVGTDTFSYAVEDWTGRRAQAQVRVGVFQSGADSG
FT                   VYARDDSVTLRPGTSTTVPVLRNDIASDNSNLVLENNVQCQGIDNVKVQGGMISLTAPD
FT                   HTGTAYIIYTVRNAAGVKDVGLLSVTVDPNAPIQPPSAYDYRVPASATVDKRTVNVDVS
FT                   AWISNPSGSLDELAVNVDKSAAQHARATGDTTLSIDLTDEARAIAYTVTNTTHGITSTA
FT                   FIHVPAYGVFPPTLRPQAPPLRVNAGETITIPLADHVRVGAGKAPMLANSESVSATKSD
FT                   NDDYVVNSGTLRFTARRDYSGPASITFTVTDGSRGTNVRFVNTAVITLPITVIGNTRPA
FT                   PTFAGTTVDVVAGEAATVIDLNALVSGGANEDRKPYSFTGGQSSAPFTTSLTTDGKLTV
FT                   AADATATPGATQSIPITLDYGNGALHAGITVRAVPSTRPLARLNPATIRLKPGESTGID
FT                   VTQGAYNPFPQTPLSLVSANADADSTLQMQTEGTVLRLSAPPTMPAATYHVVITVMDAT
FT                   KTEERSVSATLTVVVQNVPGAPLLSPVAAKPEDSAVTLNWTTGSANGSPITDYLVRWQG
FT                   GEQSCGNVTSCRIGNLHNGTTYTFTVRARNAIGWSPDSNAVTGRPNRAPEPPGQVQVRG
FT                   GHRSVEVSWNEPDYAGSRPSSYTVQLQGPDGWTKTNTRVTALATSFEIDNNVITDSSAF
FT                   SATVVANNEVGASVPSRLVSTRDVWGDPDAPQVSITQANDHEITGTVTLGNMRRAGCAS
FT                   IQLSHGTTSCESLRFRVPLDNAMYFKPLSVSATVHTSRRPATVATGQSNTIEPTIGIAE
FT                   PSVRMEGRNDECILEWSVPRGRHDGVHVKFGSIDANREPAGSETVRLSPWERCPAGEVR
FT                   TRLQGHYSPPARATSTHQYRVAPTVDANEIEVSWSQHNRDAIVMRNTGRAFTDYGQPVT
FT                   ITLSFSNGFTTRWNPDTDVTVRPAPGESTVPDNLRWTASITMNEDAGYAARTEEHTVQG
FT                   IRRAATTRTIAWHTTPRLPAGHHSLEPHHIAKERFHDSQA"
FT   gene            260479..261774
FT                   /locus_tag="BIF_01981"
FT   CDS_pept        260479..261774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01981"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01981"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84727"
FT                   /db_xref="GOA:D3R6J5"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J5"
FT                   /protein_id="ADC84727.1"
FT                   /translation="MPPSPARASTVQCRRSSTTCRCRRRDSTKPTNPRMASADMAIRKY
FT                   VSPLGWAVAGMFVLTLALFLCLGWVEMLAFALVCATLLVSSAALSVGNTAFTATLSVSN
FT                   TRVSVNQTMHAMVTVSNPSTSVTASASGDLPISQSNYGSLEWHHERFAIPSLGAHQSKQ
FT                   TAIPLTATHRAVVTVGPLSVRKGDPFGLVRREHRLTEQIRVYIHPDIVPLHTLHAGIIR
FT                   DLEGNPSDDLVNDDLSFFGLREYEYGDDVRNVHWLSTAKTGTLMIRQFEATRRTDSSVS
FT                   LDVAAFSYASAEEFELAVSVFASIGVQCVSERRALYAQSGRLHVQPRKPADFLDTCSEI
FT                   EPETRGGTMLANLAREALLACDKASLYCFVAGSAHEVDDLRRLGAAIPDSATCVVVQVV
FT                   AGASSAVRTLPECVFITVGVLDDLPLLMEVLS"
FT   gene            261711..264260
FT                   /locus_tag="BIF_00582"
FT   CDS_pept        261711..264260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84728"
FT                   /db_xref="GOA:D3R6J6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J6"
FT                   /protein_id="ADC84728.1"
FT                   /translation="MRVHHGRRARRPSATHGGALMTSPTSSFGATRHGRTRGDASWIND
FT                   NSTQMPVWLTMNARDARRADAAHAAGHATRDAAISLVVVMAIVLCACANLIDVYGSAGS
FT                   WARAAIPAALLGSGIAFMTLVPRLRFWWQILASVLAQCVIGPLVALPHTSVAYVLPTWQ
FT                   TLAEGCSAMFTSFKFLIAVPAPTGTADGSLMAVWTLCLLSCTLGGVLAVLPQRRWSALS
FT                   VLVVIGDFAVCALLGTSAGVLRLPCGVVCALAAVVWLSWRWRLFEMSRWLGAGALLLLA
FT                   GAVAVGACLPVHATRTILRDHYEPPLAPFDYASPMSGMRAYLKEHKADTLLTVRNLPAG
FT                   ASVRLAVMDRFDGNVWNLSNTRIAGASSNYTRMGLRITQDGDDSGTWFTAMFDVRDGMR
FT                   DDWLPLAGAATQVTFATNANADDFYYNTGTESGLLTSGVRSGLAYTETGTLARRPSDDE
FT                   IRQTQAARIALPDAGDIPNAVRRMAEAFAGGQPTAGAAALALANGLRDNGWFSHGLVDD
FT                   YPSLAGHGNYRITQLLGGTAMVGDSEQYASAMALMARSLGIPSRVVLGFVPKDEHGDIT
FT                   EARTQRTENGTTTDFTGNDIEAWVEVALEGHGWVAFHPTPQETKTPEDNQNPTPPNPQT
FT                   LVRQPPLPLTDPLRDKQEATGSTVLSGDDAQDPRTSGVWSKIGAVTRDVAIYGSPVWIL
FT                   LVICGCILAVKAALLMRLRRNGSTNHRVESGWRSLTQFAMQSGIPVHGTRREQAHAIAR
FT                   SFAAESAAEATASPSDTSRGPVTEAQLRHSAQTADYAAFSGNPVPESEVVQYWESVDGM
FT                   RAALLKTLPFWRRVRTRLSLRGLFRHHAYKETSDHPA"
FT   gene            264467..265174
FT                   /locus_tag="BIF_00249"
FT   CDS_pept        264467..265174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84729"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J7"
FT                   /protein_id="ADC84729.1"
FT                   /translation="MRRLCVGCACRTSASRKGISMVDYQTAVAAVQDPQADPILLAKIA
FT                   YENPEFGANVAVHPRAYPGLKRWLAEFGDKRARMTLAQMGVIATADPVEDRFDESETPS
FT                   GQRNPEPARAVKLAVEQLVRNSGAQQPVQARPTRFTQPAQSTQAAQHTLATQPDRATAS
FT                   NPNAQYSANGEFTPQLAMTTSDPAVMHDIAQYAPDLHVYLVQNPYIYPELLNWLASLNE
FT                   TEVNEAIAARRAR"
FT   gene            complement(265189..265890)
FT                   /locus_tag="BIF_00248"
FT   CDS_pept        complement(265189..265890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84730"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J8"
FT                   /protein_id="ADC84730.1"
FT                   /translation="MWGPFTVCGRGICPKNGDRSRECAAVWYNMGMSRIPYPPAPEPGW
FT                   YDDDVDAVPGVAFPAYGTQEMRRVQAHRQDGQVSEQPEWHGEPDDYAGEPDEYTAEPGS
FT                   EGDAQWDGTVLSKRFARETEREAVLTNAVTNQHIDINMNTLLGRKPSHDIPEGSKSVRL
FT                   IDPTRTVSRNHCAISYGEHGTLWLEDMGSLNGTYVVHDDEEMRVSQGMPVELDLPANIR
FT                   IGDQFFTLDAR"
FT   gene            complement(265935..269972)
FT                   /locus_tag="BIF_00211"
FT   CDS_pept        complement(265935..269972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00211"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84731"
FT                   /db_xref="GOA:D3R6J9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6J9"
FT                   /protein_id="ADC84731.1"
FT                   /translation="MLDVNAFDKLKIGLATADDIRGWSYGEVKKPETINYRTLKPEKDG
FT                   LFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTRSRVRRERMGHIELAAPVTHI
FT                   WFFKGVPSRLGYLLGIAPKELEKVIYFASYMVTSVDEEQRHQDLPDLQDEFDHEVQNLE
FT                   RRRNNEIEERAKKLEADLAELEADGEVKGSAKTKLRNGAERDMAAIRQRYDDQIKRIAA
FT                   VFDKFKSLKPGDMESDVDLWREMEDRYGDYFEGCMGAEAIKKRLQDFDLEAAAKELREE
FT                   IETGTGQRKARALKRLKVVNAFLTTDNKPEAMVLDVIPVIPPDLRPMVQLDGGRFATSD
FT                   LNDLYRRVINRNNRLKRLIELGAPEIMLNNEKRMLQEAVDSLFDNGRRGRPVTGASNRP
FT                   LKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPSLRMHQCGLPKPMALELFKPFVI
FT                   KRLVDLNYAQNMKSAKRLVDRGDSEVWGVLEEVISEHPVLLNRAPTLHRLGIQAFEPIL
FT                   VEGKAIHLPPLACAAFNADFDGDQMAVHLPLSAEAQAEARSLMMASDNILKPADGHTVT
FT                   MPSQDMILGLYYLSTVIDGAKGQGRIFSSLEEAQMALDKHEIDMQAKVLIRLPQDFVLP
FT                   KDWEPGEVQVIDPEPGSPDVVKEERFADGSVLFATSLGRILFNDTLPVDYPFINEQAPK
FT                   GKLSKIVDDIATRYSTQQVAATLDALKDLGFTRAPWSGVTMAFSDIVAPPDREEIIKGY
FT                   EAQAAKVNNQYDLGLLTEEERRQELINLWTECTDKVAEAMRENFHDDNNVNIMVQSGAR
FT                   GNWMQIRQIAGMRGLVANPKGEIIPRPVKSNYREGLSVLEYFISQHGARKGLADTALRT
FT                   AESGYLTRRLVDVSQEIIVREEDCGTTHGLPMTVAERDENGNLVLVKAADGGPYSRLLA
FT                   QDVLDPADGKTVLYHAGDALSMDVLNDLVAHGVEQVIGRSVLTCESKRGVCAKCYGWSL
FT                   ATNKLVDVGEAVGIVAAQSIGEPGTQLTLRSFHSGGVASASDITQGLPRVTELFEARTP
FT                   KGEAPISEFAGTIKVQDTERGREVILQPDDDSLEPITYQVTRRAPMLVKDGQHVDPGTQ
FT                   LVEGSVDPKKILRILGPRAAQMNIVNEVHDVYRSQGVDIHDKHIEVIVHQMLRRVTVID
FT                   SGDTDLLPGELVDRARFREQNKKTVAAGGRPAAGRPELMGITKASLATDSWLSAASFQE
FT                   TTRVLTEAALNEKEDDLKGLKENVIIGKLIPAGTGLARYRNATVEPDKAIRDTIYPNFG
FT                   LGDGSLGGDLSDGDLGDVDFSNIDFGDLKLGDDFNPDDFLDDNDNPVDFGDEFRIDPDE
FT                   LK"
FT   gene            complement(270033..273593)
FT                   /locus_tag="BIF_01034"
FT   CDS_pept        complement(270033..273593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01034"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01034"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84732"
FT                   /db_xref="GOA:D3R6K0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K0"
FT                   /protein_id="ADC84732.1"
FT                   /translation="MSQTTTNTTSVTARADQHDIDLHKASDRVNFGSIKEPIDVPYLLG
FT                   VQTDSFDWLVGNERWKKRVEEDEANGTNTVPHVSGLDEVFHEISPIENFAQTMSLTFSD
FT                   PYFEEPRHTVQECKEKDYTYSAPLYVNAEFENGETGEIKSQTVFMGDFPLQTPHGTFII
FT                   GGTERVIVSQLVRSPGVYFDRQPDRTSDKEIFGAKIIPSRGAWLEFEIDKRDFLGVRVD
FT                   RKRKQSAIVFLMAIGMTRSEIRDAFKDYPLVLDALEKETIDSEDAALVDLYRKIRPADA
FT                   ATPEAGRTLLDSFYFNTKRYDLARVGRYKINRKLGLEKDYNDRSLSREDIIATIKYLVT
FT                   LHAGDATFPGKRDGEDVELRVDVDDIDHFGNRRIRQVGELIQNQLRTGLSRMERVVRER
FT                   MTTQDAEAITPQSLINIRPVNATIKEFFGTSQLSQFMDQNNPLAGVTNKRRLSALGPGG
FT                   LSRDRASMEVRDVHPSHFGRMCPIESPEGPNIGLIGSLATFGRINPFGFIETPYRKVEN
FT                   GHVTDEVVYMTADREVEHVIAQANQKLDENGNFVEKEALVRDAAGEAEDVPVEMVDYMD
FT                   VSPRQMVSVGASLIPFLEHDEGHRALMGTNMQRQAVPLIKSERPLVGTGAEWRAAVDSG
FT                   DVILAEKPGVVIYVSADIIRVMNDDGTTSSYKLAKFQRSNQTTCYNQVPLIHDGERVEK
FT                   GTVLADGPATEKGEMALGKNLLVAFMPWNGYNYEDAVIISQRLVQDDTLSSIHIEEYEI
FT                   DARETKLGAEEITRDLPNVGEDAVANLDERGIIRIGAEVEAGDILVGKVTPKGETELTP
FT                   EERLLRAIFGEKSREVRDTSLRVPHGETGTVIAVKEITREDAEEDGDELPNGVNQMIRV
FT                   YIAQHRKITQGDKLSGRHGNKGVISRILPEEDMPFLADGTPVDIMLNPLGVPSRMNLGQ
FT                   VLELHLGWVAHAGWDISLDPDMEAEWKKMVPKGAEKGEPGTPVATPVFDGVRQDVLKGL
FT                   LSTTLTDRDGNKLVGDNGKATLFDGRTGEPYPKPISVGYMYMLKLHHLVDDKIHARSTG
FT                   PYSMITQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLHEMMTTKSDDVDGRVRVYGAI
FT                   VKGDNLPPAGIPESFKVLLKEMQSLSLNVEVLNAEGVAIDMKDEDDDPVSSSNDLGFNI
FT                   GARPDAAAKADQVADEPEYR"
FT   gene            273837..274796
FT                   /locus_tag="BIF_01980"
FT   CDS_pept        273837..274796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84733"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K1"
FT                   /protein_id="ADC84733.1"
FT                   /translation="MIVCGLLCTFGSSLRLSWATYVPRSTFGNWSSATQEVPVRFVFHA
FT                   IFCSSVTSAKNRRGRYAASHTSERQITSEPEVIVSTRLSAAVFMRHPSGLLPTYATRSV
FT                   KSSEPPTPTDVASGTSCTSTSPGVHVSTLLLCGAAGTSARLSAGAAEAPAMPCTLTAPR
FT                   TRLYTVNTASANTTASAEKNTMRRRRYRRLRSAAVMRFLPPVVRVVPRRGDCGELMLPV
FT                   YRARSPLLSPTSCTTPYWSFLQPHITSISYGMSVILTGCHLCTCVSNVFDILEVSSAKT
FT                   GLFRLLAGCAAAVKAASRRRRVTSRKNYRHPVTIEDIP"
FT   gene            complement(274809..275873)
FT                   /locus_tag="BIF_00775"
FT   CDS_pept        complement(274809..275873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00775"
FT                   /product="A/G-specific adenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84734"
FT                   /db_xref="GOA:D3R6K2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K2"
FT                   /protein_id="ADC84734.1"
FT                   /translation="MVTAYCGQSTVRPCRSGQSAVRCCAMVSDMADASPRTKSRKRAQA
FT                   TPEQTVGERRARELERSARQALRELATWWQTSARDLPWRYGRTTPWGVLVCEVMSQQTQ
FT                   MSRVVPYWEAWMSQWPDAASLAAAEKSEVIRAWGRLGYPRRALRLQECAEVVARDYDDR
FT                   LPREYDELMALPSVGDYTASAVLSFAYGERVAVIDTNIRRALSRAFLGVESLGGSCTPL
FT                   ERALAWVVLPKAAEQSVLWNQAVMELGALVCTAKAPQCEQCPLQPQCEFVKAGMPGLGE
FT                   KRTRPRQRFHGTDRQVRGSILQALRALPAGGALTHAQAEGLCADAVQLDRCIASLDDDG
FT                   LIEILPGHAMRLPA"
FT   gene            275872..276543
FT                   /locus_tag="BIF_00774"
FT   CDS_pept        275872..276543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00774"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00774"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84735"
FT                   /db_xref="GOA:D3R6K3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K3"
FT                   /protein_id="ADC84735.1"
FT                   /translation="MTAHSQNPQEIPAQHADPEAQVEKMFEYGYRKSNYGPDELVTDAH
FT                   GNPISVTDAMMTAREAAETPTTTPHLCYYSPRIPGNTGSAIRLCAVTGTILHLVEPLGF
FT                   NLRDTKLRRAGLDYHDMAHVVLHPNFEDLVESMPNSRIIAFTAHATKLYTEVEYKPTDI
FT                   LLFGPEPGNIPDPMDIMAGPHVAEQVRLPMRPSLRSLNLTNCASIAIYEAWRQLGFDGG
FT                   Q"
FT   gene            complement(276668..278032)
FT                   /locus_tag="BIF_00665"
FT   CDS_pept        complement(276668..278032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00665"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84736"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K4"
FT                   /protein_id="ADC84736.1"
FT                   /translation="MLNILEVHETNQMIEQEKLDVRTITMGIDLMDCVSTDLQTTCDLI
FT                   YNKITSYAKDLVSTGESIERDFGIPIVNKRITVTPIALVGASCCKTSADFVQIAHALDR
FT                   AAKTVGVDLIGGYSALVSKSMTPAEELLIRSLPAALSETDIVCSSVNVGSTKTGIDMNS
FT                   VELLGHIIKEIAEATADIDSYGCVKFVAFCNAPDDNPFMAGGFHGVTEGDAVINVGVSG
FT                   PGVVSRALDAAKGKDFEFLCETIKRTAFKITRVGQLVAQEASKRLGIPFGIIDLSLAPT
FT                   PAVGDSVGEVLEKIGLAQVGAPGTTAALAMLNDQVKKGGIMASSYVGGLSGAFIPVSED
FT                   KNMIDAAESGCLTIEKLEAMTCVCSVGLDMIAIPGDTTASTISGIIADEAAIGMVNQKT
FT                   TAVRVIPVVGKTVGQMANFGGLMGYAPIMPVNTASCEAFVTRGGRIPAPIHSFKN"
FT   gene            complement(278077..278373)
FT                   /locus_tag="BIF_00666"
FT   CDS_pept        complement(278077..278373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00666"
FT                   /product="ACT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00666"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84737"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K5"
FT                   /protein_id="ADC84737.1"
FT                   /translation="MKNRAGSSMNKAIITVVGQDTVGIIARVCTYLSDHHTNVLDISQT
FT                   IIDGFFNMMMIVDYADADVSFETIVNDLEELGEEIGVRIRCQREEIFTKMHRV"
FT   gene            complement(278474..279715)
FT                   /locus_tag="BIF_00667"
FT   CDS_pept        complement(278474..279715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00667"
FT                   /product="Sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84738"
FT                   /db_xref="GOA:D3R6K6"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K6"
FT                   /protein_id="ADC84738.1"
FT                   /translation="MNLSALRRRSAMSSSAADSFCRAPCPRRRPPRRTACSDLLADALS
FT                   TSRRAQHGGLCVVMGQGSEKGLQAFAISVASAAGIRYTRLRAKQRGSIWREHRRTATIC
FT                   RRTASPRWTPVAAAAQAKRKKRANRRFMLMIISMVIMLLVGVGLIVYPTVADAWNRHVS
FT                   SRAIAGYSEQVANTPKEDREAQIKKAREYNENLLGQGNARFLPNGEEKKVYNSILDVSG
FT                   TGIMGYIAIPAIHAKLPIYHGTDETVLQIAAGHYEGSSFPIGGESTHAVITGHTGLPSA
FT                   QLFTGIDGMKKGDKFSITVYDDVLTYEVEERQVVLPTNVKPLAIQEGRDLVSLVTCTPY
FT                   GVNSHRLILTAHRIPTPENKKEVEVNPERAIMSDIAITAFVIVGVAVCMATIVITQRRR
FT                   RKTHAHGSHLRSRK"
FT   gene            complement(279603..280871)
FT                   /locus_tag="BIF_01979"
FT   CDS_pept        complement(279603..280871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01979"
FT                   /product="Galactokinase"
FT                   /EC_number="2.7.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01979"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84739"
FT                   /db_xref="GOA:D3R6K7"
FT                   /db_xref="InterPro:IPR000705"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019539"
FT                   /db_xref="InterPro:IPR019741"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K7"
FT                   /protein_id="ADC84739.1"
FT                   /translation="MLKGLSMTSVEFIEPMSDAEGAARAAELFKQAYGKEPAGVWAAPG
FT                   RVNLIGEHTDYNAGLCLPIALPHRTYIALSPRDDTSVRVVSDLASDVIAEADLDGLEAG
FT                   GVDGWAAYPVGVAWALRNAGFDGVQGFDAAFSSCVPLGSGLSSSAAMTCSTALALDDVY
FT                   SQGFGDTDEGRVTLINAAIASENDMAGASTGGLDQNASMRCTPDHAIRLDCRPGLSAVD
FT                   SVQQEVFDLEGHGLELLVLDTRAPHQLNDGQYAQRRATCEEAARILGVANLREVADLVN
FT                   AQADPAAALDGVLDRLDDETMRKRVRHVVTEIGRVDDFVRAFAEGDMQTAGELFNASHD
FT                   SLRDDYEVTVPELDVAVDVARDEGALGARMTGGGFGGSIIALVNAGESQRIAQAICDEF
FT                   ERRGFVLPRALPAQASASAHRVQ"
FT   gene            complement(280920..282203)
FT                   /locus_tag="BIF_01978"
FT   CDS_pept        complement(280920..282203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01978"
FT                   /product="Galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.10"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01978"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84740"
FT                   /db_xref="GOA:D3R6K8"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K8"
FT                   /protein_id="ADC84740.1"
FT                   /translation="MMTPMSQTPNQPEFAHYQPGEYAAEHLRITPTTLSDGRDFFYLDD
FT                   EPEYVNGSRTRVLDDPRDLDYRFAPHLNAEGVEVKYAAPQMRRDPLTGDWIPMATARMN
FT                   RPITAGAGATAKGNPLAARKPGDPYQDGEVPDTDYDVVVFENRFPSMVQVPGVPNEVRY
FT                   VDGNPLWQERPAAGRCEVICFDSDENGLPADLPVERLRTVVEAWAFRTAELSAIDGIEQ
FT                   VFPFENHGEEIGVSLAHPHGQIYAYPFIAPKLETELQHTQAYFERTGGNLLRDLMHAEI
FT                   DAGERVIMRNHSWVAYVPAAARWPLEVHVQPLRDGILTLDQLNDAERWDLAQMYSTLLR
FT                   RGNRFFDKGDGKGMDLPYIAAWHQAPVRDARRENYRLNLQFFSFRRAANKIKYLAGSES
FT                   GMAAWVSDTTPELIAQRFHELGPVDIAD"
FT   gene            complement(282200..283069)
FT                   /locus_tag="BIF_01940"
FT   CDS_pept        complement(282200..283069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01940"
FT                   /product="Transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84741"
FT                   /db_xref="GOA:D3R6K9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6K9"
FT                   /protein_id="ADC84741.1"
FT                   /translation="MVNTPKCSFQVVLWKKMCDNVRMISSQRQHLILGRLRTRGAVRIT
FT                   ALSKEFGVSAMTIRRDIAELADKGLLRRVHGGAVSTSTLLSEPLFSVKSQMDIGLKDAI
FT                   AGEAIKFVSPGDVIAIGGGTTAYVFAQHLLESPNANGITILTNSIPVAELVQALESKDV
FT                   EVIVTGGVITRSNSLVGPIADKVIASLRVNTVFLGTHSVSMPRGFLMPNSLEAATDMAM
FT                   MDIADRTIILTDHTKWSSTSLSLFAKFDQVDTVITDDGLDPDSVAKTRDLVKELVLAHQ
FT                   IETEEESE"
FT   gene            283040..285493
FT                   /locus_tag="BIF_00336"
FT   CDS_pept        283040..285493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00336"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84742"
FT                   /db_xref="GOA:D3R6L0"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L0"
FT                   /protein_id="ADC84742.1"
FT                   /translation="MKRTFRRVYHTTPNKTAYIAELRIPSPTPRGAPLLAFHILLGLLG
FT                   IILSQARILTHQLPRQLQIVLDLPFHPLVVVQNRLLHAREAPLRHLTHRLAHNGAIHLR
FT                   VALRAIRKHDRHLHHMPAGGDHAARHIDLEHVAVRIDAVEVDLPQNPGAICAETARHIA
FT                   HLEPEHHARVLRTGTRDHVAVPWPVLRGATGNAPGAKHQIHLRVPLEHVDDCSQILRPV
FT                   RAVHVHLAHDVVPMAKRPFESLNVRGAQSLLAGAVQHKDARIHRARGQSVGDLQILGAH
FT                   LRVGIQRGIGILICKTHIAQYIVLVMLHVEILRQPRHARDYVGERAGAVGRVVVHDQHI
FT                   HAGIAQKEVGERGLQIVTFIVGGHHHAHTVPAVHLRHPHALPSFEHPLFDRLHCRHTPF
FT                   PQHSLAEREFARSGRNAGRVHAGMHFCPINGTMVCMAYVSQNGLHDSINKATTDLFTFA
FT                   YKHVIKPDLVFNHTPDIAHDQMIRFCQITGKMPPLMWLCRTMLNYTDPILETNVMGINF
FT                   ANPFGLSAGLDKNCDMAAVLDHAGFGFETVGSTTSRPCAGNPRPWFHRLPEYDSMMVHV
FT                   GLANDGSDVVIERAEDAWRRTQSMQLSVSIARTNDDQVGDLNEGIEDYCISMERAAGRT
FT                   AMVEVNVSCPNTTVGEPFTESAENLDKLFAALDRIERPQPTLVKMPLNKPWPQFKEFLD
FT                   VLAAHNVQGVTIANLQKDRTGLDDIPKDWLGGLSGGPCTVASTELIRRTYAEYGDRFAI
FT                   AGVGGVFTPEQAYEKIRAGSSLIMFISSLMYRGPQQITVLKRGLAKLLRRDGFGSVAEA
FT                   VGVDA"
FT   gene            285523..285618
FT                   /locus_tag="BIF_02182"
FT   CDS_pept        285523..285618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02182"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84743"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L1"
FT                   /protein_id="ADC84743.1"
FT                   /translation="MGYSDDPWNDCSANSMHLHRYQRGRLGLPIG"
FT   gene            complement(285792..286922)
FT                   /locus_tag="BIF_00471"
FT   CDS_pept        complement(285792..286922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00471"
FT                   /product="NADH-dependent flavin oxidoreductase"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84744"
FT                   /db_xref="GOA:D3R6L2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L2"
FT                   /protein_id="ADC84744.1"
FT                   /translation="MGKSKDSKKVKAQQPTLFTPFTLRGITARNRIWMPPMDTYSAFAL
FT                   DGRPGNFHYQHYVSRAMGGFGLIIVEATAVTPDGRISPCDLGLWEDSQIDSYRWIAQGM
FT                   KDAGAVPAIQLNHAGRKGSTSCFAIRTDSGYVSPELGGWQTVAPSELPFGDLPAPRQLT
FT                   VDEIHDIVNRFRDAAWRAMEAGFEVIEIHAAHGYLLSEFLDPLVNDRDDEYGGSLENRI
FT                   RIVIEVADAIRSVIRGDMPLFARISATDWAEGGWDLDQSIVLAKALKEHGVDLVDVSTG
FT                   GILPNVTIPTKPGYQVPFSEQIRKKADVPVTAVGLITKPKQAARILAKGEADAVEIGRA
FT                   ALREPYWPLRAGFKLGEPTDLLPYPPQYVRGAWRNE"
FT   gene            complement(287215..289419)
FT                   /locus_tag="BIF_00394"
FT   CDS_pept        complement(287215..289419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00394"
FT                   /product="Multimodular transpeptidase-transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84745"
FT                   /db_xref="GOA:D3R6L3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L3"
FT                   /protein_id="ADC84745.1"
FT                   /translation="MPKKKNLTGARILALALAFITLCLGGGVTLAVLFLPTVMGANQVV
FT                   KAVTPSMQVEGIDFDVTNLPQKSTMYASDGKTVIAEFYAQNREVVPLKDISKPMMQAVV
FT                   AREDRRFWEHAGVDVQGVLRAFVQTYMKKGDQQGGSSLTQQYVKNVLATQAREKDDPIA
FT                   EYHATEDTIARKMREMLISVQMEKKYSKQEILQGYLNIAQFGTNSLYGVQAAAERYFNT
FT                   TADKLNIVQAATIAMITKNPSKYDPSIPENREEAQKQRNIVLELMKNQHFITQAEYEEA
FT                   VKTPLVDTLHITPVSRGCMAAKYNTGFFCDYVVHRIENSPEFGKTAKDRERLLQEGGLQ
FT                   IVTTLDLDASNALMDVANKTIPANDSSGMEIVMASVKPGTGEVLGFGLNRAYDATDAAA
FT                   TDQTKSSMNYAVDQIDGGGQGFPIGSSWKPINLVAWMQQGRSVNEMLVAPTDFLTNRFT
FT                   CNGYTGGTDNWHVTNALTNGTVSPESPFLGLVHSHNTTMAAMGAQIGLCAVADAAKAVG
FT                   YHNAKIGQEDVYSDISMHPALLIGGTTSVSPLTMANVYATYAANGVECTPIALKKVTNS
FT                   DGKDLDVPKANCHQAVDKDIIQTLAYTMNQGVTRPDGAAGAAQLANGRKTFAKTGTNEN
FT                   MYVTTGGFIPNQIATFVLVGDVQDPTNHPIENIAINGNYHGYWDGSTIAAPAFKDAMNQ
FT                   YADKKQLPMDNDYGQPVDKYTNSVGVQSNRQGTQQNTQRR"
FT   gene            complement(289550..290344)
FT                   /locus_tag="BIF_00395"
FT   CDS_pept        complement(289550..290344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00395"
FT                   /product="Transcription regulator, crp family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84746"
FT                   /db_xref="GOA:D3R6L4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L4"
FT                   /protein_id="ADC84746.1"
FT                   /translation="MLFDRYLWRNGMNQSAERMPSGAMSDEPAGMGDARERRNPLLETA
FT                   LFKQVSEEQARELVPYLHHEEYDKGEYIFTEGDTDQRMYVIQEGRVKLTRQSVDKRVQL
FT                   LSIHTRGELLGEIPVFDPQGGPRTANAVAMVDGTQVVWLDHDALFAWLSKYPGVAVDML
FT                   QVLANRMRANNERIADLVFSDVPGRLAKTLLSLASRFGKPVEEGLQVPHDLTQEEMAQL
FT                   VGSSRETVNKALMDFANRGWIARNGRTIIIYQPGALIRRSQR"
FT   gene            complement(290351..291514)
FT                   /locus_tag="BIF_00118"
FT   CDS_pept        complement(290351..291514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00118"
FT                   /product="Lipoate-protein ligase A"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84747"
FT                   /db_xref="GOA:D3R6L5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L5"
FT                   /protein_id="ADC84747.1"
FT                   /translation="MRSGEVKIPGGKLVRVTLQGDEVRGWHATIDGDFFMEANAGSVLG
FT                   RAQSAIDAHLPELPDDWEHWGSADYLAFYRALSGELRGVIGDTLIGANGEAIALAVVRA
FT                   LVGGGARESAQTAEREFERIREARATRQGERAQSGDEPAPMLIGLQDAKRRWARMNPQT
FT                   VVDIPRMPAEQMQVDELWATQVANGERQATLRIWDWAAPAVVCGKFQSIADEVDLEYAK
FT                   EHGIEVVRRDTGGGAMFIEPQNTITYSLYVPEPVVAGLDARQCYQFCDMWLLEALAACG
FT                   VRAHFAGLNDIASAAGKIGGAAERRFPASGEGPGCLLHHDTLAYAMNTEHLQHVLRPSK
FT                   EKMSDKAVKSASKRVDPMNSQTSCTRAQIVDCMLETASRFGVVGNTI"
FT   gene            complement(291611..292075)
FT                   /locus_tag="BIF_01866"
FT   CDS_pept        complement(291611..292075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01866"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01866"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84748"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L6"
FT                   /protein_id="ADC84748.1"
FT                   /translation="MSDPNGYQPQGGDQQNNGVSGAAQAPQYTQPAQNYAAPQYTQSQG
FT                   GYNGQYQDPNAYAQQNYTYAQPPAAYPTYLPRNKYVAAALALFFGIFGLHNFYLGYTGK
FT                   GVAQVLISVLTFGIGAIAVMIWAIVEAIQILTADYGTEHHRDARGVELQD"
FT   gene            complement(292447..292581)
FT                   /locus_tag="BIF_02147"
FT   CDS_pept        complement(292447..292581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02147"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84749"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L7"
FT                   /protein_id="ADC84749.1"
FT                   /translation="MCCNCNEEAPFNYSNGFQTYARPTSGPYIATTHIPSEYGPVYVD"
FT   gene            292702..293778
FT                   /locus_tag="BIF_02148"
FT   CDS_pept        292702..293778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02148"
FT                   /product="Glutamine amidotransferases class-II"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02148"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84750"
FT                   /db_xref="GOA:D3R6L8"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L8"
FT                   /protein_id="ADC84750.1"
FT                   /translation="MPAAVFGDVEFHGGVDFRGGVVESEMTQQHGGGEDRGGRVRDALA
FT                   CDVGGRTVDRLEHGRVFVARVDAAGRRITHAAHDRARLVSENVAEQIVGENHVEARRIG
FT                   DQVDRGRVDVRIVMLDLGVFGGHLVHDVLPHVAGVDEHVLLVHERDVLAALHRQLEGVA
FT                   HHAFDAVRRVDGDLGGHLVLGAAADRTAGTAVEAFGALAHHHKIDLARVRQRRLDPRVQ
FT                   LRRAQIHILVEREPQLEQQAAFENSRLDARVAHRTEQNRVGALDAFEIFVRQNLAVTQI
FT                   PLRPQVERFVLEGRHSLGGFFERLLCPRGHFLANAVAGNDGDRVLLCVLSHMGRLPART
FT                   RRFRAVFSSWTFRRERFA"
FT   gene            complement(293865..296330)
FT                   /locus_tag="BIF_00168"
FT   CDS_pept        complement(293865..296330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00168"
FT                   /product="Protease II"
FT                   /EC_number="3.4.21.83"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84751"
FT                   /db_xref="GOA:D3R6L9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6L9"
FT                   /protein_id="ADC84751.1"
FT                   /translation="MEVCGCPFLRKGGCAGIIFGLMTGMHVFPKPPEAKQVPSVRTFHG
FT                   DTFTDPYEWMRDKDSADLKSYVAAENAYTSARTAGLANLRKTLFDEFRSHVQETDMSVP
FT                   TRLDGYWYYARTQEGKQYGVQCRMPIRGEDDWTPPEINANDAPGVIPGEQVILDANTEA
FT                   EGHDFFQIGGMDISKDGTWLLFGVDTSGDEQYDFRIRNLDTGEQLPDELDGLAAACFTP
FT                   DGRYVFATLLDDAQRPYAIRRHKVGEPVERDVIVYEEHDEKFWVGIGLSFDERNLVIGT
FT                   GSKTTTEVLMLPTATPEGEFQAFIPRQEGVEYDVSFAVFEHAGEHGEDLPVAIVYHNLA
FT                   NPNFEIDVIDMSAARPPYRIGDGVRIVQGSPYGSEDGEKVIAGASAMPVGTPYDDATNP
FT                   QILRGVRGLAVEGIAMHEHFVALSYRANGLPKLAVMSKQQAAQDFLARRPWQFAEVNVP
FT                   ELDGDWDGASDDAAVNPPQLKDFEGSSARLYSIGTAGNPSYEAPRMRYMVTGYTRPGEL
FT                   REFDPRTGEDVLLKRANVLGSFDARDYVERRIWVQVRDGEQVPVSLVWRRDCVRGRMPM
FT                   FVIGYGAYEISSDPAFSVSRLSMLDRGVLYVVPHVRGGGEMGRAWYEMGRRRNKKHTFE
FT                   DFIDVTAAIQDCGLADRARTVANGGSAGGLLMGAVANMAPERFAGIEADVPFVDALTTI
FT                   LDPTLPLTVTEWDEWGDPLHDAETYRYMKTYTPYENAPAPGEGGARWPDGTPVTAFPKI
FT                   FVTTSMNDSRVMVVEPLKWVARLQAAGLDAIIKIEAEAGHGGTSGRYAQWKQICYENAW
FT                   VLAAMGIEE"
FT   gene            complement(296486..297997)
FT                   /locus_tag="BIF_00093"
FT   CDS_pept        complement(296486..297997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00093"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84752"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M0"
FT                   /protein_id="ADC84752.1"
FT                   /translation="MAYTDRSDRELRKTKRLLEAALAQVKREQAERARLAADGDGSTVA
FT                   TQGRTVRSGEGPTDADFDDTQHAGSAETRVITGIANGQAETETPERQWRAPAVALRTTS
FT                   AATSTDDMPTVAVPLGSLSAAKAPAGRTRLRRNPKLVSSIKRVLRKAITWTFGLWIRFS
FT                   TAIAKQLHWFPMVKPYVGYGTEEYSRLVCRTILAPADGQPNKPMRGIHAMLEVPAPGQC
FT                   VQIDIDGVPLRTVQVGTMEVYNPVDSARSVTMDYSVSDSAGYLDLLAEHRLEPGVHMVS
FT                   CKVTRRPAVEAELFTIPSTAKVGVISDVDDTCMVTQVPTLWKAVYNMLFLSPHKRASVP
FT                   GMAVMYNKIASMFPGAPFFYLSTSPWNVENSIRNFLKDYGFPDGPLLLRDLDPRPKTFV
FT                   PSGVQHKLEYAEQLMEDFPDMKFILIGDDGQKDPTTYAEIARRYPGRVLAIGIRQLSPK
FT                   ESGGFGTMSGFSTTQPVPVTDVPVFTGTTGSNIMKTMLPYLRQFM"
FT   gene            complement(298054..298464)
FT                   /locus_tag="BIF_01867"
FT   CDS_pept        complement(298054..298464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01867"
FT                   /product="Probable glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01867"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84753"
FT                   /db_xref="GOA:D3R6M1"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M1"
FT                   /protein_id="ADC84753.1"
FT                   /translation="MAEENEQGTHLDVPDFLQYSHDHVWVDESVTPAVLGITEFAANKM
FT                   GDIVFVDLPEVGMRVEAGDELVQIESAKAVEPMISPVAGVVRYVNSETEDDGAVINDDP
FT                   YGEGWIVKIELDDDEPDLLSAGEYAKFIAQQQ"
FT   gene            complement(298528..299637)
FT                   /locus_tag="BIF_00629"
FT   CDS_pept        complement(298528..299637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00629"
FT                   /product="Phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84754"
FT                   /db_xref="GOA:D3R6M2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M2"
FT                   /protein_id="ADC84754.1"
FT                   /translation="MFAPLALTQALPYLPLAQGDIDYQVERRADPQLIEQVLQMPSTCV
FT                   LLCRKGKVAVPFGQHNMAQLAASRMRLATLPGSYVARALEHGNNGVVAMYLGRYKGAHD
FT                   EHAIALDLTAVEEGEELRRVEERAAAAGHAVDAAFGDDVDARESADSNAVNMFEQAVER
FT                   FDWVDLRMFAPHASSREIGQAVTMLSLANWHDMQRHCPHCGAPTEPAMSGWAQRCTSES
FT                   DDHRILFPRVEPAVICTVVDAKDRLLLQHNRAWKHSNLFSVSAGFVETGENLEHACRRE
FT                   TMEETGIRVGEVKYLGSQPWPFPFSLMMGFKAQALSNDIHVDGDETIAARWVTRDEYTN
FT                   LLVTGEIEAPGKATIARVMIEEWYGRELD"
FT   gene            complement(299637..300578)
FT                   /locus_tag="BIF_01287"
FT   CDS_pept        complement(299637..300578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01287"
FT                   /product="Hydrolase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01287"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84755"
FT                   /db_xref="GOA:D3R6M3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M3"
FT                   /protein_id="ADC84755.1"
FT                   /translation="MREMGMADDHARELPVIANHVIREGNGIPLVLVHGFPVDSRMWGR
FT                   CAMALMELSDADELVQYPIWAPDMPGAGESPVPTAAQSGRENEDGSLPDGLDRIADAYV
FT                   ALLNDAGYTQAIWAGLSMGGYVVLGIQRRHPQAVAGIALLDTKGDADSDQAHASRIAIA
FT                   KECVERQTTEPVMFFVDVHEGDSSVKKSAAYIDQFSQWIREQQPDGVAWRERMAAARPD
FT                   LNDEFAKITAPAAVICGEEDPSSAPAVMRPLAERMVNTTVVMTEIEDCGHFSAWERPET
FT                   VARALHELVSRVPAAAGADPAAADAAIAAREA"
FT   gene            300685..301440
FT                   /locus_tag="BIF_02149"
FT   CDS_pept        300685..301440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02149"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84756"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M4"
FT                   /protein_id="ADC84756.1"
FT                   /translation="MPIVHLLNELGNLRAMRIHPLHVERLILRLAVTGDRHHIAQRNRM
FT                   LARVEVRRDSRGREELGHRERCQRLRQHRQCELAHVLRNVAGNRLTQRLVIQHAASDQR
FT                   ALHNRLVVRHAQQGANLRDAAEIIDAHGHDLHIRNGHARTQIGNVVGTEPAGRVARATR
FT                   DVFGRDVVELAAGASGVEIAVIGHFIIQDSHTPIMTRASNERTPAGRIRHADIFTSWRI
FT                   AGNSRNELLNMGLYVNKGRQETPRQTLRS"
FT   gene            301443..301838
FT                   /locus_tag="BIF_01289"
FT   CDS_pept        301443..301838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01289"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01289"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84757"
FT                   /db_xref="GOA:D3R6M5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M5"
FT                   /protein_id="ADC84757.1"
FT                   /translation="MAVKELTSADFEQAVKGNEIALFDFFATWCGPCKAFSPIFDKVAD
FT                   ENPDIFFGKIDIDKNQELANAANVQAVPTLMIVKKGHVIYQEAGALREADLNDLIGQAK
FT                   ALDVEAALAAAKAAGTDQDELIEEHDA"
FT   gene            302103..303197
FT                   /locus_tag="BIF_01290"
FT   CDS_pept        302103..303197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01290"
FT                   /product="Membrane-bound transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01290"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84758"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M6"
FT                   /protein_id="ADC84758.1"
FT                   /translation="MASALSADFRRRMAHHSKHNAPTLRSLSKRQWIRISTAMASVGLV
FT                   VAGVVATQSMYSRAEAQPTPSATAYSITESNHAASRGNAREAMDGDTSYVTVKVNGKSR
FT                   VVLGQDFTDVKSVLDAGDITLEPGDQVNPSLTTKVDESTTISIERQGAKMETTESKIPF
FT                   NTVKKDDPSLPKGTEKVQTEGEEGILEKTNLVTRTGDKVVSSNTFATWVKKAPVEKVVL
FT                   VGTGNPQPAATSAPAQTSNNSNTNANNSSQQAAASSIGSTAPVGEMQQWAHDYLLANGG
FT                   SEGDFTATVYIISRESGWNVNATNPSSGAYGLAQALPGSKMASHGADWQSNYQTQLKWF
FT                   WDYCKGRYGSVQGAYNFWQANHWY"
FT   gene            complement(303469..305145)
FT                   /locus_tag="BIF_00983"
FT   CDS_pept        complement(303469..305145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00983"
FT                   /product="Undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00983"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84759"
FT                   /db_xref="GOA:D3R6M7"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M7"
FT                   /protein_id="ADC84759.1"
FT                   /translation="MLGGGAEGNTVRDTSRWTAGSSMQTQEIRIVTGHEQNHRAESKES
FT                   TRQQLPYEPITFYNTSFEESGKKRANHLCNAPRWRFLFIFTIAVVDVISMLIAVVGVLL
FT                   VNREAYTTIERYMPVWAFIVLYCIVWLTCLVWRGTYHRHIMAEGYELYVEVLNATIATI
FT                   VVFCFIVFMLHLDYPRTILLVAPIFGMVLALFGRLFLRLMLHRKREEGEYKYNTVIIGS
FT                   SAGINSVLKLFDANRNWGYRAVAICPIEKVPDRDDAYIMTDFVPEEGIAEKYAVQTVPL
FT                   NSNFPRKLQQIGVQEVFVADVLDRDSKLLHGIALAIESLGMELALSVALADVAGHRLYL
FT                   HNTTEQPILLASLPQYRATTFLLKRIFDIVLSSLALIISSPIMLGVAIAIKLDDGGPIF
FT                   FKQTRIGLHGRRFQMYKFRSMVTNAEEVKKKLMQETGQTDRFIFKMKDDPRITRVGRFI
FT                   RRTSLDEFPQFLNVLKGDMSMVGPRPALPEEVARYGSLYSARLLVKPGITGPWQISGRS
FT                   DLTEEQSEYLDVSYIENWSITGDIAILIKTVWVVIRGTGAY"
FT   gene            complement(305342..305797)
FT                   /locus_tag="BIF_00982"
FT   CDS_pept        complement(305342..305797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00982"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00982"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84760"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M8"
FT                   /protein_id="ADC84760.1"
FT                   /translation="MYMSSLQGFEVVSPNTASGRSVLTVTKNYARLNKNAVLELGRPEF
FT                   IEFFINPTTKQFAFKACEESNPNAIPFFIPGKTTASVTLNQQFVLDAMGPYFEFPEVED
FT                   DQEAYAQIKGTLLNSEDMLVFNAAKAEQGVMKKRGRKKGQKVKVSEA"
FT   gene            306104..307642
FT                   /locus_tag="BIF_00465"
FT   CDS_pept        306104..307642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00465"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84761"
FT                   /db_xref="GOA:D3R6M9"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6M9"
FT                   /protein_id="ADC84761.1"
FT                   /translation="MESICYGTIRKRTVPRADDEPSAAGNPRRKETHMEATNGDSEKTM
FT                   QSAQRHRHTDKVSSPFPELIGKGLRESWKMMALFLIISMVEGIAFITTTAPLTMADPDM
FT                   HLPSTYALATGQSFNITRAPESHRQYDPRTSEVPSSMPVGGRQLLTGEARYLQGSVNGA
FT                   KNALVESINPFDLTRNDEYATQCDRLNNLAEGERIITTPTRSNQYMFFAYIPQAIGMKF
FT                   GFLTHANPSTCINYARASNLVCYLLLFLLAIAVIPTAKGIIALLGMLPLPVFCSSTLMT
FT                   DGTLFAAVALFIAVCVRLMQRERRLNNWQVAALTVGTCLICFLKYVYIPIILLPWLACK
FT                   ALSGKQKVWYTASTVLVVGATVLCWQKFFGYNPERVEGLYAYNFNAALHNPFGTTFRIL
FT                   ANVFLTTFNMVQSNPTLIVCLILLLIAWMFGQDARIAVPRRTTMQVYTLVGFIVFATLF
FT                   LMYIPFLLTWTLPSESLRLDGLQVRYYYPILPLLVIPFIYRYKTGTKDLVTVHQ"
FT   gene            complement(307626..308633)
FT                   /locus_tag="BIF_01807"
FT   CDS_pept        complement(307626..308633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01807"
FT                   /product="Glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01807"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84762"
FT                   /db_xref="GOA:D3R6N0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N0"
FT                   /protein_id="ADC84762.1"
FT                   /translation="MTTHQTTAVLIPCLNEEQTIGKVVADFRRELPDAVIYVYDNASDD
FT                   RTSQVAADAGAIVRMAPERGKGNVLRRMLRDIDADRYVLVDGDDTYPAEDVHTLLDTLD
FT                   QGWDMVVGDRLSSTYFTENKRPFHNTGNRLVRSAINSTFHAQIRDVMSGYRVFDNLFAK
FT                   AYGVMSNGFEIETEMTIFALDRKLRVTEVPIQYRDRPEGSTSKLSTFSDGAKVLNLIFR
FT                   LAYENRPLPFFGTLGGIIGGVGLGLALWVCIEFAQTGMVRRFPLLIGSTMLMIIGVIAV
FT                   FTGLVLAVFARKDRSRFAFAAQTYIAASGRHPSVSEPYRACVDEVSHEPVTDGQ"
FT   gene            complement(308711..310636)
FT                   /locus_tag="BIF_01545"
FT   CDS_pept        complement(308711..310636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01545"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01545"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84763"
FT                   /db_xref="GOA:D3R6N1"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N1"
FT                   /protein_id="ADC84763.1"
FT                   /translation="MIWIPIRYERVGMSRTEGNEPEIEKSIDQSAESAGTAPQSEPAAS
FT                   QEREVAAPKRPWYKRIRWWGWTLIGIFAVLVAFFGTFGVQAMMVKNYELGSIDTIRRTA
FT                   MSGNVKELPNAVSKMQENTRKANRITHNGLWNFIGSWPGMGSNIGAAQDLTQIVADVSQ
FT                   DVVPKYIDIASNIMSDKLFSNGQVNIKPVTAQYVNFVEANSDLMSQLARINDIPEPSIG
FT                   VVRNLVNMAKGYVGTADGLLKQAETIMQDLPSYLGYKEPQTYAVMAMTPAEMRMSGGLI
FT                   GAIGTLTLNKGKIEIGEFLPNDAYVKEGGADVDFDTKRIFMNDGPLYMTYDVRDLANFT
FT                   DTEMTANAFLSLWKRMPWGEKTTLNGIIMVDPVVVQALVKVTGDVKLPDGTVLNGNNTA
FT                   QFMMNTVYTEHEPEETNAYFGIVAKACVGTLMKHMDMKTIGSLAKDLRTLAKERHLAMY
FT                   SFTPSLEDLIKAAGFSATLPTDKVNPTLGVYLTEQNPSKMGWYIKRSTKIKQICTDSAP
FT                   YKYQVEYTLENTLKEDEVGKLSWYITGQFPYNEGASLDKVFFYPPYGGELSNFKVQGTG
FT                   SVPAMDSFNAAIMYRSLAQVRPEQKVTYTFDVTTSKQAASRLAVDQTPMGTENTNVEYL
FT                   NSCPVN"
FT   gene            complement(310744..311634)
FT                   /locus_tag="BIF_01544"
FT   CDS_pept        complement(310744..311634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01544"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01544"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84764"
FT                   /db_xref="GOA:D3R6N2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N2"
FT                   /protein_id="ADC84764.1"
FT                   /translation="MKGIILAGGSGTRLYPLTTVTSKQLLPVYDKPMIFYPLSALMMAG
FT                   IRDILIISTPKDLPNFERLLGDGSRYGISLQYKVQPSPDGLAQAFLLGEDFIGDDACAL
FT                   VLGDNIFYGNGLGRQLRKAAALEHGATVFGYYVDDPERYGVVEFDKEHKAVSIVEKPEH
FT                   PASNYAVTGLYFYDNRVVDFAKQVKPSPRGELEITDLNRMYLDDGSLHVQTLGRGYAWL
FT                   DTGTMDSLFEAGEFVRTVEHAQGLPISVIEEIAYENRWIDRDQLLAAAERYGKSPYGKH
FT                   LLDVAEHRFLSTIDD"
FT   gene            complement(311648..313099)
FT                   /locus_tag="BIF_01543"
FT   CDS_pept        complement(311648..313099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01543"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /EC_number="1.1.1.133"
FT                   /note="dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01543"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84765"
FT                   /db_xref="GOA:D3R6N3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N3"
FT                   /protein_id="ADC84765.1"
FT                   /translation="MEFEKELKVTETNIPGLLVFDLPVHGDNRGWFKENWQKAKMTALG
FT                   LPKDFQPVQNNVSFNAKRGVTRGIHAEPWDKFISLATGEIFGAWVDLRPGDTFGQVYTT
FT                   RLDPSKAIYVPRGVGNSFQALEDGTAYTYLVNAHWSLEQKKTYTFVNLADPELNIQWPI
FT                   PLEQAELSEADLHHPMLKDAKPMDPKRTLVTGANGQLGQSIRKYVEEHDLKGFEFTDID
FT                   EFDFSDPAAYEGYDWSLYGTIINAGAFTAVDKAETPEGRVTAWKANALGPALLAKVATE
FT                   HNLTLVHVSSDYVFDGTAKVHDEDEAFSPLGVYGQTKAAGDIAVANAPKHYIVRSSWVI
FT                   GNGHNFVKTMMMLSNKVSDPNDALNEVTVVDDQYGRLTFTDDMAAAIFHLLDDEDPYGT
FT                   YDLTGSGDVVSWAQIAAEVFAMTNGNGDKVRPISTEQYFESAKAPVSPRPTNSTLDLAK
FT                   IEETGYETTDWHDSLKAYVEVELKK"
FT   gene            complement(313174..314217)
FT                   /locus_tag="BIF_01541"
FT   CDS_pept        complement(313174..314217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01541"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01541"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84766"
FT                   /db_xref="GOA:D3R6N4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N4"
FT                   /protein_id="ADC84766.1"
FT                   /translation="MVVAKLMPMTDAFIPKNIIVTGGCGFIGSNFVHYVYNNHPDVHIT
FT                   VLDALTYAGNLENIKPILGDRVEFVHGNICDAQLLDELVPGHDAIVHYAAESHNDNSIA
FT                   NPEPFVKTNVEGTFRLLEAARKYDVRFHHISTDEVYGDLALDDPAKFTEETPYHPSSPY
FT                   SSTKASSDMLVRAWHRTYGLRTTISNCSNNYGPYQHVEKFIPRQITNIIEGIRPKLYGD
FT                   GLNVRDWIHTEDHSSAVWTILTTGRLGETYLIGANGERNNLTVLHDILRVMGQPEDAFD
FT                   WVKDRPGHDRRYAIDSTKLQTELGWRPTHTDFESGLRQTVQWYIDNPQWWEPAKAATEA
FT                   KYKAQGQ"
FT   gene            314349..315314
FT                   /locus_tag="BIF_01904"
FT   CDS_pept        314349..315314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01904"
FT                   /product="alpha-L-Rha alpha-1,3-L-rhamnosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01904"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84767"
FT                   /db_xref="GOA:D3R6N5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N5"
FT                   /protein_id="ADC84767.1"
FT                   /translation="MQPEIEILMATYNGAEYIEQQIESIQQQSVPNWKLSISDDCSSDG
FT                   TLGILQRMANHDTRINIVSQGVKYGSPQANFTFLMSQASGQYVFLADQDDIWHTNKLEL
FT                   FMQRMHNAEARYGKNAPILAFSDLVVVDANNHVIAPSFLRFIGRNPHRTQLNELLAQNL
FT                   VTGCASAMNTALLNVIQSWDPENANRMIMHDWCYALIAATLGHVVYVDEATVNYRQHGD
FT                   NAMGAHSYSALKTFMSLVIHRNSIRRQRVTHMNHMLDQATYIRDALSDLQQTRNLIILD
FT                   QYCALPQMTKRQRTHTLFAYEFWPNKFMDRIVQLATIRAL"
FT   gene            complement(315316..316779)
FT                   /locus_tag="BIF_01540"
FT   CDS_pept        complement(315316..316779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01540"
FT                   /product="Capsular polysaccharide repeat unit transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84768"
FT                   /db_xref="GOA:D3R6N6"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N6"
FT                   /protein_id="ADC84768.1"
FT                   /translation="MRIYMGRQLKQPKIRSVKFNVVMNTILTTSTFLFPLITVPYVSRV
FT                   LGPDNNGIVSWAFTFVGYFSLVALLGFNMYGTRECAKLRDDREKLSVVVQELLVILICS
FT                   TTVVYVAFVVLVFLLPRTHDELPLMFIVGTSIWLSACGAEWFYRSIEQYEYITVRNILF
FT                   KIASIVLLFVFVRQTNDYLAYAAVTVLGTTGSNVLNILRLRSFVTFSRKYEMNIRRHFK
FT                   PMFAFSISSITSGMYGQIDMLLLGFFSSNYALGLYQLVFKIRNMCTGVGGSVTGVMLPR
FT                   LSYYEAQEGHDQTTKLMAKNFNFLLMLGLAIISALVICADPLIMILGGNDYLPGNAALK
FT                   IGAPLVLLGSIGSMQSQYMVASDQEKVYTYTNVAGLVIAIVLECIFIPLWGINGAALGL
FT                   VLTELSVYCIRTYILRDFMRKVRKYTDYWKIAFAWAVASIVTAGICYAMRGWNPFVQII
FT                   IAALVFCVADGGLLVLVKESFIMSMVRKR"
FT   gene            complement(316793..317680)
FT                   /locus_tag="BIF_01539"
FT   CDS_pept        complement(316793..317680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01539"
FT                   /product="Putative rhamnosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01539"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84769"
FT                   /db_xref="GOA:D3R6N7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N7"
FT                   /protein_id="ADC84769.1"
FT                   /translation="MTAAKFGFVVLHYLAGDATAGCIESIKTHCPQAVIVVVDNNSANG
FT                   SYEELQRKYGADSTVTLLHNAVNEGFARGNNTGYEYARNRLHCDFIVTMNNDATISCDD
FT                   FMELCEEDFKAHPDVGVIGPDIVSGKNGSHSNPIYSIIDTRAEVDRQIWRFKVILLLLH
FT                   LHLFGPLTRLKAKLTHSDANALPEHVNATADAITGKPYKLHGACFVFTPAFVKQFSCAF
FT                   DSGTFLYFEEDILLMRCRARHLTMWYDKRIRVDHMEDVSTDQMMRKDERRKMIFTLHNY
FT                   VRSLKVLKQYVNSK"
FT   gene            complement(317699..318730)
FT                   /locus_tag="BIF_01538"
FT   CDS_pept        complement(317699..318730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01538"
FT                   /product="Glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01538"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84770"
FT                   /db_xref="GOA:D3R6N8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N8"
FT                   /protein_id="ADC84770.1"
FT                   /translation="MRGVRGMPEISVIIPVYNQEEYVGACMDSLLDQSFEDFEVLAVND
FT                   GSTDASVSILEGYEQRDGRVQLIDQNNSGVSVARNNGLSHAKGEWVCFIDPDDYVAPDY
FT                   LDTLLKATERNTDIAMSTCVAFDDQRSARQHFFPESFTARAADEKVELFRQLMDGSYAQ
FT                   PKGFVTAIGVPWGKLYRHAFLQEHGLQFDAALPRMQDNLFNMQAFQLAHEIVYVDYAGY
FT                   YYRMGGLSARTYKNNARGLYHPAIDERARLMREYHLDGDATLLRAWNEEQVNLYFQELK
FT                   AVIMLADPQSVKQAARTRAQALGPRLDQIDVSALSPAIRFKYTMMRNATLCSLLVRALR
FT                   AKG"
FT   gene            complement(318705..320051)
FT                   /locus_tag="BIF_01537"
FT   CDS_pept        complement(318705..320051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01537"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84771"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6N9"
FT                   /protein_id="ADC84771.1"
FT                   /translation="MTDTTETVQRQAEYSPRIREVVNALMDYALVLAIIYNSNSLWALA
FT                   GDNFSLSCFVLLAVCMAYMLCCWREARHRLHRVGSAMLVLVLATVIGQLVMAVSHGGSG
FT                   YTNGTWFQYALIVPALMGCMLMRGHEYVRKVLLNRLVVVAAVFAAISVVLWAASSFLLL
FT                   PPSHVERLSWVHNVPPIYSYADVYYNVQDAHVLGMTVWRNSSIFNEPPCAVAFYGMVLA
FT                   IDLYIGKKVHWGADLCIIGALVTSLSTGGALYVLVLLVPLLWKAMLHVQRRGLRYALLS
FT                   VAALVSIAAVVAGTRIVISKMATSYSGQTHLLDFTEGFRIWWQRPLTGFGFDSDEYIWT
FT                   HYMSAYRDGMGYTSGLLFLLIHGGLVLALYMIVPFVLLVLGSHDWHMWYFAGFVMIVFI
FT                   TAPVQNCAFLLLVAAYGYASFIWRYSRRMSSLPLVARTPLTHEGSEGHA"
FT   gene            complement(320048..320941)
FT                   /locus_tag="BIF_01520"
FT   CDS_pept        complement(320048..320941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01520"
FT                   /product="RfbF"
FT                   /EC_number="2.-.-.-"
FT                   /note="dTDP-rhamnosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84772"
FT                   /db_xref="GOA:D3R6P0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P0"
FT                   /protein_id="ADC84772.1"
FT                   /translation="MRCAGIVTYNPDLERLRANLNNTASQVDAVFVFDNGSENVADIRS
FT                   LADSEYTTLRVEADPNNRGIAFALNRLLDAAKEHGFKHMLLLDQDSVPTEGMCDELERH
FT                   LTGSVALVCPFILDRNRMTEEEWQAQKMPPLERLTHAAKHGAITSGSLVDVAAALEVGG
FT                   FDDNLFIDYVDFDFNERLILNGYEIVKDNTVYLLHEKGKSERTWLKVPRNTSAGVQWQP
FT                   LYKLGYSPMRCYYQSRNRIVYWKKYHRHTGGEGLTEIPLLMALSLLFENHRIAKLRAYS
FT                   RGIHDGMKMKIVEYRK"
FT   gene            complement(320954..321799)
FT                   /locus_tag="BIF_01521"
FT   CDS_pept        complement(320954..321799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01521"
FT                   /product="Alpha-1,3-galactosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01521"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84773"
FT                   /db_xref="GOA:D3R6P1"
FT                   /db_xref="InterPro:IPR025536"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P1"
FT                   /protein_id="ADC84773.1"
FT                   /translation="MIADSVSSAIAMVRGLPPNLMAGRSDKVSVSSETIMYIVSHKDFD
FT                   APQLPGYVPILAGAVKNHASIEVKDNTGDNISAKNPGFCELTAQYWVWKNRDDRDANIG
FT                   FVHYRRYFYIDHRKAQIVPAEQFSRDLEQYDVVLPEPWVLRKTIGDQFAQFHNLDDLEV
FT                   VRSIMQEQCPEYVPALDELLKSHSLHAYNMFVMSGERFDAYMTWLFRILDEAERRIDVS
FT                   KYDAYNQRLFGFLSERLLNVWVNARKLRVKEYPVYMPEQSARKENLRTRVKSLLFEHKL
FT                   "
FT   gene            complement(321723..322625)
FT                   /locus_tag="BIF_01522"
FT   CDS_pept        complement(321723..322625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01522"
FT                   /product="RfbN"
FT                   /EC_number="2.4.1.-"
FT                   /note="Putative rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01522"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84774"
FT                   /db_xref="GOA:D3R6P2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P2"
FT                   /protein_id="ADC84774.1"
FT                   /translation="MGGNELVDGAISVIVPTLNAGRQIDTLLTRLEQQTRKPDEIIVVD
FT                   SSSEDITQEMIKRHPEVKLIVIDRKNFNHGGTRDAMLRESTGDFVLFLTQDAMPSGNDY
FT                   IAKIVAPFADDEVALVYGRQLPRKDARPAEALVRKYSYGDESMVITKADIPSLGIKAFH
FT                   STDVCAAYRRTAYLEVGGFETDVLTNEDMFIAARFLHAGWKIVYEANATVIHSHNFTFK
FT                   QQYKRNYIQGVEIAKHKDILGDASLSGEGFSLVKYTLGGLLRQGHVIEAMRFTVDCGFR
FT                   LIGNRNGQRAAAKSHGRKE"
FT   gene            complement(322760..323875)
FT                   /locus_tag="BIF_02150"
FT   CDS_pept        complement(322760..323875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02150"
FT                   /product="Capsular polysaccharide synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84775"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P3"
FT                   /protein_id="ADC84775.1"
FT                   /translation="MISMPSRIVPTSLWRTDGMSRISPMPPTRCIRAISSAVTDNTQGA
FT                   WILPRKAEHLYTWKAAMGKLHNIRTKLKRYRKECVSAWRLFGPKLAMEGYLAHTVGIGV
FT                   DRYYTDLSQATWSTLMEDLPYSMSIPAVDEQQCANAPIWVMWWQGVDNQAPDIIQACVR
FT                   SIRKHANGHPVHVISKQNLHEYASIDESVVQAAECGEIPMAVLSDIIRCTLLYQHGGAW
FT                   IDATVYLTDDINPEVFTHPIYSIPVHQKNPTRNWTSYFIASTQGNPLFDYAGRSLTHLV
FT                   TRGKGIPEYFMLDVMLSVAYTRHAEFTAMIDAIPANNEGRFALSEQMDSTEAQPRIPSS
FT                   TYINKLTYQIDYPTTVNGKETIYQRLLDGEF"
FT   gene            complement(323757..325004)
FT                   /locus_tag="BIF_01523"
FT   CDS_pept        complement(323757..325004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01523"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01523"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84776"
FT                   /db_xref="GOA:D3R6P4"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P4"
FT                   /protein_id="ADC84776.1"
FT                   /translation="MKIAVAGTGYVGLSVALLLSQHNEVHALDIVPEKVELLNNCQSPI
FT                   VDTEITRFLDGKRDGTMDLDFQATLDPAVAYTGADYAVVATPTNYDSKKNYFDTSSVEA
FT                   AIKAIREYDPDCWIVIKSTIPVGYTAQLREKTGDKKIIFSPEFLREGHALYDNLHPSRI
FT                   VVGAPTDDAEAVKAAQTFAMLLAEGAAPEENDRLNADGSTGIPELVCGTTEAEAIKLFA
FT                   NTYLALRVAYFNELDTYAESRGLNTAEIIRGVCLDPRIGTHYNNPSFGYGGYCLPKDSK
FT                   QLLANYADVPQNLIGAIVESNRTRKDFIADQILSKLEGVEKPVVGIYRLTMKSGSDNFR
FT                   QSSIQGIMKRIKAKGIDVLVYEPTLDDAEFFGSEVTHDLNAFKNRSDIIVANRWNESDL
FT                   ADAADKVYTRDLFRRD"
FT   gene            complement(325125..326561)
FT                   /locus_tag="BIF_02151"
FT   CDS_pept        complement(325125..326561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02151"
FT                   /product="Oligosaccharide translocase (flippase)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02151"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84777"
FT                   /db_xref="GOA:D3R6P5"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P5"
FT                   /protein_id="ADC84777.1"
FT                   /translation="MSNSLAKNSIFNVCYQLLNVIFPLISASYVARVLMPSGVGLVAMA
FT                   QNWVAYFVIFASLGIPNYAIREVAHARDSKAGTKRVFTELISINAISTTLAAIAYCAMI
FT                   FVVPNFKENLVLYIVCGGSILLNYINVDWIYQGLEDYSFIAVRSFIVKLVSLAALFVFV
FT                   RSQNDYVWYALIGVCAIGLNNIFNVGHLHKLNIGLGFSNIELKKHIKPIILIFSTIISI
FT                   KLYTLLDVTILGLMSNNAAVAYYTNADKIIRIIITVITAVGGVLLPRISRYKVEKRYEE
FT                   CASIVSRVFEILFFCFLPIGIGLICTSRQLVLILFGDAYSAGILTMQIMSLLIYALGFS
FT                   NLFGTQVLLAFDQEKKLLYCTIGGALINITLNLALIPLLSQNGTAVASVASETFVTATT
FT                   AWFASKTLSFGIRKNVIWKTVVSTLIMTIIVEVFNFVIKNVFFSFITCVLMGGVSFLLS
FT                   SVMLKNPILNYIVNVLRRRK"
FT   gene            complement(326609..327631)
FT                   /locus_tag="BIF_02152"
FT   CDS_pept        complement(326609..327631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02152"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02152"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84778"
FT                   /db_xref="GOA:D3R6P6"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P6"
FT                   /protein_id="ADC84778.1"
FT                   /translation="MKDYKIMTVSNNAYSAIYVVCPAYSKSGGPELLHQLVHVLNNNGV
FT                   KAIIAYTAYNKEDKLSPVNAAFKKYVKKYCLFEQIPDRADSIVVFPEVNIEDIHFLKNA
FT                   TKYCWWLSVDNYLKRYNLHYIIKNKLTRYFLTWTKHGFWRYGFSYIRKNVSKNLVQSYY
FT                   AEDYLKKRGFTNIVYLSDYINEEYQEDTSISYRNNAVLYNPKKGIEFTRQLIEAAPDLN
FT                   WVPLENMSNEEVRGKLKTSKVYIDFGDHPGKDRFPREAAISGCCVITGKRGSAAYDDVP
FT                   IPEEYQFEDSVTSIPAIVETIRECLVDYDRRMRDFDGYRSTIKAEKNKFIEDVRSIFMH
FT                   "
FT   gene            complement(327666..328529)
FT                   /locus_tag="BIF_01903"
FT   CDS_pept        complement(327666..328529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01903"
FT                   /product="RfbF"
FT                   /EC_number="2.-.-.-"
FT                   /note="dTDP-rhamnosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01903"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84779"
FT                   /db_xref="GOA:D3R6P7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P7"
FT                   /protein_id="ADC84779.1"
FT                   /translation="MSVCGITTFNPDLKRLEANFNAILPQVGSVLVWDNGSDNYKEVIA
FT                   LAASLSDKIHIATEGSNKGVAYALNRLCAYALERDERDILLLDQDSEACENMYSNLIRY
FT                   RTDNVAIVSPIISDINVRVDTSDLPEKEVCLLPITSGSLTNLDAWKAIGGFDEKLFIDL
FT                   VDTEYDIRALMKGYCSYRINTVVLTHEIGHIEPSGLPFPRIQQGKIVIRRGHRSGHSVF
FT                   RTYYQIRNLLYVREKYGSFLKRMHIQLQSPQSAIVHTLVFDPNRIQRVRAILKAIRDSR
FT                   TLFNKF"
FT   gene            complement(328623..330158)
FT                   /locus_tag="BIF_00944"
FT   CDS_pept        complement(328623..330158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00944"
FT                   /product="Undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00944"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84780"
FT                   /db_xref="GOA:D3R6P8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P8"
FT                   /protein_id="ADC84780.1"
FT                   /translation="MAQAKSDAQLAEEVDVRSSRVLRWRFVMNLALMLFDALVYFATSM
FT                   IVLVVSHGTNLVTTRLQLNLPIDPWLYSAACAAIYVYCMHVAGVYHRHVFADRYQLNML
FT                   LLKGGFIAWVAICALNFIIQCNIFFYMVCLTSLIVWVAEMIVRFIARVILTSKHRKGEY
FT                   SYPTVIVGSPEGIGQILKFLNQRRQLNYKPIRLCPIRVNSETGLIEADPNTELLSKEVH
FT                   ESWNSPIDVIEYGPQLAGRIAETGAQTVMVTDVLDRFSDNLSTFALQMESVNLEIALIT
FT                   SALDIAEHATQMRNIQGMSIMTISLPQYSPSAQIKKRVFDLVVSTIAIILSSPIMLIVA
FT                   LAIKIEDGGPVFYKQERIGLRGKPFYIHKFRSMRVDADAHLKEVLAAQGQELGARYKLK
FT                   HDPRITKVGNFIRKTSLDELPQFFDVFMGSMSVVGPRPQRSFEVAEYDPVYATRLLVKP
FT                   GITGPWQVSGRNDLNEEESRQLDVSYVQDWSVMGDVVYILRTIGTVLHPSGAY"
FT   gene            complement(330368..330478)
FT                   /locus_tag="BIF_02183"
FT   CDS_pept        complement(330368..330478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02183"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84781"
FT                   /db_xref="GOA:D3R6P9"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6P9"
FT                   /protein_id="ADC84781.1"
FT                   /translation="MSESLVIGESLMVVMGLLLYLTNGRIGRFMLYVWRG"
FT   gene            330435..330776
FT                   /locus_tag="BIF_00945"
FT   CDS_pept        330435..330776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00945"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84782"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q0"
FT                   /protein_id="ADC84782.1"
FT                   /translation="MTTINDSPITNDSDTELEAFEQRVNEMLSTGELDSALSITDENGV
FT                   AQVLPMLDTEPIAHLLDGIEELGGSANVFVRTAEGTAILTVNEYSPEDAALDTAESEAD
FT                   AEADAQSAE"
FT   gene            330849..332573
FT                   /locus_tag="BIF_00009"
FT   CDS_pept        330849..332573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00009"
FT                   /product="Multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84783"
FT                   /db_xref="GOA:D3R6Q1"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q1"
FT                   /protein_id="ADC84783.1"
FT                   /translation="MTSHEGPEEGEQRGGNTVTAAGKPYTRDVHHDTEPAPPRASGYFA
FT                   GLTQALTRTDAYRDGHLSRPAFLSLAILTFITFVGNFTQLQLSAALPTLVSDFHISVTL
FT                   GQWMTSIFQLTMGVMVPLTAYLTRRFSTRQIVITSMVVFTLGSVLAWLSPSFPLALFGR
FT                   FLEAVGTGVMWPVLQITVFSIFPLARRGMAMGIVGMAMAVAPAIGPTLGGVQTDLNGWR
FT                   SIFLTLTIIGCLAIVLTTFGLHNFGQADTSAHADFFSVGLSIIGFGGLMFGFTNIQAYP
FT                   FSAPVVWLPMAIGLAGIIWFVLRQFHTEKMFKAGKSSRPALLDLSVLRNRSFSIGTIIA
FT                   SLSFFAFSSLIVLIPLFIQDCRGYSATISGLVMLPGAIAQAISQFFGGRALDRFGARPV
FT                   ALIGTILLTAGTACMSTIGLHTWIWSISFYQFIRQIGMGFVMMPVTTWSLNCLKPSEVS
FT                   AGSAVTNTVRQIAGAVGSPVMILIMYSITAASMSNGQQTIPANITGIEWALRISAVINF
FT                   IMILMVVFGVKGEDAGSAREAVRIALHHDSIEQEDKGTKALAHTDDTAKLRTIETGK"
FT   gene            complement(332700..334058)
FT                   /locus_tag="BIF_01572"
FT   CDS_pept        complement(332700..334058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01572"
FT                   /product="MntH"
FT                   /note="Manganese transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01572"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84784"
FT                   /db_xref="GOA:D3R6Q2"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q2"
FT                   /protein_id="ADC84784.1"
FT                   /translation="MAERDEGATGSQSAMVSGEPVVDIDTVAEAAVADQDVAIARKDSG
FT                   KPEKPIHALASMLGPAFIAAVAYVDPGNVAANLTSGAQYGYLLVWVLVLANCMAVLIQY
FT                   QASKLGIVTGKSLPQILGERMGSAGSFLFFAQAEVIAIATDLAEVIGGAIALNLLFGLP
FT                   LLVGGLIIGAVSTVLLLFQGGKTHKIFERLVIGLLLVITFGFIAGLFMDPPNPLKVAEG
FT                   LIPRFNGGASVLMAASMLGATVMPHAIYLHSTLVNDHYAHKAHKPSIKEMLHGSRIDVV
FT                   WALALAGSVNIALLVLAANSLHGMGGTDTIEGAQHTISQVLGPTVGTVFSIGLLASSLS
FT                   STSVGTYAGSEIMKGLLHWNVPMWACRITTLVPALVVLALTSNPTEALIIGQVVLSIGI
FT                   PFAVIPLMRYTHNKQIMGKYVDGPVKHAICLLVVAVIIALNLVLIVLTLMGKA"
FT   gene            complement(334162..334923)
FT                   /locus_tag="BIF_01573"
FT   CDS_pept        complement(334162..334923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01573"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01573"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84785"
FT                   /db_xref="GOA:D3R6Q3"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q3"
FT                   /protein_id="ADC84785.1"
FT                   /translation="MFANVRVYTVRMARRFKRKYGVTPLERILIILLIAVVVGATLGVI
FT                   LPRINNGIAEITGRYTATGTAAETLNKLAVVDRPNGDGYDRDLFGFRETDDDGNGCDVR
FT                   EDILARDLTDVAYVTRNGCKVKSGVLNDPYTGKVIHFTRGQNTSAAVQIDHVVALQNAW
FT                   QSGAKDWNARKRMQFANDPYNLLAVDGPANQGKGSASAAYWLPTNASYRCDYVARQIGV
FT                   KDKYGLSVTSSEKRAMQSVLHGCPGQEIPAD"
FT   gene            335049..335924
FT                   /locus_tag="BIF_01575"
FT   CDS_pept        335049..335924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01575"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01575"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84786"
FT                   /db_xref="GOA:D3R6Q4"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q4"
FT                   /protein_id="ADC84786.1"
FT                   /translation="METTRNELNRNLAQMLKGGVIMDVTTPEQARIAEDAGACAVMALE
FT                   RIPADIRAAGGVSRMSDPAMIKGIQEAVSIPVMAKVRIGHIAEARILQAIEIDYIDESE
FT                   VLSPADDVYHIDKREFDVPFVCGAKNLGEALRRIEEGASMIRTKGEPGTGDVIQAVRHM
FT                   RTMTKQIRELASLRDDEVYEAAKQLAVPYELAKYVHDNGRLPVVNFAAGGVATPADAAL
FT                   MMELGAEGVFVGSGIFKSGDPAKRAAAIVQATANWRDADLLARLSENLGEAMVGINEDE
FT                   IETIMAARGE"
FT   gene            335951..336601
FT                   /locus_tag="BIF_01576"
FT   CDS_pept        335951..336601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01576"
FT                   /product="pyridoxine biosynthesis amidotransferase"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01576"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84787"
FT                   /db_xref="GOA:D3R6Q5"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q5"
FT                   /protein_id="ADC84787.1"
FT                   /translation="MVVDVSYISKEHSEDATTASSGVTGILAVQGAFAEHAAMLDRLGA
FT                   PWKLLRAREDFDESIDRVILPGGESTTQGKLLRSTGLFEPINEHIKAGKPVFGTCAGMI
FT                   LLAQRLENDPNVYFGALDATVRRNAYGRQLGSFMATENVATFHADGTPAGVIENFPLVF
FT                   IRGPFVAETGANARVMCEANGNTVALQQGRILATAFHPEITPDTRIHEFFLII"
FT   gene            336944..338080
FT                   /locus_tag="BIF_01577"
FT   CDS_pept        336944..338080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01577"
FT                   /product="UDP-glucuronate 4-epimerase"
FT                   /EC_number="5.1.3.6"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01577"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84788"
FT                   /db_xref="GOA:D3R6Q6"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q6"
FT                   /protein_id="ADC84788.1"
FT                   /translation="MQVSSEYQDPSIASDGNRSELDSNSSPAQQKTPVELSGKTILITG
FT                   AAGFIGWNLAERLLHSYPDITIVGLDNLNDYYDVKLKEARLERLTKYPNLIFEKGDLSD
FT                   KKLIGRLFEKHHFDVVVNLGAQAGVRYSITNPDAYVSSNLIGFYNILEACRHNPVEHLV
FT                   YASSSSVYGGNKKVPFSTEDKVDNPVSLYAATKKSNELMAHAYSKLYDIPSTGLRFFTV
FT                   YGPAGRPDMAYFGFTNKLLAGETIKIFNYGNCQRDFTYIDDIVEGIVRVIQGAPTRQTG
FT                   EDGLPVPPYALYNIGCGHPENLLDFVTTLQEELIRAEVLPDDYDFEAHKELVPMQPGDV
FT                   PVTYADTEALTRDYGYRPTTSLRDGLRRFAEWYKQYYM"
FT   gene            338185..338649
FT                   /locus_tag="BIF_01578"
FT   CDS_pept        338185..338649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01578"
FT                   /product="Beta-1,4-glucuronosyltransferase accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01578"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84789"
FT                   /db_xref="GOA:D3R6Q7"
FT                   /db_xref="InterPro:IPR013969"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q7"
FT                   /protein_id="ADC84789.1"
FT                   /translation="MVHKRKPRLCFVSSSGGHWEQLQKLLPLAEKYEGFFVTEKTQFET
FT                   PRAKYFMKQTDLKDKFMVPKMIVNSARALVIWIKERPDFIITTGTMVAYPFYLLAVLFH
FT                   KKFIFIETFGRANMPTEAGKKMEKHSDLFIVQWESQKKFYTKAIYGGCLY"
FT   gene            338637..339149
FT                   /locus_tag="BIF_01579"
FT   CDS_pept        338637..339149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01579"
FT                   /product="beta-D-Glcp beta-1,4-glucuronosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01579"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84790"
FT                   /db_xref="GOA:D3R6Q8"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR039042"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q8"
FT                   /protein_id="ADC84790.1"
FT                   /translation="MFILMIFVTVGSRNYPFDRLFKKLDDLYEQSVLSEPMFAQIGTSS
FT                   YKPKHYQYTDFISPEEFEEKIQEADIVVTHGASGSIMKALNAKKKVIAVTRLAKYGEHI
FT                   NDHQIQNNEAFSSNHYVLMADPELGNLAECFEKIYIGTDGLIPWENKDPLSIVKIIDKF
FT                   IQKEWYG"
FT   gene            339227..340180
FT                   /locus_tag="BIF_01874"
FT   CDS_pept        339227..340180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01874"
FT                   /product="RfbF"
FT                   /EC_number="2.-.-.-"
FT                   /note="dTDP-rhamnosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01874"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84791"
FT                   /db_xref="GOA:D3R6Q9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Q9"
FT                   /protein_id="ADC84791.1"
FT                   /translation="MKASVAAGVVLFNPEDINRVQQCIAAILEQTDHVYVFNNGTVDVP
FT                   LAEDARITYLSENANKGIAYALNRIMECAMKDGHEWVLTMDQDSIVPDGMVDDFRRLIE
FT                   KDRDKTAIFCPQVIDKRRAYMKTADDNNVIKITKCITSSSCTSTKAWECVGGFDEWLFI
FT                   DLVDDDFCRRLIASGYTIKRANKWVLDQEFGKIVPKSSRKQQFWIGLSNLLHNKNIAKF
FT                   SYNKYVSPLRVYYTNRNIIYVNRKLKKYGPVGYINYNCKGYLGFIFCFNLPSLLRARHK
FT                   GQVLSAIIKGTRAGLKTYPSQWVAPTITEAAKEHNE"
FT   gene            340173..341009
FT                   /locus_tag="BIF_01875"
FT   CDS_pept        340173..341009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01875"
FT                   /product="RfbF"
FT                   /EC_number="2.-.-.-"
FT                   /note="dTDP-rhamnosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01875"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84792"
FT                   /db_xref="GOA:D3R6R0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R0"
FT                   /protein_id="ADC84792.1"
FT                   /translation="MNDTTARQNLFAGIVTFNPDIELLRKNIEAICAQVDLVIIVDNGS
FT                   RNLEDIRPLADAHHCKLIPNAQNEGIATALNQIALAGKGDGYSWMLTLDQDSECPPDFC
FT                   STLSQFFSMNSRIAIVAPVIQDRDRGIIGHKPAGTYGEVRTCITSGSCTRLSAWEKIGG
FT                   FDEKLFIDSVDFDFCYRIRKTGYVIIQTREAVLEHSIGEVKKNKLLGIPYSEHSAFRYY
FT                   YISKNNIYYPLKNRLYLHALRGNARNMRNLLQVLFFEEDKKAKLKQIARGWVNGYK"
FT   gene            341195..342328
FT                   /locus_tag="BIF_02025"
FT   CDS_pept        341195..342328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84793"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R1"
FT                   /protein_id="ADC84793.1"
FT                   /translation="MIQAVSYFILLSISFFKRKSYILYFVCIVFLWLIASFTTGNADEQ
FT                   IYQSRYDEYQLWEDNTEYLYMALIKTCNALGLTYQAFKCVSAFIVLTLISCTILRFAAC
FT                   PILTLLLYAVYPFPIDVAQMRNCLATSVFIFGMGFLLDDVQNGDNQGRFLTKNDILYCL
FT                   CIFIATMVHTAAFFWIIILVAKKLNTKWAAIFTFVFCLLFSAIMTPRFISGLSGLFGSN
FT                   DRINAYTTAAYDLTRDLHLPLALLRVAIFFITSLAVLLITNLSSMKMTGVQKKEYIFYF
FT                   KITILTLCILPITINYTPEIYRMQTGLSLIFYMIILNIISGETINSTNDAILRFIIPLL
FT                   LLVFGVVNAFLLYIFGDNLETVFIPIFENNTFFNSIV"
FT   gene            complement(342453..346334)
FT                   /locus_tag="BIF_02024"
FT   CDS_pept        complement(342453..346334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02024"
FT                   /product="Multidrug resistance ABC transporter ATP-binding
FT                   and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02024"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84794"
FT                   /db_xref="GOA:D3R6R2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R2"
FT                   /protein_id="ADC84794.1"
FT                   /translation="MVSSLRTVSAGPGVVYSVSICLISLSWQITNNLHELLSKSSSILS
FT                   YAGVANLCELRQRMAKLIVRFTQSAVFRAGVCCKRDSAARLAHGFLKSKCELECRMFDK
FT                   RLFPLAPGVRGLIVAKVVCLWVGLLADIALSVTAVSLMGAVLGRNTAYTFTVVSLGWYA
FT                   LAFAVIAFIRFLAHYLGSRFGTEAAERVKLGLRNALYRKLLVLGPSYRQQASTASIVQL
FT                   AGEGVDQVQSFYEKFVPQLFYAVLAPLTLFAVLAPINMPTAVVLLVCAPLIVIIVGMVA
FT                   MRASRVFKKYWGKYTDMGSAFLDNLQGLETLKTFDADESAARKMHEEAENFRVMTMRVL
FT                   QIQLRSLTAMDVVAYGGAAAGIGVAIWQLTHSGVTMFRTTFAPLDMFAGPQLGSPGMLL
FT                   IVLLSASFFLPLRQLGSFFHVAMNGMTSSKKIFALLDAPAPHHGEQTLPAGPISVHAHN
FT                   LGFFYGDDEADAQPALRKVSLDIPAHSLTAIVGESGSGKSTLAALIAGELEGYSGSLAF
FT                   EVDGESVEVADLSESALMAAVSFVGARSHLFVGTLRDNLIMANPQATDEQLHHALRLAH
FT                   IDDFVREQPAGLGMPIDPANLSGGQRQRIAVARALLHEAPIMIFDEATSSVDAESEALI
FT                   MQTIHELAQSKTVIVVTHRLADTVDADMIAVFDHGSCVETGDSSTLMAADGRYARMFHA
FT                   QATVEQVHRRTEGGGIRYAHTQNEVGGDMPKRVAESAGKRNAALSGIDMAADDAMTTVQ
FT                   VIRRLLAQVGSLRPLMVLACCFGVLGHLAATFMPVFGIMAACAAFGHPVWGLSVGWAVT
FT                   LMVVCAAIRGIMAYCEQYMNHNLAFRLLALFRERAFDALRRLAPAALANRGNGDMISLI
FT                   TTDVELLEIFFAHTISPTIIALSTTVLYTVALLFLSPWFALLLVIAHLLLGVLMPRLFA
FT                   AALRGVGSKLRKDSAALDDQVLDDMHGLDQIIRFDCGDDRLKRIDAWSRSLWRQRTRLS
FT                   ARNGAFSGYDSMIVIVVTAVAALLALTLSLGNTSAAANIAAFVLVVSSFGPTLALSALP
FT                   ANLTQTFASARRLFSVLDAEPAVEERGTEQCAYDGMSLDGVTFGYGDGAPVLRDVTMDI
FT                   PLSGILGIQGPSGRGKSTLLKLLMRYWDPQQGTVSMSGHALPAIDAHTRRRLQTMMSQE
FT                   TYLFDDTIAGNLRIAKPEASDDELHRALEQASIAALVDDLPEGMETRVGELGDRLSEGE
FT                   RQRLGLARMFLRDASLYLFDEPTSRLDSLNEAYILQSINALVEERDAAVVLVSHRASTM
FT                   RIADGIHKA"
FT   gene            346207..348096
FT                   /locus_tag="BIF_01159"
FT   CDS_pept        346207..348096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01159"
FT                   /product="Long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01159"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84795"
FT                   /db_xref="GOA:D3R6R3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R3"
FT                   /protein_id="ADC84795.1"
FT                   /translation="MLEDLLSNSCRLFVICQDKEIRHMLTEYTTPGPALTVRNDETIYS
FT                   LLTDRIARSGEDSPLTENKEADGAWSKLTAGQFNDRVRAIAKGLIAFGIKKGDAVTIFS
FT                   ATRVEWGLLDFALAAVGAVTVPIYDTDSAAQAERILNDSNVKLAIADNQERFDRLDSVL
FT                   DHCPSLERILMLDANAVEALEGLGVMVSSEELDERIASVNADDLATIVYTSGSTGTPKG
FT                   AELSHRNFVSITRAAADCVPEVLEGNSRLLLFLPLAHCFARFIQYFAFTSDAGVIGYLP
FT                   STKTLPHDMQVFEPTFVLAVPRVFEKVYNAASRKAGTGWKGRLFAKSVEFAREWTEMEQ
FT                   AGIAPTPKQKAEHAMYEKLVYSTIRSAFGPRIKYLACGGAPLDRKLATFFNGIGLTMIQ
FT                   GYGLTETAAPFAFTRVHDNVIGTVGQPVPGSSVRISPTGELEVKGQNVFLGYHNLPEKT
FT                   TETFAEDGWLKTGDLASIDDEGHITLTGRAKDIIITAGGKNVSPIPMEQEISTCPIVEH
FT                   AVVVGDNRPFVGAVITLDQEGLASWLPTQKLPADLTIEQAAGLPEVAAEIQKYVDRANT
FT                   NVSRAESVRKFIVLPTTFSQDNKCLTPSMKVVRPKVNQVFKEQIDNQLYVGKR"
FT   gene            complement(348148..349560)
FT                   /locus_tag="BIF_02184"
FT   CDS_pept        complement(348148..349560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02184"
FT                   /product="Septum formation protein Maf"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02184"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84796"
FT                   /db_xref="GOA:D3R6R4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R4"
FT                   /protein_id="ADC84796.1"
FT                   /translation="MCVRYGGSMSIPLILASKSKPRRDLLFHAGICPTIRVSHVDEPGV
FT                   IAKAAVGAGVSVDDLPIATKVMVLAQAKANAVYQAYKDVAEVSTNAHGDEVTGFPLEAA
FT                   QSTADSAHTDDAQTRDFSGVQFPTRTQPIQDTVVETHGLTNAKVGPLILGCDSMFLLDG
FT                   KAYGKPHTEQIARERLELMSGASGELFTGHCLIDFASGRMVTGVSRAVIHFAEFSDLMI
FT                   DRYIATGEPLEVAGSFTLDGFGGAYIDSIEGDPSGIIGLSLPLARELVQELGIDWTDLW
FT                   NVARDEQFPQPLSSVKALPPKENVHQPGDGWVDCACGRKHWGTNGAAGVLLARRDQETG
FT                   EVTHIVMQHRATWSAEGGTWGIPGGAIADGESPIEGALREAYEEANITPADIEVVGSYC
FT                   EDHGPWAYTTVFAFEKPGHEVYPRANDDESMEIEWVPIAEVPNLKLLTAMRADWPRFEK
FT                   RLNEIASTYKGR"
FT   gene            349724..350290
FT                   /locus_tag="BIF_01478"
FT   CDS_pept        349724..350290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01478"
FT                   /product="Protein tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01478"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84797"
FT                   /db_xref="GOA:D3R6R5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R5"
FT                   /protein_id="ADC84797.1"
FT                   /translation="MKVLFVCTGNICRSPMGELLFPHFFHTNGIETDSAGTQGLVDSPI
FT                   DPSSAKLMALDGIDSSQFRSKRLTPQLAMSSDLILCFTEHQRRKIVALAPRVRSKTFLL
FT                   SDFANLCRYFGQNNLLHGSNVEDRMREVMCNASMARRALPEAEDIADPYRKEFAAFQVA
FT                   HDQIGYAIADIAQALEPSRAGHATE"
FT   gene            complement(350375..352246)
FT                   /locus_tag="BIF_01477"
FT   CDS_pept        complement(350375..352246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01477"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01477"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84798"
FT                   /db_xref="GOA:D3R6R6"
FT                   /db_xref="InterPro:IPR025101"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R6"
FT                   /protein_id="ADC84798.1"
FT                   /translation="MPFGVRCLSLSGARMASHRVSRTNVKRHHRVWPWVLSIVGLFVAV
FT                   LVLFGIAGFNVYRQSKEVQAHESRALSMISDFSTKIDDANVQKVKDQLPQIQQETSQAS
FT                   AIANGAWWNIANKIPYFGSNVSTVQGMTNVIDDLMHQSVPQFMDVVTNLQHANLSSTDD
FT                   GINLRPIIDCQQGMQKANESLQHQVGAYNALPQPNIDIVRSAYAQGSDKLNALATRVDA
FT                   LSSTFRMLPGFLGNGQTRTYAVMSMTTSEMRSSGGLIGSVGELTADNGSVHVGEFKANK
FT                   DYLPYGIGDHSADMARVFSDEGPLHMSFDIRDTAVFPDTERAALAMQSIWNRTPWGQQK
FT                   PLSGVIMVDPVFVQEMVAINGPVTLADGTTLNGDNTAEYFLNTVYKQYEASQTDAVFGE
FT                   TTGNVIAGMFKSLNLGKLVKIGETMGTMARERHFTMFSFDANLEKEIQAAGFTGETPND
FT                   PQNPSVGIYLTEQNPSKMGWYIKRTATIEKTRCDASGATYHVEYTLNNTMKVSDVANLP
FT                   PYITGVDAPNRGKGIEKILFYPPAGGRINNISQLNGAVNAVQKTTMNGKELYKTVVEIL
FT                   PEQSVTYSFDVTVSPQAQSALTIDQTPLGWKDTGITVKEPKCSAKAN"
FT   gene            complement(352270..353817)
FT                   /locus_tag="BIF_01476"
FT   CDS_pept        complement(352270..353817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01476"
FT                   /product="Chain length regulator (capsular polysaccharide
FT                   biosynthesis)"
FT                   /note="Tyrosine-protein kinase (capsular polysaccharide
FT                   biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01476"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84799"
FT                   /db_xref="GOA:D3R6R7"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R7"
FT                   /protein_id="ADC84799.1"
FT                   /translation="MRLKRKPRDSSDLSGASMLEWKALYMAENEVNRYSQSQSQTPVPA
FT                   HEGMTIVDLLSILRKHIITIAVTFVVILGVDILYTAMSPVAYTTTTQLFATYNSSNDSA
FT                   NSSEQYSGSSYIMSQIKSYPDLAKTQSVLQPVVDELKLDTTPISLASQITVTNPTNTAF
FT                   VNIAVTDADPSTAARIANGVAASLSNVVEKSLYTAGSNSAVKLSIVQPAQVPTKQSSPK
FT                   WSLNILVGVLGGLIIGILAALLKDVLSKKIQDESDVTDIVDAPIIGRVVKDDILAGSSP
FT                   VVVSEPGSPIAEDFRRIRTNLSFSTPVEGTNCRLVVVTSAGASEGKTTISVNIAAALAE
FT                   DGPRVLLIDADLRHPSVAHKIDIDGSAGLTHVLSGQAAVKDVIQRYWKPNLHIIPAGPK
FT                   PPNASTLLNSPLMTTLVANAMQQYDYIIIDTAPMVVANDAVIFMKQGGTLEMVCRRDQT
FT                   LKRDLHEIADELETLDMPVTGVIINCAKENKKALENSNYYYYSNSSPAEKNRKNRKS"
FT   gene            354631..355485
FT                   /locus_tag="BIF_01475"
FT   CDS_pept        354631..355485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01475"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84800"
FT                   /db_xref="GOA:D3R6R8"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6R8"
FT                   /protein_id="ADC84800.1"
FT                   /translation="MFNGKKKAPKNDWRQSIMSLGQVKNEANESESQTTRRMPFGRTGR
FT                   TDRPQSQHMPTATMPNGPATGMQVAAQAAPPQKRKRFKVLIYAFAFLMVFALGVGAGSS
FT                   NASKPAGTVPSAAVAPTEQIDAKENDAELKRREEALNKQAEELDKLKRELDEQQKSQSE
FT                   RQTQLDEREKSIASKEEAKKQAEVEAAQRKKAEQEQAAAAEKARAEAEAAERERAQAQA
FT                   AQAAAEEAARQQEQAPQVVEQQTSRIVHPGAFCSTAGETGVSQKGVGYTCKADNSGRLR
FT                   WRR"
FT   gene            356341..357684
FT                   /locus_tag="BIF_02023"
FT   CDS_pept        356341..357684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02023"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02023"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84801"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D3R3D7"
FT                   /protein_id="ADC84801.1"
FT                   /translation="MIEKLNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGP
FT                   GLRQIRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCS
FT                   RSWSDDLEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGM
FT                   LLLEQADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQ
FT                   VLREWMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKV
FT                   RCRLQRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDA
FT                   YQRVIHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRH
FT                   PRSSNGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            complement(358247..359230)
FT                   /locus_tag="BIF_01300"
FT   CDS_pept        complement(358247..359230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01300"
FT                   /product="Homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01300"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84802"
FT                   /db_xref="GOA:D3R6S0"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S0"
FT                   /protein_id="ADC84802.1"
FT                   /translation="MDPVTRKVHVRVPATSANLGSGFDTVGLALDYHDELEFTLSSDPL
FT                   NMAAQILITGEGENTLPRDESHLVVSTFRRACSRFGLSKCGFIMEAHNNIPQARGMGSS
FT                   AEAIVAGISAAYAFSHEGELDRDVIFQYAADLEGHPDNVAPAVYGGMTVSWTEDGQSEI
FT                   VQGEVVNTGFRSVNYLVDAGVRASIFVPDYELSTAQARAALLNTVPFADAVFNVSRMGL
FT                   LIGAMNPSALAGEQDPNELLFTATQDKLHQSYRAPLMKPSAELIDLLREHGYAAAVSGA
FT                   GPCVCVLHNGDASDDLNQIATAQLASGHWRVLHLNVDTQGVQVARL"
FT   gene            complement(359293..360639)
FT                   /locus_tag="BIF_01299"
FT   CDS_pept        complement(359293..360639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01299"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01299"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84803"
FT                   /db_xref="GOA:D3R6S1"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S1"
FT                   /protein_id="ADC84803.1"
FT                   /translation="MNTQCAPHERIPMAEQNAPIRVGLLGAGTVGSQTARILVEQKDEL
FT                   GQRIGRPLEISGIACLDPNEVDFPWIDKSLLTSDTMSVVKNADIVVELIGGTGVARTFV
FT                   LEALNNGASVVTANKALLAKYGPELYKAAEDNHADIYFEAAVGGAIPIVRPLRESLVGD
FT                   QVKSMLGIVNGTTNYILDEMTTKGLDFDVALKEAQEKGYAEADPTGDIEGYDAANKAAI
FT                   MATLGFHTNVGIDDVTVEGITHITADDIAAATAEGKVVKLLAVVDHTEDGVSARVYPAL
FT                   IRNEHPLASVHGSFNAVFLHAEYADDLMFYGRGAGGAPTASAVVGDIVTVARHIASGCT
FT                   GPAIRMYNDYPIAPLSSAKASFAVRFLIHDKPGVLLQVAKEFADRGISINGVNQDLKPT
FT                   ATEPGYDGEIQQLRLVTHMTDETTLREAVDAVCQLDSVTGDPSIIRVLD"
FT   gene            complement(360876..362645)
FT                   /locus_tag="BIF_02022"
FT   CDS_pept        complement(360876..362645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02022"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02022"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84804"
FT                   /db_xref="GOA:D3R6S2"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S2"
FT                   /protein_id="ADC84804.1"
FT                   /translation="MRSSWPPLRLLFLCGLSALLPLCKKRRIRASGCLFLRKGGRGEER
FT                   GTERRRYRKRDEEMNMAISPIWPADTARNSNGELTFHGITASTLLDEFGSPLYVLDLDE
FT                   VRARASHFVKAAAHAFTNNTTHVSYAAKAFLSKEMARIVTEEGMFVDTCTLGEMKIALA
FT                   AGVPGRRLVLHGNNKSDEEIELAIAEGFSKIVIDSPDEPARIAAIAERLGKRARVMLRV
FT                   TSGIHAGGHEYVSTAHEDQKFGVALLPAGADTEIVDNIDQLQDVSPAATNALVHETELE
FT                   RGGETKQQADRQLRYDVRYPYDLNAADVTEGDRLLAAAMELVANGPAIAVLREIAKYGN
FT                   LELVGVHSHIGSNIHDAEAFIQAAKRMMLLRKTFYATNAYTLPEVDLGGGYSVAYTDDE
FT                   DRMDVDRELGRLADAVSKTNRLLGMPAPIISFEPGRWIVAPAGVTLYRVGTVKTVQLGD
FT                   GFTNNAGERIRERAYISVDGGMSDNIRPALYDAKYTAILANRESAEPAKLSRVVGIHCE
FT                   SGDIVVNEANLPADVHRGDILAVPVTGAYGRSMASNYNMALIPAVVGIDGHGAHVMMRR
FT                   QTIDDLLALDVSE"
FT   gene            complement(362660..364456)
FT                   /locus_tag="BIF_01486"
FT   CDS_pept        complement(362660..364456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01486"
FT                   /product="Arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01486"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84805"
FT                   /db_xref="GOA:D3R6S3"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S3"
FT                   /protein_id="ADC84805.1"
FT                   /translation="MSPEALQELIFTIANNLVSEGKAGTLTAEELPDSAKFAVMRPKDR
FT                   AHGDWASNAAMQLAKKAGMKPRDLAQLFADALNGTDGIAAVEVAGPGFINITLDSASAA
FT                   AVVDQVLDEGNRFGKNNHLSGKTLNLEFVSANPTGPIHIGGTRWAAVGDSMARILQANG
FT                   ATVVREYYFNDHGEQINRFAKSLVAAAHDEPTPVDGYKGAYIDEIARRVIVEANAEGID
FT                   ILNLPRVDGGTDEKGEPLGEGDSEQREEFRKRAVPMMFDEIRQSMKEFRVHFDVWFHEN
FT                   SLYEDGEVEKAIADLRNAGDIYEKDGATWFESTEHGDDKDRVIIKSDGTYAYFAADIAY
FT                   YRNKRHRKTDPADVAIYMLGADHHGYIGRMMAMCAAFGDKPGENMQILIGQMVNVMKDG
FT                   KPVRMSKRAGNIVTIDDLIDAIGVDASRYSLARTDYNSPVDIDLNLLASHSNDNPVYYV
FT                   QYAHARSCNVDRNAEAAQINAADADLSLLDTEADGEVIAALAQWPALLTLAGDLRAPHR
FT                   IAHYLEDLAAAYHKWYNVERVVPMPLTEAEERADEQTRERTRIAKNPEPARAAARLKLN
FT                   DAVQTVIAEGLDLLGVTAPDKM"
FT   gene            complement(364696..366150)
FT                   /locus_tag="BIF_01487"
FT   CDS_pept        complement(364696..366150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01487"
FT                   /product="Glucosylceramidase"
FT                   /EC_number="3.2.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01487"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84806"
FT                   /db_xref="GOA:D3R6S4"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S4"
FT                   /protein_id="ADC84806.1"
FT                   /translation="MIQAFSTYANAQGTTLAAAFAPLGNAYLRVGRTPESTSHASTPTL
FT                   SIDTTRVRQPIDGFGASITEATSWLWHNRVTDKERCIRDLFSPRDGIGISMLRQPIGPS
FT                   DHVSAPYRFVRRFPDRNLNSLDFTPEMERVLPMVEAANDCALATQSHALNIMASPWSAP
FT                   WWMKTNLSVLGKRRYTRITGHLRRGMYAAYARYITGFARLYAQRGLPLFALTVTNEPDY
FT                   PQSRWPSMAMTPREQAEFVARHLRPMLDHAGLEGTRILCWDHNYSTDHYPDGAFVRDMY
FT                   ADSAALTACAGSAWHYYGGSARTMSRIHDAFPNKGIWATEASGGDWGPRNFTPALLSLG
FT                   TAVIDMMNNWARSAVLWNIALDEHGGPDYYYLRNDRRHSENRGLITVRDDGSIRRNADY
FT                   YALGHFSKYVPIGSRCVECALDHAQGVRAAAFLVPAALTHGDGDQVVAVLVNSRPEPLD
FT                   LLCHLRGAGNGVMLTLPASSLTSFLA"
FT   gene            complement(366218..366676)
FT                   /locus_tag="BIF_01488"
FT   CDS_pept        complement(366218..366676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01488"
FT                   /product="Translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01488"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84807"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S5"
FT                   /protein_id="ADC84807.1"
FT                   /translation="MHTQGAKPEHRFTPASERNIMYENLQAVTTMEAPAALGAYSQAVK
FT                   ANGFVFVSGQLGIDPATGELDGVTAAEQAARALKNITNILAAAGCGVEHVCRATIYLRN
FT                   VEDFSEVDGVYAKTFTGTVKPARVAFGNNMIPKGALVEIDVIAVCPQN"
FT   gene            complement(366737..366829)
FT                   /locus_tag="BIF_02185"
FT   CDS_pept        complement(366737..366829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84808"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S6"
FT                   /protein_id="ADC84808.1"
FT                   /translation="MSLYLGLFHIRNPQNIEDAWFPNLSRETFA"
FT   gene            complement(366864..367535)
FT                   /locus_tag="BIF_02021"
FT   CDS_pept        complement(366864..367535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02021"
FT                   /product="CebG"
FT                   /note="Cellobiose/cellotriose transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02021"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84809"
FT                   /db_xref="GOA:D3R6S7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S7"
FT                   /protein_id="ADC84809.1"
FT                   /translation="MFRNIARAFGAMKFWEALGGTFLVATIVSISTVFFSTLAGYSFSK
FT                   LRFRGRNALLMLVVATMTIPQQLSVVPLYIMANKAGLFGSLWAVIIPGLVSAFGVFWMT
FT                   QYIGDALPYELIEAARVDGCSMFRTFLHVAIPAARPAAAMLFLFTFIAQWTNYFWPMLI
FT                   LGPNKNKMLTVAAATLKGAYFTDYTIVMSGVVLTTAPLLLLFFFAGKQLVSGIMAGAVK
FT                   G"
FT   gene            367456..368460
FT                   /locus_tag="BIF_01489"
FT   CDS_pept        367456..368460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01489"
FT                   /product="cellobiose-phosphorylase"
FT                   /EC_number="2.4.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01489"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84810"
FT                   /db_xref="GOA:D3R6S8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S8"
FT                   /protein_id="ADC84810.1"
FT                   /translation="MVATRKVPPSASQNFMAPKARAMFLNKPVPGIIAGMFVLYGEQYA
FT                   QILEQFGEACGMGADEVANETAEVRKTIAEVREATLTAGWDGAWFRRAYDANGNPVGTN
FT                   EDSEGKIYIEPQGMCVMAGIGVDDGKAAKALESTKELLTCRWGTAILAPAYSTYRIELG
FT                   EISSYPRGYKENGGIFCHNNPWISIANAKINNNDEAFNVYKRTCPAYTEEYSEIHRTEP
FT                   YVYCQMVAGPEAPTPGEGKNSWLTGTAAWTFVDVSQHLLGVQPTFDGLKIEPHLPPNFG
FT                   ELHIERTWRGTRYIIDVTRTGEQSLTVDGQPVSGTVVPTAATGTEEVHVALTI"
FT   gene            complement(368629..368704)
FT                   /locus_tag="BIF_tRNA05"
FT   tRNA            complement(368629..368704)
FT                   /locus_tag="BIF_tRNA05"
FT                   /product="tRNA-Arg"
FT   gene            complement(368795..369793)
FT                   /locus_tag="BIF_01172"
FT   CDS_pept        complement(368795..369793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01172"
FT                   /product="Thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01172"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84811"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6S9"
FT                   /protein_id="ADC84811.1"
FT                   /translation="MQTFNSARTRAERGIMPEREIKPGISLAGAIDLEGLKHQVKAEPG
FT                   QAGGAPAAGGYVIDVTQNNFQAVAQASATYPIVIFMWVPTDNRLFDMARELGDAVNGMD
FT                   GKLQLARIDVSREPEIAQAFGVQGAPALFALIGGRPMPILQGMPQGDEMTQITTQVLPQ
FT                   LVQVAAQAGVTGTAPYITPQNADDEEDTQKEPAVPPEHAEAHRLAQEGDYAGAADAYEQ
FT                   VLEREPDDELAKRGRAKALLLARSANADVREAREKAAANPDDLDAQLAVADVDMIGGQI
FT                   QDAFDRLLDYLAAHPDAVEPIRERMLEYFLIPEATDERLARARRRLATLMY"
FT   gene            complement(369815..370825)
FT                   /locus_tag="BIF_01173"
FT   CDS_pept        complement(369815..370825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01173"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84812"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T0"
FT                   /protein_id="ADC84812.1"
FT                   /translation="MNTRRKAVSLGAAGLALCMCVTLGACEGQLPEPVQATASASASPN
FT                   LTTEQEKAIRKQLLEAIEQCNNAKSADGLDRAMSGPELEIRRSELAVAQKTGNLDPKTD
FT                   IPDAITQTIIPTDSGWPRSVFTITTTTQDQQSKRLLVFDQESARQNYKLWGVARLFQGV
FT                   QMPKFTVPQIGAQMGTDNDDNLKMTPKEAVKRYADVLQNGDKSQYAGDFDNDYLRQELA
FT                   TLSQTVQQGMERNKGTQTQTFEPVDGQMRIMRAADGGDLVVAQINSVWTRAAGEGRESQ
FT                   PASDSEKALFGDAKATSTMRVTYVNVVALYIPSAKANAKITAVGAERQPVKVEAI"
FT   gene            complement(370822..372171)
FT                   /locus_tag="BIF_01174"
FT   CDS_pept        complement(370822..372171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01174"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84813"
FT                   /db_xref="GOA:D3R6T1"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T1"
FT                   /protein_id="ADC84813.1"
FT                   /translation="MTDIHEQREQTRTKKEPTRHAKIMRGVVTPIFGLLAVACIVFGIL
FT                   NQTIWQPNPQIAATAPVRNTQYLLVDQGVANLVDKNVRIEAASPSATANDGVCMALTSP
FT                   KDAAGWLAGQPYERITGLSNWSTLSYAEQGAQGEANTSGADVAFKDSNMWKEVNCGAGK
FT                   ASLDLKDAAGTDVVLADFGQKVSDGSLEMHWTRHDIPNFSIPWYFAGGLCAVLAVLCAS
FT                   VFAMDMSARRKKVSEDAERARQERQEQRKDEPKIGEALAGSLAALKPRSKGKSKTKGGP
FT                   RHGRHAGKQEDEQPTTPTIVDPHARNLVAEQAQQANENASVEVSVANGSDEASETATRT
FT                   VSNDGSATDGTTTSVITEAELQDYFARLAREVGMESSTPSEQGEPEAERVQDTDESESS
FT                   EDEQSAESNESTESTEPEDVTETSEGGEASQEETEGEQSAAAESGDKEGK"
FT   gene            372210..373235
FT                   /locus_tag="BIF_00973"
FT   CDS_pept        372210..373235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00973"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00973"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84814"
FT                   /db_xref="GOA:D3R6T2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T2"
FT                   /protein_id="ADC84814.1"
FT                   /translation="MPERIYIRRNTCARIFLAGMTQAKSAGIRKRAVQAVAAMCVAATC
FT                   FAFAACGNSNASESTGKSSASSSASSGLTKIEGVKDTAKVGEKPVLEFKKPLNVPDNSY
FT                   AILQEGDGEVIKPGNRVCAQGMAVDGKTGDIKMSTWETNQMDCSLVAPKKGEKTSALLS
FT                   VIDGLKLNSTVVFGSNDSTADSSNLIVMTLKSQSTDLTKAEGTKVKDIPSDLPKVTNAA
FT                   DGKPSIDMNGYKDSDKLVVQPLIEGDGEKLDSNSYAVVKYTGWLLDGKQFDSSWDRNST
FT                   FDVNMQGGVIEGWLEGLKGQKVGSEVLLVVPPSLGYGDQAQGEIPANSTLVFVVDILAK
FT                   Y"
FT   gene            complement(373308..374057)
FT                   /locus_tag="BIF_00055"
FT   CDS_pept        complement(373308..374057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00055"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84815"
FT                   /db_xref="GOA:D3R6T3"
FT                   /db_xref="InterPro:IPR002793"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T3"
FT                   /protein_id="ADC84815.1"
FT                   /translation="MGEQGWGRGAASLDGMRIIVADCCAEYTGRLSASLPLAKRVLLIK
FT                   ADNSLLIFSEIGSYKPLNWMLSPCTIKDITPQDADDDPATPTPEKIIRVQSTKTNDVLE
FT                   VTLQHIYSDETHDLGTDPGLRKDGVEDHLQRYLAEQIERIGEGAKLVRREYPTAIGPVD
FT                   IMAIDADGTHVAIEIKRHGGIDGVEQLTRYCELLNRDPLLAPVRGIFAAQTITPQAQVL
FT                   AKDRGFDCLLLDYDDMKGTDDGALRLF"
FT   gene            complement(374404..374712)
FT                   /locus_tag="BIF_01897"
FT   CDS_pept        complement(374404..374712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01897"
FT                   /product="ATP synthase epsilon chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01897"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84816"
FT                   /db_xref="GOA:D3R6T4"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T4"
FT                   /protein_id="ADC84816.1"
FT                   /translation="MAGATIAVNIVSSERPVWSGEAKQVVVPAYAGGMGILPGHEPVLS
FT                   VIEEGRLDVTDPNGKKFSFEVTGGFISFDSNKLTVAVENARSIAFQAEGADQSGIVG"
FT   gene            complement(374712..376199)
FT                   /locus_tag="BIF_00327"
FT   CDS_pept        complement(374712..376199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00327"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84817"
FT                   /db_xref="GOA:D3R6T5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T5"
FT                   /protein_id="ADC84817.1"
FT                   /translation="MAENQANAAADEAAEPIVGHVTRIQGSVIDVEFPVGHMPDIYNAL
FT                   TVEIKQMGQQEEGEVKDSVITLEVEQHLGDSTARCVALKSTDGLVRGAIVHDTGGPIEV
FT                   PVGDVTKGHVFDVSGHILNKKPGEKIVIKERWPIHRNPPAFDQLESKTQMFETGIKVID
FT                   LLTPYVQGGKIGLFGGAGVGKTVLIQEMIQRVAQNHGGVSVFAGVGERTREGNDLIGEM
FT                   DEAGVLEKTALVFGQMDEQPGTRLRVPLTALTMAEYFRDVQNQDVLLFIDNIFRFTQAG
FT                   SEVSTLLGRMPSAVGYQPNLADEMGSLQERITSTRGHSITSLQAIYVPADDYTDPAPAT
FT                   TFAHLDATTELSRDIASRGIYPAVDPLASTSRILDPRYVGQAHYDCANRVKAILQRNKE
FT                   LQDIIALIGIDELGEEDKTTVNRARKIEQFLGQNFYVAEKFTGVPGSYVPAEETIEAFT
FT                   RICDGVYDNVPEQAFSGIGGIEDLEKKWHKMQKEYGD"
FT   gene            complement(376209..377129)
FT                   /locus_tag="BIF_00544"
FT   CDS_pept        complement(376209..377129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00544"
FT                   /product="ATP synthase gamma chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84818"
FT                   /db_xref="GOA:D3R6T6"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T6"
FT                   /protein_id="ADC84818.1"
FT                   /translation="MASQLALKSRIASTGSLEKIFNAQEMIAASHIAQARQLALDSKPY
FT                   TDAIFDAVQTLVSHTHISHPIVKKDEGNPRVAVLALTADRGMAGAYTSSIIRETEDLLA
FT                   RLEGEGKQPQLYVYGRRGVSYYHYRNRPLAQSWEGDTEKPGVEVANAISRALLKAYMEP
FT                   VDEGGVAELYIVYTEFINMVVQKVRVLRMLPVEVVKEDKSHLNVPDTTTAPQVRPLYSF
FT                   EPSLDEVLDTVLPRYVRSRIHECLFEAAASEVACRQNAMHTATENARDLINDLTRKLNA
FT                   SRQASITQELTEIIGSADALNKKEE"
FT   gene            complement(377133..378779)
FT                   /locus_tag="BIF_01340"
FT   CDS_pept        complement(377133..378779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01340"
FT                   /product="ATP synthase alpha chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84819"
FT                   /db_xref="GOA:D3R6T7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T7"
FT                   /protein_id="ADC84819.1"
FT                   /translation="MIMAELTIDPATIRKALDDFVEAYTPSETPTQEVGHVATAGDGIA
FT                   HVTGLPGCMANELLTFEDGTLGLAFNLDAREIGVVILGDFVGIEEGQEVRRTGEVLSVP
FT                   VGDGFLGRVVDPLGRPIDGMGEIKSEGRRILEAQAPDVMHRHPVDQPMSTGLKAIDAMT
FT                   PIGRGQRQLIIGDRQTGKTAIAIDTIINQKKNWESGDPKKQVRCIYVAIGQKGSTIASV
FT                   KQSLEEAGAMEYTTIVASPASDSAGFKYIAPYTGSAIGQHWMYNGKDVLIVFDDLSKQA
FT                   EAYRSISLLLRRPPGREAYPGDVFYLHSRLLERCARVSDDLGGGSMTGLPIVETKANDV
FT                   SAYIPTNVISITDGQIFLQSDLFNAGQRPAVDVGISVSRVGGAAQTKALKKVSGTLKIS
FT                   LARYRSLESFAMFASDLDAASKAQLNRGARLTELLKQPQFSPYSMEQEVVSVWAGTHGK
FT                   FDDLAIADVLPFEHGLLEYVDRNTDILTTIRDTGDFTKETEEALDKAVDAFRETYVTKA
FT                   GKPLVDKKTAPKSVTPVDQEQIKAGKAQEKK"
FT   gene            complement(378837..379670)
FT                   /locus_tag="BIF_01339"
FT   CDS_pept        complement(378837..379670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01339"
FT                   /product="ATP synthase delta chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01339"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84820"
FT                   /db_xref="GOA:D3R6T8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T8"
FT                   /protein_id="ADC84820.1"
FT                   /translation="MQGEASRLADRESRDSFAAKLRESGNDAWEIGNELFTITYVFDHN
FT                   PRIPRALTDPGRPTEDKVALLNNLLGKQALPLTMEILTDLVGRSWSRAGDIDNAIEDFA
FT                   VDAMMYQADDEKKTLKVSVQLAQLQSALLNLPVVRSDLSDSQGPLNVRYELLHALIDGA
FT                   DFDRITVRLAEHCTRNPRNRRYLESVQWLINKFSRHMGESMVTVTTATPLSDEQSDKLA
FT                   RIYTKKTGRPVHIHSVVDPTVMGGMRIQVGDEVTDNTVVAQLENLKRKVKAGVSE"
FT   gene            complement(379728..380255)
FT                   /locus_tag="BIF_01338"
FT   CDS_pept        complement(379728..380255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01338"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01338"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84821"
FT                   /db_xref="GOA:D3R6T9"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6T9"
FT                   /protein_id="ADC84821.1"
FT                   /translation="MTIAANGVDLFLPETYDIVWSLIILIIVALFFYKFFLPKFQSVFD
FT                   ERTAKIEGGLAKAEQAQKDAEEAKKKYQAQLSTARVEASKIRDDARAEASHIIADARSR
FT                   AETEAAQITANAERSLESQQQKAMVNLKGEVGSLATSLASKILGSELQDSAVQTQMIDQ
FT                   MLADMENDESKK"
FT   gene            complement(380309..380560)
FT                   /locus_tag="BIF_01896"
FT   CDS_pept        complement(380309..380560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01896"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01896"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84822"
FT                   /db_xref="GOA:D3R6U0"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U0"
FT                   /protein_id="ADC84822.1"
FT                   /translation="MTRKEITMDIVTLAEVAGNLNVVGYGLAAIGPGIGLGILIGKTIE
FT                   STARQPELGGRLQTLMFLGLAFVEVLALLGFVAAFIFQ"
FT   gene            complement(380591..381403)
FT                   /locus_tag="BIF_01337"
FT   CDS_pept        complement(380591..381403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01337"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01337"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84823"
FT                   /db_xref="GOA:D3R6U1"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U1"
FT                   /protein_id="ADC84823.1"
FT                   /translation="MVDVFSAGALTLAESSMEMPSIDDFLPPEILFQGTPFAINRIIFV
FT                   RILATIIMLLVLGITAARAKLVPGRWQGAVEWLIEFIKKDIVYQVMGEVRGKRYVPMIT
FT                   TVFLTLLVFNLCGEVPGMNIAASATITLPLVFAMWCFAQYWIAGIREKGLGHFLRDELF
FT                   PKGVPWPIYILLSPIQLLELLVIRPFSLTIRLFANMVSGHLILALCLSATQYFLIDVVN
FT                   KFMMPFGVVTFAAGVFMYLFEVLVACLQAYIFAILTTAYINMSYPEID"
FT   gene            complement(381695..382834)
FT                   /locus_tag="BIF_01336"
FT   CDS_pept        complement(381695..382834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01336"
FT                   /product="Homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01336"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84824"
FT                   /db_xref="GOA:D3R6U2"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U2"
FT                   /protein_id="ADC84824.1"
FT                   /translation="MRYGRWVLCACRPYSLDCISACVLCGCVVRTFAHNWSMPIKIPGG
FT                   LPARAILDSERIFALEKPEAERQRVRPLKMVILNLMPKKIETETQLLRLISKSPLQVEI
FT                   DFMKTSTHESKHVSADHLVKFYEPLEAYEGNCYDGLIVTGAPVEHLRFEDVDYWDEFKR
FT                   VLDWSSTHVFSTMYMCWGAMAALYQRYGVHKMDLDEKLFGVFPQFLQDEYCFLTNGFDE
FT                   IALQPHSRLAGVNEADIAANPELQVLTWGPQAGPGLIATRDFSEVFALGHWEYGKYTLA
FT                   EEYRRDMAKGMSNVPFPRNYFPNDDPALAPLFSWRAHANLLWRNWLNWVYQTTPYDLSE
FT                   VPQLRAERRLGTDRSIRHAPCSPRDDQFLPFDTSGYGLK"
FT   gene            complement(382844..384274)
FT                   /locus_tag="BIF_00289"
FT   CDS_pept        complement(382844..384274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00289"
FT                   /product="Multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84825"
FT                   /db_xref="GOA:D3R6U3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U3"
FT                   /protein_id="ADC84825.1"
FT                   /translation="MTSVHNAPAPKQVDAKHVGALMAALMAAIFAFQLNASMLSPVLTT
FT                   MRVELNTTDAEIGLTQTVFFTACAVFSLFLPRLGDLKGRKKVLIGMLACTAIGCVISAC
FT                   ATNVTMLMIGRVIQGVAGPVVPMTLLMLHAEVTDNARYARLMAILTSVNGGIAGVDALL
FT                   GGWLAGNFGFRSVFWVMCGVAVLAVVLVWSFARESTADETPKMDWLGAILLSAAFLAAY
FT                   LAINEIEKLAGANWWLIAIEIVVAAVLFVIFWHVENAQKNPMVTTTYLKERRTWGLLLT
FT                   TLLTMTGVFAVMNGIVPALAQDTSVGASMSADTVSLATLTPYALVGLVFGPVAGVIASK
FT                   MGYRSTLRGGLIVSAIAMVFGVFVCQSPHIWGLVVLSVVLGLSYAGTANIMLNGLGIVL
FT                   SPEDNPGYLPGLNAGAFNLGAGLSYAILYGVQQGFSDAHGATMGYTGAMIAGIILLVLA
FT                   FLSSLLIPKPAQNAAEEH"
FT   gene            complement(384388..385329)
FT                   /locus_tag="BIF_01895"
FT   CDS_pept        complement(384388..385329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01895"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01895"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84826"
FT                   /db_xref="GOA:D3R6U4"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U4"
FT                   /protein_id="ADC84826.1"
FT                   /translation="MVKKIILDCDPGHDDAVAILLAIGNPNIELLGVTTVGGNQSLEKV
FT                   TYNARAVLEKAHAPNIPVHAGCARPIIRDPQVAATIHGETGLDGVELPEPTRPLDPGHA
FT                   VNWIIDTIMSNEPGTITLVPTGPLTNIALAARLEPRIVERVKEVVLMGGGVHVGNWSAV
FT                   AEFNIKVDPDAAHIVFNEKWPVTMIGLDLTHQALCKPEKQRMIEGIGTPLASFVSGLMD
FT                   FFRKSYAENQDFVDPPVHDPCTVAYLIDPTVITTRRCPVDVELRGELTLGMTVADLRGP
FT                   EPSAEECHTQVAMKLDFDKFWNLVTDAIRRIG"
FT   gene            385599..385675
FT                   /locus_tag="BIF_tRNA06"
FT   tRNA            385599..385675
FT                   /locus_tag="BIF_tRNA06"
FT                   /product="tRNA-Met"
FT   gene            complement(385765..386910)
FT                   /locus_tag="BIF_02162"
FT   CDS_pept        complement(385765..386910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02162"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84827"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U5"
FT                   /protein_id="ADC84827.1"
FT                   /translation="MKKDTAEVSMEIDSKMLVASLRNYAEAKHMQLQDVGKQLGFSKDR
FT                   TKSIFTGRSKLTGDDVLRILMNVDIPLPELKRYRQLWRLRREVLNFERPDDFEQFVDGL
FT                   NVSATLFPRKVQGSLARSDNERVSTELARDMMARENWYVLRNGWVCALKVEGKWVTFTP
FT                   FAPDFMTAARAMIGLKWIHRKTETSIPFIDWGAVRGGCPSSEETSRFVGRELLKYIQSK
FT                   PDRFPLDDEFRGMVAGKAMGEFQQNRILELEKSLNTVKEIAESSLKYSLSTEKDEYGIS
FT                   PAEIYSSVFDYLESNVTNLYGIRRLLLEDGITIPPQLEEECERVLGLNERHYKYSLYIE
FT                   PILAVNDLPDRLASPTKAERVQYEKLRADSEEKSKKSKSGR"
FT   gene            complement(386998..387204)
FT                   /locus_tag="BIF_02161"
FT   CDS_pept        complement(386998..387204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02161"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84828"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U6"
FT                   /protein_id="ADC84828.1"
FT                   /translation="MQSGFDRAHFQWSWEETANGVLSKKNFETLVWLTRLAHTLHDFYV
FT                   QNRVRGVCHVAHLLSFVFVGDSI"
FT   gene            387239..387730
FT                   /locus_tag="BIF_00709"
FT   CDS_pept        387239..387730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00709"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00709"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84829"
FT                   /db_xref="GOA:D3R6U7"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U7"
FT                   /protein_id="ADC84829.1"
FT                   /translation="MAVPKCRSEPQLRHSIFTVFTFVIFEPVQGEPMDFITKAQLFAQD
FT                   HFIVIAIVLFALLAVCAFFIARHNSRAARKHDTLCAKPLSLSPDEEKAVKVRYARKPKR
FT                   VIFLLPAALTTDEDVNAWADAVAPRLGHAFQAVNVETIPQGLFSRAKYRVTFARLEELR
FT                   "
FT   gene            387727..388488
FT                   /locus_tag="BIF_00874"
FT   CDS_pept        387727..388488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00874"
FT                   /product="Cell division protein ftsK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00874"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84830"
FT                   /db_xref="GOA:D3R6U8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U8"
FT                   /protein_id="ADC84830.1"
FT                   /translation="MNIFRNHRKLPSDRYSLGLDIADPKRTVTIPRSAHLAVIGESNSG
FT                   KGSVIANIISQEVAFGGEIWFIDLKAGMEAENYCNVLARKAYTLEEAYDLLTDFNSNVD
FT                   TLAAEWRGKTRSLTDAQTCHRLLVIDEAADMVRSGPNKKLSDSCIELVRSILSRSRALN
FT                   CTVVVATQNPRVSTSLPYRSLLLTTVALRLNSKGEATMALGEDAVKRGARPWQIPFSRP
FT                   GDGYLWDTETNQTVYLHVPFISDEELHRLHR"
FT   gene            388485..389402
FT                   /locus_tag="BIF_00873"
FT   CDS_pept        388485..389402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00873"
FT                   /product="Replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00873"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84831"
FT                   /db_xref="GOA:D3R6U9"
FT                   /db_xref="InterPro:IPR002631"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6U9"
FT                   /protein_id="ADC84831.1"
FT                   /translation="MTRLAMGEASAKAQTQQSRRLKGVWGPTTTAPIRDVRCEKGENMT
FT                   DDNTQTSLNDKGRYWAGLIYPDSCPDDWKATMQMSGLQILVSPVHDKDIEDPKTGKLKK
FT                   PHRHVVAMWTNTTTRRNATRFFEQFNGPKTILRVESPRGMARYLVHLDNPEKVQYLPED
FT                   VIEINGADWKKIALTDEERPEVMELLELIEEWEVHGYFELLKLCELKKPKLLPVAAKAT
FT                   TYCREVIWSYWQFKERNSKFKDELMERQREELRRKKATEQTKQRAQRKKLDQSARKSRK
FT                   NRRVKNQPQKSAKKQRRKNHGHRA"
FT   gene            389386..389613
FT                   /locus_tag="BIF_02186"
FT   CDS_pept        389386..389613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02186"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84832"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V0"
FT                   /protein_id="ADC84832.1"
FT                   /translation="MATVPSSETPSDRLKFYDVNDLRQMFHVGRNKARLMMDALPSIRV
FT                   GSKDYVTESALNAHIAEHGGILVKWPKRNR"
FT   gene            complement(389633..390751)
FT                   /locus_tag="BIF_00872"
FT   CDS_pept        complement(389633..390751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00872"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00872"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84833"
FT                   /db_xref="GOA:D3R6V1"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V1"
FT                   /protein_id="ADC84833.1"
FT                   /translation="MQITENRIKVRDVYENYENDDEEGVVGYDDRLDIRPRYQREFVYK
FT                   DAKRDAVIDTVLQGLPLNVMYWAKTGDDTYEVLDGQQRTISLMEYVDGNFSIKYENNAM
FT                   NFDNLPEDVQERILDYELLVYICDGTDSEKLKWFKTINIAGERLTNQELRNAVYAGPWV
FT                   SDAKRYFSKTNCPAARYGNSKGCNGYVKGESIRQEILETAIEWIADRDGTTVDGYMSAH
FT                   QNDPTAQELWSYFRTVIEWTESLFPVYRREMKGLPWGLWYNQYHEQKYDPKALEDRVSE
FT                   LMADDDVTRKSGVYEYLLTGHERVLNIRAFTDRDRRAAYEKQKGICPLCQQHFELSEMQ
FT                   ADHNIPWSKGGKTILENCVMLCVKDNIKKSNK"
FT   gene            complement(390751..391863)
FT                   /locus_tag="BIF_01894"
FT   CDS_pept        complement(390751..391863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01894"
FT                   /product="Modification methylase EcoRI"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01894"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84834"
FT                   /db_xref="GOA:D3R6V2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR025247"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V2"
FT                   /protein_id="ADC84834.1"
FT                   /translation="MDGGDTGMATPLNRANQAKEDEFYTQLSDIESELKHYRKHFAGKT
FT                   VLCNCDDPFESNFFKYFCLNFNRLKLKKLIATCYSGSPITGNELTLFGDDTEEERRTPY
FT                   KAVVTSVRDANGDGATSMVDVAELFKQGENLCERLEGNGDFRSEECLRLLDEADIVVTN
FT                   PPFSKFREFVSTLVEHDKKFIIIGNQNAITYKEFFPLLRDNKVWLGYGCGDMAFKVPDD
FT                   YEPRKTRYWQDESGQKWRSMGNACWYTNLDIKKRHEDLVLVKRYNRDDYPKYDNYEAIN
FT                   VGKVIDIPCDYEGIMGVPVTFMDKFNPDQFEIIGLLAGNIRGLAGIPSSTGKDGPYING
FT                   KLKFGRILVRNLHPEPRPYETVTLEEAQGK"
FT   gene            complement(391920..393140)
FT                   /locus_tag="BIF_01175"
FT   CDS_pept        complement(391920..393140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01175"
FT                   /product="DNA integration/recombination/inversion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84835"
FT                   /db_xref="GOA:D3R6V3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V3"
FT                   /protein_id="ADC84835.1"
FT                   /translation="MAKRETSGEIKELERGRRYSIRVRLAPDDTHQSWHWSKSRKVQGN
FT                   KAEATAALVAYRQELEDARSGKSVTVGEYATDFQAKRRALGKVSSLTIERDQHEIDRIV
FT                   KFLGDVRVVDLDAQRIEKAYLHMAEQDNASPDAIHKVHMKLAQIMRKAYLEELIERNPC
FT                   DAVEDIKRPKVSPQKRKETRITKEQALEFVHKLKNEPQDGRIVAVWLGLATGLRRGEAL
FT                   ALVWEDVDLENARLRIRKQYGKEKVLKDPKTAKSRRTISIDNQTVEFLTKWKTKQAGLF
FT                   AEVGLTLQESSPVCSNDLCVFLDPDNFSRWRRKFYVEEGLAHYAHESTYIDRRGIERVK
FT                   RSGYIGPNFQALRRAQATLLVAGGVDPKTVQARLGHESLNTTLNIYAEEVGENDRKAAD
FT                   FMGKLLE"
FT   gene            393744..395075
FT                   /locus_tag="BIF_01176"
FT   CDS_pept        393744..395075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01176"
FT                   /product="Formyl-coenzyme A transferase"
FT                   /EC_number="2.8.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01176"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84836"
FT                   /db_xref="GOA:D3R6V4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V4"
FT                   /protein_id="ADC84836.1"
FT                   /translation="MADKSTAPLAGIKVIDWTQVQSGPSCTQILAWLGAEVIKLEKVHG
FT                   GDPTRNEMNDVDGSYSLYFLQLNANKKSITLDMKDPEGKKILTDLLKDADVFVENIGPG
FT                   DVEKLGFGWDEVHKINPKLIMASLKGFNQGSRFEHVKAFEPVAQCAGGAASTTGWWEGD
FT                   KNIPTQSGAALGDSNTGMHLTIAILTALLQRERTGEGVFVYQSMQNAVLNLCRIKLRDQ
FT                   LILDHLHQLSYYDCYPGYKFGKAIPRAANAEGGLVLGWCYRAKGWETDPNAYVYIVIQQ
FT                   SQKGFENFCNAMGFQDWLTDPKFSTPNARDEHKQEVYKRVEEYTMQYDKYTLTKELGAK
FT                   GVPVGPVLDWNELENDPDLNEDGTLITIDQGDARGKFKTIGLPFTMSNYAPDYQRAPKL
FT                   GENNEEILKSLGYTDEQIADLATKGVIGSNDGVKADLTAAPAQA"
FT   gene            complement(395263..396420)
FT                   /locus_tag="BIF_00941"
FT   CDS_pept        complement(395263..396420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00941"
FT                   /product="Mannan endo-1,4-beta-mannosidase"
FT                   /EC_number="3.2.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00941"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84837"
FT                   /db_xref="GOA:D3R6V5"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR002883"
FT                   /db_xref="InterPro:IPR009031"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR036601"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V5"
FT                   /protein_id="ADC84837.1"
FT                   /translation="MEEESRLMHTNMKKTLAAVVGAMTLAAVLPATAAQAADNSLHVSG
FT                   GKIYSAGKQFVPQGINHAYQWYPEHTSSIGDIANTGANTVRVVLSGGRYGTTSASEVSN
FT                   IVNECKSNNLVCILEDHDTTGYGDTAYAADAKSLSDAVQFWKSVGSAVKGQEDYVMINL
FT                   GNEPYGNNTASQWTQGTKDAIRQMRDAGFRHTLVLTAPNWGQDWQGVMKDNAKSVYSQD
FT                   SNVLFDVHMYGVYSTADKVKSYIDSFVNQGLPLMVGEFGNKHSDGIPDAATIMSYTKEK
FT                   GVGMLAWSWCGNTEGVEYLDLVNNWNAGSLSGWGNMFVNGANGLKSRGIEKAGIYGGGS
FT                   NSGGSGNTGGNSGTTDDGYPICSSASVDPDGDGWGWENNASCKVR"
FT   gene            396394..396630
FT                   /locus_tag="BIF_02187"
FT   CDS_pept        396394..396630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02187"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84838"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V6"
FT                   /protein_id="ADC84838.1"
FT                   /translation="MHEPTFFFHCFIADVCFIACNRNTFAQPLSCSDYECKDIVKLKRF
FT                   TTELPNAETLNLRNVRQTVQNTQSVPTNNLQII"
FT   gene            397266..398495
FT                   /locus_tag="BIF_02160"
FT   CDS_pept        397266..398495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84839"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V7"
FT                   /protein_id="ADC84839.1"
FT                   /translation="MAAQRHEPDPQQAGDGERNRGDRGGRRTFLDVDVVAARDDDAGEC
FT                   RRQGHSHDEHGELVHIAAHAQQQADAEECRRGENQAVERVPDRLPAQRELHSGEREAGG
FT                   QHGDTGVRFGNQVEGGSETGRHAHADEHEHDGEQRSPAHRLLECVDERFEVLVLLLAHV
FT                   RRLGDHHLCRLVGLRILVRIDGDIVLRIGDADLALRVRDGGLRQALAILALAEVDQIHA
FT                   DRNRDGVDDDRDDRDDEVRAHGVAVDRVEHGEAEEADGRRAGDQRAYGRFLDRMVEHQS
FT                   AQVVAQHEHHDDADEAENCEHRILCEHLTGRLDDRDEQCGREGDVQHELVEALTLIVVE
FT                   VAEFSTDIAQRHDDDDGDDVVYQYLCHLSSLVFWWSGREHRCRGADDLSSYHAAALRGT
FT                   GANHIWAPLR"
FT   gene            complement(398471..400273)
FT                   /locus_tag="BIF_00592"
FT   CDS_pept        complement(398471..400273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00592"
FT                   /product="Oxalyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84840"
FT                   /db_xref="GOA:D3R6V8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017660"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V8"
FT                   /protein_id="ADC84840.1"
FT                   /translation="MNNHTRRMFAMVDVSVTATSSDQNLTDSPHYLAETLIKNGVKHMY
FT                   GVVGIPVTDFARIAQGMGIRFIGMRHEEDAVNAAAAEGFLTGRPAVALTVSAPGFLNGL
FT                   APLLEATTNGFPVIMIGGSSTRHVVDMHEGEYEGLDQMNYAKQFCKESFRIDKIEDIPL
FT                   AVARAMHIACSGRPGGVYIDFPDDAVAQTLDKDVAESQLWVANQPAPAMPPAQSSVDEA
FT                   LKLLSEAKNPLMLVGKGAALAQAEDELREFVEKTDMPFQPMSMAKGVIPDDDPHCTASC
FT                   RGLALRTADVVLLVGARLNWMLNFGEGKEWNPNVKFIQIDIDPNEIENARSIACPVVGD
FT                   IKSAMQMINAGLEKTPVKASAQWLDMLKADAEKNDAKFAARVNSNTVPMGHYDALGAIK
FT                   KVYDQHKDMILTNEGANTLDDCRNIIDIYQPRHRLDCGTWGVMGCAVGYSIGAAVATGK
FT                   PVLYVGGDSGFGFDGMEVEVACRYNLPITFVVLNNGGIYRGDFENLGDDGDPSPLTLSY
FT                   DAHYERMIEAFGGNGYYATTPAEVEQMVGEAVASGKPSLVHVQLADYAGKESGHISNLN
FT                   PKPVVGPLATSEMTANPYLKGAHM"
FT   gene            complement(400446..402179)
FT                   /locus_tag="BIF_01266"
FT   CDS_pept        complement(400446..402179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01266"
FT                   /product="Chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01266"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84841"
FT                   /db_xref="GOA:D3R6V9"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6V9"
FT                   /protein_id="ADC84841.1"
FT                   /translation="MCARRAPAKMETNQAQHRAERRGAGMTSEQSPHNGNAAGPPEPLT
FT                   QEGNGLSGRVKGSAARFDWRESFKHLLFAVVCGVAGGFGSILLCLFVDAMRSVFVRNTW
FT                   LIWLLPVAGLLELLLYKMFRIPLGETTESVIARMRHGRTVRGLLAPGIFLTTGMSILAG
FT                   GSVGKEAGALQMGASLGATIAKPFKLHDVLRVQEGAAEDRSMHSYAASMGMAATFSALF
FT                   FAPLGSCMLVLEFMRFSELRYVASMLIGCFVAYFIARHFGIGDLICTVPIPEFTWRAVG
FT                   ICLVIGVACAVAGSIFALCIRLLQNTTMQIVRNYYLWVVVGGLIMATLVSVFGWWRLTG
FT                   SGGEMLNHMLAQPNVSWDFAIKGLLTFICLGFWFKGGEIMPSLCIGGLLGGACFAMTGS
FT                   SPQMGVAVGALCFLAAFNRCPVSAFLLGCEIFGWGMAPFLAVGVAVSFMFGYPAGMYGA
FT                   SIDLLMTSGWRKFVLRQHRRAMENAANHDPDLFDYVLSATTAFKKATDRTRVFADPWIA
FT                   EHQREHEEHMQERMEREEKRRADVRRAQRAPAKPHHPEAPTRPAQSANANGTQEREPKT
FT                   K"
FT   gene            complement(402302..407737)
FT                   /locus_tag="BIF_01265"
FT   CDS_pept        complement(402302..407737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01265"
FT                   /product="Collagen adhesion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01265"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84842"
FT                   /db_xref="GOA:D3R6W0"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="InterPro:IPR041100"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W0"
FT                   /protein_id="ADC84842.1"
FT                   /translation="MRCHCDGKTVNTTRRPQAPTNTWKQERNRRNLMRKHNGVRLDGGH
FT                   SALAVLARRAASACMAVATVVGVVEAAPAWAEESAEFPQTMHFAVSMANMNLSENDLPA
FT                   FRYGFSGFREANPTVPVYTNSQFEEAQAYFRGNAAYCMDVDKGAPGDHWGDARNTVTVA
FT                   EPVTGYHMFKYTTRPSTVEYHKAGAPQTGAVAWIAAKGYPNVESQSVFAKNLDDVDARS
FT                   VTQLAIWIASGQVRVEGGEDSSKATKAVSVANPGHQVAGAGYSSGGQQNFAPYTMIGLA
FT                   WLLAQKALNAEDRDEYEAVFYEPVGTAGTLQRMLYARRVPKKAHPRTVTMRKVATNAAY
FT                   TTANEAYDMTGAEYALRRNGTLVHTFSTDAEGRATSSVDVMPGTYTLQEMQAPRRGYML
FT                   NSKVKTVEIAEGSGTQTITMDGEHAELPLTSIDDLHVRKVIANAGSPGSLEGDVASLEG
FT                   VRFRVEWFGMVATDAAALEGKHPQANAIWRTDSNGVARLHEKPDEGTWPYTDSAGRTMF
FT                   PLGTVRITELNAPQGLVRAASAQHPGSVFTLTDGGDHKVMRTTLNPWNNGSGGNDATTI
FT                   AFPNETVKGGVEVVKTDDDLHGSQPQGDASLDGTVYEIVNKSMAPVHVGGREIPRDAVV
FT                   ATIATKTVQGNSVAATETRLLPYGTYQIRERSAAAGYHRAGFDKTFRIREDNMIVRYTL
FT                   DANGVDANMATIRGVGANANDVQRGGLQLLKVDRETGLATPLGAASLNGTGFEVINRSA
FT                   NAVVVNNRTYKSGDVVRTLSASYGDIVDSDGKPTGSKGIVARTAIDELPYGTYEVRETV
FT                   ASAGYLRDASARAWSKRFTIGHDGGDASTGAYEANGNPHRYASLAHVSGAGSASNQVQR
FT                   ADFHFIKKSADTMERMGPIAWRLTSKTTGESHVIVSDKNGELHTKSCDGRFNDSGTGTT
FT                   GCRPHSRNTNANDPDAVNANGAVGKDSQGNPVVKDASKLDAEAGIWFTGIGPRSGGQSV
FT                   QWTSATSYEVTRDGAKRAVQVNDALRALPYDDYELVELPTPGANDGHRMLSVTLTAKEF
FT                   SRNGDGSLNPDGNGVDMDYGTLGNVAMGMTTRLAYFGAGADAFGDDGNAGDKLAPAIGT
FT                   LSVVDSAEYWGVTAGTYTDSGELYVIENGRISGEAVAKATKQLKVGNPHGGTSKLTFTI
FT                   DHAERLAGKTVVAFRTIRNADGTSLLEHRDAADAEQQLRFPQIHTNAAADIDDEANASA
FT                   QSVTITDAVSYANLVAGKPYTLKATLHYRTFGDTGVVSDGGVVHDRHGKEVTAELPFAP
FT                   SQSDGTVDVTFLFEPPEDLAGKTVVAFESLQHNGVDFAAHADIADERQDVRFPAIATSA
FT                   SDAFDGDSLLPITNGVVKDVVEYRNLSPGHDYELVSTIHAKVVGDDGTVSDMGALTDGD
FT                   GNTLTVTTTFTPGQADGTVDVEFPLDVGHLRLEGKRCVMFETLLRDHTMLAEHADINDE
FT                   HQEVQIASIGTQLTTEGGAHELQVTSAVSQAQLDAQLGIQVRESDDDVSQVEVVLTDTV
FT                   AYANLLADMPYRMDGELHLRGFDNAGHARDAGVLKDHAGNTVVASVEFTPKRSNGTARL
FT                   EFRFTVLKRDLHNVVLVAYERLYSNPMQDAQQLTAEHADIADEGQTVRIIDIGTQARDA
FT                   RSGTHSGTLDSRISQVDTVAFTGLTVGKEYEVRGELHIRDANGEDGGVLRNKDGQPVTA
FT                   FARFTAAKPTGTAELRFDAELGNVSGEVQTVAFERLMVEGKQVAMHADIDDAGQTVIYP
FT                   KPPEPQRPRGNAGSGTSVAATGVIADVFLAFAVITGALGLMVLTGLLIARRNRNL"
FT   gene            complement(407652..409748)
FT                   /locus_tag="BIF_01518"
FT   CDS_pept        complement(407652..409748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01518"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84843"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W1"
FT                   /protein_id="ADC84843.1"
FT                   /translation="MNRSARHMRVVVVRLLAMLAAVCAIVGIRGATRANAYTGEKLTVA
FT                   SASDYQSYFDGGRIYFFGMIGYDGQQRRYYCMDQSQETNYTLGVTKPMPDTLVTRLVGE
FT                   MLNRHQREHNVDDLQAALAFIVHDAFDTSQGDAGWPHARGILESQYPNILAKARELYEE
FT                   VRPVVPQSIATRVEYTDGKRAGNIVLEILDDEGTPTTNTEYSVSLEGDAVFANGARTRI
FT                   GRTNGKTLRFAWKASGEGAVRVHAQMQVPAVEMAVSSQNLLRVAAAKTVEAAGTAFDTV
FT                   TVFSPTLVTQTTPKSTDPGSAVTDDVTMRLDGDDNYWPADSAVEASGWYFTGLRGENLD
FT                   SVIRPDSGEPAREFLGRLKRLGFEPAAYGNATFTHDGQHRQVQAVSEENGTEPYRAHDG
FT                   DAYGTWVWAVERQRQPSAVQQVMTHDWVSGFMEPAETNVTRTPVQVRSQAGEHSAHVGA
FT                   MLTDVIEVSGFPHDHGEFGGNEQYGLAADEPYAQVSMWWAGDGNGGDDEPYRPQGEAEP
FT                   EEDGHHTLIGSWDVPARNGIVRFGGGQIDAHGDAVTVQAARPGWYVFVWKFKGDARAMP
FT                   QQSAYGDSWECVRVVRGSVHAEPAADGLPADERKTADLSASPTQQGVRTDPAKSVTRQP
FT                   APIRLARTGVSMGGVALMGVVIVTAIAMLLVAHRRHAMSLRREDGEHNAATAGADEHME
FT                   TGKE"
FT   gene            409728..412271
FT                   /locus_tag="BIF_01519"
FT   CDS_pept        409728..412271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01519"
FT                   /product="Alpha-amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01519"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84844"
FT                   /db_xref="GOA:D3R6W2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021828"
FT                   /db_xref="InterPro:IPR026585"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W2"
FT                   /protein_id="ADC84844.1"
FT                   /translation="MSCRSVHSNRPSRIVLADYVLSDSHSQVGVHSRTGHCGRRTAFQS
FT                   IVDNRATIHNPQRLCDNGTNFVHPALNSCGNEEACGLPTGNASTMWTIGKEFPPFVQAR
FT                   NLSREKLHTMTGMEAQHNETEAAGKPAAKKTTRTRKPRASKQATFIAEAPAMPIAIKEP
FT                   GQFGRVNILNCQPSVEDDVYAARVEIGEQFTVSAQVFMEGRTKVGATAVLKNPRGRIMA
FT                   RVPMTVENAGLDLYTAKLQAGEHSTLNPWDAEFAEVKKQLGNWRVAIEGWEDTYGAWLH
FT                   DARIKVDVLSDVENTLTSGSELLTRWASTRDANLNAEQRKTLREAAKSMMDTSLDAKSR
FT                   LTFADNADIEALHETNPLRDGLTSSGDHVFHVERPKSSFSAWYQFFPRSEGAYLDDNGK
FT                   KVQGNFHTAVSGLERAKAEGFNIVYLPPIFPIGVTNRKGPDGALNAGPDDPGSPFGIGS
FT                   ELGGHDTVDPLLGTMDDFKAFCQRAHELNLEVALDFALQCSPDHPWVKEHPNWFRTKPD
FT                   GSIAYAENPPKKYQDIYPIDFDNDLEGIEREVERIMNLWIDAGVTIFRVDNPHTKPVRF
FT                   WQDVIAAVTKKHPEVLFLAEAFTRPAMVRALSYAGFTQSHCYFPWRNTKPQLEEFLQET
FT                   NGKGGYYQHNTFWPTTPDILTAYVRDGGVAAHAIRAVLAALGSPSWGIYNGYELIENRQ
FT                   RADAEEQSSNEKFEIKVRDWSAANRIGISKLLTSLNEIRSKHAATTSYHNLTILPSANE
FT                   NIIAFARQTEGRFTKDGRTDTLIVVVNLDPYNEQQSSIHVDAKALGLPTEHPYRVKDQL
FT                   TGREYDWSWDNFVSLAPWADVAHVFHVETGEQPLD"
FT   gene            412354..412881
FT                   /locus_tag="BIF_01115"
FT   CDS_pept        412354..412881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01115"
FT                   /product="Inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84845"
FT                   /db_xref="GOA:D3R6W3"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W3"
FT                   /protein_id="ADC84845.1"
FT                   /translation="MQRRNTMAETFNVVVEIPRGSKNKYEVDQASGRVFLDRTLFTAMG
FT                   YPDDYGYIDGTLGEDGDPLDALVMLTDSVFPGCVVKCRAVGLYHMVDEEGGDDKVLCVP
FT                   DDVRYDNIKNIDDVSKFHKAEIKHFFEQYKALEPGKEVMPGDFFADVETAEKEIKEAKE
FT                   RLAKSKNEDITL"
FT   gene            complement(412926..413774)
FT                   /locus_tag="BIF_01114"
FT   CDS_pept        complement(412926..413774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01114"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84846"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W4"
FT                   /protein_id="ADC84846.1"
FT                   /translation="MSETQHGNDARNAAADGELTADSTLTAQMAPDYRPVAPVAPFSRS
FT                   VWLQIALYVVLVALACIPGSNAVSSVMFSLTGFVVGVMIMLFAFFTPLRDGIPGRVTGV
FT                   ILGLLGMIFASTPMLGEFVFGSMGSPSRPQLGSPGTLAVCAWFAGVGALLVVLVVVAFG
FT                   RQMARLDRSHLIVQLSHMVMDGACTVLCSGWCFLPMLMQGFGESKAESANGELWVWIAG
FT                   VVAIVVFAVGLGFMDRVWYRDSRPLEGAQAPWVGFALIPVMLTGGLVALATLVVQLTLT
FT                   V"
FT   gene            413998..414834
FT                   /locus_tag="BIF_01113"
FT   CDS_pept        413998..414834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01113"
FT                   /product="GlnR"
FT                   /note="Transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01113"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84847"
FT                   /db_xref="GOA:D3R6W5"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W5"
FT                   /protein_id="ADC84847.1"
FT                   /translation="MLAHTMRTSLLHKHGTQQERIGNVTDLTLMTFSTDPTTVLPSLTL
FT                   LSHRVRVLPMDASSLVRMPENTILLLDARDDLASAKTLCRLLHASGLSTPIVLILTEGG
FT                   FTVVNGEWGVSDVIVNTASPAEVEGRLRLVTERVATYNVMPNALANSGPEDEDGLIRSG
FT                   DLVVDTNGYTANLRGVPIDLAYKEFELLKYLVQHPGRVFTRAQLLQEVWGYDYYGGTRT
FT                   VDVHVRRLRAKLGGEYEHLIGTVRNVGYRFDPPEEESANNTAREAAEMGSPTSADE"
FT   gene            414791..415657
FT                   /locus_tag="BIF_01112"
FT   CDS_pept        414791..415657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01112"
FT                   /product="Endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01112"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84848"
FT                   /db_xref="GOA:D3R6W6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W6"
FT                   /protein_id="ADC84848.1"
FT                   /translation="MKLPRWAHLPRRTNNSPLPVTLPLGTCEFAWNLTVEDCGSGMAGE
FT                   SRKARITRMHRQYETLCEFIPTVKCQLDFHTPFELLVATILSAQTTDKRVNSITPELFG
FT                   TYPTAAALADARLEDVESIIRPLGFYHVKAEHIIAVARQIVERFGGQIPQTMEELTSLP
FT                   GVGRKTANVVLGNAFRVPGFPVDTHVIRVTGRLHWRDDWMKTSTTPERIEQEITGCFPE
FT                   SEWTDLSHRLIIFGRNICTSRSPECENCPLLPTCPSAGEFLEIAAERKARATRRAPRKP
FT                   RSRKTAK"
FT   gene            complement(416053..416169)
FT                   /locus_tag="BIF_02188"
FT   CDS_pept        complement(416053..416169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02188"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84849"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W7"
FT                   /protein_id="ADC84849.1"
FT                   /translation="MQSVSFYADRSLRIISCISCISCINNANICVKRDKSRT"
FT   gene            416168..417769
FT                   /locus_tag="BIF_00853"
FT   CDS_pept        416168..417769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00853"
FT                   /product="Dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00853"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84850"
FT                   /db_xref="GOA:D3R6W8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W8"
FT                   /protein_id="ADC84850.1"
FT                   /translation="MDTCLLVRRVGREARRIIYTGAMTEHGNRRARKIRPWIVFFVIIA
FT                   VLGAAAGVGITGLRGGNSGLNAVVGSLRGGRKLEVGLLDEPTSLDIRSNSERSVQQALM
FT                   GNVYETLVTFNDEQAIASGLAARWTQTTDGLRYTFFLRNGLTFSDGTPLDASSVVRSLQ
FT                   QTLAGDHTNDGLSNITAVENNDARSVTFTLSSPNPRLLPALASQAGAIVNPNAKNPDFA
FT                   HHSYGSGPFIVNAVQPGSIELTRNEHYWADKPKTSQATLRYYTDEQKMADDLKAGKLNV
FT                   ALPRSAHIAEQLSHTSGITLQDGFSTRKTLLALNSKSESPFSDEQVRQFTRYAIDARQI
FT                   ANAEPGAKAQLSGPISQMQPGYVDLDNLFQHDLGKASSMRWYFAADYFKPFNLLADEAH
FT                   RELAQTLVDQIAAIPMPVSLEVVDSATLNSRVQSGDYTCALIEMDDPHDYTRFVDGSAM
FT                   FGYVNGTVQQQYRKALEQTDFKDYREQLREFDRLVSDDAASAWLYTGKDYVAAQNDVQG
FT                   VDANLAGSRLALAQLS"
FT   gene            417833..420625
FT                   /locus_tag="BIF_00854"
FT   CDS_pept        417833..420625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00854"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00854"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84851"
FT                   /db_xref="GOA:D3R6W9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6W9"
FT                   /protein_id="ADC84851.1"
FT                   /translation="MTDSEDYSINANLTALPDRVGVDGLEAKWRKVWDEDGTYTFHDPG
FT                   ERKAVYSIDTPPPTVSGHLHVGHVFSYTHTDIIARFKRMNGYEVLYPMGWDDNGLPTER
FT                   RVQNYYGVRVDTSLKYDPDFVPPFEGTEGKKIQAKDQVPISRKNFIELCEKLTAQDEKQ
FT                   FEELWRQLGLSIDWKQTYHTIGEYPQRVAQKAFLRNLERGEAYQKDAPGLWDVTFQTAV
FT                   AQAELESREYPGFYHRIAFRFEETGEPIYIETTRPELLPACVALIAHPDDERYKPYFGK
FT                   MVTSPLFNVKVPVLAHPAAEKDKGAGIAMCCTFGDMTDVEWWRDLHLPTRSIIQRNGRI
FT                   VMDTPDWIHDEKGRQYFAGLAGKTTFSARKQIVEDLQETGDMDGEPKPTMRMTNFYEKG
FT                   DKPLEIVTSRQWYLENGGTNKALNTELIERGKELNFHPDFMRVRYENWVHGLNGDWLIS
FT                   RQRFFGVPFPLWYPLDANGEPDYSNPLTPSEDRLPIDPTIDVPEGYGEDQRDQPNGFMA
FT                   EPDIMDTWATSSLTPQIVTKWAEPGEENERFFKSTFPMDLRPQGQDIIRTWLFSTIDRA
FT                   DLENHCLPWANATLSGWILDPDHKKMSKSKGNVVVPNKPIEQFGADAVRYWAASARLGL
FT                   DATYDEGQMKIGRRLAIKLLNATKFALAIGREDENHHVGEGATASWDPKDVTEPLDRAA
FT                   MAKMAKVVYDATESLNNYEHSKALETIEDFFWQFCDDYIELVKNRAYGTAESTGVEPSP
FT                   QAVKSARTTLGLGLDAFARLLAPFLPYTTEEVWSWMHAGEGSVHHAPWPKPITYATAAF
FT                   KASPELLTQAGAALTALRGIKSKAKVSMKTPILSVMLNVNDELHDALAPALGDIAEAAR
FT                   VTGRISLQKASDLMAKFARPKGEGTAAPGPASDETDVEEITVVESELGEPPVKKPKAAQ
FT                   "
FT   gene            420666..421322
FT                   /locus_tag="BIF_00197"
FT   CDS_pept        420666..421322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00197"
FT                   /product="Transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84852"
FT                   /db_xref="GOA:D3R6X0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X0"
FT                   /protein_id="ADC84852.1"
FT                   /translation="MPPAFRFPAAACKGPSPIRRKLMGRLFVSRIGFGRIQKSCRGLKL
FT                   IDERIFYLLEKNETMTSTHTTTERRYVDGRTLDEKDNIILDILEHNGRATLAQLAEAAS
FT                   LSISATQSRVQKLEKNGVIVGYRAIIHYPEQTTGTIHAFVSVTPLEYDENANIPEKLEH
FT                   ISGIDSCDAVSGSQVYVLTVTVPTVPQLEDLVTKIHRIVPSNVETTMVLHRYFPR"
FT   gene            421378..421782
FT                   /locus_tag="BIF_01818"
FT   CDS_pept        421378..421782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01818"
FT                   /product="Chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01818"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84853"
FT                   /db_xref="GOA:D3R6X1"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X1"
FT                   /protein_id="ADC84853.1"
FT                   /translation="MSEEHMEQGASGSNETVIDSEQDWRDERTRDIVDKIETLRQSIDN
FT                   VDMAIVALLAERFKYTSSVGVLKARAGFAPADYKREEEQMRRLRRLAIDAGLDPEIAEE
FT                   YREFVVTEAKKRHKRIAETGEDPGVLDIFA"
FT   gene            421806..423821
FT                   /locus_tag="BIF_00671"
FT   CDS_pept        421806..423821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84854"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X2"
FT                   /protein_id="ADC84854.1"
FT                   /translation="MKHSSSPHHAKPSAAKAVLTAGLAAALCAALTMPALTSTHADQPA
FT                   TTNVEGLAARFTDDDLFMVNSAADSSRRMYAVSRNGTSHMQLDGSLPFTLDVSYTLNGP
FT                   NVPVDRLNNASGMVGVHVVARVNDRAGDGMQRLGRQMRPFAFLSIPSAAVGDISASDGV
FT                   VVQRDGSAITIAATAEPGSTLDFHVYADAKRFSMSPVALAVLPQSAPTGYTAQLQSLAR
FT                   NSTTLVNSITGENNDDANARLIGELERLREQERVLAQQQIAQADAAHKRAFHEYMAAYV
FT                   SSYTAHLSGSVGNSTQLTALMGTAGELNGDTPLARAVTNLASAVNARSDAYQHTGAADE
FT                   VDWIIRRIRQRGTQGLTAELSQRAGMNSRDGAQNYAAGQKQLSSAMIPYSMAYTDAYTE
FT                   NLNALTGGDVSRAQAMGAQAIAQTDAQFGSNSTLTSDQTKVDAAMNELAQARERTGASS
FT                   ADRQIALRYADRFSNAAANASGAAQNAGLGTPVSAIASQVYDGWLEHSIGGKIVGARTK
FT                   AIADAQAKERRQQGDDAQAGASLVVASDDDAAADVSKFAGSAAAGLGVKGGGAKDDAAH
FT                   HSSDAGGSGTPHRERVPESERLATQFGVSDLASGLVLHADPSQVVDETVIIGQAQPLLE
FT                   AGAAMSGPSGGLASQLAHDTADHWPNLRLLLVRPTL"
FT   gene            complement(423892..425922)
FT                   /locus_tag="BIF_00700"
FT   CDS_pept        complement(423892..425922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00700"
FT                   /product="Transcription termination factor rho"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84855"
FT                   /db_xref="GOA:D3R6X3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X3"
FT                   /protein_id="ADC84855.1"
FT                   /translation="MADSQDLSKMKLPELKEIAKELGLRGLSAKRKGDLVAAIEEARAK
FT                   QSSAKSETAPAQAEQPAGHDDAVSVPVRKTGARRVVRKAGEPKAVEESAAEQPTQVKEE
FT                   GHAALPAEEEMTQIRGRRVRGKRRQMESADQAATNGETSAAEQLLSTLNLPEHAERGGE
FT                   QPRRRRGAVDSLPTRRRAGAAAVREPDAEAKPDLDDILSSLPLSANDDESDERHEEHAH
FT                   RRGERGSRTNDRSNARADRENRQHRRNRNERDYEEREEGNERRSRDERGNNRNERNNRN
FT                   DRNERREENTEDLVEVGGIVDVLDSYAFIRTSGYLPGPNDIYVSMGQIKKYGLRKGDAV
FT                   RGYTRAPHEGERRNQRQKFMPLQSITLINGLSVEEAQDRPNFSKLTPLYPDERLRMETT
FT                   PNRIIGRLIDIVSPIGKGQRGLIVSPPKAGKTITLQNIANAIAVNNPEVHLMVVLVDER
FT                   PEEVTDMERTVKGEIISSTFDRPASDHTIVAELAIERAKRLVELGQDVVVLLDSMTRLA
FT                   RAYNIAAPASGRILSGGVDAQALYPPKKFFGAARNIENGGSLTIISSALVETGSKMDEV
FT                   IFEEFKGTGNMELRLSRELADKRLFPAVDINASGTRREELITNPQELPVLYSLRRLLGG
FT                   LEPEQAYQTLVPRLKKTMTNADFFKAIVQQGNSSLNGGSNN"
FT   gene            complement(426102..427769)
FT                   /locus_tag="BIF_01226"
FT   CDS_pept        complement(426102..427769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01226"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01226"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84856"
FT                   /db_xref="GOA:D3R6X4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X4"
FT                   /protein_id="ADC84856.1"
FT                   /translation="MIQAGRSPIVLAICIPSMKEDLIVTTNEPESVVIIGGGPAGLTAA
FT                   WELVKDGSNAYDVTLLEESEEFGGIARTVKHDGNRMDIGGHRFFSKDERIMDWWQETLP
FT                   LQGAPSYDDKKLGRDTHDLEPGGPDPEIEDKVMLKRHRVSRIYWNKHFLDYPISLSLDT
FT                   LKAMGPKITMKAGFSYLKSMVHKLPEDNLENFYINRFGRVLYSMFFEGYTEKLWGRHPS
FT                   VISADWGSQRVKGLSISEVLKNAVQKLMPKQRDNSEVETSLIEEFWYPKLGPGQLWETV
FT                   KDNCEARGVKVKTDAKVVGVNRGADGRIASVLVRHSDGTQETLEADQFISSMPVKDLVE
FT                   AMDTEQQPVPSDMRHIAEGLPYRDFVTVGLLVKHLKLKNTTDIPTLGNPPIVPDCWIYV
FT                   QDPGYKVGRLQIFNNWSPYLVKDVDDTVWIGLEYFCEEGDEFWNMSDEDATKFAIHELT
FT                   RMGVIAGPDDVLDSHRERVKKAYPAYFDTYDQMPELVEYLDSFGNLYCVGRNGQHRYNN
FT                   MDHSMATSMEAVDNIRTHKTSKNNVWSVNTDKSYHESK"
FT   gene            complement(427897..428211)
FT                   /locus_tag="BIF_01227"
FT   CDS_pept        complement(427897..428211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01227"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01227"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84857"
FT                   /db_xref="InterPro:IPR019592"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X5"
FT                   /protein_id="ADC84857.1"
FT                   /translation="MSAEDLDNYETDAELALYREYRDVIKLFKYVVETERRFYLANKVD
FT                   FNVRSAGQDVYFDVQLSDAWVWDVYRSSRFVKNVRIVTFKDVNVEEVQQTDIDIPEDMQ
FT                   "
FT   gene            complement(428220..429296)
FT                   /locus_tag="BIF_01228"
FT   CDS_pept        complement(428220..429296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01228"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84858"
FT                   /db_xref="GOA:D3R6X6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X6"
FT                   /protein_id="ADC84858.1"
FT                   /translation="MGMPIYKDGNDMTAVVDGDSGEGTARSRELPSQITIPCIQGEMVY
FT                   LRPASVGDLASMDALDAYVNASGVTGKDRVAERAAVQAWVRRSQAWVDGIESRKSGIGD
FT                   PESRRTIAWAMLTVPEEHEDETVNEHTATEFIGMIFLIDIDGWARSARIQVILGKEYRG
FT                   RGYSRDAMPRVMTYGFADEPEGLGLHRIWVAVPEKNTRSYSVYQSLGFVPSGTSRDALW
FT                   DEANNKYQDLNVLDTLVDEYDPVRAMDAFGMHVITTNPGMEKALLLHQHSTAIRKQALS
FT                   DTIASQPEAHSDEAQDETTMGDKMKSDSARIAQDNIESENTWPYNSTERNKSKKAWWRR
FT                   LGHDRMSSRNANDSQQEE"
FT   gene            complement(429688..431187)
FT                   /locus_tag="BIF_00924"
FT   CDS_pept        complement(429688..431187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00924"
FT                   /product="Glutamyl-tRNA(Gln) amidotransferase subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00924"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84859"
FT                   /db_xref="GOA:D3R6X7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X7"
FT                   /protein_id="ADC84859.1"
FT                   /translation="MAEKLMKYSEAVKEFDPVIGLETHVELSTRTKLFCPAPISFGAEP
FT                   NTELTPVSLGLPGSLPVLNATAVDYAIKLGLALHCQINEWSQFSRKNYFYPDMPRDYQI
FT                   SQYDKPTNGEGYLDVELEDGSVFRVPIERAHIEDDAGKNTHVGGADGRIEGADHSLVDY
FT                   NRAGVPLIEIVTKPITGVGDRGPEIAGAYMRAIRDIVRALNISHARMEQGNMRADVNVS
FT                   LRRSPDDPFGTRSETKNVNSFRGIERTVQYEIRRQAAILNDGGEILQETRHWDEASQAT
FT                   AGGRVKSDADDYRYFPDPDLVMLHITPEHIERLKAEMPEMPRERRNRLKAEWKFSDVEM
FT                   RDVINADALDLIEETVKLGASPAGAKKWWLGELSREANAKGISLEELPINAQEVADVEK
FT                   LIAEGKLNDKLAKQTVALVLKGEGTPAEIVEKHGFKVVSDDGMLQTAVDEAMAANPDVV
FT                   EKLRSGNMKPMGAIIGAVMRATKGQADAKAVTKIVMEKIKG"
FT   gene            complement(431208..432752)
FT                   /locus_tag="BIF_00447"
FT   CDS_pept        complement(431208..432752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00447"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84860"
FT                   /db_xref="GOA:D3R6X8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X8"
FT                   /protein_id="ADC84860.1"
FT                   /translation="MTNTATIELVKLSAVQMAELLRSKEVSSRDLVNAELEVIDAAEPT
FT                   IKAFLKVAGEAALEQADAFDNLSDAEKAELPELAGVPIAIKDMIVTKGIETTAASRILE
FT                   GWVPPYDATVIEKLKAAHMPLLGKTNLDEFAQGSSTEHSAYQHTANPWDVERVPGGSGG
FT                   GSAAAVSAFEAPLALGTDTGGSIRQPGALTGTVGVKPTYGGVSRFGAIAMASSLDQIGP
FT                   VSRTVLDSALLQEIIGGHDKRDSTSIPQGPRPMAKAAREGMNRDLKGMRIGLVKELGGE
FT                   GFQPGVEARFNEAVKKLEAMGAEVVEVSCPRFKYALGAYYIIMPSEVSSNLARYDGMRY
FT                   GLRVMPPKDVAQTAANMMAYTREAGFGDEVKRRIILGTYALSAGYYDAWYGSAQKVRTL
FT                   IIEDFENAFKQADVLISPTSPSTAFKFGEKMDDPLAMYMNDIATIPANLAGVPAMSIPA
FT                   GLSDDGLPVGIQFIAPQQRDEVMYKPAAALEAALEDEWNGPIFKSLKTPWLDSIND"
FT   gene            432736..433077
FT                   /locus_tag="BIF_02159"
FT   CDS_pept        432736..433077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02159"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84861"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6X9"
FT                   /protein_id="ADC84861.1"
FT                   /translation="MAVFVISLLPQNSRCHEHAVLGNRGSGQRLGLRQRCRRNVGAQVG
FT                   LKRHRVRRRLHIGRGDLLHGIDGVCNDIELTLHTSDFLVGERDSGQIAQMYYFFACECR
FT                   HSPNYTNQM"
FT   gene            complement(433172..434119)
FT                   /locus_tag="BIF_01014"
FT   CDS_pept        complement(433172..434119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01014"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01014"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84862"
FT                   /db_xref="GOA:D3R6Y0"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y0"
FT                   /protein_id="ADC84862.1"
FT                   /translation="MSGAMQSANPTGTPSGTVPGAAHGAAHGASHARRLGFGGALRAEW
FT                   CKVWSVTSTYVLLVLAIVFFAVNSLMMGWLMRFVESQGDGMPLGNEDLWAAVSSGADNV
FT                   LLIVGILGVMVLTSEFSSSSIITSLTVNPRRTMFMNAKALVLAVVTFLASFVGMLLAWG
FT                   CAAIMMGSSVSTGNAEMPAAMPWVTLLGIPLAMALGAVMSMGFGALCRSTAGGVLCVVV
FT                   LFMIVPSMLQMVQLLGEKFTWVVSLNNCLPANALTYFTGVGANSFSNSASAQLSMGATH
FT                   PFQPSWGWAGLIYLAWAVVVYAAGVIVMDRRDVK"
FT   gene            complement(434116..434901)
FT                   /locus_tag="BIF_01013"
FT   CDS_pept        complement(434116..434901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01013"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01013"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84863"
FT                   /db_xref="GOA:D3R6Y1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y1"
FT                   /protein_id="ADC84863.1"
FT                   /translation="MLDAKYAPKSRSAYAYLCSLAYTNNISKSRVDEVMDLTGPASVKK
FT                   TKAGRFSLGMSQRLAIAASLLGDPKNLVLDEPVNGLDAEGVKWVRDLCRNCAAEGRAVL
FT                   LSSHLMSEVALTADNLVIIGEGRILQTTTVSDFVEEHSRDLLSVVTPDAERMQAMFANS
FT                   PSVRITETTVEDGYPADSRAFRIEGADFAAVAHGFARSQIVAYRFTREQVSLEQAYMEL
FT                   THAHAQYVSAPMTAAGAQIPQNMPMQNMPVQNMGNGGAR"
FT   gene            complement(435136..435945)
FT                   /locus_tag="BIF_01012"
FT   CDS_pept        complement(435136..435945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01012"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01012"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84864"
FT                   /db_xref="GOA:D3R6Y2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y2"
FT                   /protein_id="ADC84864.1"
FT                   /translation="MHEPNPIDVLAKASGEPEFREVGVGPWAEMHLQEPRPDDPRFDAA
FT                   LLDEGDRRNVLDRYRYWSVEAIKADLDARGRHMFEVAVENWTHDFNIGSMVRTANAFTA
FT                   NRVHIVGPHKWNRKGALMTELYQHVVHHPSIRACVDDWHARIAQERTEARQRIETAQTA
FT                   AQAGVLSPADAARELVYARHDLNIAQNAKVIAMDIIDGAVPMETYRFPERCLLLFGAEG
FT                   PGLSKKALELADDVVYISQFGSVRSINAGAAAAVTMHAWIAQHAHIA"
FT   gene            complement(435991..436653)
FT                   /locus_tag="BIF_02157"
FT   CDS_pept        complement(435991..436653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02157"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02157"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84865"
FT                   /db_xref="GOA:D3R6Y3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y3"
FT                   /protein_id="ADC84865.1"
FT                   /translation="MSQSQGFRPTGVSNSEQAASRTVSREEAVDFSAMEPREQLKRMLR
FT                   EHMADRPFSELSDVTFDSHGASLIGHILLDTIEEAGYSVDDFDAVGALTAAAVPMVCAM
FT                   MHAAASRGEDLNGFVMDFVFPSIKGPSIEGKRVLLLDAWLSEKSYVQTSSLVTLRNGNE
FT                   LSLDFGIVEAQGAEVVAVASLIGGVDMVDPVIRVVNPADDSTAELPFIEVFRESELH"
FT   gene            436699..438192
FT                   /locus_tag="BIF_01885"
FT   CDS_pept        436699..438192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01885"
FT                   /product="PacS"
FT                   /EC_number="3.6.3.-"
FT                   /note="Cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01885"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84866"
FT                   /db_xref="GOA:D3R6Y4"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y4"
FT                   /protein_id="ADC84866.1"
FT                   /translation="MRMLIPATYGNAQRFRVQYGYTRSRTGSAMTLNTFIAAVCVVVAI
FT                   MLTIAHIRFFFGEETHKQQGELFHQPPHDEAAPVSAGDTLRTRRRDNAADLRILRKQII
FT                   VGAALTLVVVIPILIHTFAPHCPLGPLVDPWWQAVLITPVMFYSGYPVHVDGWSSLADR
FT                   RPNMNTLASIGTIAAYAYGLLICFAGDLFPAGMRMSYFAIVGIVITLVLLARLVSDLYL
FT                   PQQPAFPLQLWVDRFSFVFVPVVIMIALWTFVAWLLFGRQPALPMALLTAISVLIIACP
FT                   CALGWAATLAAVFANENAGRHGLQIHSLGSLQIARHLTDVLFAQEAASRCQEDIRRLQQ
FT                   AGVSTSVIDADAVDDVLATVDSMRKLAVSLGQRPVVAFVGDGPTDERIRHAVDITLEVG
FT                   EAKEGEAHGHADVIVDSRSTMAVSDLRNLSHAMMANIRENLVWTFAFNIIGIPIAAGVL
FT                   YPFTSWLLDPSFAAIAMILSSLCVLVNSLRMRHYNPERA"
FT   gene            complement(438286..440985)
FT                   /locus_tag="BIF_01318"
FT   CDS_pept        complement(438286..440985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01318"
FT                   /product="ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01318"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84867"
FT                   /db_xref="GOA:D3R6Y5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y5"
FT                   /protein_id="ADC84867.1"
FT                   /translation="MEDDMEQKYTTLAQEALGDAVQSASAAGNPQVEPLHLLDSLLRQE
FT                   NGVIGGLIEAVGANRQTIGAQVRNALVSLPSASGSSTAQASASRQLTTALADASKEMKD
FT                   MGDEYISTEHLLLGILDAAPNEAAKILEQNGITADKVRAAIPNVRGGAKVTSPDAEASY
FT                   KALEKFSTDLTARAREGKLDPVIGRDQEIRRVIQILSRRTKNNPVLIGEPGVGKTAVVE
FT                   GLAERIVAGDVPSTLQNKRLISLDLGSMVAGSKYRGEFEERLKGVLDEIKQSDGQIITF
FT                   IDEIHTIVGAGAAEGSMDAGNMLKPMLARGELRLIGATTLDEYRENIEKDPALERRFQQ
FT                   VFVGEPSVEDTIAILRGLKQRYEAHHKVTIGDDALVAAATLSNRYITGRQLPDKAIDLV
FT                   DEAAAHLRMELDSQPEEIDELQRKVTRLEMEEMQLKKAEDPASKERLAKLQSELADARE
FT                   KLAGLNARWNAEKEGHNKVGDLRAQLDEKRVEADKATREGDLAKASRILYGEIPAIQKQ
FT                   LTEAEHEAEKEADFAHEDEPMVPDHVDADSVAGIVSEWTGIPVGRLMQGENEKLLNMEE
FT                   YLNRRVIGQPEAVRAVSDAVRRSRAGLSDPNRPTGSFLFMGPTGVGKTELAKALAEFLF
FT                   DDEKAMIRIDMSEYMEKSSVSRLIGAAPGYVGYEEGGQLTEAVRRRPYSVVLFDEVEKA
FT                   NSEVFDILLQVLDDGRLTDGQGRTVDFKNTILIMTSNLGSQFLVNPDLDEQQKKDAVMN
FT                   AVHSQFRPEFLNRLDDMVIFHPLTRQELGKIVDLQVKQVASRLTDRRITLDVTEAAREW
FT                   LADTGYDPAYGARPLRRLVQTEVGDQLARMLLAGEIKDGDTVLVDHTGGEHLELTDHTH
FT                   NPMEGDPNPGDSQITVDDKKDDGEQKDA"
FT   gene            complement(441220..442077)
FT                   /locus_tag="BIF_01319"
FT   CDS_pept        complement(441220..442077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01319"
FT                   /product="Fumarylacetoacetate hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01319"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84868"
FT                   /db_xref="GOA:D3R6Y6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR018833"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y6"
FT                   /protein_id="ADC84868.1"
FT                   /translation="MRPVKPGRRLRRMRLARFSRNDTPQYAFVQKDATDGKDYLVVLDG
FT                   HPLLQQVTPTGERVALDEDGVRLLAPVIPSKVYGLAKNYEAHAQFMHEHNQSPQAHAPA
FT                   EMVIFTKPSTSVIGPDDPIVYPTYSHDMNYEPEVAVVMGRIAKNVPVDKAMDYVLGFTC
FT                   VNDVTLRDLQGSDPMWTRAKGFDTSCPLGPWIVTKDEFDWRDARIGFTLNGEDVPAASG
FT                   TTANLIHNIAEQIAGISSFSTLLPGDVIMTGTPNASGTLKPGDEAIVRVEGIGELRNVV
FT                   VQGE"
FT   gene            complement(442052..442669)
FT                   /locus_tag="BIF_01320"
FT   CDS_pept        complement(442052..442669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84869"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y7"
FT                   /protein_id="ADC84869.1"
FT                   /translation="MLSTCSVCQTLRCRLSQWYIESSRSKVWERGPKVASGGGAFSVEE
FT                   VAYLKTLPAVADATRNRIIYTEEFKVDCVLRYAQGESPVQLFREAGLDPSLIGYKRIEC
FT                   AIARWRRQMNVAATTVKQPRGKRGNAVMADLRAPTHIDASFAPQAIGSRGDIRDVLIAQ
FT                   QVRRIDELERQVDELSRELRKLSAPHGDAGSDPMGASGETRA"
FT   gene            complement(442750..444438)
FT                   /locus_tag="BIF_00999"
FT   CDS_pept        complement(442750..444438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00999"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00999"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84870"
FT                   /db_xref="GOA:D3R6Y8"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y8"
FT                   /protein_id="ADC84870.1"
FT                   /translation="MNMNLKRVFAGVAAAATALGTLAIGAATANAAPLTGSTESITINE
FT                   ALEGQTFQAYQLATFTDATGANGVINDLAMSTPAAANAALKKAINALNDANPAGWTTDV
FT                   DLTAANVVDNNLALLVTTLSSSQLRVLAKQLAGSGLNSTHEATVAPGATSATITGLQPG
FT                   WYLVTCTSGAEDAEVAPAIMPSTVAEYTSIAQKPSGTITLGKLNVKMVVPTPHKTIDAN
FT                   DPKVLKVGDTLHYTITSTLPAHDATSTVKYHYIIDTPGLGLTVDNPATGEKNIKVFVNG
FT                   TQLTDGTDFVVQGFTGADLNGTTITGTEGFPIQGNGKNNIFTVDLTEYATAHPELAGKQ
FT                   VTVTYAATVNSDALDTVSNKVNVGGDDPTDWRGTEEITRAVSQLQLKKVGVEDTDKNGA
FT                   AGAKFQLTDAQGKVLNFVQHTDNTYTYAPNGGNGTVSKVTSQEDGSIVIYGLPTGTYKV
FT                   TETDVLSRYSSNFKAVFNATVTSTTTDDVTSASWNLDTGENLLGLATQASGTAPIQVKN
FT                   VKSITQLPLTGAAGITMLVVVALLIGGAAALIAVRSHSLKQQLRG"
FT   gene            444500..444622
FT                   /locus_tag="BIF_02156"
FT   CDS_pept        444500..444622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02156"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84871"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Y9"
FT                   /protein_id="ADC84871.1"
FT                   /translation="MQCPTQCEGHNTHLDILFSCSCASQAKEVRPGLLGPATKS"
FT   gene            complement(444627..447344)
FT                   /locus_tag="BIF_00998"
FT   CDS_pept        complement(444627..447344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00998"
FT                   /product="Collagen adhesion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00998"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84872"
FT                   /db_xref="GOA:D3R6Z0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR022464"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z0"
FT                   /protein_id="ADC84872.1"
FT                   /translation="MSTAKKAVYARFKIDLFDQTDFSGGSMKRLKHRSAQSGASDHAGR
FT                   KGARPLRSVLASLCAVAMSLGMASASVAAFADDRQPAATADPQAATASAGNVDAPQHTK
FT                   RISKNDDGTYTLSMDVTGKSDESTEQQVVPLDIALVLDVSGSMNELSGKLVYNEVELLS
FT                   MNPISTYYVEKDGSYQAVRCSAISWGRCTTWQDQDSAGQKYTVTYNWIGGPSASVSPDV
FT                   QFYKSKQSEETRLDALKDAVTYFLDQVEDQNQRINDPGKKVQVALIKYAGKNSDKIGND
FT                   TYNEDGYNYNYSQTVHSLAWTPEDLQKEQAAVNSLKAGGATRADFGLQHAVKQLNSGRP
FT                   GAQKLTVFYSDGSPTSSDGFEAKIANNAIKAAAQLKNDHSQVISIGAMPGADPSGTDNA
FT                   NKFMNYVSSNYPKAQSMSEPHDRVEGTYYYAVSARTDLQTIFKEIISIVTSGTAYQDVT
FT                   MTDTLSDYVEFSKPNAQNFDAELVIRDKDGKKVDPSEVGLTDYTIAQPGSKTISISFPQ
FT                   GYVLKDGYTYSLEYKIVPSAKAYEEYAANVNAGKNGYGDTKGDDDTGASSARQSGFRSN
FT                   ERATIDYTPRVDGEQQGPVEGTEYPHPVIQVDTTQFARLSIDKAWIATNPEQDKVTVDV
FT                   TCMDTDGKCTGYSDIDISKSSNWTSTVLIPKAAADRTYTVTERPVDGFHTHYTKPITIP
FT                   ANTAGEYSSTVTNYPAAISFNLNQIRVGKTVQGTDTDQDFTFTLSPVTAEGVTNADGTP
FT                   FTDATLTLGDRFANGTQVTGTFADTSIKLATPQLGADAMYTFNVRENAPSPSAGWAADM
FT                   DAVTVTVTVHVPTEGDTIPTGVTYRYGVNDTDDTESNKDLAAFTNHWIAVSQLPFTGEQ
FT                   GATPLAWLAVAGGLGALAVLSAVGISAWRRRHML"
FT   gene            complement(447544..448590)
FT                   /locus_tag="BIF_01042"
FT   CDS_pept        complement(447544..448590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01042"
FT                   /product="Sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01042"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84873"
FT                   /db_xref="GOA:D3R6Z1"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042002"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z1"
FT                   /protein_id="ADC84873.1"
FT                   /translation="MDMGVTMRRKRRNGGEGTAARQWQPLTFEQATDVADVVQLRRSLR
FT                   RRMIALRVFAIVLAIVAVVVGATPFVLQWRSSQQLSAQTRMVNQRVLGWPYPQAENKLR
FT                   DARAYNQRLAASGQPILGEAVDPFSQRAGGSSVSEKGDSAASKDSEYQSLLDTGGGIMG
FT                   SVSIPKISVNLPIYHGTSEEALAAGAGHLYGTSLPAGGLNTHAVITGHRGLVDAPMFTR
FT                   LDEIKNGDYFYIDVMGEKLAYAVDSITVINPDDTSRLRVVPGEDRVTLMTCTPYGVNTQ
FT                   RLLVSGHRVSIPYPAPNPSDVHDGRLVGIMAAIVALAIGLIAATWFSRARTRVERMRHA
FT                   RPDDVMSE"
FT   gene            complement(448615..449508)
FT                   /locus_tag="BIF_00827"
FT   CDS_pept        complement(448615..449508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00827"
FT                   /product="proline synthetase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00827"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84874"
FT                   /db_xref="GOA:D3R6Z2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z2"
FT                   /protein_id="ADC84874.1"
FT                   /translation="MRKALDTEGGGGMTAYMDHKDLANEVIDEVRAQQIADGVHRVMDR
FT                   IAAAEERAGRPAGDVRLLAATKTRDVGEIMAAIDAGVPMIGENRPQEVVAKIDGLRYQC
FT                   KQRGYVIGAYDFDLTVDADPTYAEPEDLKEAPFIPFHLIGQLQSNKISKILPTVNTVES
FT                   VDSLELAEKIARRCMVRGRSMGVLLEVNESGEESKSGCAPDQALELAEQIAALGGVELQ
FT                   GLMTVGAHVRDERRIREGFAHLRGLRERIQSLGMPGTARCVELSMGMSGDLEYAIAEGA
FT                   TIVRVGSAIFGERDFK"
FT   gene            complement(449575..450702)
FT                   /locus_tag="BIF_00826"
FT   CDS_pept        complement(449575..450702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00826"
FT                   /product="tRNA synthetases class I, catalytic domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00826"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84875"
FT                   /db_xref="GOA:D3R6Z3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z3"
FT                   /protein_id="ADC84875.1"
FT                   /translation="MRGRGQEGAAHAGAVDGLARLHSERMAARQRVVDGVLMAGRFAPT
FT                   PSGRMHLGNAFAMLAAWLSARSRHEPIYLRIEDIDTPRVLPGADRMIMDDLTWLGLDWD
FT                   GEPVYQSARQAVYDAVFERLRSLDGDALLYPCFCSRAEIRAASAPQEGDGFLVYPGTCR
FT                   RLRDEDRDEVERRLAAGRRHSWRLAVPGAQEPGAFVAFDDLVYGAQSFNVGRELGDVIL
FT                   RRSDGLYAYQFVVTVDDLLMGVSDVVRGRDLLRSTALQIWLRGQMLRTGLGSHNLPAAD
FT                   PQYAHVPLLDNAAGVRLAKRERSLDLGRLREAGVRPDQVIGYCAWHMGLCEGVLERPEA
FT                   MSAQQALNLFSWRKVRRHAGDVVVPGNIVEVLRAL"
FT   gene            complement(450591..451850)
FT                   /locus_tag="BIF_00339"
FT   CDS_pept        complement(450591..451850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00339"
FT                   /product="Aquaporin"
FT                   /note="Glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84876"
FT                   /db_xref="GOA:D3R6Z4"
FT                   /db_xref="InterPro:IPR022603"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z4"
FT                   /protein_id="ADC84876.1"
FT                   /translation="MLHGRPDRPRPQPGPRPDAARAAFDPADPAQGFLPLERGVDPGRR
FT                   ADHRRHHRLLALSRALRHLICPAFGCRHACKPHLRVRFFVFGVSARNARMRASALGSQP
FT                   DGMRWCDRILERMTGSHKQNSIRSSRQSSPRRKRRLPKRVYIMRRVVVLLVTVLWIVFV
FT                   WLSVAGEARALFQARNLQASSNAGAASRWKPTHFHDAQIERANTERSESAEHSENTHAE
FT                   QDAQAIAALEAPLSDEQRHEILDKARQAAYEDNKTPVVLHYCVATNGNVGSAEGFANTV
FT                   FRVLNNPQGWPRAGVIFAPTHDTNACEFTIMLAESSKLAEYSQGCSAEYSCRVGTDVII
FT                   NKKRWDEAVEHWFAHGETLSQYRTMVLNHEVGHVLGHVDNETVCEGEGKRAPLMQEQSM
FT                   DLRGCTPNAWPLDNELWTAY"
FT   gene            complement(452548..452907)
FT                   /locus_tag="BIF_02155"
FT   CDS_pept        complement(452548..452907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02155"
FT                   /product="Aquaporin"
FT                   /note="Glycerol uptake facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84877"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z5"
FT                   /protein_id="ADC84877.1"
FT                   /translation="MKRYAVEWIIFALGVIALGGVMIGLPEMDKVWLWVLWGALALWVA
FT                   AYVYVLRFCTTGFRALSIVVYVLAWVLIAARVGLFELGSMPQDAATSLSDLLLAGVLIL
FT                   VSLGWIRDPRSNEEH"
FT   gene            452982..453128
FT                   /locus_tag="BIF_02154"
FT   CDS_pept        452982..453128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02154"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84878"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z6"
FT                   /protein_id="ADC84878.1"
FT                   /translation="MSPRIWPLDSPVVACHRIAQTIAGDFLVRPHLPQKQKLANSRASF
FT                   RFS"
FT   gene            complement(453151..453258)
FT                   /locus_tag="BIF_02189"
FT   CDS_pept        complement(453151..453258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02189"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84879"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z7"
FT                   /protein_id="ADC84879.1"
FT                   /translation="MFNRWESTTTALDKLMMETAQGAQQDSNDHGNLDY"
FT   gene            complement(453496..453572)
FT                   /locus_tag="BIF_tRNA07"
FT   tRNA            complement(453496..453572)
FT                   /locus_tag="BIF_tRNA07"
FT                   /product="tRNA-Lys"
FT   gene            complement(453701..454624)
FT                   /locus_tag="BIF_00444"
FT   CDS_pept        complement(453701..454624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00444"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84880"
FT                   /db_xref="GOA:D3R6Z8"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z8"
FT                   /protein_id="ADC84880.1"
FT                   /translation="MQCPHCGSPPNADDAVCPVCGKPVQESQSTHTEHRIQPVAFEATT
FT                   TAVMQPIRMQESQQRPLVTNMNSPALPPSLPPAESARRRVPARTATAAAGEPVNDSAVP
FT                   RTGRAHASTATRNGRHVWIIVAIVLIVAILAGIGVWAWRTQPRPHPDASAQQPTSEVQP
FT                   TPSESMDGGETGGAADEEHPRESAAEQQAYDELQRQVEADKAKAAGLLNVYTTQLSSKK
FT                   PGLQAAGRTWTYETILGQYRELKAKYPNALLVWGPDYTNYSRSGHPSDYYVMLSGETFA
FT                   TAQAAKGWCTANGYGSEDCLPVHLAQ"
FT   gene            complement(454823..455269)
FT                   /locus_tag="BIF_01051"
FT   CDS_pept        complement(454823..455269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01051"
FT                   /product="LSU ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01051"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84881"
FT                   /db_xref="GOA:D3R6Z9"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D3R6Z9"
FT                   /protein_id="ADC84881.1"
FT                   /translation="MATTKIILKKSVNNLGHAGDIVEVKAGYARNYLIPQGYAFPWTKG
FT                   AAAQAEAMKRARLAKAIATREGAVEAKQIIEGTAVEIFAKVSESGKLFGGISNEQIANA
FT                   LAEKVAVDPKGITVEKIQTLGEFPATVALHPEISANFFVKVVAE"
FT   gene            complement(455290..455538)
FT                   /locus_tag="BIF_01052"
FT   CDS_pept        complement(455290..455538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01052"
FT                   /product="SSU ribosomal protein S18P"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01052"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84882"
FT                   /db_xref="GOA:D3R700"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:D3R700"
FT                   /protein_id="ADC84882.1"
FT                   /translation="MSRKRPQPPVKPFKKKPNPLKAAKITEIDYKDVALLRKFISDRGK
FT                   IRSRRITGVTVQEQRKIATAIKNAREMALLPYATNGR"
FT   gene            complement(455586..456218)
FT                   /locus_tag="BIF_01053"
FT   CDS_pept        complement(455586..456218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01053"
FT                   /product="Single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01053"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84883"
FT                   /db_xref="GOA:D3R701"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D3R701"
FT                   /protein_id="ADC84883.1"
FT                   /translation="MAGETIITVVGNLTRDPELRTVGNGSTVVNFTIASSTRTFNRNTN
FT                   QWDDGDTLFLNCSAWDSARTSMATNIANSLSKGMRVIAQGRLTQRSYQAQDGSQRSVVE
FT                   LRVDEIGPALSRATAQVTRQTSSGFNGGQQGGGYGNNGGGYQGGAGYSGGGFNGGNGGY
FT                   QGGASAPAPQAPSAPVSDPWSNDSGSSNAFGSFGTSDFGGDSDEPEF"
FT   gene            complement(456256..456546)
FT                   /locus_tag="BIF_01054"
FT   CDS_pept        complement(456256..456546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01054"
FT                   /product="SSU ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01054"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84884"
FT                   /db_xref="GOA:D3R702"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:D3R702"
FT                   /protein_id="ADC84884.1"
FT                   /translation="MMSAHNYELMFIADPELDENGLKKLTNQHMEIVTKEGGSVENIDI
FT                   WGRRKLAYEIDGKTEGNYVVVTYSCEPATNDELDRVLNLNESIVRTKILRK"
FT   gene            456648..457751
FT                   /locus_tag="BIF_01056"
FT   CDS_pept        456648..457751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01056"
FT                   /product="Ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01056"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84885"
FT                   /db_xref="GOA:D3R703"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D3R703"
FT                   /protein_id="ADC84885.1"
FT                   /translation="MRSDTRTHTCTLLYWGVLHFCVRKQCERRMMSAVLEGTPDKRLAL
FT                   VTGRAYPEQATETAHYLGTEVLPTTAYDFANGEMYVRYTEPIRGADVFIMQAHTQPINK
FT                   WIMEQLIMIDAAKRASARSITVVAPFFGYSRQDKKHLGREPITAKLMFTLMRAAGADRV
FT                   MTVDLHAAQEQGFFNGPVDHLTAMPILLDYMRDRLPLDNTTIVSPDAGRIKVSEQWAAK
FT                   LGGLPLAFIHKTRDTTRPNHAEAHGIIGEVKDRDCVVIDDMIDTAGTICEAVRTLHDHG
FT                   AKSVTLVATHGLLSGPAVERLKDSGVKEIVLTDTVPIPEEKRLPNMTVLSAAPLLAAGI
FT                   RSVFESRSVSNLLNGLPEDMHTRHIYA"
FT   gene            complement(457890..458021)
FT                   /locus_tag="BIF_02190"
FT   CDS_pept        complement(457890..458021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84886"
FT                   /db_xref="UniProtKB/TrEMBL:D3R704"
FT                   /protein_id="ADC84886.1"
FT                   /translation="MRCVGSQAPLRSSSHRLGCPIRHQTDSSSLLQVRCLLRGTRGG"
FT   gene            complement(458027..459040)
FT                   /locus_tag="BIF_00857"
FT   CDS_pept        complement(458027..459040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00857"
FT                   /product="Ribokinase"
FT                   /EC_number="2.7.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00857"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84887"
FT                   /db_xref="GOA:D3R705"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3R705"
FT                   /protein_id="ADC84887.1"
FT                   /translation="MPRKQTTKHICEGNTMNQILDKLEQIHGSVSVVGSMNADYTVTTE
FT                   RLPGPGETVTGGPLQVLPGGKSGNQAAAAAKLGATVRMFGAVGSDSNADFLLTQLASAG
FT                   VNTDGIRKVLGPSGTTVITVDSHGENTIVYSPGSNANVTVEYIESQRDLLTASSVLGLC
FT                   LESPLETVTACATMCHDAGMKVLLNDSPFIATLPSELIAHADILLVNEHELVQLLHIDE
FT                   PEDDDWDSFDWAQAQNRLSEFGFDQAIVTLGGDGSVVLDSTVDPSIIRIAPVRVDAVDT
FT                   TGCGDSFMGTVLASLASGLSLEESAQLASYVSAYAATGYGAQASYGTAAQIRERFR"
FT   gene            complement(459098..460576)
FT                   /locus_tag="BIF_00468"
FT   CDS_pept        complement(459098..460576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00468"
FT                   /product="Permease"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84888"
FT                   /db_xref="GOA:D3R706"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R706"
FT                   /protein_id="ADC84888.1"
FT                   /translation="MTAPNNTAVVQEEPVDLEQQNKMAVRALILLLITFILGTLCLQGF
FT                   NLVFTNIGSDVGAPEQAALITSLPSIVLGIVCFIYGSLGDFVSLKKLIVFGLVTLFVGS
FT                   LFGFIANFFFTKNLWTVIIARILQTAGEQVSGSVYLVIATKYLKKELKVIFFGLFTAGY
FT                   QVSAAIGVFAAGLLTSIAWQYLFLIPAVTIVFLPFLLHLLPNRRGGSQHVDWLGFTIFG
FT                   LASAFLSLFFSYNSWWMLAVCVVLFVLFGVYINKASDPFITPAFFKNTRWLAAIMLIVL
FT                   FYFTNYCVSPIFNTMGTTLYNMDVTQVSQYIVWAFIVAAVFGTTSGWIVGKIGRTTAIV
FT                   LASLLMICGFVGSALCVNTDFGLLTLFACIFYAGCGLMYSPVVSTVLDTLPVDESGRGV
FT                   GMNDLVMNVTASIGIAVFGAQLGGTALAGGSLTGATGPAAVYSNLLIIAAGVVVLGLVW
FT                   FLVFHKHIYRGESAQVQKEVEQPEDVEEVLHPAK"
FT   gene            complement(460659..461612)
FT                   /locus_tag="BIF_00679"
FT   CDS_pept        complement(460659..461612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00679"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /EC_number="3.2.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00679"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84889"
FT                   /db_xref="GOA:D3R707"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D3R707"
FT                   /protein_id="ADC84889.1"
FT                   /translation="MKKLILDLDTGVDDALAISYALGSPEVELIGITGTYGNVLMEQGV
FT                   RNALAITELLGHPEVPVYKGLPHASTKDSFEVLPISAFIHGENGIGDAVIPDPQRDAET
FT                   EPAVDFIIDAVKTYGDDLVYVPTGPQTNIAAAFRKAPEIAEQLGKIVLMGGALTVPGNV
FT                   NAWTEANISQDPDAADYVFRHTKDATMIGLDVTLQTLLTYKETQRWRDLGNAAGTFLAD
FT                   MTDFYIKAYETTAPHLGGCGLHDPLAVGVAVDPTLVTVHPINMKVDVEGPTRGRTIGDE
FT                   DRLNDPHKTMGAALDVDVPRFLDEFMTRITNVAKNA"
FT   gene            complement(461795..462841)
FT                   /locus_tag="BIF_00680"
FT   CDS_pept        complement(461795..462841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00680"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84890"
FT                   /db_xref="GOA:D3R708"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R708"
FT                   /protein_id="ADC84890.1"
FT                   /translation="MVRRVTLREVAQEAQVSVATASLVLNNKPSRISQPTQQRIRDVAR
FT                   RLHYVVNENARGLVTNETRLIALIVPDIENMFFASLSKCLETECRRNGYQLFISNSDDD
FT                   RTLERRLMRNFVGRDIDGLLLIPSIDSYTDRALLRDQICASPCPIVIIDRLITADICDG
FT                   VGFDNELGGRLAAKKLLCAGHRRFACITGNKDSVNANTRCYGFLKTLQEHEVPADSILT
FT                   LDGNYRFSGGYDAADAVADFGATCLFCCNDLMALGAIDRFRELGIAIPADISIIGYDNI
FT                   VKRFGLLTRLTTVEQNVSELASQSWQCLYRHIQHHDSGRNCAEANDLLLLEPQLVEGDT
FT                   VAQAPIFR"
FT   gene            complement(463191..463308)
FT                   /locus_tag="BIF_5SrRNA04"
FT   rRNA            complement(463191..463308)
FT                   /locus_tag="BIF_5SrRNA04"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(463423..466479)
FT                   /locus_tag="BIF_23SrRNA05"
FT   rRNA            complement(463423..466479)
FT                   /locus_tag="BIF_23SrRNA05"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(466968..468199)
FT                   /locus_tag="BIF_16SrRNA06"
FT   rRNA            complement(466968..468199)
FT                   /locus_tag="BIF_16SrRNA06"
FT                   /product="16S ribosomal RNA"
FT   gene            468641..469099
FT                   /locus_tag="BIF_02163"
FT   CDS_pept        468641..469099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02163"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84891"
FT                   /db_xref="UniProtKB/TrEMBL:D3R709"
FT                   /protein_id="ADC84891.1"
FT                   /translation="MQADNGTGIIKDDQEPQRPRQPKRHQPWSSSTVHAIEFSNHHHTP
FT                   TTPTREPRQAVSGSKRKTYTTTPTHATPPPTTHPQTPTNTTPPPACRKPAKTPTNTHTQ
FT                   KHQPHHTDETHHERNNAEREPRIGVPVRIQKASSQNAICKYKQIQTTS"
FT   gene            complement(469089..470297)
FT                   /locus_tag="BIF_02191"
FT   CDS_pept        complement(469089..470297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02191"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02191"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84892"
FT                   /db_xref="GOA:D3R710"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D3R710"
FT                   /protein_id="ADC84892.1"
FT                   /translation="MIFSEGLEMTANEQNATPDLVIVGAGIFGLTIAQQAVEKLGVNVT
FT                   IIDIRDHIGGNAYSYMDPETGAEIHKYGAHLFHTSNSRVWEYVNRFTKFTDYVHRVYAT
FT                   HDGEVFPLPINLGTINQFFRANYTPAQAKALIDEQAGELAGTDPANLNDQGISLIGRPL
FT                   YEAFIKNYTAKQWQTDPSELPASIIKRLPVRFNYNNRYFKDTWEGLPADGYTAWLERMI
FT                   DDPRITVKLETDFFDETQPLNKRALLEAGVPVVYTGPVDRYFDYDLGELKWRTVDFKEV
FT                   RYDEGDHFGCAVMNFSDADVPYTRAIEFKNFNPERAAEQNPNKTVVWEEYSRFANRDDE
FT                   PYYPINTDEDKALYAQYKAKAADEPNVVFGGRLGTYAYYDMDQVFNQALISYEKQVEPL
FT                   LKK"
FT   gene            complement(470275..470589)
FT                   /locus_tag="BIF_02192"
FT   CDS_pept        complement(470275..470589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02192"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84893"
FT                   /db_xref="UniProtKB/TrEMBL:D3R711"
FT                   /protein_id="ADC84893.1"
FT                   /translation="MCHATYGKPRRGKFRHEPWLHCMNTVCIFRAHVCICSMCHVRRHI
FT                   FLCCRISFAGRVSIGIRESRRSVHTAFYAGDKCPLQTVSVVCGDEYAHAACSIDIFGRT
FT                   "
FT   gene            470494..471579
FT                   /locus_tag="BIF_01492"
FT   CDS_pept        470494..471579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01492"
FT                   /product="Glycosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01492"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84894"
FT                   /db_xref="GOA:D3R712"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R712"
FT                   /protein_id="ADC84894.1"
FT                   /translation="MRAEYAHSIHAMQPRLMAELPPPWFTIGCMTHRERRETTAPFTLL
FT                   MAVYGGNSLREVERSVQSSTIEQTLPPNQVVIVRDGPVQEPVQRYLDTLQSTMAVWFTA
FT                   ERPELEVPEVTIVPLDENRGLAHALNIGLQHCDFDVVARADCDDVSLPNRFATIIPQFT
FT                   RRSAASHTTVKSKLPIDVMGSAIREFTDDERQPGQIRMLPAEGADLEKYARMQSPVHHP
FT                   SVVFRKSAVLAAGGYPEDAGRFEDYLLWERMMLNHAQFLNMPEPLVLYRTNQEAYERRG
FT                   GWDMFREELRLQWRFLRDGFTSPAQFLRNTFIRAAYRMMPTSLRKRAYHSIVSRRNTEI
FT                   SAAPAPAEVQAKPRGRHAQSE"
FT   gene            complement(471824..472852)
FT                   /locus_tag="BIF_01491"
FT   CDS_pept        complement(471824..472852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01491"
FT                   /product="RfbF"
FT                   /EC_number="2.-.-.-"
FT                   /note="dTDP-rhamnosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01491"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84895"
FT                   /db_xref="GOA:D3R713"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R713"
FT                   /protein_id="ADC84895.1"
FT                   /translation="MCMASGRHHTSPILAGMQYSVTAVVVSYNRAGLLDECLSALNAQT
FT                   RRPDSLVIVDNASTDGALQVARDFAGRTPIPAYILELRENTGGAGGFCAGIAYAVANGS
FT                   AEPGIAEYVWLMDDDTVPTPTALEQLLAAADECVTVNDRLPTALGSKAVWVDGREHLMN
FT                   KPRPRAVLAKGEREMAGGAYQVRSLSFVSCMLNMGAIRGRRRLPISAFFLWNDDFEYTT
FT                   ALLRNGVGYYVPASEVVHKTKKFGSSDADPGQRFYNEVRNKIWMLRFCRSDFSFGGLLS
FT                   FLAKTARRWLLTVMRAGDRPLILQCLRDGWRDGWHTEPESNAEIFARACPPLVPDIERI
FT                   SL"
FT   gene            472826..472933
FT                   /locus_tag="BIF_02193"
FT   CDS_pept        472826..472933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02193"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84896"
FT                   /db_xref="UniProtKB/TrEMBL:D3R714"
FT                   /protein_id="ADC84896.1"
FT                   /translation="MVTSTRHAHLIRVLLVKTSRKWASLGFHLAERIEY"
FT   gene            472956..475139
FT                   /locus_tag="BIF_01490"
FT   CDS_pept        472956..475139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01490"
FT                   /product="Phosphoglycerol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84897"
FT                   /db_xref="GOA:D3R715"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D3R715"
FT                   /protein_id="ADC84897.1"
FT                   /translation="MPFTCPKPNLRGLRVSDQEYQAETPTPVIDAHKCTPKTVFRDICA
FT                   AVRQWWPTRPKYSYGAYMVVFMLTCVWSDYMALWSMDSDNRYDPGHGPLVAQIFNSAHA
FT                   RLSTNQGWMNLIIIVMVYIVLLTLINRFWAATAATFTLFAVYAVATVIKCVLRDEIILP
FT                   SDLNFLTGGGEGDLMSFIPADLSSMIAPSVVMIVTFVLICVALQFLDGRSMFIHCSWRH
FT                   ALDSKRNIFGLICRIVAPILSIALLASYATGLGQQDSAVRRFLDYFEYTPQQFNTTSDA
FT                   NRNGVLTSFLSLVDVKAMEPDPNYSESAMQALNSKYAQSAQRINTERRATLTDSTVINV
FT                   LSESYADPTRVPGVSFSEDPMPNLRSIMQSTTSGLALSPGYGGGTANIEFQQVTGLSMT
FT                   NFAPSLATPYQQLIPNRPTFFSFNQMWNAACDGSTDCSVAFHPYYQNMYLRGANYTKFG
FT                   FSHFHALNSKPQITHRESTSNSKYTSDEQAYANVLDELKQPDSRSKYIELITMQNHTPY
FT                   TADEYPDNEFIAADTSTDVAASDRGSIRTYAKGVQITDKATSDFLEELDAIDRPITVVF
FT                   YGDHLPGIYSKAMADPKNDIALHETDYFIWSNTASDAHTTKLDKANAAHTSSNYFMAQT
FT                   AEHLNAKVSPYLALLTELHDEIPAMARLGRNDGEWKNDSSLTMLDAQGRPIDENDLSSK
FT                   AKELLADYRSVQYDMCVGKNYLETMGFMELPKS"
FT   gene            475208..477649
FT                   /locus_tag="BIF_01251"
FT   CDS_pept        475208..477649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01251"
FT                   /product="Phosphoglycerol transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01251"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84898"
FT                   /db_xref="GOA:D3R716"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D3R716"
FT                   /protein_id="ADC84898.1"
FT                   /translation="MSMKSVARHDGPRTRAQRIRCAKHRRARIRAAYRRHLTSMAAGNT
FT                   YALHAASSGDPLAMPAVANHVTARNGDHDNVKPSAARKAAHPRAGVQNAAPQPTGEKNS
FT                   RRVNPVTRQWRRFKETKFYEIWNKRPKFSYGAYTVVFIAMVILATMFLWWSTNTKLKYD
FT                   PASELNFLQQVTGDAYHYLSSASCYLNMIALVLIYLLLVTLVNRFWVGTALFGAFVMVF
FT                   AVATKIKITMRSEPIIPSDLGFLSGGGGGGAGDVASFVTDDSRPLVNTAIAWLVWFVVI
FT                   CVILQCVDKRRAFIYCSWRHPIAGPKNIFGLICRILAPIVSVLLLISYAGVLSNPQAPQ
FT                   RKTLSKIGYSPTLWNVQQDAETNGALTTFLSLTRVKAMEDEPEYSQAAMQQIKNRYAQA
FT                   ADEINAQRSQNLTDNTVVMILSESFSDPNRVPNVHFGADPMPNIRALGQTTTSGLMLSP
FT                   GYGGGTANIEFQQMTGLNMANFSDTLLSPYQQLVATRPKFYSFNQMWNEHCGDEYSTSC
FT                   SIGYHPFKQFFYLRGVNYKKFGFSHLYTLDSDPKIAHGEAYVGPNGTKTEVSDEEAYKN
FT                   VVEEIRTNTEQNKPSQYIQLITMQNHAPYPDLYGSENEFHGVNETPDTVPERGIIATYA
FT                   KNVQRTDEATANFLNELDGIDKPITVVFYGDHLPGIYNTANADKNNALTLHETNYFIWS
FT                   NRASASHDVKLPESDAAYTSSNYFMTQAAEHMNARISPYLALLDELHAEVPAMSRSVNA
FT                   GVWSAKGEPTLLDDNGEVIDTNTLSSKAKQLLADYKMVQYDMSVGKNYLMDMGFMDIPK
FT                   Q"
FT   gene            477661..479715
FT                   /locus_tag="BIF_01252"
FT   CDS_pept        477661..479715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01252"
FT                   /product="Beta-Galf-beta-1,5-Galf transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Beta-Galf-beta-1,6-Galf transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01252"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84899"
FT                   /db_xref="GOA:D3R717"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D3R717"
FT                   /protein_id="ADC84899.1"
FT                   /translation="MAVNTPKKRQTPRHAAAAAQGTGDWETVNRVVFPTSDEDMTMPLY
FT                   AIEWTRPKLDEDVVNPFADFYSLDFGAMNESELRRLLNGNKRPIANASDAVFTVTGRTA
FT                   ITIHTGRHASFCTYFNAFPASYWRRWTPVRSVRFTAQVKGAGALALMRSTGRGLLHPVE
FT                   TVPIDSPQAFTEVSVEMGMDGLLDGGFFWFDAKATDTSALYIADACWEVPTAQRPNDLH
FT                   PFSIAITTFNRPSYCLRQLRAIAANADVRARLDTIYCTDQGTDHVCDQPDFDETADELG
FT                   TQLTYIQQANLGGSGGFSRGMYETLKAGTSAHTLLLDDDAISEPESIIRAVQFADYCNT
FT                   PTIVGGGMLHLDNRTVMYAQGERVDMREMRMFPAVGAEYNHDYAQFPLRDCPKLHRRFN
FT                   VDFNGWWLCLIPTACMKQIGLSMPAFIKFDDIEYGLRAKEHGFHTVSLPGVAVWHQAWH
FT                   DKDPGRTWEEYFNNRNRWVCALLHAEKPSPIMAYQMAYGDANLGLRFIYSGIKLRHIAL
FT                   RDVMRGPQYMLDTVHTQLNTVRELRKGFSDTDLKPNLTDFPEAKAEFEPHAVPKSKAAV
FT                   QKECFKVVLKSLISRTDGTHDERPAIAVPAKDATWHAFQGQSSVLVTSADGNSASWCRR
FT                   NNPLFRKQFMRGLYLSKEFFKRWDRLAAEYKAANIASVEHWEQIFRNPR"
FT   gene            complement(479803..480684)
FT                   /locus_tag="BIF_01632"
FT   CDS_pept        complement(479803..480684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01632"
FT                   /product="choline binding protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01632"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84900"
FT                   /db_xref="GOA:D3R718"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R718"
FT                   /protein_id="ADC84900.1"
FT                   /translation="MTMRMGLGLHEYGGWCNPNAVRRVARRLKTAVCALLGCVLAMFAL
FT                   TGCGNVNGSDQADAWNEAADPWSYSFGVHVFTEGDGRVLRPVWRVIDVAEHQRNINWQK
FT                   VKQSEVDAAILRIGYGHGNEDKYFKNNLAQVRVNRIPHGLYLYSYAYDTDFAREEANFV
FT                   LQTLRRYSITDKSVPIFYDMEHLDDWGGHTMPTRPIQFEQIAKVFFGVLEDAGYTNLGI
FT                   YTYAHNMATRLDSDWLHGHANWIASYSDTLEYDFAGCPDLHAWQYTSTARVPGVTGDVD
FT                   VSVFDPRFFDVE"
FT   gene            complement(480765..482393)
FT                   /locus_tag="BIF_01633"
FT   CDS_pept        complement(480765..482393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01633"
FT                   /product="choline binding protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01633"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84901"
FT                   /db_xref="GOA:D3R719"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R719"
FT                   /protein_id="ADC84901.1"
FT                   /translation="MGLRVRTMTKGVCAGLLTVAMCTTVAVTAPSAWANDSVAPDAAAT
FT                   QTMESTETADVQPQWQGEGEMPDELKGITNPEHMWQEGAAQEQWEAEQQAKGEQQGAGR
FT                   AKASAGCSALYDWDTANGYKRFSSAGTGQNCAGKKVFNPAMKVLDVSEHQKVIDWNRVK
FT                   RSGVDAVILRIGYGHGFEDGHFRRNLQEVRRLGIPFGIYHYSYAYDVNFAVQEGQWVVQ
FT                   LLRKYGVNPSDMALPVFYDVEQGDWGGHRMPTNANAFRPIINAFVNQLASAGYGRTYLY
FT                   TYLNYANSRLNANDLRARIGWMAQYSYQLSYDFHSGYSDVRGWQYTSIDRISGVSGNVD
FT                   MSAFDQRIFSDVNWKTPHLQDIAWAKSSKVTDGFPNGTFRGMNTVVRQDMAAFLRRVAV
FT                   RHNIAGAKTWKPSAADWNRFTDVDPGTPHAADILWLAHAGIADGYDNGNGTQRYEGMAP
FT                   MYRQDMAAFLYRLAKKANKLGNVRPMSFTDVNASTPHYQEVQWLGGSGISQGYSNGNGT
FT                   WRYEGMGHMYRQDMVALLHRLDARL"
FT   gene            482886..483803
FT                   /locus_tag="BIF_01634"
FT   CDS_pept        482886..483803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01634"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01634"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84902"
FT                   /db_xref="UniProtKB/TrEMBL:D3R720"
FT                   /protein_id="ADC84902.1"
FT                   /translation="MVPGLAPGIEPDGVVHHTVMADGTHMNGWCLLVAIDGEDGEVLAW
FT                   QWCDRESAAAYKALSEQIAPPDVLICDGMKGIGKACAEAWPGTRIQRRLIHVQRDTRAD
FT                   LTSRPRLEAGRELKGPADAPARIHDPEHAARWGEAPDAWHERWKTMLAERTFAKDHPDD
FT                   PRAATSTSGWWWTHLPLRRAYPRLERLFRNGTLFCFLDPELLEHGPVARDSNRLEGGVN
FT                   AKLKLMLPNHRGLPPKHMRRACEWHCHMKSNDPDPTRILKEHDRKSKTKQAAPQENDMP
FT                   QPTLGTGIDWNEFHTSTRYPNSTD"
FT   gene            483930..484490
FT                   /locus_tag="BIF_01635"
FT   CDS_pept        483930..484490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01635"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01635"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84903"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:D3R721"
FT                   /protein_id="ADC84903.1"
FT                   /translation="MMNTLKKMAVSAVAALAGVMMVAPTAMAANGTIPIDAAHFPDTAF
FT                   RVRIAQEFDSYPKDGKLTIAERNAVTEIRGGDSYEIKFAKGIGYFPTLENLYLYNQLLT
FT                   SIDLSHNAKLQNLNLSRNKLTKIDLSRNPELRDLDLSSNKLISINVSKNTKLTEFDFQS
FT                   NPLLWISSIAPAVNVDIYSPFTD"
FT   gene            484551..485078
FT                   /locus_tag="BIF_01636"
FT   CDS_pept        484551..485078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01636"
FT                   /product="choline binding protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01636"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84904"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D3R722"
FT                   /protein_id="ADC84904.1"
FT                   /translation="MISNVRGGKIENGVAMPDKLNGSVTYRYTYDYTHEPLKAEITFTP
FT                   SVWFTDVNVYSTPHAVDIQWLADNKITTGWLVNGCYVFRGMDNVKRRDMAAFLHRLAAK
FT                   AGKGTNVTPKNNFKDVNAKTPHVADIQWLAGAGVTEGWKVGNSYEFRGMNNVVRQDMAA
FT                   FLHHLNDKVLAR"
FT   gene            complement(485230..485931)
FT                   /locus_tag="BIF_01637"
FT   CDS_pept        complement(485230..485931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01637"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01637"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84905"
FT                   /db_xref="UniProtKB/TrEMBL:D3R723"
FT                   /protein_id="ADC84905.1"
FT                   /translation="MMLMIRENDLETVLANRRNFIGIAPRLESALTIITGVFYVASAVV
FT                   MEDLWWKIPMYVLGAIVTIYGIAGVIRKPYTTKQLFKEIAGMNAIASSIIAITEPGISD
FT                   SNKYLVYWDTKWKCWFFPNRRSTPSVPDDERDLRNYLHAEFKVPQDDCTLEYKTDGEST
FT                   KYSTEHDEMRYYDYRIYRGVVSALPDSWSVDGPFDVGGHRCKWMTIDEMLADEETDRIN
FT                   HDVIVLVRDNA"
FT   gene            complement(485951..487306)
FT                   /locus_tag="BIF_01638"
FT   CDS_pept        complement(485951..487306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01638"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84906"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:D3R724"
FT                   /protein_id="ADC84906.1"
FT                   /translation="MSGSGSGGPLKAAKRAFWEQITRLYNRHYGVKPLPETEIVRRSKC
FT                   HYLIGEAGYPNYGDELIAREWVKYLAQVDPEVPVVLDCLCAGPAAAICSGLHPKFSVVD
FT                   TVAQMCMIDRAHIYDEQHAVSDSVEPAAAVAPTIEEIPVPQIANRVLAALDAEGLDARY
FT                   AAGIRLLNNRALDMHVIGGGYMHSFWNANLARLAVAKWAQAHGKPAVVSGVGLEPLDAE
FT                   DAEWVADIASHITAFSCRDMPSLDAIDSSHSYATLAPDDCFVNGLEGVYLPDEAAGDLP
FT                   ETMVCVQTDLVPDPAALLDHMVAVLQAWEAPAGERVGVVECIPYDSMDALRVIRDHGWE
FT                   PVLFPLQNLIDHGFPARSGQRWLSTRYHPHLLAAARGCSGTFIPVKPGYYDVKHAAVLR
FT                   MGSRWTQTTIGDSLIPKPGPGFADPSVRFAYRDQIRAQVAPLYGEPHSFVSL"
FT   gene            complement(487303..488718)
FT                   /locus_tag="BIF_01639"
FT   CDS_pept        complement(487303..488718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01639"
FT                   /product="Polysaccharide export ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01639"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84907"
FT                   /db_xref="GOA:D3R725"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R725"
FT                   /protein_id="ADC84907.1"
FT                   /translation="MTQATDHNTDAVENGDVVTIDNYMDKPVVLDVEHVDKWFKLPTEQ
FT                   ATGLKQAFINWTKGIKGFKKQQVLKDVTFQVHQGEFFGIVGRNGGGKSTLLKIISQIYY
FT                   PNRGSVNVTGKLVPFIELGVGFNPELTGRENVYLNGALLGFTPEEVDAMYDDIVEFAEL
FT                   GEFMDQKLKNYSSGMQVRLAFSVAIKAQGDILVLDEVLAVGDEAFQRKCDDYFTKVRQD
FT                   PTKTVILVTHDMSAIKRYCTRAMFIKDGEVAAIGDRETVSESYTLANLEAIDQENEEKA
FT                   RKALEAGHEEYPNGLNERCPLLRTYGVSPLMLTSADTFRFAVEYQFDETDDFYLAIALH
FT                   DVRRGGITFDTGARNPQMHMTKPGHHTVYFEMPLDLFNNGEFRLITSLRTPTPGDGKMT
FT                   DAVAVALDDNACTFAIRDPRNSNYALINNRALYIKPISEEEAEDAAAEQKAARKETADT
FT                   AADANTVFESGQA"
FT   gene            complement(488718..489560)
FT                   /locus_tag="BIF_01640"
FT   CDS_pept        complement(488718..489560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01640"
FT                   /product="Polysaccharide export ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84908"
FT                   /db_xref="GOA:D3R726"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D3R726"
FT                   /protein_id="ADC84908.1"
FT                   /translation="MRVNTLSQRLKSRYGYAMTVLRGLVKTDFKMRYQGSFLGVAWSVL
FT                   KPLMLFAVMYVVFAKFMRMTDGTPTYPVVLLLGISSWQFVTETVGIGLRSIVDRGDLLR
FT                   KVHFPNYIVVVSASIGSLISLAINYVVILIFAIFMRVQFTWRVLWLPINVLELYIIALA
FT                   LALILSTFYVFYRDVLHIWEVLQQIIFYAMPIIYPLSFITDKHPEYRTIANLELMNPIA
FT                   QTIQDIRHNFIAPATQPTVWNTFGSWWVKMIPIAITVLLLWFGVYIFRKNSRRFAEVM"
FT   gene            489735..491681
FT                   /locus_tag="BIF_01641"
FT   CDS_pept        489735..491681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01641"
FT                   /product="UDP-galactofuranosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01641"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84909"
FT                   /db_xref="GOA:D3R727"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3R727"
FT                   /protein_id="ADC84909.1"
FT                   /translation="MPSIRFANVLLETKPRALSYPTMYYHTDQLITPSGENGEWTINGA
FT                   GTVDFTTYFNALSVLKLQKYTRATGFALHIDVKSAGEVTLTQTCAERLSMNPEIVKDNS
FT                   QTVAGDNDWHTVTLDISVDEHTVLAGFQIATTAATEIRNGYYEVSFDGEPRDVELSIAT
FT                   TTFRKEKFIERNIELVKTELLASDYDIAKHLTMHVIDNGSTLDAAALSDEHVIVTPNEN
FT                   VGGAGGFARGMIESLEQSTPATHVLLMDDDVEVSPESILRTYNLLRIVNDEYAEAFVSG
FT                   AMLNIEDTQDQKEDTGFISTYDGSCVPAKPPLQVTKFVDVVYNECFDESVCVPEDAHRY
FT                   AAWWYCVIPTTVIERNGLPLPIFVRFDDVEYGIRCNPKFMTMNGICVWHAKFDIRYNAG
FT                   VERYQTVRNQMIGQAVTGLAPSMKTMLHSLHHMVDLESRKFNYTDAELALDGFEDFLKG
FT                   PKFIMQPVAQERFMRANREKEKLVPFDELKKQAAEMGITDFDPDMLTRQVIDFDEPRSF
FT                   QQRVFDFVTKNGQRFGTDKLVAIRFDGRGDEPETALGSDGDRVEYTIIPSAGWLYPAGM
FT                   IHNENVIIAIDWATRKGVIRVKDAKRYKEVMKRYKRDMAYYKKHADRLAAEYLAAGPQM
FT                   QSMRFWKQYLGMD"
FT   gene            491784..491868
FT                   /locus_tag="BIF_tRNA08"
FT   tRNA            491784..491868
FT                   /locus_tag="BIF_tRNA08"
FT                   /product="tRNA-Ser"
FT   gene            complement(491972..494221)
FT                   /locus_tag="BIF_01642"
FT   CDS_pept        complement(491972..494221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01642"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84910"
FT                   /db_xref="GOA:D3R728"
FT                   /db_xref="UniProtKB/TrEMBL:D3R728"
FT                   /protein_id="ADC84910.1"
FT                   /translation="MRGVKTMEQITDSQVRSKRGLWVAIAVAVVIVTFFEVGLFNLGHW
FT                   RTTGLQQAVVGEPVIGRGLKSLGNNEYEITDPETATVTVPVSARDGGGPVRVESVRVQA
FT                   TPNNRNNTEYQQNRYVDGAIELRTTGGRTMSGNEWVSSRDSDGVWGDPRNELHYTTNPS
FT                   SQYLLIGKKLQYYDSTEIRVRFYGDKGHKVIFDRVYANPTIPFEINPFRLLLEIAIAAF
FT                   FVVFRPRSAIYRLHVNLHSNRQRSATTVYVVAWSALIVAVAALTMPRPWGYDAGTGHYV
FT                   DHEQYQRLADALIHGHTWLDLPVDPVLQTMANPYDFFARRGLAASDGHQFIWDHAYFNG
FT                   RYYCYFGVVPALLTFVPYQLITGHWMPTWVAMGIFSALAVVFGTLLVRRLAHDYFPKAS
FT                   LGVVWLVIIGFNIGTNLFVYNMSCNFYGVPIVCAIALVLMGLWFWQVSKRHDGSVNGRL
FT                   IGAGSLCMALLLGSRPQFAAAWLLAFPLFWEQITQHRTLFSKRGAWGTAAALLPFVLVT
FT                   VPLLYYNHIRFGAWLNFGQNYNFTGFDLTTRRSPLYILPGQVFNQLFEPVATTMRFPFI
FT                   TTVDTTLAAPNEPSIGGYFAVYPLALFALLFILLRYQLRDHKVWGLACTMMTVGFIVAV
FT                   FDCYKGGTTMRYSGDYAFYFMLATLLVVLAFDSGIQQGAIESEGLDLAKSHEVPFAVRD
FT                   SLGFRTLVTLLVALVFFTMLINLFGLFAKGRLAEFASVRTGMYTTVRNWFIGMTA"
FT   gene            complement(494218..496467)
FT                   /locus_tag="BIF_01643"
FT   CDS_pept        complement(494218..496467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01643"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84911"
FT                   /db_xref="UniProtKB/TrEMBL:D3R729"
FT                   /protein_id="ADC84911.1"
FT                   /translation="MREPVSQAQPHGSVTASATHSGGNRRSLWVSMAIAFVAVMILEVG
FT                   FFNLGHWRTSRLQAATVGDAIIGEGLKSLGHHEYEITDPETATITVPVGARDSGAPVRI
FT                   GSVRVQATPGNTNEVPNQRNHYSRAAIQLNTTGGQTISGNTWVDSRDSDGVWEDRLNIL
FT                   DYTTNPASQYLIFGKKLQYYDSHEIRVRYLGDKGDFVLFDSIHANPVIPFEINPWRLLV
FT                   ELAFAAFFVLFRPRSGIYRMRVDERRVRQNLAIAGYVVAWSAIIVAIARFAMPKPSGLN
FT                   TGFMHWVDYEQYQRLADALIHGHTWLDLKVDPALTTMANPYDYFARRSIAADGTHTFYW
FT                   DHAYYNGHYYCYFGVVPALLTFVPFQLVTGHWMPTWAAMGVFTTLAVVFGTLLVRRLAR
FT                   DYFPKASLGVVWLVIIGFNVATNLFVYVYSPNFYGMPINCSIAVTLVGLWFWQVSKRPD
FT                   GTVNPWLIAAGSLCMALNFGSRPQFMAAWLLAFPLFWPQITKLRTLFSRKGLAPTIAAF
FT                   VPFALVIPPLLAYNYVRFGSLFDFGQNYNLTGFDMTTRSSSPYTVLPDLFNQWFQPVDT
FT                   AMRFPFIMQVDTTMAGPNEPSIGGYFAIYPLALFALLFVLVRRQLRAHGVWAMTVMMMA
FT                   LTAVVALFDCYKCGTAMRYYGDFAYLVMLSALFVVLAYATAAQHRPAVNLHAKGFSVNR
FT                   FLGFRTLQTMLVTLVFLTLLINLFGLFNENRLDAWHGTFSGTYTTVRSWFIGLTA"
FT   gene            496466..496708
FT                   /locus_tag="BIF_02165"
FT   CDS_pept        496466..496708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02165"
FT                   /product="Repetitive glutamine-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02165"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84912"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:D3R730"
FT                   /protein_id="ADC84912.1"
FT                   /translation="METPPPCSVFGLRFSGYPYSVGNANEKFHIACENGRMAGPLPLSS
FT                   RNCMHGPQAGKAPLHRGQPGYAPKLDRDGDGIACE"
FT   gene            complement(496758..498422)
FT                   /locus_tag="BIF_01645"
FT   CDS_pept        complement(496758..498422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01645"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84913"
FT                   /db_xref="UniProtKB/TrEMBL:D3R731"
FT                   /protein_id="ADC84913.1"
FT                   /translation="MGAASLGKEDCMPEPFAFDSIGFLQLLNQLERRFDEVVSHAPLSF
FT                   DRIDSPTIQPHTSTESSNRRTGAFHRRGSAAKGRNATPERAENEQMCQTVSAQVQAQMD
FT                   LFSRVDRRIDVLAQDLFGPTHWGSLIRMASLGLDHDLIDEARKFMLYCSSTVRRHGMAV
FT                   WLYDIMNDASMALLLHKPAEHMPVIVNGPDVVNGRLRCGLDATVQRTGPTWQRECYNRV
FT                   HSLHTYMLAAYCVAKWGEPGERRRELATLILNDWGLGMCMLREDKTVRRLGASTDMRFR
FT                   RIIRYRRKLRVQADLEYAHALIDEHDASDVEEHAAATKAMDRRYLYDAGKVVEAYRALW
FT                   NKQTRSTRMLSGMLEETNAVPSVPLWENPLYLEDLTVSLMGAAMGSKITMGFERRNREE
FT                   FEEGVRLLGHLCDDVRDLTVALLPMQVVVRFEHEIEDGGNFGLCDADDPDFWNLSQFQE
FT                   NVFSDMASVVLQRVFVDDDDLNSELAMAVLNDHPGTYARLIMPYFEDEDDGDVDSAELA
FT                   EIVASAKEPETAPHSESEHALGEAAGDAEIIDVDVVA"
FT   gene            498454..500073
FT                   /locus_tag="BIF_01630"
FT   CDS_pept        498454..500073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01630"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84914"
FT                   /db_xref="GOA:D3R732"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D3R732"
FT                   /protein_id="ADC84914.1"
FT                   /translation="MHREFLVSTKICGQVDDRVDIHGDNLNFHREYVDNERRGMHIVDD
FT                   LPSQSTMNCASVVDNPAANFASQHSHSRAWKYTYSGTHKVHEYRLRGTMFIFGQAWKML
FT                   CRHPLRSLLIVLVSAAIAMWSTFGGAVLQENHKARTETLDKQSNTAVIRPSSQLLETRQ
FT                   GDDSSWTEHYLSWSDYDKLASAGQTQGMQYKYTVAESVPVRESKSVQAITTGKTSDASA
FT                   DKTGGNLTLQSFYTAEAAQANEYGPYEVVEGKGLDYQNSLAQNVLISEALAKKNNLKVG
FT                   STITIGNPTDAKKTYEYTVVGIYRYTGNPDNAQGDDAKFAKDNRNNVLYTTYTTFAVNG
FT                   FDTTKGKGWSIPDLNVVFTFQNRSDIDKFAAALKADLPKGFTVSSPTITHYMQSIEALG
FT                   TLAGTTRIIMIVLWICGALALLGLVLLAALPRSNEIGMGMLVGLSKGRLAWQFMLETFM
FT                   PTLVGLAVGLVLGACTANPLAGALGAQHDVHATGGLVWQVIWIGVLCSVALAIVAGLRV
FT                   TFFRTIRLFESPYISDSADSED"
FT   gene            500075..501139
FT                   /locus_tag="BIF_01629"
FT   CDS_pept        500075..501139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01629"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01629"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84915"
FT                   /db_xref="GOA:D3R733"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R733"
FT                   /protein_id="ADC84915.1"
FT                   /translation="MTEHHDSKDTDSKDTPTTPQENASENAAPDTFDYVVDYWDDEGSA
FT                   SNDSSDAVIEALSATVDANATDPTDGDTDADGEPAADKSRETAPAHSNENAQVTVPDVV
FT                   QVADHLDSSLQAEEDGEDAALAGSSIFRAYPMLSLHDVTVSDPKTKEHIWQHLTFRCEA
FT                   GECYAIMVDAHDTRRHATLLALIGGFIAPSSGEIMTKTTPYEDMDAEQLRGHRLGMITP
FT                   QFSLRGDLNAVENLTYVMNASGQTFMKPVKGLAQDLLVRTRFGENTKADESTLADELDP
FT                   VDAARLSIARALAIDPDYIIADNLTVNLNETDTKQVLNLLKAQVSTPDKQRTVIVVTAS
FT                   EQIAKQFDNIIDLR"
FT   gene            complement(501332..502126)
FT                   /locus_tag="BIF_01628"
FT   CDS_pept        complement(501332..502126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01628"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84916"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D3R734"
FT                   /protein_id="ADC84916.1"
FT                   /translation="MGMSGIIPTFGQIDELHRKCAQSQAAYDLIHTHCQIIAQITRQLI
FT                   HRQNALFMRRCTLPDDALERTGDYPTLAGERIADAIGSPEEDRFVVPPTDGVTGGMVPP
FT                   RYIDVEKATIGALLHDIGTYAVLKNDGSNGEPLSFDGPRYVEHGLIGYELLLNEGYDES
FT                   IAEFARNHTGCGLTREDVIDQHLPLPPADYVPVNLEQEVVMVADKYHSKSVPPKFLTAS
FT                   AYARKAARFGAENKQRWLELVRKYGEPDVPALAEHYHMRLVD"
FT   gene            complement(502359..503261)
FT                   /locus_tag="BIF_01627"
FT   CDS_pept        complement(502359..503261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01627"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84917"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3R735"
FT                   /protein_id="ADC84917.1"
FT                   /translation="MGNMRTLHSTTMCRLLGYATANENISLREVLGAQSTDAFRELSEI
FT                   HNDGWGTAMVKEPDQTAHVTDGGAPSPSTGSAIYRNTIAARYDSIFGDLASVPVRGGIW
FT                   HLRLASSNLPLVLENQQPFYASGLSFIHNGDISDAQGRNITTNRAYPVDHTLVQSTGGR
FT                   SDSAIYFAIVLQYLGYGYELEEALAQAVRELRGAYPDSSYNCIIQSRDQLIVLEAHDNG
FT                   PTQQDVLDVYAQYGRAAEAADYRTVRYREITGADGARKGVVAASSGFAQPADEGWKDLG
FT                   NNRMIVASNRTGAFRVRSI"
FT   gene            complement(503542..505740)
FT                   /locus_tag="BIF_01626"
FT   CDS_pept        complement(503542..505740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01626"
FT                   /product="Kup system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01626"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84918"
FT                   /db_xref="GOA:D3R736"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:D3R736"
FT                   /protein_id="ADC84918.1"
FT                   /translation="MSMDERPEQQADEPLLRTADKYTQAPKVSHKVLTKEERLAIIEAN
FT                   EKKRQEAAKLEQHKAFGPVGRWWRTLQSGPDKVTLAMSIVALGVVYGDIGTSPLYTMQT
FT                   FLAGQGGVQHADETAVIGMLSLVFWTMTLITTVEYVLICMRVDNKGEGGIFALYSLLRK
FT                   YGKWLIVPAMIGGAAFLADSVLTPAMSISSAVEGLQTLPALQGVFEENPSLTLFIALVI
FT                   ILAVFAVQSRGTERIGKVFGSTVLVWFLFIAVTGAISMSQNLEVLRALNPVHGIQFLVS
FT                   GDNHAGLALMGTVFLSITGAEALYSDMGHVGRGNIYATWPFINLALVLSYFGQGAWIIR
FT                   TLENPAFVPDGNAPNPFFAMLTPGVRYVAVLLSVIAGIIASQALISGAFTIVSEATRLN
FT                   WMPHLQVRYPARTRGQLYIPTVNVVLCCSTLLVLLIFRNSEHIAAAYGLALTITMIMTS
FT                   ILVTVYLWHMRSRFAAVLFAIVFPMIMFMFFIASMAKFLHGGWFTMLLALAILTVMATW
FT                   DEGTKLERAQRRHMSPEDCLPVLHRLHDDDTIPYYADNIVYLTSDTEMKRIDTDIFFSI
FT                   FASHPKRAHAWWCVSVETSDEPFTREYSVETLGTDFLFRVRIRLGFKVRTSVPAYLHQI
FT                   MHDLLRTGELPAQKSTYPKVDADPEIGPIRYVLIHKELMPESKVSQRGAMALRIKYAIR
FT                   HVAGSPIKWFGLAPYDPVTEVQPLFLATVRPPRLKRIN"
FT   gene            complement(505940..506896)
FT                   /locus_tag="BIF_01625"
FT   CDS_pept        complement(505940..506896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01625"
FT                   /product="DNase, TatD family"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01625"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84919"
FT                   /db_xref="GOA:D3R737"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3R737"
FT                   /protein_id="ADC84919.1"
FT                   /translation="MSKKHRVRDWAPLPPALPQDAHVIDNHTHVASVVPFSQALSHEAV
FT                   EKGQPEIAVYSVDQLLDQAAAVGVEGVIDCGCELPHLMTAIDMAREHPGSVWAAIAIHP
FT                   NEAVLHGHRGAPGPDGLPVRYKPWHDVPFDEAMTEVRRLAKAYPKQVVAIGETGMDLFR
FT                   TGESAKEIQREAFRDHIAVAKELDLPMQIHDRDAHRDVIETLLADGAPRKTVFHSYSGD
FT                   AEMGEIAREHGWYLSLSGASSYKGNTGILESAALVGLDHVMVETDAPYLTPMPYRGRPN
FT                   APMMIPYTLAALAEYLDTPVEQVARATRNTTREVYGI"
FT   gene            complement(507067..509466)
FT                   /locus_tag="BIF_01624"
FT   CDS_pept        complement(507067..509466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01624"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01624"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84920"
FT                   /db_xref="GOA:D3R738"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R738"
FT                   /protein_id="ADC84920.1"
FT                   /translation="MMLEHSRPALLDELTAPRNALKPDSKGRIVWGNGTVTLVFAVSDD
FT                   RPVTLIGMSGRGMEPVDANIAGEPDAQPIVELRSSLDGGGDNRLKLAVSSAGLKLRFVR
FT                   AYELNRLGDERQPVTLLAIVQRDPDGDGPLVTSVFEATAHTSAVRTYTRLCSEEPYPVE
FT                   AVSSMNATLPMEAAKLEDAQAQVYWGESSWDCENAWQSAPLRSTTLRDRNQVINPGMSS
FT                   ARFARRSTSTWSTGEFEPMGIVEGGGRPGELGHFSFAWQIEHNGAWEWEIGEDDPGLRV
FT                   SAYGPEYDDHQWFIMLRDNQPFVTVPVSFVVCAGDWQHAVAEMTVQRRALYRAKAMEMG
FT                   RLEQAEQAKGLVVYNDYMNTLWGDPRIEKELPLVEGAAKVGADVFCIDAGWYDSEDGGW
FT                   WDMVGEWKPSMNRFGDIRLAGLIHDIQSHGMKAGLWLEPEVIGVRSPLAKMLPDSAFFC
FT                   RHGVRIADQGRYHLDFRSPVARAHATATVDRLIDEFNVRFFKFDYNTTPGAGTDVDTDS
FT                   VGEGLLEHCRAVQQWIEQIRAKHPDVMIENCGSGAMRADYAMLSRLDMQSTSDQSDPLV
FT                   YAAIAAGAGMTVLPEQQGNWGYAQQEMDDETAVFTLAAGILGRLYLSGFIDRMDEARLG
FT                   LVRDAIALHRTILGGQSHLVPWWPCGLPDFNSPWLVYGLRHAPNVTGLSHDEDWNGTDG
FT                   QGSEHVDEAQYLTIWRRGGINSLYLEIGEGAHIEQVFPNPAKPEHAPDAKPWRIEWADS
FT                   ETVRIEASADKEPSARVFAITFPQPSADGTADDDASENAGHDIEGR"
FT   gene            complement(509541..510500)
FT                   /locus_tag="BIF_01623"
FT   CDS_pept        complement(509541..510500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01623"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84921"
FT                   /db_xref="GOA:D3R739"
FT                   /db_xref="UniProtKB/TrEMBL:D3R739"
FT                   /protein_id="ADC84921.1"
FT                   /translation="MASRGIAVCDDLGRRLKHPPWRVCCERNRRGGRRAIVPNGMLKLG
FT                   NQRGNAHDARSGSNMERTAYSGLGMPTACAALVLGGIMQDKDDMLPKNVQQDISELTKP
FT                   DVTEHESAWATYRKLPKSHKWPYFYHHFFWPIIVAVVVFAAIVAFVVNMVISPKGQGLG
FT                   VAFVGVEESDRSMDKLEDGFLKYRALDEKKITFENDLYIDSSNKESASMSLDTLETQMS
FT                   GGTINTIIGDDSALRSQHLLGYLEPLDNVLTSYQMGKLRERGALVTDGEGGAAKAIDLG
FT                   KSAEWTRIKGQDPHAQLSFVNVQNKDYARLFVDYLFGM"
FT   gene            complement(510452..512245)
FT                   /locus_tag="BIF_00887"
FT   CDS_pept        complement(510452..512245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00887"
FT                   /product="Multidrug/protein/lipid ABC transporter family,
FT                   ATP-binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00887"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84922"
FT                   /db_xref="GOA:D3R740"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3R740"
FT                   /protein_id="ADC84922.1"
FT                   /translation="MAQRNTYREDEELEESINFHDLRRIGRYLRPHGRRLARIAAVVIS
FT                   MSCITVAVPYLTKVVIDDVLPHRNYTLLAWLVVVMLVLSVLYEVALRYRTLEITRVGQL
FT                   ILKDMRRDLFTHIQTLPFSYFDSRPHGKILIRVVNYVNTLSDTLSSGLINVIADVFTFV
FT                   ITLVVMFAIDFKLALWSLLLFPLLIVVVRVLQHFQRKAYQNLSNKQSNVNAFIHESIAG
FT                   VKTTQTFAREHGQYETFQHLQSEQRSAWMRAVHIQFLLWPSMEIISMSTMALIYYVGIM
FT                   HVAGVTATTGTLIAFVGYANNFWNPVINIGNFYNQLITCSAYLERIFETLDVQPDIVDK
FT                   TNAEPLPPIRGDVRFDDVVFRYEPDGRNILDHVDLHAKPGQTVALVGPTGAGKTTIVNL
FT                   LSRFYDVAGGAVLIDDHDVRDVTLRSLRSQMGVMLQDTFIFSGTIRENIRYGKLDATDE
FT                   QIIAAAKAVHAHEFIEELPDGYDTVVQERGSTLSMGQRQLIAFARVLLADPRILILDEA
FT                   TSNIDTRTEEALQAALQHMLVGRTSFIIAHRLSTIENADMICVVDHGRIVERGTHEELM
FT                   AKRGEYWRLVESQYAMISGGD"
FT   gene            complement(512268..512447)
FT                   /locus_tag="BIF_02194"
FT   CDS_pept        complement(512268..512447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02194"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84923"
FT                   /db_xref="UniProtKB/TrEMBL:D3R741"
FT                   /protein_id="ADC84923.1"
FT                   /translation="MILPVGGPRIGDPAGGAGLRSSVVCVPWRSSARPTPPRRIRRSAV
FT                   SNQQFAICNPHTNL"
FT   gene            complement(512444..514276)
FT                   /locus_tag="BIF_02195"
FT   CDS_pept        complement(512444..514276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02195"
FT                   /product="Multidrug/protein/lipid ABC transporter family,
FT                   ATP-binding and permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02195"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84924"
FT                   /db_xref="GOA:D3R742"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3R742"
FT                   /protein_id="ADC84924.1"
FT                   /translation="MHTHRRIARTPSMYVDPNRNRNASNLCWLMPYCRPELPRVIGAQI
FT                   LYLVSAAMALVTPLIAARIVDRVIEQRQLSLLTGLCLALIGVTIVRDGAYYGNQMWMER
FT                   AGQNTVYRLVSDEYEKLHTLDFDYFNHTRTGDIMSRMTSDTDAIRHLLSWVSYQMLNCV
FT                   VMFVGALAFMTSIDWRLALALACVTPFLFIFTHQFSTKAKPLFLAIRNSLASMNSMVEE
FT                   NIEGNRVVKAFVREDYETGKFDEHNDDYMDRNMAMAMNTRKYLPRLDWLGFALQLITLG
FT                   FGGFLVARGAMSLGGLVAFSSYLWMIDGPVRQFGWLVNDWQRFNASCVNIRRLLTATPH
FT                   VKNTKAAREGTVPDSMRGDIRFDHVDFAFPDDPDTLILHDIDFHAPAGSRLGILGETGA
FT                   GKSTLVNLIARFYDPTSGTVTIDGIDARRWPLKQLRSQVAIVAQDVFLFSDTIEGNIGF
FT                   GASDEQATDSDFVRRMAQIAGADDFIRRMPEGYQTVVGERGVGLSGGQKQRLSLARALA
FT                   DDPAILIMDDTTSAVDMETEAQIQQHLKDLDDRKTIVTIAHRISSVKDCDLILVLDHGR
FT                   IAERGTHDELIARHGLYEHIYEKQLGQQADNLRQ"
FT   gene            515027..517342
FT                   /locus_tag="BIF_02061"
FT   CDS_pept        515027..517342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02061"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84925"
FT                   /db_xref="UniProtKB/TrEMBL:D3R743"
FT                   /protein_id="ADC84925.1"
FT                   /translation="MGQIHTATCPFLREENQFHTGRTRTCSSHRMFPRVRRDRWTCVFV
FT                   PSYTDCITQIVCESDESLLAGSELGLLGVQARLFGLATCLEVGVEPGELLVHGLRRDLR
FT                   EDRRRLDHWRTHDDRLALPRMHVLAKHILAGDHRVGELRIVEIVHLLDVRQRRECTLAT
FT                   QGLPHLLRGMRQERGEQVVGIGDGLGRHMQHGAEALRVVLDLPRLGGRDVFVDVAHQRH
FT                   RVVERALLSMLLDERAHRVEGCGGLRQQGTVLIGHLFLHDRRDLAEVLGDQIRHTVHQI
FT                   APRGGEHLVVLAHELGPREVGVRRLRTCGRDVVAHRIHRVTGENVFDIDHNAARRRELL
FT                   ALHGHELGGHHLLGQVEPAELTRLAALGPLAVVGEHLGRPDLRMERDVVFAHEIVARRG
FT                   RVVPPCAPSLRITGTTRPFNRCGQVADHRIEPHVQAFVRVVDPTRHRHGDAPVDVAGDG
FT                   ARLDLLEQADREVEHVRAPALARLQPCEVRLRQGGEVEEVMLSLLEDGRFAVDLRNWVD
FT                   QLVRIELIAAVVALVAARALRMADRALAFDVAVWQRTAGGRRDRDLLRALVNVAVGQTL
FT                   AEHLLHHVLMVLCGGAGEQIVAQAEVAQIVRDHAVVAVRKFLRGDALLVGLHQNRRTML
FT                   VGAGHHEHIVALHALVSCVDVGRHTEAGDVTNMTGAVRIRPSDVHHNMTHTPDYLHALG
FT                   HFRTVFRPVAASPCADWRSLDYSQSTSHAFTLSTYPHFPRNSWSPPHVLPSMCGMRIRA
FT                   HTQRPTGKGERRERNIRP"
FT   gene            517264..518022
FT                   /locus_tag="BIF_01430"
FT   CDS_pept        517264..518022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84926"
FT                   /db_xref="UniProtKB/TrEMBL:D3R744"
FT                   /protein_id="ADC84926.1"
FT                   /translation="MRYAHPCAYAATYRQGREKRKEHTSVNTTAVQEAVRAGNEVGYMV
FT                   PLDLGPAYADPEPRVPRQPERPHNSHSIIHTKQLPGPLAMQRLLRLDALYELDEFHAVT
FT                   AECAHTLYGRAMLMRDILPNRTTACGRTAAWVWVGGRLPQDYFEVLSSSHYRRLAFGRR
FT                   IKAWQRQVDESQISTLNTLNLTTPLRTACDLAMYPKDDPHARDVQSIIGRLMEHYEFSL
FT                   VDCEPILEECSHLRNLPQAREMLTQFESIA"
FT   gene            518057..518503
FT                   /locus_tag="BIF_01085"
FT   CDS_pept        518057..518503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84927"
FT                   /db_xref="UniProtKB/TrEMBL:D3R745"
FT                   /protein_id="ADC84927.1"
FT                   /translation="MDALPHARAHRPCMPARRAGMPLRAARRRHAASRTASQAPRRRSS
FT                   AKRLASTLHTAHTPNKGLLHPPPPPLALTPQSASDPNTPMDALWHIARTMPPLRKWVVV
FT                   NRAADANLLEYISQQGGPGVRQALELVLESLELQRSSMQRMRTS"
FT   gene            complement(518538..519671)
FT                   /locus_tag="BIF_01084"
FT   CDS_pept        complement(518538..519671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01084"
FT                   /product="Tetrapyrrole (Corrin/Porphyrin) methylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01084"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84928"
FT                   /db_xref="GOA:D3R746"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3R746"
FT                   /protein_id="ADC84928.1"
FT                   /translation="MGVPVERMPICSPYISHARRPRAHTRFHGTRPRGFAPTYAPASPP
FT                   SHRVSPPADLPARHTERMNEQSEHTGIAEDPADETRTLHVDVPRGTVVLAATPIGNTAD
FT                   ASARLVALLERADIVAAEDTRRLYALANRLSVHVGGRVVANHDHNERGKADALLDHVAN
FT                   GETVLVVSDAGMPTINDPGLAIVRRAIERGLPVTCAPGPSAVLDALALSGLPTDRFCYE
FT                   GFLPRKHSERMQALRALKGERRTIVFYETLHRIAESMADLEEVFGPDRRMALCRELTKD
FT                   YEQIRRGTIHEINESVANDPPRGEMVLVIAGASEDEADPAQSLSVEELAELAMQYAQAH
FT                   GMRIKDAIAEVIGKHPNADGTLANRKQVYNAVLALRD"
FT   gene            519643..521256
FT                   /locus_tag="BIF_00930"
FT   CDS_pept        519643..521256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00930"
FT                   /product="decaprenyl-phosphate-mannose--protein
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84929"
FT                   /db_xref="GOA:D3R747"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="UniProtKB/TrEMBL:D3R747"
FT                   /protein_id="ADC84929.1"
FT                   /translation="MGMRSTGTPKHAAAERVELESSELAASSPPSAHARLMTWVWTLVI
FT                   ALFGGLLRFVRLGQPRAVVFDETYYVKDAWTMLNTGEPMSWPDEVSLGGQMVPVDTAFA
FT                   DGDTNAWINTAEYAVHPPLGKWLIAAGLKLFGGAANPAAWRAATAIAGVLGIVLLIRIT
FT                   LRLFRNLPVALLAGLLMAIDGVSIVMSRTGLLDIFIMVFALGAFSLLLIHRDWAAARLR
FT                   MAAQSGANRPPQITFSWWRAGAAVLLGCATGVKWSGIYFFAVFCVISVFWDAWMIRQAG
FT                   FRSPRQWLARGVFGDGLLAALYMVPLYAATYLLTWVGWFVHPNSYMRNWAATHTGQGVQ
FT                   WLPADWRSFVAYHAEMWRFHTTLDAPHDYKANPLTWPLQIRPTSFYWQKLDGHPGLCSL
FT                   SPRSQCVAAVTSLGNPLIWWLGSLCAVLAIVIAILKRGDWRIWAVLAGFLGGWLPWAQY
FT                   LNRTTFTFYSIVLLPWMILAICYVFNWVRETSSREVWLITLWVMVGVCAIVSVFFYPIW
FT                   TAMPVPYEFWRMHMWLPSWI"
FT   gene            521506..521820
FT                   /locus_tag="BIF_00929"
FT   CDS_pept        521506..521820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00929"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00929"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84930"
FT                   /db_xref="UniProtKB/TrEMBL:D3R748"
FT                   /protein_id="ADC84930.1"
FT                   /translation="MRSLRLQSQIGTLAACRIAQFAIAISDWLLCRFLNAWVRPELQTK
FT                   RSGKRRKWHLSSVVCHGRYRRRQTTTPSTGASIVCSLNKQGAGSSPPIPAQRKRCHAVF
FT                   "
FT   gene            521807..522628
FT                   /locus_tag="BIF_00928"
FT   CDS_pept        521807..522628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00928"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00928"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84931"
FT                   /db_xref="GOA:D3R749"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R749"
FT                   /protein_id="ADC84931.1"
FT                   /translation="MQYFETTIIGIDGSGARFAGYLPENYPDIVPDRKRPTVLVLPGGG
FT                   YEMTTGREGEPIALQFLAADYNAFVLHYSCKPSVYPIAVLEVAEAMRQIRAHADEWNVD
FT                   TARIAVIGFSAGGHLAADFATSASDAALVAHGYDPDELRPNALMLSYPVITSGRFRHDG
FT                   SFRALLGERYGEESAMNEVSIEQHIDAKTPPVFVWHTMPDDCVPVENTLQLIAACKAAN
FT                   VPIEAHLYPAGGHGLSLGTAQTAWGGVNSIEPAVQSWIFLAKDWLDRTFAE"
FT   gene            522949..523698
FT                   /locus_tag="BIF_00927"
FT   CDS_pept        522949..523698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00927"
FT                   /product="DedA"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00927"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84932"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D3R750"
FT                   /protein_id="ADC84932.1"
FT                   /translation="MGFIQFIANLLKDPRAAIAGWIAMGVAPTLGFVFLIVFIETGVVF
FT                   FPFLPGDSLLFAAGFFAAPDAATGKSALPLAALLPVVWLAPILGDQCNYFIGHFFGRRI
FT                   IESGKVKAMTPERLAKTEKMIDRWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPF
FT                   SVLGGLVWSSLFTLLGYFFGGIPVVQDNFELVIVAILVISLIPTFVGLIKAKTGKKEAP
FT                   AHAMAEVAEKEATPLVEDLDGNIEHGA"
FT   gene            523872..523947
FT                   /locus_tag="BIF_tRNA09"
FT   tRNA            523872..523947
FT                   /locus_tag="BIF_tRNA09"
FT                   /product="tRNA-Ala"
FT   gene            complement(524014..524757)
FT                   /locus_tag="BIF_00699"
FT   CDS_pept        complement(524014..524757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00699"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00699"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84933"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:D3R751"
FT                   /protein_id="ADC84933.1"
FT                   /translation="MRFHARISPLSEMMLIRAAHSCIFCYSVLMPYDVKREQKNLYVPG
FT                   KTPAIVEVPAMQFVAVRGAGDPNDPHGEYQSALQLLYGISFTIKMSEKSKDSRDHIAGY
FT                   MPYVVPPLEGLWWMGRNASEPVDYARKQDFQWISMIRLPEFVTADAFEHARGLFANKHP
FT                   EADVSRARLFEYDEGLCAQVMHVGPYDTEPATIAALDKFVGEHGYALDFSDARHHHEIY
FT                   LSNPQRCAPDRLRTVIRHPVRMASE"
FT   gene            complement(524758..527214)
FT                   /locus_tag="BIF_01607"
FT   CDS_pept        complement(524758..527214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01607"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01607"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84934"
FT                   /db_xref="GOA:D3R752"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D3R752"
FT                   /protein_id="ADC84934.1"
FT                   /translation="MTVAVLCSVTNMELSSVCAGGYSTVRYMLGYASSANFDEEIVMTS
FT                   RETNTPYLDSSLPIPARVADLLGRMTLEEKVGQMMQLDARSGELSDLIVDRHVGSILHT
FT                   SPDDLVRAARIVRDQTRLGIPLLVGDDCIHGYSFWPGATIFPSQLGMACSWDPQAIEDA
FT                   ARVTAEEVSCTGVHWTFSPVLCIARDTRWGRVDETFGEDPVLIGEMASAMVKGYQKNAA
FT                   AGETFADDAILACAKHFAGYSYTQGGRDASEADLTHRALESWYLPPFERVAKEGCATFM
FT                   LGYESIDGTPVTFNNWLLNRKLRGEWQYGGTLVTDWDNVGRAVWEQHIKPNYTVAAADA
FT                   VKAGNDLIMTTPGFYEGAIAAVSEGLLDERLLDDAVARLLTLKFQLGLFEDPRLPDRAR
FT                   IDAVIGSADHARRNLEMARESIVLLRNNAVLPFADAGELHRIAVVGPLADDAQNQLGDW
FT                   AGNSGQVPWMPEGQPREMICTVLDGVRELAPADCEITYARGANVVDLVPDPEGELYPDG
FT                   QPRPKMAVAAKIDQRLLDEAVEQARAADAVIAVVGDVVQLVGETCSTATLELQGGQNRL
FT                   LEELANVARETHKPLIVVLVSSKPQVLPACVIGENGVIVDESAADGLGALLWAANPGMQ
FT                   GGRAIAEIIFGKTEPSGRLPITFPRHAGQLPVFYNEIRGQHGNRYADLTQDPAFAFGEG
FT                   LSYTTFEYGDPQIVNGSEFRAGDTVRVEVDLTNTGARTGTEVVQLYISDVVTSFTWACK
FT                   ELKLFRRVTLEPGETRRVAFDLPVDSCTIVNGDAERIVEPGEFKVLVGHSSRDENLRQA
FT                   TFTVVE"
FT   gene            complement(527211..527879)
FT                   /locus_tag="BIF_01608"
FT   CDS_pept        complement(527211..527879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01608"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01608"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84935"
FT                   /db_xref="GOA:D3R753"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D3R753"
FT                   /protein_id="ADC84935.1"
FT                   /translation="MCDARKWWRNMAERPETQEKRKVILRAATEVFGEKGATKGTLEDI
FT                   AEKVGMTRAGVLHHFGSKDNLLLQTVIYRDSVDLEDYPEDMARGGMPEDGAITFRHLIK
FT                   TAKANEARPGLVKAFIAFCADSIREDSPAYDYFVSRYRNLRRMLEKALRIMADELGKSV
FT                   DDATICNTAMSILAVMDGLQIQWMLDPDAIGLAEETERAIKLMLAGALDLNDEERDAIL
FT                   "
FT   gene            complement(527918..528043)
FT                   /locus_tag="BIF_02060"
FT   CDS_pept        complement(527918..528043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84936"
FT                   /db_xref="GOA:D3R754"
FT                   /db_xref="UniProtKB/TrEMBL:D3R754"
FT                   /protein_id="ADC84936.1"
FT                   /translation="MVVEVTRCSLNDHMRLLGIFIGWLGGMPALMEIAGIGRRPT"
FT   gene            complement(528105..528833)
FT                   /locus_tag="BIF_01609"
FT   CDS_pept        complement(528105..528833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01609"
FT                   /product="Phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01609"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84937"
FT                   /db_xref="GOA:D3R755"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3R755"
FT                   /protein_id="ADC84937.1"
FT                   /translation="MLGRTRKSANKERRMMLKAVFWDMDGTLIDSEPYWHAGEMQIAHE
FT                   NGGVWNDELAWNGSGRPVPDVAREIAEHGCTLPVEEIGRRMIEYVTRAEYERIPWIPGT
FT                   RELLVALRDAGVPSVLVTTSPRNLAENLIAQAPAGTFAGYVCGEDDVAKKPDPAPYVEA
FT                   ARRLDIPRADMPQCVAFEDSMSGLTSAAASGATTIAQLGFIRTDNSDGPQYMSIDGYDG
FT                   VTPESLNAVVERRIAELAAR"
FT   gene            complement(528896..529459)
FT                   /locus_tag="BIF_01610"
FT   CDS_pept        complement(528896..529459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01610"
FT                   /product="HspR"
FT                   /note="Putative heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84938"
FT                   /db_xref="GOA:D3R756"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D3R756"
FT                   /protein_id="ADC84938.1"
FT                   /translation="MITMTRISPARRRLYEMCATAIVAKRANLEGAAGVGFDIDLPVFS
FT                   VGKVGQIAEIHPQTLRQYDRQGLVVPGRTEGGSRRYCLRDVDRLVQAQHLSQDEGINLN
FT                   GVMRILELEEENRQLRHEVQELTGVTGFSVFTADMNGSITQTSRSHRARYWRGQLHAEV
FT                   HALPAGESSSAQSKSMVLWHTAKH"
FT   gene            complement(529456..530511)
FT                   /locus_tag="BIF_01611"
FT   CDS_pept        complement(529456..530511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01611"
FT                   /product="DnaJ"
FT                   /note="Chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01611"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84939"
FT                   /db_xref="GOA:D3R757"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3R757"
FT                   /protein_id="ADC84939.1"
FT                   /translation="MAENDWLNKDFYKTLGVSKDADEKEITKAYRKLARKYHPDINKTK
FT                   EGEEKFKDISEAYDVLKDKDSRQKYDAIRSFGAGGARFTGGAGGGGFNAGDFSDIFGSM
FT                   FGGGGGNGGSHIRFSTNGGGSHGAGFDDIFSMFGGGAGNGGFGGGRGYGDYSDGAYAGY
FT                   RPAPHPEDGDDLSSKITLTFRQAVKGATVSLKAAGKKFKTKVPAGVKNGQKIKIAGKGK
FT                   PGQHGGKPGDMYLTVTVTEDPKFTMDGKDLVMDLPITVGQAVDGAKISARDFDGNDVTF
FT                   KVEKGTSSGEEVRVRGKGVETRTGTGDLVGRIQIRVPKHPTMGEKHAAKEFDKACGDFV
FT                   EELATENTETK"
FT   gene            complement(530642..531331)
FT                   /locus_tag="BIF_01612"
FT   CDS_pept        complement(530642..531331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01612"
FT                   /product="GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01612"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84940"
FT                   /db_xref="GOA:D3R758"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D3R758"
FT                   /protein_id="ADC84940.1"
FT                   /translation="MSDFNKDDYLNDLPDADELANGQASPDADGADAPSDTGEQLKDDM
FT                   LKDAAAEQSAGEQASEESAKAAAEATADAASDGDAEGSSLTPLGQAKKEAAEYLEALQR
FT                   ERAEFINYRNRTKKDMDRARQQGIIDVLTAMLPGLDDIDRIREHGEMDDSFKAVAAKID
FT                   KTFEKFGVEKFGLKGEDFDPTKHEAILHKPDPEASKATVDTVVEAGYRIGDRVIRAARV
FT                   VVASPQN"
FT   gene            complement(531331..533220)
FT                   /locus_tag="BIF_01614"
FT   CDS_pept        complement(531331..533220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01614"
FT                   /product="DnaK"
FT                   /note="Chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01614"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84941"
FT                   /db_xref="GOA:D3R759"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D3R759"
FT                   /protein_id="ADC84941.1"
FT                   /translation="MNNKRRYSMGRAVGIDLGTTNSCIATLEGGEPTVIVNAEGARTTP
FT                   SVVAFSKSGEILVGEVAKRQAVTNVDRTISSVKRHMGTDWTVDIDGKEWTPQEISAQIL
FT                   MKLKRDAEAYLGEPVTDAVITCPAYFNDAQRQATKDAGTIAGLNVLRIINEPTAAALAY
FT                   GLEKSKEDERILVFDLGGGTFDVSLLEIGKDDDGFSTIQVQATSGDNHLGGDDWDQRII
FT                   DWLVGEVKNKYGVDLSKDKIALQRLKEAAEQAKKELSSSMSTTINMQYLAMTPDGTPVH
FT                   LDETLTRAHFEEMTKDLLDRCRTPFNNVLADAGISVSQIDHVILVGGSTRMPAVKELVK
FT                   ELDGGKEANQSVNPDEVVAIGAAVQSGVIKGDRKDVLLIDVTPLSLGIETKGGIMTKLI
FT                   ERNTAIPAKRSEIFSTAEDNQPSVLIQVYQGEREFARDNKPLGTFELTGIAPAPRGVPQ
FT                   IEVTFDIDANGIVHVSAKDKGTGKEQSMTITGGSALPKEEIDQMIKDAEAHEADDKKRK
FT                   EDAETRNNAENFAYQTEKLVNDNKDKLSDDVAKSVTDAINELKDALKGDDIEKIKAAQE
FT                   KLMTEAQKIGQALYAQQGAEGAAGAADSGSANNGGDDDVVDAEVVDDDDKDNK"
FT   gene            complement(533949..534974)
FT                   /locus_tag="BIF_01615"
FT   CDS_pept        complement(533949..534974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01615"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01615"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84942"
FT                   /db_xref="GOA:D3R760"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R760"
FT                   /protein_id="ADC84942.1"
FT                   /translation="MHKAGIRDVAREAGVSISTVSRAFTKPQLVSQATRDRVMAAANKL
FT                   DFNISRSAMALKSGQTYRVALLMSEGITSWFNAEVFAGIDDVMHGKGYDISLYQHINDA
FT                   ETRDRFFTVLPVLRNVDAVFVASFAIEPAEIEQLRRTKVPIVGINTPDPLRFDASETID
FT                   DEGGMYRAAQHMIKLGHKRIVYTCSAAAETLDASIDLRGHGFIRACERAQNTHDISWKV
FT                   LTVPRGRDFADNALTAVLSEDRFPDAICCQMDMMAIPLMIKLARHGYRAPRDYSIIGFD
FT                   DAPYADTVELTTMRQNPYEMGRNAAMKALTLLEGRALEQPHAILEPKLVLRGSDSRYEG
FT                   E"
FT   gene            complement(535014..535787)
FT                   /locus_tag="BIF_01931"
FT   CDS_pept        complement(535014..535787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01931"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01931"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84943"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:D3R761"
FT                   /protein_id="ADC84943.1"
FT                   /translation="MVDEYTRHLERNKEVKGKGLSQFRMKVLADVLLFFSPFSVAVLPH
FT                   IVGTPSRENMFALSVCVIGEAISWASIPMFAWLLYQGFEWTGNAWLYGLRLLVLALVCE
FT                   VPYDYVVFGSAFDMRSQNPVFGLVVALIVLGILDLMYAWRTSVLKVVLSAGVIIIGLLW
FT                   DFMLSIGQTQRLMNVGIVTLGMCVTYYYLHSRENTMVFTAAIFGAACVLTPGLGAVALH
FT                   YRNDKLGYTHRWTRWAFYPVYPIMLVLCAAIGMAN"
FT   gene            complement(535803..536606)
FT                   /locus_tag="BIF_01616"
FT   CDS_pept        complement(535803..536606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01616"
FT                   /product="[phosphocarrier protein HPr]-phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01616"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84944"
FT                   /db_xref="GOA:D3R762"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3R762"
FT                   /protein_id="ADC84944.1"
FT                   /translation="MNADGGGMTHYTTVFFDLYGTLIDIHTEEDSDAAWSALRAALYQN
FT                   GADYATNSQLRNEFRRQVVRANATRARTEWFEPDFLPAYRGLLEACWADDSLVHARKAA
FT                   WAFRRAATTKFRLYPGVFDMLTQLRAAGLRVALVSNAQACYTRPELELTGLGDVFDEVV
FT                   ISSDEGVRKPSAELFRSALVRMNVEPKHVVMVGNDPRNDIDGARMANIDGIYLHTDNHT
FT                   PAQCDTAVCSLEGADYAGVLAYIQRANTEDGRGREYSDTLEEKLR"
FT   gene            complement(536596..538695)
FT                   /locus_tag="BIF_01617"
FT   CDS_pept        complement(536596..538695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01617"
FT                   /product="Pullulanase"
FT                   /EC_number="3.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01617"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84945"
FT                   /db_xref="GOA:D3R763"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R763"
FT                   /protein_id="ADC84945.1"
FT                   /translation="MALARQSEGLKAGVAEPFPLSLERELGAVANDHGTQFAIWAPSAK
FT                   SVTLRFFTKGSSMEDGDAMVGAHRPELQSDGAWTIHFDGNLHGTYYDYLVEQQDGNRVR
FT                   TADPWAKGAGVNGRRSMVVDLARTDPAGWEHDTHPITPLRETMVAEMHVASFSANPHGG
FT                   FPLEHRGKYLAFTDLGTTVDGKGEFPTGVDYFKQLGVTAIQLLPFYDYGSVDENDPRQY
FT                   NWGYDPLNYNVPEGSYSTNPFDGTVRITECKQMIQSLHAQGFKVIMDVVYNHMYTADNW
FT                   FERVVSGYFVRRNADGTLSNGSGCGDDMASERAMMRRYIVDSVTYWAREYHIDGFRFDL
FT                   MGLIDTDTMNAVRASLDALPGGKDLIMYGEPWAAGPSSTLPGTELANKEGLHLLDSRIG
FT                   HFCDRTRDAIKGHVFERRIKGYVNGNAHDTKPQIELAVDAWRAPETNEGNAGQIIQYVS
FT                   AHDDWTLWDKLCLSMIGDDSPESANKAESGHADDSHRTLESRDDALEHAYRAMPGTQTR
FT                   KVLEANALAAGLIYTAAGIPFMLAGEEFGKTKFGNDNSFDSGVKVNELDWARAERMQGL
FT                   VDYYRRLIAVRRANPGLFDAEHIAVEAPGNAVAYRSDDIAVLVNPDDEEYSLPVERIDS
FT                   AFADSLHDDLPATPESASHAEARWVCVLDSSGTSTGEFRQTGIRIAGGGFPMPARTLSI
FT                   WKRER"
FT   gene            complement(538700..539668)
FT                   /locus_tag="BIF_01618"
FT   CDS_pept        complement(538700..539668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01618"
FT                   /product="MalG"
FT                   /note="Maltose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01618"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84946"
FT                   /db_xref="GOA:D3R764"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R764"
FT                   /protein_id="ADC84946.1"
FT                   /translation="MSNATKAQTKASEAYVEAIDKRVDSELAESHNAQRQSFWKDQKSR
FT                   RILGDVLTYVLLTVLGIIWLLPIVWIFLESLNKNTAPFTDTFFPTQYSFDSYVTLFTQR
FT                   NVLDFPRMFMNTFIIAVFTCIISVFFVLSVAYVMSRMRFHGRRFFMNFVLILGMFPGIM
FT                   SVVAIYFILKAMGLTSSGTTILALILVYSAGTGAGFYVMKGYMDTIPTSLDEAAMLDGC
FT                   TRWQVFWIIIVPICRPMIVYQAIVGFLTPWLDFVMAKVIARTQENYTASLGLWLMLDKE
FT                   YINNWFGRFAAAAVLISIPIAILFIVMQRFYQESMSGSVKG"
FT   gene            complement(539665..541083)
FT                   /locus_tag="BIF_01619"
FT   CDS_pept        complement(539665..541083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01619"
FT                   /product="MalC"
FT                   /note="Maltodextrin transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01619"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84947"
FT                   /db_xref="GOA:D3R765"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R765"
FT                   /protein_id="ADC84947.1"
FT                   /translation="MKGMSSSVVTLSKREMKRRQKLGADYVAPSPYTLSAALKDGDVFT
FT                   KLSIIFFGLGNFARHQIAKGVIFLAGEIGFIVFMIYAGAHNLAMLPSLGWRQASTEWVG
FT                   AKLVHTAGDNSVLILLYGVCTLVLCAVFVLWWDLAIRSAYKAQCLAGKNGHAPSLLDDI
FT                   HTLLNEKANILFLALPTLGILIFTVLPLIFMISMAFTSYDHNHLVLFDWVGFENFKTVF
FT                   SNSGSIVSARLFMSVLGWTLIWAFFATFLNFFCGLFLAMVINRKTTHGKGFWRAVFSMS
FT                   IAVPQFVSLLVMHQMLQPQGAINRILMNWGWIDNPMPFFTDATWARVTVIVINLWVGIP
FT                   YTIMQVTGILQNIPADQYEAAEIDGANWWQIFTKITMPYIIFVLTPYLITTFTGNVNNF
FT                   NVIYLLTRGDPAVVGDSAGKTDLLITWLYKLTVDNNDYNLGAVIGIMTFVVLAVVSLIT
FT                   YRSSGSYKNEEAFR"
FT   gene            complement(541358..542698)
FT                   /locus_tag="BIF_01620"
FT   CDS_pept        complement(541358..542698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01620"
FT                   /product="Maltose/maltodextrin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84948"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3R766"
FT                   /protein_id="ADC84948.1"
FT                   /translation="MKQFQGDSPNVMPRKCTVLHCKERKRSMKIEWKKAVGLAAAVAMI
FT                   VPMAACGANGGDSNAADGSKPSETQSANLTVWGPSEDSEWLKDMEEAFGKAHPEYKVTW
FT                   KNSVVAEGDAAKTVKTDPTAAADVYMFANDQLGDLLDQNAIAPVNDVVAQQVKEQNSQT
FT                   MVDSVTGTDGKIYGVPYTSNTYFMYYNKDKFSADDVKSLDTMLEKGKVAYPLSNSWYIP
FT                   AFYLGAGMTMFGPKGTDAKAGIDFGPNADAVSEALVKLVANPNFTNDDGTLGLAGLKNG
FT                   TLDAYFSGSWDAANVQKALGDKYGAATVPTFKAGDKDYQMKALAGSKAIGMNPNTKAPE
FT                   VASAFAAFLGSTEAQKKHWEMRQIIPSDKTLTNLEGMSTSPYVQAQLDTIAKTSVAQPT
FT                   ISAMSAWWTPAETFGKALVSKQVNDGNVKQKTADFMASVKKDVANKQ"
FT   gene            542887..544539
FT                   /locus_tag="BIF_01621"
FT   CDS_pept        542887..544539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01621"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01621"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84949"
FT                   /db_xref="GOA:D3R767"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R767"
FT                   /protein_id="ADC84949.1"
FT                   /translation="MSSSHQVPQWLDQATFYEIYPQSFADSNADGIGDIPGIIEHLDYL
FT                   LQLGCNAIWLNPLYESPFRDAGYDISDYKKVAARYGTNDDLAALFAAAHARGMHVLLDL
FT                   VPGHTSNEHPWFRQSATDSPNLYDDRYIWTGNWIEGGDGLPFIGGEEARDGAYIVNFFA
FT                   FQPALNYGFAHPRKGWQAPALGDEALRTCDAMLDVMRFWLDMGADGFRVDMADSLVKGD
FT                   DEGKPYTIRTWQYMLGQIRGEYPEAAFVSEWGRPDEAFEAGFDMDFYLDWRWDGVANGY
FT                   SMLLRDTDTPMLRDGDHSYFNADSGTSIVPFLGEYEPRLEAARKAHAYFDLITCNHDTM
FT                   RLVPRLTTRELALAYSTIFLMPGVPFIYYGDEIGMRYRNLPGKEGGYTRTGSRTPMQWD
FT                   NSANHGFSQAAADALYLPVDEREDAPTVAAAVADGNSLWHHMHAALEQRRSTPAFAPDA
FT                   DFSVLFAEEGRRPFVFKRAKDGVSAIVAVNPGRDGETVTLPDDDGSETRTITLNIGGAV
FT                   LDGTTLTLPPQSFAVLQWPSRYSRRAPQRWMKT"
FT   gene            544616..544753
FT                   /locus_tag="BIF_02059"
FT   CDS_pept        544616..544753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02059"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84950"
FT                   /db_xref="UniProtKB/TrEMBL:D3R768"
FT                   /protein_id="ADC84950.1"
FT                   /translation="MVWTRHRAPQRYAATHGAAGESAHARANCRPSRRVQSANVGVKNT
FT                   "
FT   gene            544898..547120
FT                   /locus_tag="BIF_00869"
FT   CDS_pept        544898..547120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00869"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00869"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84951"
FT                   /db_xref="GOA:D3R769"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R769"
FT                   /protein_id="ADC84951.1"
FT                   /translation="MTHIRRNDMSQINSAPPRREESPERLARPLIQLAKGCGVATCYID
FT                   QLGTYVEIRDAVLISVLGALGVDASTPELVDINLNARRNEAHERLVAPTVVKFLGTPAS
FT                   TPLHTKHGEPHIGLTLEDGSDATDALSLTFREHDGDVDVYDLAIGDNLEIGYHTLHVRD
FT                   GETGSERDVDVTLLCAPASIPVPEALASHKRWGWMTQMYSVRSPESWGVGDYGDLRELL
FT                   VDAAGSGADFMLINPVHASAPVSPIEPSPYSPMSRRFINTTYIRPQDIAEFAELDEQDA
FT                   AAVRALHEQVAPMNTESSPMDLDAAWKAKRAALQIIFRQPRSPERQASFEAFKEKAGAD
FT                   LDTWALWSVAFEVLGEPWEPDSWFRMTAKSNPRIQALRTEHPDLYEFACWLQWIAEEQL
FT                   DAAQRAARDAGMSLGLMQDMAVGVHSYGADAWGNPERFAVGSVTVGCPPDFYNQQGQDW
FT                   GQPPLNPNYLELTGYRMYREMVHHMFEHAGAIRIDHILGLFRLWWIPAGQGAKGGAYVT
FT                   YNYDAMIAVLSIEATRVNGIVIGEDLGTVPDFVRNVLARHGLLGTTVEWFARVDDSPNA
FT                   GDPYAMPQTYRTYSLSSVTTHDLPPTAGYLMLEQVKLREELGLLTEPVEEFRESALAER
FT                   QAMLDLLVQGGWMSQEAADDVPDNLQTIVEAMHAMLTDAPSLLLQAALVDGVGEARAQN
FT                   QPGTSTQYPNWRIPLADEHLKVVPTQEVFKSPRVQALAKIMNRINQ"
FT   gene            complement(547592..548224)
FT                   /locus_tag="BIF_00870"
FT   CDS_pept        complement(547592..548224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84952"
FT                   /db_xref="GOA:D3R770"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D3R770"
FT                   /protein_id="ADC84952.1"
FT                   /translation="MCPAPTKATQMKFLSPDSRFMQGWNDLTDAIWINMLMLVTSLPVV
FT                   TAGAALCAGSTALRKSQRGQGTVTRNYFAAFRENLAKATLLWLIFGICGAAIAYSWIVL
FT                   QITPLLIPKFALTIIWAIGFEWAFYLQARFENPLGQTLRNAYVFGVVYFPATLACVAID
FT                   VVFVGLLVAAWFYMPQGLFLLVVLGYGCMLALHVPILEYALRRYTRQ"
FT   gene            complement(548513..549352)
FT                   /locus_tag="BIF_00747"
FT   CDS_pept        complement(548513..549352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00747"
FT                   /product="MsmG"
FT                   /note="Multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00747"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84953"
FT                   /db_xref="GOA:D3R771"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R771"
FT                   /protein_id="ADC84953.1"
FT                   /translation="MMQEKPKHGALWTIFFSMISIAWVFPIFLVLLNSFKGKAYISRNA
FT                   FAFPVGDTFVGLENYKRGIESTNFFASFGWTVLITVGSVCLILVCTSMCAWWIVRVNNW
FT                   AAKLLYTLFLFNMIVPFQMVMFTLSKLADMLKLNTPWGLCFIYLGFGAGLAVFIFTGVV
FT                   KGIPQSLEESAMIDGASVPRIFFQVVVPIMKPSIVSVAILEAMWVWNDYLLPYLTLDLG
FT                   KYKTISVAVQYLKGGYGSVDMGAMMACLVLAIIPIIVFYLICQKYIVKGVMAGAVKG"
FT   gene            complement(549349..550272)
FT                   /locus_tag="BIF_00746"
FT   CDS_pept        complement(549349..550272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00746"
FT                   /product="Sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00746"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84954"
FT                   /db_xref="GOA:D3R772"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R772"
FT                   /protein_id="ADC84954.1"
FT                   /translation="MNRDMALPHSGVGRTRRGESRHAMISMAGKAIRRWWALFVLPTFV
FT                   AFFIGFLVPFIYGIYLSFCSFTTVTDAKFIGWQNYARAIKDKEFLHALGFSTLMTIVTT
FT                   IVINVVAFAIAYLLTKSIRGSNLFRSVFFMPNLIGGIILGYIWMLLLNGVLAHWERSLT
FT                   YSAKYGFWGLVILVCWQQIGYMMIIYIAGMQSLPTDVLEAAEVDGANGRQVMFRIIIPL
FT                   MMPSITVCSFLTVTNGFKLYDQNLALTNGAPQNMSEGLALNITRTFYGRIGWEGVGQAK
FT                   AVLFFILVAIVALIQNKITTSKEVDA"
FT   gene            550456..551676
FT                   /locus_tag="BIF_00745"
FT   CDS_pept        550456..551676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00745"
FT                   /product="Transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84955"
FT                   /db_xref="GOA:D3R773"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R773"
FT                   /protein_id="ADC84955.1"
FT                   /translation="MRKMSKQILDHAAGATDARPCATARRINCQPCGCNMFAIRYAHAA
FT                   ATGAIVCCIESSEARQPASRTRRAEVNASIQDVAKAAHVSISTVSRSFTRPELVSAATR
FT                   EKVLRIAEELNFSTSRSAAALKTGRAMRVALLMSDHIRLWFSASVIEGLNSVLHAEGYD
FT                   ISIFQISSIEERRDFFEMLPVRRNADAVIVASFDADETEIAQLASANVPIIGINSVMPR
FT                   ELGFTAAVNIDDTQGSILAARHLINLGHRDIAYVRTNRDVSLHFSVQQRFDSFMECCAG
FT                   SGISPTVIVAQEGPDRIRRVLTDLMSLERMPTAIACQEDGIAVPLIFQLERSGYEVPND
FT                   ISVIGYDNSFYANDIGLTTIAQDPIEMAKMAAEMTVKLIEGEKPEHLFRTIPAELVVRS
FT                   STAKHVA"
FT   gene            551895..553412
FT                   /locus_tag="BIF_02058"
FT   CDS_pept        551895..553412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02058"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84956"
FT                   /db_xref="UniProtKB/TrEMBL:D3R774"
FT                   /protein_id="ADC84956.1"
FT                   /translation="MSIYTKSIYTPNRGGPPLASYSAWVPRGRSGRGIHAPIQRSLVGV
FT                   GVVVLGLPVVDEGLPHVIPAAGALRVGEHGLAELVLPLLRRHHREVPGDLLLAGFGVLD
FT                   GLLDERVVALHLVEGLERRGEAHVFRQRLDALIGGDDPVQEVLRGLLVGFGGLRIDAQA
FT                   VLGTGGGQALVLLALGTDVDREHTHLIGLHAGLLQVGPCPGAVLVERGLAECELGVRVV
FT                   TGLRAQLRRGGGGILEVQVEDVLEVRQVGALDRLRLRGHTVLLELIGERDVRQVGLETP
FT                   VGAGVEACGGEGALDAELVLLGLHVVRDFLELVEGVDLLGVLDLGARQLGVLLEQVLVV
FT                   DDAVVLHDVRNAHDLVAVLQRAVLVVELVVDAGVLEVGGVALPVLVVHLAVDLEDRRRI
FT                   ALGELGLERLLIGARGGRLHLHLHAGLVGVFLGERDPLVGGLRLEVQEVDLALAVVRAA
FT                   SATRGQAGQRHCGDRHETHCCFHCAIHLRTFPHPTSATHRSGTEVFS"
FT   gene            553570..555483
FT                   /locus_tag="BIF_00496"
FT   CDS_pept        553570..555483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00496"
FT                   /product="Trehalose-6-phosphate hydrolase"
FT                   /EC_number="3.2.1.93"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84957"
FT                   /db_xref="GOA:D3R775"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:D3R775"
FT                   /protein_id="ADC84957.1"
FT                   /translation="MQAFAHDLQTWAFRTALRLQTTRRGDRANGITMVPEFVSKNKKRA
FT                   SMTANNMHDDWWKQAVVYQVYPRSFRDANGDGLGDIAGITEQVPYLKHLGVDAIWLSPF
FT                   YPSELADGGYDVIDYRNVDPRLGTLEDFDELVTALHAHGMKIVVDIVPNHTSNMHEWFQ
FT                   AALTAEPGSPERDRYIFREGRGEHGELPPNDWQSLFGGPAWQRVADGQWYLHIFTVEQP
FT                   DLNWKNPEVHEDFKKTLRFWSDRGVDGFRIDVAHGLAKDLDSKPLAEMDADCVFDTDNR
FT                   NGNNPLWDRAEVHDIYREWNAVFNEYRPARFAVGEAWVIPEHQHLYAREGELGQVFNFE
FT                   FAKANWNAAAFKVAIEDGIRSAHDAESTTTWVMSNHDVVRHASRYGLPQVPTTGYHELP
FT                   NDWLLRDGTTYIEDRDLGARRARAAILMELGLPGSVYVYQGEELGLPEVANIPWNHLED
FT                   PIAFHTDHAGAQKGRDGCRVPLPWRADDEPRPADWDPLFGTGASFGFSDAPADGSAPAD
FT                   PHLPQPLWYKQYAADKQMADDTSMFNLYRQAMQFRQEHLTPSDDTDDITWLPGTDFNAH
FT                   NAEVVAYTRPCTGEGDGTFACIVNFGPDPIDLPAGTVVLSSEPLDEPHKLSADTAVWML
FT                   LP"
FT   gene            complement(555765..556433)
FT                   /locus_tag="BIF_01682"
FT   CDS_pept        complement(555765..556433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01682"
FT                   /product="Phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01682"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84958"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D3R776"
FT                   /protein_id="ADC84958.1"
FT                   /translation="MESAGKLVLLRHGQTVWSQSGQYTGRTNIPLTPVGREQAAAAGER
FT                   LRATFPNGFTPSNIYTSDLARAMETAELAGFAEHNVTADLEEWDYGRAEGRTREQLNAA
FT                   AGYEWNVWRDGPHSLDETLSGTRVEVFEDGSEITVVNGEGEALEDAAARTRTVIEQVLP
FT                   ALLAGENVLLVAHAHILRILTSQWLDLAPDFGRKLHLDTAHYSVLGIYKGDHVIYSWNS
FT                   "
FT   gene            556368..557012
FT                   /locus_tag="BIF_01683"
FT   CDS_pept        556368..557012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01683"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01683"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84959"
FT                   /db_xref="GOA:D3R777"
FT                   /db_xref="InterPro:IPR025329"
FT                   /db_xref="UniProtKB/TrEMBL:D3R777"
FT                   /protein_id="ADC84959.1"
FT                   /translation="MAGLAPHRLSMAEQYQFACRFHDGTVFSLGNKLVHHFTVFPGRTR
FT                   AHARISRARTARACSTLVHMARKLKTAPDLSMATAKPVQSAHTRDTNEKLANLDNTTKE
FT                   TVQRIDKVNNKITDLREQRMRDPDTLGDKAFKLAFPALIGMVAGKAFQSVWNLVTNKVH
FT                   PSPNDDEADRKQGLLMSVLFAAASAAFSTVVTTYSDKLTQSIVGRLQRKRK"
FT   gene            557112..557888
FT                   /locus_tag="BIF_01684"
FT   CDS_pept        557112..557888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01684"
FT                   /product="Chromate reductase"
FT                   /EC_number="1.-.-.-"
FT                   /EC_number="1.5.1.-"
FT                   /note="NADPH-dependent FMN reductase; Oxygen-insensitive
FT                   NADPH nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01684"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84960"
FT                   /db_xref="GOA:D3R778"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D3R778"
FT                   /protein_id="ADC84960.1"
FT                   /translation="MAKIIHNDTVDVLLERVSIRAFKDEAIGLDVLNTIEQAAQNTASS
FT                   QYLNDWSAIRIKDPAVKTEIARICNQDYIANAPVLYIFVLDQYRNSLIAQSEGVAVDSD
FT                   EFTLKNSYRFSQAQNDAVLALHAMETAAESFELGTVILGSILGNIPELVKLLALPKYTY
FT                   PVLGLALGKPDQHPDPKPRLPRDIQFFDDSYNAEPNRILDGIREYDREVQAYYDTRGKD
FT                   LSERAYSDMTTKKATSTAALEMGFEHARAQGFDLEK"
FT   gene            complement(558214..558465)
FT                   /locus_tag="BIF_01685"
FT   CDS_pept        complement(558214..558465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01685"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84961"
FT                   /db_xref="UniProtKB/TrEMBL:D3R779"
FT                   /protein_id="ADC84961.1"
FT                   /translation="MHYFTPKRCETTTKIMYHDRQTAWQAAEQSRIERGVELWVYQCQY
FT                   CGQWHLTHRDPALAQAVGHFKRSQKPYSRKKGFKPRRR"
FT   gene            complement(558511..559101)
FT                   /locus_tag="BIF_01686"
FT   CDS_pept        complement(558511..559101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01686"
FT                   /product="Multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01686"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84962"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R780"
FT                   /protein_id="ADC84962.1"
FT                   /translation="MVNSQPMPAHALSLGQFPTVISRNLNLSIIATGIMAFVGILTETM
FT                   TNVLLPVLMGLFTVSTATVQWLTTGYLLMVAVVISVSSYCNRRFTNRATFIIAMVLCIA
FT                   ALAAIAPTLHADSNAVFNTLQQLGGVVGTTVMALCLSIVQFGHGEVGSRDYMEATKQGG
FT                   EWALIVVSVFVFVAILANLRAFLNERRQNVRMR"
FT   gene            559072..559248
FT                   /locus_tag="BIF_02056"
FT   CDS_pept        559072..559248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02056"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84963"
FT                   /db_xref="UniProtKB/TrEMBL:D3R781"
FT                   /protein_id="ADC84963.1"
FT                   /translation="MGRHWLAVDHCFEIAWITWTREDSRYWFAQIPPECVCSWEWDRSR
FT                   SNFLGLEGDFKPA"
FT   gene            complement(559434..559551)
FT                   /locus_tag="BIF_5SrRNA07"
FT   rRNA            complement(559434..559551)
FT                   /locus_tag="BIF_5SrRNA07"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(559666..562722)
FT                   /locus_tag="BIF_23SrRNA08"
FT   rRNA            complement(559666..562722)
FT                   /locus_tag="BIF_23SrRNA08"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(563211..564442)
FT                   /locus_tag="BIF_16SrRNA09"
FT   rRNA            complement(563211..564442)
FT                   /locus_tag="BIF_16SrRNA09"
FT                   /product="16S ribosomal RNA"
FT   gene            565153..565356
FT                   /locus_tag="BIF_01312"
FT   CDS_pept        565153..565356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01312"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84964"
FT                   /db_xref="UniProtKB/TrEMBL:D3R782"
FT                   /protein_id="ADC84964.1"
FT                   /translation="MSKTQHPRPESPIHAAGRNTLPSPSQASRPAQLTTPSTSDFTIFA
FT                   PDSRPTSRTRDYAEPQCIICDS"
FT   gene            565335..565910
FT                   /locus_tag="BIF_02055"
FT   CDS_pept        565335..565910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02055"
FT                   /product="Glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84965"
FT                   /db_xref="GOA:D3R783"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D3R783"
FT                   /protein_id="ADC84965.1"
FT                   /translation="MHNLRFIEREGIRMIMNNGFVPVATASPNTRVADPMANAELCCDA
FT                   IVRAANAGAKVVALPEVVLTSYIADDMLCHDIVLGAAEETLAHLVAETAKLDVVFSVGL
FT                   PLCVNGKIYNTLAICHAGEIMGVVPKTYIPTYGVDFEGRWFSSGPADVTYITVAGQEHV
FT                   PFGSHQVFRCCQMPQLCLGYEICEDIWA"
FT   gene            565828..567279
FT                   /locus_tag="BIF_01313"
FT   CDS_pept        565828..567279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01313"
FT                   /product="Glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01313"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84966"
FT                   /db_xref="GOA:D3R784"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="InterPro:IPR041856"
FT                   /db_xref="UniProtKB/TrEMBL:D3R784"
FT                   /protein_id="ADC84966.1"
FT                   /translation="MARIRCSAAARCRSYAWDMRFARTSGPDPPSIHLALAGAMIICNG
FT                   PASNASLEKDLYRRSLISGQSARLLCCYAYCSSGQGDSTGDVTVGGQEIIAENGSILAQ
FT                   SEPFGDGFAVADVDVESLWGARRGMSSFHVEPTPQYADYHETMFDMTIPDHPLMRPVSK
FT                   QPFIPADEKMRADCCSLAVTMQAHGLAARVGAQNADHLVIDTTNSSVTNTALAVLAVAR
FT                   FYDLERPAVPDMYVAISQDAQNGQSANVKLIEQLADALGLPLATLASARAEQQNAAQSS
FT                   PEHPVLDIQELIGDTSWLIVNPSDMTQLALGLTQFPFDLGRQYGINSQIAHTFVPVIPR
FT                   QYAQECADGNLQTLLGAICDPDNELHIPEHDTVSMSESAELGPAVVEDFYLDGFLRAQY
FT                   RPAKTFALARQAFAGEYGEHELPGWMKAFYERFFGSQFLRHSLPDGPRIGSAGLDLRDG
FT                   FMMPTYAQSTLWMNEVDALLNAATK"
FT   gene            complement(567443..567751)
FT                   /locus_tag="BIF_02196"
FT   CDS_pept        complement(567443..567751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02196"
FT                   /product="DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02196"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84967"
FT                   /db_xref="GOA:D3R785"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D3R785"
FT                   /protein_id="ADC84967.1"
FT                   /translation="MSLILSYVGQGVVMNMTSVTVRVDEDTKKQASDIAEDFGFDLSSV
FT                   TRAFYRQIVRERRIPLNLSYSNVPEETLEALAEARRMAKEGAPRFQDADAMFDSLGI"
FT   gene            complement(568135..568252)
FT                   /locus_tag="BIF_5SrRNA10"
FT   rRNA            complement(568135..568252)
FT                   /locus_tag="BIF_5SrRNA10"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(568367..571423)
FT                   /locus_tag="BIF_23SrRNA11"
FT   rRNA            complement(568367..571423)
FT                   /locus_tag="BIF_23SrRNA11"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(571912..573143)
FT                   /locus_tag="BIF_16SrRNA12"
FT   rRNA            complement(571912..573143)
FT                   /locus_tag="BIF_16SrRNA12"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(574053..575498)
FT                   /locus_tag="BIF_01549"
FT   CDS_pept        complement(574053..575498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01549"
FT                   /product="Isoprimeverose-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01549"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84968"
FT                   /db_xref="GOA:D3R786"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D3R786"
FT                   /protein_id="ADC84968.1"
FT                   /translation="MSDTVSNNASPATEVTKEAGRVKLPFKEMVSYSFTDMAGNLLYVT
FT                   LSSYIMYFYTDVFGISASGALGAATILLVARFADAISAVVWGSIVDHTRTKWGQCRPWF
FT                   LWLAVPFAVTVFIAFTAPSLPNETSKFWYALVTYVLAAGAVYTGIQTPITAILPNLTSD
FT                   PVERNNANSFRMLGGNIGSFITSAFTIPLVGFFGTMLGGGDRSGFMAVTALYGVIAIVL
FT                   LVLAFRNLRERNYHPEVQKPIPFKDSLRAAKGNWPWVILVTAFVIYWIAQSTRNGMAVY
FT                   YAKYNLGNENLTSLFNGVQVIGIVGTIAMPILANKLKNKTLTMIIGLAIGAIGQLLMPL
FT                   AGSNVPLALTFWTIGVIGAAIACGMPFGMLADTVDYGEWKTGIHAAGFLTAVGSAFCIQ
FT                   VGSGFGAFLPLQIMNANGYVANAQQSQQALNAISFCFIWLPVIVYAIVAAIMCFYRKYE
FT                   KMEPMIKEEIAVRRAREVEEVAE"
FT   gene            complement(575687..577750)
FT                   /locus_tag="BIF_01548"
FT   CDS_pept        complement(575687..577750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01548"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01548"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84969"
FT                   /db_xref="GOA:D3R787"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:D3R787"
FT                   /protein_id="ADC84969.1"
FT                   /translation="MRVTARQRGAELLRKGMAMANVTITSPFWNRYRESVAREVIPYQW
FT                   QIINDERRIEIPVDPAGNDDGEVNDGLSREWSHAVRNLRVAAGDVDAPFNGMVFQDSDV
FT                   YKWLEEAAYALAYQPDAQLQALCDEVVDLIARAQQPDGYLDTPFQIKSGGYARRRRFSQ
FT                   IQQSHEMYVMGHYIEAGVAYWQVTGNEQALQIACRMADCLDANFGDEDGKIPGADGHPE
FT                   IELALARLYEATNESRYLRLARYFIDVRGKDPDFYDEQNKAVHAEGLPAIFPAMETWSH
FT                   EYTLTARPIRDQQTAVGHAVRVAYLLAGVMQVGRLTNDEGLLRTGERLWNNIVHKRMYI
FT                   TGGIGSTHVGEAFTYDYDLPNDTMYGESCASVGMCFVARQMLEHELRGEYADVLEKELF
FT                   NGAIAGIALDGKHFFYVNPLEADVQATENNPDRRHVLLERAQWFGCACCPSNIARLIAS
FT                   VDRYLYTVREDERMIAAHQFIANDARFFDDVRVKQESDFPREGVVRFTVDVPEGADPVI
FT                   FKVRIPSWSPEYRLTVDGVDVTGEMPVHDGFVSVEVADRTVVELELDMSVKYMRANTAI
FT                   RHDAGRLAVMRGPVVYCAESCDNRAPLWDYRIGDSAGEDIACAAGTGVLEGLQTVSVPA
FT                   LRTPDDASDAPLYMPADHGARQADHTRLEMIPYHAWANRGASQMQVWFTALC"
FT   gene            577837..578886
FT                   /locus_tag="BIF_01547"
FT   CDS_pept        577837..578886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01547"
FT                   /product="Transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01547"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84970"
FT                   /db_xref="GOA:D3R788"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R788"
FT                   /protein_id="ADC84970.1"
FT                   /translation="MAKKVTLHDIAIAANVADSTASKALTGTGRISAETRRRVRDIAAQ
FT                   FGYARPATKTRTGNGRTGLIGIVTPDRNGRFALPLLAGAERALGAHNHAALLMISQGVP
FT                   ALERSHINQLSAQGVDGLIIAGNTCNARHPIDPRIQNGLPTVYAYDPSDDPADCSLICD
FT                   NEGAGRQAAEYLLGIGRRRIAIVGGLDFFQATIDRERGALDTLRMAGAAPLLVINDRWS
FT                   EDWGERAAQLLLERDEMPDAVYCLNDEIARGMCRTLQMHGHRVPQDIAVIGHDNWDSVC
FT                   VNVHPTLTSFDNELETMGRRAARHLLDAINGRPHHGVFQVESRLVIRESTDATRHDPLH
FT                   GSGWRAGLE"
FT   gene            578957..579712
FT                   /locus_tag="BIF_01546"
FT   CDS_pept        578957..579712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01546"
FT                   /product="SIR2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01546"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84971"
FT                   /db_xref="GOA:D3R789"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D3R789"
FT                   /protein_id="ADC84971.1"
FT                   /translation="MTKQIVVLTGAGISTSAGIPDFRGPDGVWTKHPDQMQVYDIDAFL
FT                   TDKEAREYSWRWQKESPVWNAKPGKAHYALVDLEKAGMLSLIATQNFDALHEKAGNSPS
FT                   KIVNLHGTIGTSHCMKCHAKYDTADIMARLDEEPDPHCHHQLPYRGNMPCNGLLKTDVV
FT                   YFGEALPEGAMERSIRAAQQADELWVVGSTLEVFPAASIVPAAAQAGVPITIMNMGRTQ
FT                   YDSLATRLIHEDIAVALPELVQRTIADNR"
FT   gene            complement(579870..581144)
FT                   /locus_tag="BIF_01598"
FT   CDS_pept        complement(579870..581144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01598"
FT                   /product="Threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01598"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84972"
FT                   /db_xref="GOA:D3R790"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3R790"
FT                   /protein_id="ADC84972.1"
FT                   /translation="MAPMEQKDVLQAMRRDHAAELKMAAERLEGTAKHTQIIASPVLSE
FT                   MTGHTILLKPENLQVTGSFKIRGAYNKIASLTDEELERGIVTASAGNHAQGVAYAAHER
FT                   GAKATILMPEITPPLKVDATKAYGADVVLHGDVFDEAAAYAIELSQREGMIYVPPFDDY
FT                   EVLCGQGTIAMEILEDVPGVTDIVVPLGGGGLGAGVALAVKMFRPEVRVIGAIPEGSPA
FT                   FRRSFDAGHVVPADKVVTSAEGVAVRRPGDLTFALLNEFLDDLVEVSERDINEMILLML
FT                   EKHKMVVEAAGAVSLAALEHLNLRSRKFAEAPGEHVVVPIMSGGNIDTVTIGAVIQKGM
FT                   IARGRIMNFEVELPDTPGQLVKVATILAKARANVIALDHDQFKANGHYTNSVALGVTVE
FT                   TNGPDHIEQVMQMLRDAGYSPKRIY"
FT   gene            complement(581295..583157)
FT                   /locus_tag="BIF_01597"
FT   CDS_pept        complement(581295..583157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01597"
FT                   /product="Oligo-1,6-glucosidase"
FT                   /EC_number="3.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01597"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84973"
FT                   /db_xref="GOA:D3R791"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R791"
FT                   /protein_id="ADC84973.1"
FT                   /translation="MLFKGKGASMTTMNRPVLPDSVRTNGATPNPWWANAVVYQIYPRS
FT                   FQDSNGDGIGDLKGITSRLDYIADLGVDVIWLSPVYQSPQDDNGYDISDYEAIDPIFGT
FT                   MDDMDELLAEAHKRGIKVIMDLVVNHTSDEHAWFQESRDPNSSKADWYWWRPAKPGMEP
FT                   GAPGAEPNEWGSYFGGSAWQYDAKRGEYFLHQYSKKQPDLNWENPQVRKAVYAMMNWWM
FT                   DKGIDGFRMDVITQISKVVDKNGRLPGEAGSEIDDYPAGPEGYSSPYPFSSDGPRIDEF
FT                   LQEMRREVFEKRGGYMNVGEAPGVDAARNEYITDPDHKELDMLFLFDHVGIDQGDSKWD
FT                   IVKFDVRHLREQLKAQQEAVHDRGWASLFTCNHDQPRVVTRWGDDSNEENRVHSAKAFG
FT                   MLIHLHRGTPYIYQGEELGMTGAHFTELSQYRDLESINAYRQRVEEAKVQSGESMMDSL
FT                   ALFGRDNARTPMQWDGSKYAGFTAADAKTEPWLSVNPNHVEINAAAQFDDPDSVYAFYK
FT                   KLVNLRHNSAVVSAGEWALVDDDDEQVYAFTRTLTNADGTAERMLVAINLTGRHAALPK
FT                   PVADLLADGVSEDRIILSTYDAIHSAKSLANGELAGWEGVVVEL"
FT   gene            complement(583209..583493)
FT                   /locus_tag="BIF_02051"
FT   CDS_pept        complement(583209..583493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02051"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84974"
FT                   /db_xref="UniProtKB/TrEMBL:D3R792"
FT                   /protein_id="ADC84974.1"
FT                   /translation="MAWFSEVSLRRTAKTSFAGMVLGAFRKIHHLQTPPRHGLRMLPHD
FT                   RPQRGSSMAFLAETSVKYAAQTPYMVDFAKIPVHVTAELLSHTPVRILR"
FT   gene            583895..584887
FT                   /locus_tag="BIF_01596"
FT   CDS_pept        583895..584887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01596"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01596"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84975"
FT                   /db_xref="UniProtKB/TrEMBL:D3R793"
FT                   /protein_id="ADC84975.1"
FT                   /translation="MHDIRHSPTVESMKIDSQIERLLDESQNAHRCAVTTDVNLRRKLR
FT                   RRCESGELTMPYPQLFARKETWDALNPREKKRHVILALAMVRPDWIFCAQSAACLYGIE
FT                   QSYQIHDNPMIHIASTHESGIYRARRSDAVIHRVYTPNPQYNVINGAKVTTLPCTIYQC
FT                   ALVLPFEQILPLADSAVRSGMALDDLRQFPVHSATEALAIGNVLEYTDPRSENGGETLA
FT                   RSRFIERGLMIPQLQKEFPNPQNPEYPFRVDFIWILPNGRMIVAEYDGMTKYGNDRKTI
FT                   ANHVHREKLRDEALRQHGVTAIIHFDYEDLLNPNELIARLVAAGVPYRR"
FT   gene            complement(585328..587220)
FT                   /locus_tag="BIF_01595"
FT   CDS_pept        complement(585328..587220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01595"
FT                   /product="Glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01595"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84976"
FT                   /db_xref="GOA:D3R794"
FT                   /db_xref="InterPro:IPR008811"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R794"
FT                   /protein_id="ADC84976.1"
FT                   /translation="MITVRSVVAHTECGPFDEHGEVELPPDSVSEHRIPWRTLRSATVT
FT                   EISAQLPESNPILERPTLLAGRSVSVRLQLGRSKPVGPILCLYQHKEWWMRPAWVERFC
FT                   DIPERTQLVLWKSAKAWHVMIPVFCHGMRVDIRGDGRGDNDLLLDVSTNQVGHVQLQGP
FT                   LLVHRQSDRKVEDPYELIRGCAEWVMLQNGGLGRLWKQTLPESLRGFGWCTWDSLGTNV
FT                   SEQAIIAKMEEFAAKHVPVSWVLIDDGWSQVENGKLTGFDADTTRFPQGLSHTIDVLKH
FT                   DFGVRYVGVWQAFQGYWRGVDVDALAGKPESDDDWREYYKQGYSDGDARVEDPKLLVSR
FT                   SAFETLPNGMAIPTANPECAALFWRTWNTHLDAAGIDFVKVDSQGTLPVLTRGLESYAS
FT                   LGVRHDAVEYATNWIRHEDDNGDWEYAHLAVIHCMGMTPENYWQRCAEGVARTSDDFFP
FT                   NIPESLAEHAIENAYCSLLIGCLCYCDWDMFWTRHPHARTHMLLRWISGGPIYCSDKLG
FT                   ETDSAPLAPLFDADGNLTHPDGVGVPVLDSLLADPVHGDVPLGIRNTFRGDEVLLFVGL
FT                   NADAPQTAHIRATESPLTVFDPQTGERVHLSVGEDLALTLHYGECELRILQTLT"
FT   gene            587426..587611
FT                   /locus_tag="BIF_02052"
FT   CDS_pept        587426..587611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02052"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84977"
FT                   /db_xref="UniProtKB/TrEMBL:D3R795"
FT                   /protein_id="ADC84977.1"
FT                   /translation="MQLQSHAGNLICNWVSLLQIWAQIGSWIADYLAVFANAVSSWATM
FT                   TRLPGPSETAAAGQAI"
FT   gene            587624..587773
FT                   /locus_tag="BIF_02053"
FT   CDS_pept        587624..587773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02053"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84978"
FT                   /db_xref="UniProtKB/TrEMBL:D3R796"
FT                   /protein_id="ADC84978.1"
FT                   /translation="MPFSQTRLWQGAREPLAVPYLQTQSQFADFNMQIQPQILALPDAH
FT                   LQSA"
FT   gene            complement(588173..589078)
FT                   /locus_tag="BIF_01594"
FT   CDS_pept        complement(588173..589078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01594"
FT                   /product="Raffinose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01594"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84979"
FT                   /db_xref="GOA:D3R797"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R797"
FT                   /protein_id="ADC84979.1"
FT                   /translation="MTTATANTMSQQSAQQSATMNTAPAKAEKFRKDRRINWWLTAVVA
FT                   VFSLTILVPLYFTVVTALKTPAEAGTFSLPTSWQWGNFAAASAKVDYPRAALNSAIITV
FT                   LAVSLTLVTNTFVAYAIARNMDKRFFRFLYYFFIAAMFVPFPVVMLPLAKQMGSWHLDN
FT                   QAGLIVLYVILGLGTNLFIATGFIRSIPVSLEEAARIDGAGTWRIFWKIIFPLMGPINA
FT                   TIAIMTALWAWNDFLLPLIILTDQSNQTIPLAQYVFSSQFATNYPQAFASYLMAMAPVL
FT                   VVYIFAQKWVVGGVMRGAVK"
FT   gene            complement(589083..590075)
FT                   /locus_tag="BIF_01593"
FT   CDS_pept        complement(589083..590075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01593"
FT                   /product="Raffinose transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01593"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84980"
FT                   /db_xref="GOA:D3R798"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3R798"
FT                   /protein_id="ADC84980.1"
FT                   /translation="MTSLANADQQARAMEDVLANDIDTHHSRTPAGKPPRKRRVSAFSR
FT                   RKVDHAYYWMAVPAAVIFAVFLYVPFVRGIMYSFTNSQGYGSCNWIGFQNYFALFRDER
FT                   VGHAYLFTFLIAIAITVLINVIALFLSVALNGKIACKNGFRAIYFIPYTLAVLVIGYVF
FT                   KYIFMQPLPELGKALGIGWLSESLLTSERYAWIPIVFLAVWQGVAYSVLIYLAGLQTVD
FT                   SEVYEAAAIDGVNAWQKFWKITFPLIGPFFTINLVLTMKNALGTFDQVVALTDGGPNSK
FT                   TETVTYLIWKGGLTGGEYAYQTANAVLFFIVLAIIAFIQLKFFGSKEKV"
FT   gene            complement(590109..591428)
FT                   /locus_tag="BIF_01592"
FT   CDS_pept        complement(590109..591428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01592"
FT                   /product="Raffinose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01592"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84981"
FT                   /db_xref="GOA:D3R799"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D3R799"
FT                   /protein_id="ADC84981.1"
FT                   /translation="MEMDKGVRMKFATRMRRSAMRRMLRGIGAAVCALAVGVGAAGCGN
FT                   SAGSGQVTLDFFQFKAEAADWFKQAAQEFEKENPDIRININNSANAQTDLRTRFVKDRV
FT                   PDVITFNGDYSFGTFAASGVFHDFTDDPLVSELNEGMVNIAKNLVQTSDPAKKRLYGLP
FT                   FAGNASGYIYNKDLFRKVGLDPDNPPQTWDEFIAMLKKFRDAGINPVQATLADAWTTQA
FT                   PLASLAGTLVPESEYAALKSGDTTFKQIWTEPIEKEIELFKYADSEKGVTYQQGTQNFA
FT                   KGTAAIIPLGTYAIPQITMVNKDIDLGFAQMPATNDASKQILTAGDDVILTMGANSRHK
FT                   EQSMRFIRFLMSKKQLENYADAQSAITPLKETYFGNKALEPVRPFFESNRVADFCDHYI
FT                   PSSINIGGYLQSAIMSGNVNQFIDSMQNEWNKVQARDFRK"
FT   gene            591532..592761
FT                   /locus_tag="BIF_00628"
FT   CDS_pept        591532..592761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00628"
FT                   /product="Xylose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84982"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A0"
FT                   /protein_id="ADC84982.1"
FT                   /translation="MAYIYILMETNSDSLDFPRWFSRSDATHNVARGIMQYGPIARTPL
FT                   AQIFNLSQGALSRITSDLIYDGVIEEMPAGSTQAGRLPQGFDLRESSERRGRPQTALRI
FT                   REDSHAFVGVNIHDGAITVSEVNTMCRPIGSDITETVSNTAPQAVVEQITRMVRELVAA
FT                   SPDAPAPTALGLSLGGHVEDDRYVTFAPFLYWDSSVDLGGMLQRDTGIPTKVFNDLDSV
FT                   LLHECWFGDAIGVPRFAVITMGAGVGYSISDHGDPIDNPDKSYGLAGHVLIDPEGPRCS
FT                   SGHIGCSQCLTSDSIAEEYSGIMGRVTTFEEFSHDLRANRPQARRLAERTCYRLGVLVA
FT                   TVSNLAMPSRVLVSGESSFIAKKNREFIRKGIDAYRHSQAAPVEFSIPRFSWRLWSDSA
FT                   AARAIATYIS"
FT   gene            complement(592786..595008)
FT                   /locus_tag="BIF_00525"
FT   CDS_pept        complement(592786..595008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00525"
FT                   /product="Alpha-galactosidase"
FT                   /EC_number="3.2.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84983"
FT                   /db_xref="GOA:D3R7A1"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="InterPro:IPR031705"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A1"
FT                   /protein_id="ADC84983.1"
FT                   /translation="MTRISEFNATTHAGEALHVVSMENHDADSAFALAFVADELPRVVH
FT                   WGRPLTQPRTLVSAVDALRPQRVSGALDETTWPSVLPTQAEAWTGEPRFVVRRDGVELF
FT                   CRFVVTDIAVGDAGVAVTASDAEQGVEIIWTCEMRDSGLVRQRADVRNLGAGSLEIGKV
FT                   ELGFPVPADMTELLTTTGHHLRERSPQRQPLTIGRFQKASMVGRPDFDASLLLNAGRPG
FT                   FGFTHGDVYAVHVAWSGNSLMAAERLPYTTGVIGGAEVLAGGEITLHDAADSYTTPWLY
FT                   GSFGEGLNEVAARFHADLRATHARWRAEHGIADKPRPVILNTWEAVYFEHDYDTLVRLA
FT                   DKAAASGVERFVVDDGWFGDRRGDTAGLGDWRISQDVWPDGEHSLKALADYVHAKGMEF
FT                   GLWFEPEMVNPDSAMYREHSDWVLMPTAHRLPMQGRNQQVVDLTNPQAYAYVYGCMDSL
FT                   VGELGIDYIKWDHNKYVTEAVSPRTGSCAVHGQTLAVYRMFHDLKTSHPGLEIESCSSG
FT                   GGRVDMGILELADRIWASDCVDPVERADIQRYTSLLVPPEMIGEHVGASPAHSTHRATS
FT                   QEMRMAMAFFGHLGIEWNLLKEPQHDLDLLGEWVHAYKEHRVDFEHGVAVHDDAADPTV
FT                   RVDGVISADGARAVYRFTQLTTSQTYPAAPIALPGLDAQATYRVRPLALNMASGEPFGE
FT                   IGNGQSELGWWNANGVEMTGEALASYGLRPPSIHPANAVLFSVTRV"
FT   gene            complement(595124..595738)
FT                   /locus_tag="BIF_01481"
FT   CDS_pept        complement(595124..595738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01481"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01481"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84984"
FT                   /db_xref="GOA:D3R7A2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A2"
FT                   /protein_id="ADC84984.1"
FT                   /translation="MADLLICCLVSVCCISRAVVCERSKARCRTVEALGMRAGGRWHAY
FT                   KGRGGIAMTQYAEAMGEALAQARMARSAGDVPVGAVVLDAHGEVIGRGRNLRERDADPL
FT                   AHAEIVAMREAAAVRGNWNLADCTLVVTLEPCPMCAGACLQTRIGRIVFGGWDAKLGAC
FT                   GSVWDIPRDPHVGHEPEVYGGVCERECTALLAEFFHSRRHA"
FT   gene            595744..597855
FT                   /locus_tag="BIF_01482"
FT   CDS_pept        595744..597855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01482"
FT                   /product="NhaP"
FT                   /note="Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01482"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84985"
FT                   /db_xref="GOA:D3R7A3"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A3"
FT                   /protein_id="ADC84985.1"
FT                   /translation="MPAADPAHTERKPVSVLILILCILGAVLLSSFLSRFLPRISTPLV
FT                   QIVLGLIASQMPFFPDVQLDPELFLVLFIAPLLYLEAHEINKSQLLKSLKLSLSLAIGL
FT                   AIFTMVVVGFSLHTLWPMFPLAAALALGAALGPTDAVAVSSLSHEATLTQRQIGVLKGE
FT                   SLFNDASGIVGFQFAIAAAVTGQFRVGEAAWEFLITFFGGAVFGCIVGVLANWVFESSR
FT                   QLGWETTTTRILMELFLPFLLYLGAEAVHVSGILSVVAAGLVIRFDRTGIGPNVARTNI
FT                   VASSVWSVLSFSLNGAVFILLGMLLPGAMRASWDNPMVSNYTLLAVILCVSTLIVGLRF
FT                   LWVSGMLRLARAQDSHKRRRMTPERWRSAAVMTFGGAKGTITLSLMFTIPYTIADGEWF
FT                   PMRDELIFIAGGVIIVTLLLSNFLLPVIAPNKAKDVPRETTEASIEVLRRTVEELAELT
FT                   TDENRSAVMVVINSYTQRIGRLKNQLGTIDPSARIELQIDALNWEKEYVKRKLAEFRLD
FT                   PTLSEREREVNVEACERLLDQIMDTLRHTNTKHDSSHVVWQVKGRAHLAQRRLVLLSRR
FT                   AANTIRRSTPLVNENEIYASLRNLELGAFDHVIDRLYEEMSSNTYGTEYVSSLLMDYRR
FT                   AEAALKSRPNMANSASLVTQIEDVKRESFGIELSVIQNMVEAGDITRAQARQLRKNVYV
FT                   MSVAADSNF"
FT   gene            complement(597926..598873)
FT                   /locus_tag="BIF_01483"
FT   CDS_pept        complement(597926..598873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01483"
FT                   /product="COBF protein"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01483"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84986"
FT                   /db_xref="GOA:D3R7A4"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A4"
FT                   /protein_id="ADC84986.1"
FT                   /translation="MRRMSTADDTPNPDDPFEPSDDPEHLDDLSRELDDLVDFANLERE
FT                   MTEAANTTPSGPYAGQSAGERKRMEPPVGRVASVVPGHFGDRLTVTEALASRGGGNAQP
FT                   NRPLFVCLHGWGSNEDDLAGIMRYVAPYSDFVSLRAPLVLQEASPRGFAMQQGAYSWFH
FT                   DAVPVGDDLDYDAYAAACAIDDWVTTNVGENRDVVPIGFSQGGTLAVELLRVHPQRYRA
FT                   AISLSGFVAPGNVPATTPYDDILADLNIPVFYGYGELDTVLPKYMIYETIAWLEEHTWL
FT                   TARGYRGLDHAVSMEEFSDLRQWLLDQDIASGII"
FT   gene            complement(598907..600466)
FT                   /locus_tag="BIF_00942"
FT   CDS_pept        complement(598907..600466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00942"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00942"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84987"
FT                   /db_xref="GOA:D3R7A5"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A5"
FT                   /protein_id="ADC84987.1"
FT                   /translation="MTDSGNPSDLQFPVSPEPRDFDVTHVVDKDALEFPSMDDDPSHAA
FT                   AHESQLQSAGSANTAAIPAPPVNGHPHDHARRTARSGAHDATPTPDETPADSAALTLAA
FT                   SQPSAGRHAANTVNGASAGDAAPTQLFTSPHDDVLAGVSVNPPLPAEEPTRVVSSEWEQ
FT                   IVDSQTSVMPPAAPAAMPPAIPPTDADGNADGSGDEPDEEAPHHSANGGGKSHTKLIAG
FT                   IVVGVLVIALIAGGIAWWSSSRRNNAQRNAYTLCQNTRDSYDDAHTALAAALKDANALT
FT                   STPTDQVADAKTLDTLKSAVADAEKLDQQSVAECAVDANTAAIEKTTDSLRNTANEITK
FT                   AKSALDAATKAVNDSKNMQSQSAARDELTKAIDDAQKILDASANAVTDEQVRTDLENRI
FT                   ADARKLADGQNLNAEDVTAMVKTLTDAGTAVQQSQTEYANQQAATAQQAAEEAQRQAEA
FT                   QAQAAQQAQQNAAQAQQQNAQTTTPDTSDAGTAGDGTTGAGATGTDGETTGNGGTPANG
FT                   AQ"
FT   gene            complement(600516..601286)
FT                   /locus_tag="BIF_00943"
FT   CDS_pept        complement(600516..601286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00943"
FT                   /product="Deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00943"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84988"
FT                   /db_xref="GOA:D3R7A6"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A6"
FT                   /protein_id="ADC84988.1"
FT                   /translation="MPARRGRPLPFPGPGVRSWRFMPPVNSLGITTLGRICACEGHGSV
FT                   CMRPTCAGTLIVLCKEKLMLLSDRDIRAAHAEGHISLDPWTDEMVQPASIDVRLDRFFR
FT                   LFNNHAYTYVDPAENQGELTEQFEVGPDEPWILHPGEFALGSTWEYVKIDETLAARLEG
FT                   KSSLGRLGILTHSTAGFIDPGFEGHITLELSNVSTLPVKLWPGMKIGQMCFFQLSSPSE
FT                   HPYGSETTGSHYQGQRGPTPSRSYQNFYRAQITD"
FT   gene            complement(601308..604298)
FT                   /locus_tag="BIF_00250"
FT   CDS_pept        complement(601308..604298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00250"
FT                   /product="Calcium-transporting ATPase"
FT                   /EC_number="3.6.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84989"
FT                   /db_xref="GOA:D3R7A7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A7"
FT                   /protein_id="ADC84989.1"
FT                   /translation="MDDRIIDPSALNREPHVEPADAEESKEVKAQEALLHDVDPSLASA
FT                   DEVAEALNVDTHTGLSSEEAKRRLEKFGANELASAPPVPKWKKFLQQFQDPLVYLLLAA
FT                   TAISLVAWIIEKVNAAPGAEGGEALPFDAIVIVLILIVNAVLGYVQEAKADEAVNALSE
FT                   MTAPTSNVLRNGRVERIATTDIVPGDVLVLGEGDTVPADGRLFAAASLRIAEASLTGES
FT                   VPVGKKPETLEKAKALGDRSNMVFNGTSVTQGTGRAIVTGTGMNTQVGKIADLLQSTED
FT                   DTTPLQKEMNHVSKILGIAVCIIAVVVLVALAVLEGFHSVHDVIDSLLLAVSLAVAAVP
FT                   EGLATILTVVLALGVQRMAAHHAIVKKLHSVETLGSASVICSDKTGTLTRNEMTVERVV
FT                   VPSGEVELTGTGYAPEGDMVSLNGDAVPENIAQEVYATLGAGTLANDGELREGPKPGTW
FT                   EIVGDPTEVSLVVAARKTHADKRFHHFTRVAEIPFTSERKRMSVITKNDTDSGKLTVFA
FT                   KGAPDVLLSYCDRIFVNGAVRKLTEGDRQDILKKVEELSREAYRTLGEAYRPLETASLS
FT                   EVPGIRTNAAGDVSDISEQADVIEHQLVWTGMVGIIDPPRVEVRDAVAEAHRAGVRTVM
FT                   ITGDHPLTAARIASDLGIIEQGGKALTGDELDSMDEKQLDKATSEVSVYARVAPEHKLK
FT                   IVESLQRQGNIAAMTGDGVNDAPAVKAADIGVAMGITGTEVTKQSAKMILADDNFSTIV
FT                   AAVREGRGIFDNIRKFLRYLLSSNVGEVFTVFLGVVLAGFLGIKNPDSVGVTVPLLATQ
FT                   LLWINLLTDAAPALAMGVDPTTEDVMNRKPRKLTDRVIDGAMWGDIVYIGLIMAIVTLI
FT                   GMDMHLSGGVFTDRSVDALGHDAQMVEARTMGFTILVFAQLFNAIASRSHLQSAFKGLF
FT                   SNKWLWGAIALSIVLQLLVIYVPWLNTAFGTTPLPPMAWLECIGLAAIVLVASEIRKIF
FT                   LRMRATH"
FT   gene            complement(604280..604492)
FT                   /locus_tag="BIF_02054"
FT   CDS_pept        complement(604280..604492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02054"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84990"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A8"
FT                   /protein_id="ADC84990.1"
FT                   /translation="MRDKAYAHNRAARRVPALQTVQQQLQSVQYCADCVCRLCRCCEQR
FT                   QLQARQSMVDYSAADRGDYLWMIAS"
FT   gene            604613..605608
FT                   /locus_tag="BIF_01240"
FT   CDS_pept        604613..605608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01240"
FT                   /product="23S rRNA Gm2251 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84991"
FT                   /db_xref="GOA:D3R7A9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7A9"
FT                   /protein_id="ADC84991.1"
FT                   /translation="MATKKGPTKGSGGKHRNSLRGKGPTPKAEDRVYHKAYKAKKQAEK
FT                   RQRSDPRLAARRRAAHFTSNSDDLVIGRNSVLEALRVGVPASVLYVANRIEHDDRTREI
FT                   VRLAGQHGLNLLEADRLEMDRIARSGNHQGVILKADPFQYSSLHELVERAERKARAMEM
FT                   ADSKASRLSARPLFIALDGITDPQNLGAVIRSAAAFGVNGVILPERRSASVNAAAWKVS
FT                   AGAAAHMPIARVVNLTKAIEALKERGYYSIGLDGGGSKLVGETGFETDPLVVVLGSEGK
FT                   GLSRLTREACDAIASIPITSAVESLNASVAAGIALYATVNARRKAGEAAN"
FT   gene            complement(605757..607205)
FT                   /locus_tag="BIF_01046"
FT   CDS_pept        complement(605757..607205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01046"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01046"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84992"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025111"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B0"
FT                   /protein_id="ADC84992.1"
FT                   /translation="MGITDNPQLDPRALKATSVKAEDPATPGPGPSTLKITAASSDPKM
FT                   FTLPWEKPLATWPPELLVNLPRGISRHIVRFVHVGDEVYAMKEITRTVAEREYELLRQL
FT                   QKLNLPTVQPIAVVTGRHDDNGEPLEAILVTKHLRFSMPYRALFARTLRPDTAERLIDA
FT                   LAVLMVRLHLAGFYWGDVSLSNVLFLKDADAFSAFLVDAETGDLQIELTAGQREYDIDL
FT                   ARTNIIGELMDLSSGELLPPDVDEISIGNRLVDRYHSLWSALTDTDNFSPNEMWKIEKR
FT                   VNRLNELGFDVDELEMKTAEDGKRVLVRPRVVDAGYANRRLLRLTGLDVQENQARRLLN
FT                   DLDAYRASSWREGEDLEIVATDWMREVFEPTVRMIPREYRSQIEPAQFFHEVLDHRWYM
FT                   AEKAGHDVPMAEAVQSYIKNVLPQYQLDTKTVNELNADADAGVVDDEYTYDDASNNGAH
FT                   TAPAAGHDDGYNPEDDPDAAVWAH"
FT   gene            607182..607340
FT                   /locus_tag="BIF_02197"
FT   CDS_pept        607182..607340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02197"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84993"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B1"
FT                   /protein_id="ADC84993.1"
FT                   /translation="MRIIGYSHALPILVPYSAVFRFQIPRLPAFRTGHPNNLQKEENAP
FT                   EYAKARV"
FT   gene            complement(607411..608544)
FT                   /locus_tag="BIF_01681"
FT   CDS_pept        complement(607411..608544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01681"
FT                   /product="Sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01681"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84994"
FT                   /db_xref="GOA:D3R7B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B2"
FT                   /protein_id="ADC84994.1"
FT                   /translation="MAEVIFDHVTRIYPGNDKPSVDDLNLDIKDGEFLVLVGPSGCGKS
FT                   TTLRMLAGLEEVNKGRILIGGKDVTTMQPKDRDIAMVFQNYALYPHMTVADNMGFALKI
FT                   AGTPKDEIRKRVEKAAEILDLTEFLDRKPKALSGGQRQRVAMGRAIVREPKVFLMDEPL
FT                   SNLDAKLRVQTRTQIAALQRQLGVTTLYVTHDQTEALTMGDRIAVIKLGILQQVGAPTE
FT                   LYDRPANVFVAGFIGSPSMNINTHPVVNGKAQIGADTMELPKEALDKLTPEDKNEIIVG
FT                   FRPEDASLAAPDEANAFSLKVVNVEDLGSDGYIYGNIITDDSVAQKTTDTLMSDQNQLT
FT                   TIRVNPRVLPKVGDVVKIKVNPAKMHLFSPSTELRLN"
FT   gene            608821..609990
FT                   /locus_tag="BIF_01680"
FT   CDS_pept        608821..609990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01680"
FT                   /product="Potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84995"
FT                   /db_xref="GOA:D3R7B3"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B3"
FT                   /protein_id="ADC84995.1"
FT                   /translation="MRHASMPTERAHWRPCHARNRSSESGFADCLDLGAHVTRGIDIDN
FT                   RIGTMTARKSARRPGLTLHTWQHYTNAPMFVLSAFFLFAYSWQILAGTHTRLCNLVINL
FT                   VWVLYSIDYAISLYLAPNRWSWFKSNLILLITMILPMFQPLRLLRFVPMLHMFNRSAGT
FT                   ASRGRISLYAVAVVAMLIYVGALAEYSVEHKAPGATITSFPLSIWWAFVTVTTVGYGDV
FT                   YPVTTLGRFIAIILMITGIAVIGIVSAMISSWVIDQVNVRPHPVIPAPAVGEDGGASPS
FT                   ANASTHDAGGCPDEDYTTGDEDIIDAPDPLNGSSLGPSLNPAQSRIVQAELLRLTDSVN
FT                   RLHNEIEQLRRAEHRHMQASGQTARKLRWHANRNGHMPPHDSPEGDKPA"
FT   gene            610021..612177
FT                   /locus_tag="BIF_01679"
FT   CDS_pept        610021..612177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01679"
FT                   /product="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01679"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84996"
FT                   /db_xref="GOA:D3R7B4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B4"
FT                   /protein_id="ADC84996.1"
FT                   /translation="MFASRVRSLYDRRMTDVYALQLQPGDVVGGYTLESRLGSGAMGSV
FT                   WRAVDGGGNAYAMKILRASLSDSDDGNPDSPEYRAQMVARERLRREAVAMRKIRNSGVC
FT                   QIVDMEIDDSLAFLVTELIEGENLREDVRHNGKYVGDDLERLSSKLIDAVHAVHEAGIV
FT                   HRDIKPTNVMISVTGPVLVDFGIAMTPGESHVTSTGLVMGTPGFIAPEVIEGAESTAAS
FT                   DWWSLASVLAFAATGEPVFGTSPMMAVLQREASGHANLAGLPPHTLEAFRAALDPDPAQ
FT                   RCTPQELLEAIRTDAWTSDGEAMLPFDLRRIGRRETDAPGVSGSVLSTHERVENPRTLW
FT                   HRQSLPTEAMPVNASTGTVPLPPMAQASHAANDNGDIVTPSFNDAESTGGTRVLPQQSF
FT                   PRKWDSEHTATMPRPQPTTPLAATPPLEAATQSMRPMQSATGFQPVGPEANNAGASPNL
FT                   DQPQYDAPNGAYAPQAPALPSDYGPVATAYQNTVRMHRTRGILPVLLATLPLMALAAAC
FT                   PMGAGIAASMLIWVELTLGMNLNTHVAHVLRRNGQEGSGSKVLRVAQLPWHAFAALFMS
FT                   LWSLLLFWAIYVALMLAAIYLVRLPGAYYTLPPEPPWSRLDSVLLLAGSPTGINGLWLA
FT                   ISAAIAWAVTQFGPYSANLRAGAGVIVGLSPKQRLALRPDGNHRNIRRFIVLGIWVIML
FT                   ALTIFNLEATPSIDWWPILPWSGF"
FT   gene            complement(612290..613444)
FT                   /locus_tag="BIF_02146"
FT   CDS_pept        complement(612290..613444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02146"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84997"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B5"
FT                   /protein_id="ADC84997.1"
FT                   /translation="MACDLAAVHIPVVAVDRHRRGAHRTLELSGAVEQLGTGGGVGVHG
FT                   IEPLVVAALHRLALHILGDAGAIHADLNLVVGHLFVPGTLFGLEVLGVEVRDEVEQMIR
FT                   VVIVLGHVDCRIGGAARVIVDIVRIAVDPRVTVHEAHDVQIDVDLARIHHLHEVLVEVA
FT                   VEIAAAGAHEVHVDSHGGHALHRLVIAVLRHEQASELAGLRRLHLGVLERGLRCGLLVR
FT                   RLLLPGGTRVRVAIDGDAGDGDECDEHHGDHDADDRLCSAFLLQSLALGLYACLLLLPA
FT                   LSPAFPFRLLRICGHARPFLTLSSLWQRPCFGNRVQLRHSGEGELGSRLVRASRYGGFT
FT                   DALREARLPDMRCSWEEKLGPRIFFPVRCLFAGRKYAGSIFLRR"
FT   gene            613808..613884
FT                   /locus_tag="BIF_tRNA10"
FT   tRNA            613808..613884
FT                   /locus_tag="BIF_tRNA10"
FT                   /product="tRNA-Thr"
FT   gene            614220..615809
FT                   /locus_tag="BIF_01677"
FT   CDS_pept        614220..615809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01677"
FT                   /product="Rpf protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01677"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84998"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B6"
FT                   /protein_id="ADC84998.1"
FT                   /translation="MQGLCCNGKRERGTMARRWTPQRMMRLRTIRIASSMVTIVALLLG
FT                   FFVCTRKTVALEVNGKTTTVTTFATTIPGFLREQHVKLKTHDLVRSSTPGQLTDNSTVT
FT                   VQSAYQTTISIDGQQMPFWTVADSAEQLIAFFEQNEVAANRITVDIKNVYNQLTGGLVI
FT                   NADGPVTVIADGKTFIAPNGKLPAASILDSKGITLGKNDRVSVSKDGSQTILRVERVTT
FT                   KEITETEDVPFSTQTIVDDSLEPGATEVRQEGRNGQNQLRYRVTYVDGKEDSRELLDTT
FT                   PLSTPIDRIIAIGPEPVKETPQKEDNSGASNDEGQSADQSAGNSAGTNDKQSATENNTG
FT                   DAAEPSAESSPTPSAQPSQQPGAKPSEQPTSKPTQSAQPTQKPSEQPTQQPSAQPTQQP
FT                   KPTPTPTQKPTQQPEQPTPSNCRLCKPSPSAAQAYAAGAAAQYGWTGKNWEDLVKLWNR
FT                   ESSWLWYAENKSSGAYGIPQSLPGSKMAQFGENWKEDAAVQIDWGLNYIATHPKYGSPS
FT                   KAWAHSEKYGWY"
FT   gene            615849..616844
FT                   /locus_tag="BIF_01676"
FT   CDS_pept        615849..616844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01676"
FT                   /product="Dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01676"
FT                   /db_xref="EnsemblGenomes-Tr:ADC84999"
FT                   /db_xref="GOA:D3R7B7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B7"
FT                   /protein_id="ADC84999.1"
FT                   /translation="MVRPRMQQMRTPTLGIEHLTDRITQRSHKDSGASMGTAQADGGNL
FT                   LGAADIRRIAAEEGITPTKKFGQNFVIDPGTVRKIVREAGVDAGDQVMEVGPGLGSLTL
FT                   AILETGADLTAVEIDPPLAQRLPQTIAEFMPNATNRFRVVNMDALKVTPSQLPQLADAA
FT                   TFTLVANLPYNVATPILLTLLERFGNLDSFLVMVQKEVAERLSAQPGSKVYGTPSVKLA
FT                   WYGTAKSVGNIGRNVFWPAPNVDSALVRFERHAADDPRNPNNRSVGRDLVFRLIDASFA
FT                   QRRKTLHAALRKIVPSGAFERAGIDPTRRGETLDIDEFVALATACKELEA"
FT   gene            616841..617797
FT                   /locus_tag="BIF_01675"
FT   CDS_pept        616841..617797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01675"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01675"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85000"
FT                   /db_xref="GOA:D3R7B8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B8"
FT                   /protein_id="ADC85000.1"
FT                   /translation="MSAPNGARFQTPTLRADYASVHVDCPAKTNLTLHVGERREEWGGR
FT                   HALETIYCGVGIYDTVTVTAKEPGTGFSLDLAGTHLGDLAASTSDMRRNHAVLAMFAMA
FT                   QASGHEPDVSISIEKRIPVAAGLGGGSADAAGTLLALNALWNLNWPVARLREIAAALGA
FT                   DMPFCVTGGLALGTGFGERIKDLTASDPRIEHAVGDLFADAPSGDGVHMLVGAYLSQLS
FT                   TPEVYSTFDVLGAGEGDLNELQHAAVSLHPRSGVAIREAQQAGATSAFVSGSGPTVIAV
FT                   VPDDRVREATRAAWQASGAVDRIIDAQAPAAPLMRAE"
FT   gene            617863..618495
FT                   /locus_tag="BIF_01674"
FT   CDS_pept        617863..618495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01674"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85001"
FT                   /db_xref="GOA:D3R7B9"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7B9"
FT                   /protein_id="ADC85001.1"
FT                   /translation="MDMAENNDAREERREYVHRRQTIVFAVVGAVLVVALFISSLFLFH
FT                   VGGLGEVKTTAEGADHGVVAPCVSPAEDGSKPKYLDSKSVTTRVLNGTKFSGFANAVGR
FT                   ALQNREFVVQSIDNYDNAKVERTTIVFGKNAIPQAYTLAANFPDAQLQMDDRQDKLVDV
FT                   ILGATFQNLTKTDELPKTGSEIPNIEGCKPANDMKDLPKAPEHTSVG"
FT   gene            complement(618625..620205)
FT                   /locus_tag="BIF_01673"
FT   CDS_pept        complement(618625..620205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01673"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01673"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85002"
FT                   /db_xref="GOA:D3R7C0"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR014065"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C0"
FT                   /protein_id="ADC85002.1"
FT                   /translation="MHMGIGMLDGGMTGAAAKACSRGVMGVSPLLRTRQVLVLQIGRFA
FT                   WAGANERCGVNFEVWPEAIELGQMFADEGFELALVGGPVRDLLLHRRSHDLDFCSNARP
FT                   EQFEPILRRFGHDGFWDMGRKFGTLGAMRRRPDGTEVKVEVTTYRSDVYDPDSRKPEVS
FT                   YGDSLEGDLSRRDFTVNAMALTVPDLEFVDPFGGANDLNKRVLRTPVDPYQSFDDDPLR
FT                   MMRAVRFVAQLGFSIEPETAEAITRMTDRIEIVSAERVRDELTKLLLSDRPRAGIEALV
FT                   DSGLADVVLPEIPALRLEIDEHHRHKDVFDHTMIVVDRAVALETGPDGPVPAPDLVLRL
FT                   AALMHDIGKPKTRRFEPGGKVSFHHHDAVGAKMTRKRLKALRFDHHVVEQVSDLVDLHL
FT                   RFHGYVDEPWTDAAVRRYVKDAGPLYARLNRLTRADATTQNRRKALMFEHAMDEMEERV
FT                   AKLKEQEDIDAIRPDLNGDEIMAELGIAPGPLVGKAYRHMLEYRLDNGPVDHDTAVAEL
FT                   HNWYASQAE"
FT   gene            620148..621233
FT                   /locus_tag="BIF_01672"
FT   CDS_pept        620148..621233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01672"
FT                   /product="Phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01672"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85003"
FT                   /db_xref="GOA:D3R7C1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C1"
FT                   /protein_id="ADC85003.1"
FT                   /translation="MPWPQHPSFRHQAYRYPYAHLLSMVGTMITPADVARMHANAAVNH
FT                   ALSPDDPDFDPLVPDELMYTSQTTTVHLNTVLDEARAVKAKLGAERIESASTQAAHMPT
FT                   PADMPSHPTSHEAAQEQSGPSEDTVPNQARGTRRIPTPAQVAQAAHAARMMQALHATQP
FT                   LYSSQPVPAQSTAVPAHPMRNAARRDPGKPTPAMMPQRRSTDRRSSFASLDAQELPVVR
FT                   EYSAGGLVFDAHGRVAIIARHSRSGHLEWCLPKGHIEKGETPQQTAVREIHEETGIIGE
FT                   VVDSIATIDYWFTGTSQRVHKLVHHFALRQTGGELTVEGDPDHEAEDAIWVDFADLDDV
FT                   LSYPNERKIAWLYARKLNRQA"
FT   gene            621236..623485
FT                   /locus_tag="BIF_01671"
FT   CDS_pept        621236..623485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01671"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85004"
FT                   /db_xref="GOA:D3R7C2"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C2"
FT                   /protein_id="ADC85004.1"
FT                   /translation="MNPHRTDLRHTARQRCKGTALLTVLFTLILALCTGFAVRPAHAEE
FT                   PDATTNTDQAAKPGVSITVNSMTPVITPSSGYKLNLTVTNNTDADVDHGSIDALTNFTY
FT                   NFISRTDLQEWAEGRGQIPLPDLLVTLHVPRIAAHKSVTVNSSLPASEEILKQFNSWGP
FT                   RPLALDYRSDDGAQTSTLHSFVTRSQDGLQGERTPQLHMTMLMPLTAGDWSLDETTLKA
FT                   LRADRSAKTHASAIATLDGKSAEALRTKDQLTQRFPHVQALADPQVLATLQAPHMQALM
FT                   QPADFDITRYSYADNANGYENAGVPLSSWAASSSVQTLRTVLNDGAAERPVYAMQGVGA
FT                   WNTEALDTARMQGYDTVIATHDFDDQDDTAAHTGVYRVPTAHGDVTVMATHPMLSQLAA
FT                   GQATSQEAQAETNTAGRLQRFIAQSAFYQMEQPYQNRCLLVSFGPDSSAANIAAFMGAL
FT                   QEASWLDLTDLETLRASEPYMSGDDAATVADTTTVDPAAYDTTTLDTTLTTLAHTRRDL
FT                   QHFNTSVLLADGSMPGGPAAQTGDANNTKPGDGDANDADDASDNATSDTSGDALGALQW
FT                   SNRWLQAHDELALLSLNANTARSSALTAATQAMVDYLRQGIGLTTPTNVNVVSESASLP
FT                   VTVTNSLPYPISLRISSRTDSMEIVTSRFVDVNVPPGSEAQATLEIRVSTAGTTVANQE
FT                   LVNHEGVPLSGIHTTTITSSLQISDKSGIVFIIIAVLLGIVGLWRQFHRKKDPDE"
FT   gene            623446..627504
FT                   /locus_tag="BIF_01669"
FT   CDS_pept        623446..627504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01669"
FT                   /product="MviN"
FT                   /note="Virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01669"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85005"
FT                   /db_xref="GOA:D3R7C3"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C3"
FT                   /protein_id="ADC85005.1"
FT                   /translation="MAPIPSQEGPRRMSSSIGRNSLIMASGTAASRITGQIRTILLAAA
FT                   IGTTGMAANAYQAGSMIPQVIFTLVSGGVFNAVLVPHITRTLNSDNAQETLDKIVTFAL
FT                   TLLLGATVIIAALTPVLTRIYVNGSPDLVGLSMAFMLWCTPQIFFYGLHMLLGQILAVK
FT                   NRFGAYAWSSVGANVISCLGFGVFIAMFGNAAQQPIGFWTPATLALTAGTWTLGVAFQG
FT                   LVLLIPLKRLGFHFHLRFGVRGIGLRSMGPVAGWSLGIVGIDQVVNVITTRILTSAPSI
FT                   AERTLHMNQFDVAGNATYQNAYTLYILPYSLIATSVATALFPQISQAIATKDLDGARTD
FT                   LSSALRTVGVIMCFFSSAFIVMPLAITRSLLPTVGVSQALLICGPLVGMSICLPLASAY
FT                   LLIQRTFYAFEDGRSPFMFMALMYALQLVLIFIGTRVFPATDWATMVGLCMSLAYVLSF
FT                   TPLVVMLRKRFNGQLDGRRIAVTYGKALLAAAVTIIIGMALRNPVYSLAQVLKPRLGVT
FT                   GWILTVLATGVLAVVLLVIYVAVLWVLRCAELMGIIATLKTRFGRKSAAPQSEPSTAAG
FT                   ESAGTAPAVGRRISASTARPVEMPPSFPPSFSPSIPPSMPPSFPPSMSTDLPAEPYGQI
FT                   EQLGVVEPIELAENPVALQDNQSEGLSRPTSGNSRIESAYRRAQSTDGEHMRPHLGDTV
FT                   LNRYTLVSPLREEPGLQAWKANDRVLSRDCQLFIVNNKAVLKNTNAVAGTLAATKDPRF
FT                   TPVLQLLHDGPVAVVLTQLDAGVSLTEYLQRPDSSPLSYEAMRTVIGETGKALASLQRD
FT                   HLTHHAVSTDTVRITVGGIQLADASISTALADTSGASPADNDERLAVRQLASVLYGMLT
FT                   RRPSTFPPKFNLNDLPADVPMELFVICKRGLELQDGTTPTIPLLTLNELEALLGPYKPL
FT                   HMLTRHDLRIPNAEGACSVVYAPVRPILPSDLLELPDSLISSQTLPSLTFASTAGPEFA
FT                   AVEVDDEDETPGEKTESMPANSFKALWNKSKAYMEGGEDAASAIPEISPADATEMFSAF
FT                   DPNAQNEPPMQPSRMTVPVDVSGVRDGSMDATRGVTTTGRIPLIDDQGNEVPNGTESQR
FT                   ALEEERKAIDAAYAAGTPALPPSFAPQSNPGANTNPPRAFTTTGEEKKRSKGATAAVIV
FT                   VIVALVAVLGVAIHSLATGGTLFGFGKQNTNYWPSDADIEKVPFGTRSGEDVQNKSKEP
FT                   SEEVKPTPTPTETKKPENTTAYPVASQRFLDRPGGQQGYGYYIHLDKKEDVSKIVIKIQ
FT                   SSGGKGYIRVNTNGDPNAGEQVAEFTFAEGGTTEVKLDKSVNTQDIVMWVPIDSLPGNQ
FT                   LYINSMQAF"
FT   gene            627728..628699
FT                   /locus_tag="BIF_02198"
FT   CDS_pept        627728..628699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02198"
FT                   /product="Thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02198"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85006"
FT                   /db_xref="GOA:D3R7C4"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C4"
FT                   /protein_id="ADC85006.1"
FT                   /translation="MGVMNSTATVHNVIIVGSGPAGYTAAIYLARAGLKPVVVAGALTP
FT                   GGQLINTTEVENYPGFPDGVMGPDLMESMQRQAERFGAEIVFDDVESADLQGELKSVHL
FT                   SGGQDLQTRTVIVATGSNYRHLNVPGELEYSGKGVSYCATCDGFFFRGKPIVVVGGGDS
FT                   AMEEANFLARFGSSVTLIHRRDEFRASQIMVERTRENPKINLLMNTVVERINGDGKGVT
FT                   SLDLRNTATNETSKIEANGVFVAIGHVPQTGFLGGQLDLDDHGYIRIDETSTGATRTSV
FT                   PGVFAAGDCADAIYQQAIVAAGSGCRAALDVQSYLEDIPEGI"
FT   gene            complement(628809..630197)
FT                   /locus_tag="BIF_00741"
FT   CDS_pept        complement(628809..630197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00741"
FT                   /product="ParB"
FT                   /note="Chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85007"
FT                   /db_xref="GOA:D3R7C5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C5"
FT                   /protein_id="ADC85007.1"
FT                   /translation="MASKSRLGRGLGALFPTLPDEQEFQHEAQAAKPEPTKPEPAKKTT
FT                   ARKAAKKAPSKPSKAATEPKKAPYDPEAYADVDGPISPLSSTIPSMGAMTIHAETVNKL
FT                   SAPMTLQPQAAEHHAAQQPDRPSSPVKTHGKRATMPAISSMTHHPSDMFFDGTPLADTA
FT                   KPKEEESEAPELKPVAGGYLVELNPNQIGPNLYQPRTTFNEEELQELADSIKEVGVLQP
FT                   IVVRKRPQEQIDEAKRRQSEEHAADRFAGRMDSEYELIMGERRWRASQLAGLTEIPVIV
FT                   KTTSDEYMLRDALLENLHRVALNPLEEAAAYQQMIDEFGLTQKQLAQSVSKSRPQIANT
FT                   LRLMNLPASVQKKVAAGQLSSGHARALLGLDTDEEMEQLAQRIIDEGLSVRSVEEIVSM
FT                   SANKETRKPKTNRNNPWAGSPIQQHLSERFATKVSIKGSEQHGRIEIVFSSPEEMQRII
FT                   DLLG"
FT   gene            complement(630197..631171)
FT                   /locus_tag="BIF_00740"
FT   CDS_pept        complement(630197..631171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00740"
FT                   /product="ParA"
FT                   /note="Chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85008"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C6"
FT                   /protein_id="ADC85008.1"
FT                   /translation="MTHQGSSPEFESAEDTIARIFSDHENSGVGSEIADASTRLHALER
FT                   LKFKQPAQTRRIAVANQKGGVGKTSTTVNLAAALALAGMNVLVIDMDPQGNASTALGAK
FT                   HNSGDPSVYDVIEGRAGIADVMQTCPEFPTLQVVPASIDLSGAELEISDLPNRNDLLDE
FT                   ALDKFLDESEIHYDYVFVDCAPSLGLLVINAMCAVNEMLIPIQAEYYALEGLGQLINTI
FT                   GLVQTHFNPLLLVSTMLVTMFDKRTLLSREVYQEVKTHYPSIVLDTTIPRTVKISEAPS
FT                   FGETVITYDPRGLGAISYREAAYEINERSQIVLETIASRRNEN"
FT   gene            complement(631767..632510)
FT                   /locus_tag="BIF_00658"
FT   CDS_pept        complement(631767..632510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00658"
FT                   /product="GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="Methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85009"
FT                   /db_xref="GOA:D3R7C7"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C7"
FT                   /protein_id="ADC85009.1"
FT                   /translation="MSEMMSDEQIEQSGILETIFGDALPKVRAFYEKLKSEGEPRGLIG
FT                   PRDVDILWERHLLNSAAVVPFIRQATSGKQFRSVADIGSGGGFPGLVAAAMLPDHTFTL
FT                   IEPMERRCEWLSECVETMGLENVQIVRARSEEAIAALEQARGKSSGRGHAKNTVTPEVA
FT                   QAIRHPFTVVTCRAVAPMTKLTGWTLPLVAPHGELIALKGRSAGAEIEKARKVIAQYGG
FT                   RHARVKEAEVAPGLEPTHVLIVDKQ"
FT   gene            complement(632941..633483)
FT                   /locus_tag="BIF_01209"
FT   CDS_pept        complement(632941..633483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01209"
FT                   /product="Jag protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01209"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85010"
FT                   /db_xref="GOA:D3R7C8"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C8"
FT                   /protein_id="ADC85010.1"
FT                   /translation="MVQTDDKTLDQLNEEADIAADYLEGLLDIADYEGDIEMGVRNGRP
FT                   MVQIVADDDTDIKHLIGKNGEVVDALQQLTRLAVQQATGERSHLIVDVDGFLKRKRQTL
FT                   RDMALDAVDEVRETGEPVDLKPMNSFERKIIHDVVRDEGLRSRSHGEEPHRYVTVYLKR
FT                   AEADGEAVEEDEFLVDD"
FT   gene            complement(633470..633589)
FT                   /locus_tag="BIF_02199"
FT   CDS_pept        complement(633470..633589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02199"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85011"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7C9"
FT                   /protein_id="ADC85011.1"
FT                   /translation="MSYIGKAVGDILGVVGRTHLQDQRYNRVSMSKECQHGAD"
FT   gene            complement(633606..634616)
FT                   /locus_tag="BIF_01208"
FT   CDS_pept        complement(633606..634616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01208"
FT                   /product="Inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01208"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85012"
FT                   /db_xref="GOA:D3R7D0"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D0"
FT                   /protein_id="ADC85012.1"
FT                   /translation="MNSENFLLDAGIWGFVYKILTPIEWLMTWVMWVFHKLFTFIGMPE
FT                   HGISWALAIIFLVIVVQACVFPLYYKSMKGMRAMQAMQPKMMKIQNKYKGKNDPASKEA
FT                   MQREMMKLYKDNNANPAGSCLPMLLQGPVFMCMFYVLSAIPYIARGKRSPLGAFDVATA
FT                   ESFSQSTYFGVKITDSFTTATTTGKVVIGIFVALMCACLWYMQFYSMRRNTAPASVNRQ
FT                   SQMMQKAMLWVFPIMYIFSGVAMPFAVLIYWLANNICNLLRTMWQVHEFPTPGSPAAEA
FT                   KEIRDHDNENKKREKEGRPSLEEEELIKAKQEAESRVTQGFQREQPKRKNRGRKK"
FT   gene            complement(634617..634934)
FT                   /locus_tag="BIF_02050"
FT   CDS_pept        complement(634617..634934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02050"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85013"
FT                   /db_xref="GOA:D3R7D1"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D1"
FT                   /protein_id="ADC85013.1"
FT                   /translation="MTGYAGRVMIRCIRWYQRRISANTPPSCHYYPSCSNYALEAIERF
FT                   GAIRGGMLAALRLLRCRPWKRCDIDDVPQRFSLFYRCSWSKAHEEPRLTPLPSHGKEQA
FT                   A"
FT   gene            complement(634931..635287)
FT                   /locus_tag="BIF_01905"
FT   CDS_pept        complement(634931..635287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01905"
FT                   /product="Ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01905"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85014"
FT                   /db_xref="GOA:D3R7D2"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D2"
FT                   /protein_id="ADC85014.1"
FT                   /translation="MERLKNHREFVAVLKRRRRVSDADIVLHYVVRTPSTPTGAAPARR
FT                   LGLAVSKSVGNAVVRNTVKRRFRVLAHRYEHELPADCDIVLRAKPGAAHASFQSLEAQI
FT                   QALFRAVMRKSEQS"
FT   gene            complement(635300..635434)
FT                   /locus_tag="BIF_01906"
FT   CDS_pept        complement(635300..635434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01906"
FT                   /product="LSU ribosomal protein L34P"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01906"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85015"
FT                   /db_xref="GOA:D3R7D3"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D3"
FT                   /protein_id="ADC85015.1"
FT                   /translation="MKRTFQPNNRRRHMKSGFRVRMRTRAGRALINRRRAKGRKSLSA"
FT   gene            635770..637533
FT                   /locus_tag="BIF_00360"
FT   CDS_pept        635770..637533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00360"
FT                   /product="DnaA"
FT                   /note="Chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85016"
FT                   /db_xref="GOA:D3R7D4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D4"
FT                   /protein_id="ADC85016.1"
FT                   /translation="MKCSMNAENLDPATQAQTIWSDTLALIKQNSRLTAREQGWLAGVT
FT                   AEAVVGTTIILDVENAQTLQVLQTELNEPIIGALEIANGGSPMFPAFKVMPPAQPEPQT
FT                   TASPEDSGSRAADAQGAAKESVQPDEDSRTPRHSAEQTGDSRPAAAQEREDSAVHMARP
FT                   DEQTAESHREPEHEPAQQPVTSHYDEAIVQTFEDIDPVAGFGPSVAGTTAPQYPPQSEM
FT                   QGSFTPGVTGNYRDPVTHLNSNDTFDTFIQGDSNRFARTVALAVAEGSGRDYNPLCIYG
FT                   GSGLGKTHLLHAIGNYAVQNQKPRPRVLYVTSEEFTNDFIESIRTSGQDNEDPAMEKFY
FT                   RKYREVDVLLIDDIQFLGGKRGILEQFFHTFNSLYQANKRIVIASDVPPHNLEDFEDRL
FT                   ISRFEQGITVDVKPPNLETRIAILRMLAEQNHIRVPNDVLNLIAERFANNVRELEGALK
FT                   RVIAMASLNHQPVTRALTERTLQDFFTTDVEVKPTDIIARVAKYFHLTFDDIVGPGRPR
FT                   SVTLARQIAMYLTRDMTSMSLMNIGQIFGGRDHTTVMHACKHIADKMQEKQEIYNYVNE
FT                   LTVELKQHLND"
FT   gene            638074..639261
FT                   /locus_tag="BIF_01452"
FT   CDS_pept        638074..639261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01452"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01452"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85017"
FT                   /db_xref="GOA:D3R7D5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D5"
FT                   /protein_id="ADC85017.1"
FT                   /translation="MSIARGTRAPCTPSLYPARRAMKVEVNTASFADAVAWTTSVIDAR
FT                   PANPILAGVKLEAADGTMQLSAFTYEISARDHIEAGVDESGTVVVLGKLLADISKVLPA
FT                   EKTYLSANETTMTITSGPATFTLQLMPESEYPDLPQLPPQIGQVDAETFTQTVTQAAVA
FT                   VAHDENRPVLTGVHMRFAGEEVTLSSTDRFRLGRASFRWTPDEADLDTAALVRGSHLVK
FT                   IARSVDERANVVIYLDPANPKLIGIANAGRISTVQLIDGEFPAVDRLYADSYPIQAVIR
FT                   KEDLLGAAKRVSLVAERNAPIRMVFTDQQLTLTAGGADEASAKETLQIDLDGEDITVAF
FT                   NPSYLREGLSVISEPYIRMKMTTAVKPVEFNGQQDEDGEESMSYRYLLVPMRFNV"
FT   gene            639307..640734
FT                   /locus_tag="BIF_01454"
FT   CDS_pept        639307..640734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01454"
FT                   /product="RecF"
FT                   /note="DNA replication and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01454"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85018"
FT                   /db_xref="GOA:D3R7D6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D6"
FT                   /protein_id="ADC85018.1"
FT                   /translation="MITVSRLALDHFRSWTNCVLDFKPGVNILEGPNGLGKTNIVEALE
FT                   VLSTGSSHRASTSQPLVEQGFPAAAIRANIEELSEDFENNTETIDDRTTTFELTIRVRG
FT                   ANRARVDGGPSLYMRDIVGRVPLVAFTPDDQRLVWGDPAVRRSFIDQAASVLVRGYTDL
FT                   LQRFTHIAKQRAALLKQIGAQEGVSVSEEARQMRMNGLEVWTAQFIETGLELTRQRMAV
FT                   IGMLNEYFGTIVQELSDVDQTATLVYEPSFDELYLTQGAEAGEQGGPERVKAAISEHFQ
FT                   RIYTGEVARGVNLIGPQRDDVSIELNGMPAREYSSNGESWTLALALKMALYRLLERKAG
FT                   ERPIVVLDDVFAQLDPSRRAKIMEFALRQDQVIITVAAAGDVPELPGDAHAHVIDVAAL
FT                   KLQGSGGEGTAFMPEPLPADDPFAGQLAAVQASRRTAGMHAGSDGKHKVEQSADQSAEQ
FT                   VSGEREIGLTKHESAHA"
FT   gene            640731..641234
FT                   /locus_tag="BIF_01455"
FT   CDS_pept        640731..641234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01455"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85019"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D7"
FT                   /protein_id="ADC85019.1"
FT                   /translation="MSEPPIAVTLKLDERALPAEEFEHVSARAGLIAERRVKREEALEN
FT                   FGKPGRDEVAFGSLFAGIAKRAGWVPHMKLAQLRHDWASIVGDVIARNTWVGAIDNGVL
FT                   TIHAKSPSWTTQLTFMLPELREKVLERLNGLDIRDIRVTGPQAHGPATRRKQYVRQNMH
FT                   YRPQ"
FT   gene            641425..643542
FT                   /locus_tag="BIF_01456"
FT   CDS_pept        641425..643542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01456"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01456"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85020"
FT                   /db_xref="GOA:D3R7D8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D8"
FT                   /protein_id="ADC85020.1"
FT                   /translation="MADQPTDSAAESLESASNDPIDQNLEANGTDQNDEQLDDTLSPEH
FT                   YDASDLRVLEGLEAVRIRPGMYIGSTGPRGLHHLVYEIVDNSVDEALAGYATHIEVTIL
FT                   PDNGIRVVDDGRGIPVDEVPGEGKSGVETVMTKLHAGGKFGGGGYAVSGGLHGVGISVV
FT                   NALSTRVDVEVRRQGYYWTQTYIDQHPTGPLERGRAMRDDESTGTSVTFWADPKIFETT
FT                   IYDFETLRSRFQQMAFLNKGLKITLTDMRQVDEARDEVAGDGDNTVEELHQTVTYQYKN
FT                   GIKDYVAFLVKSRGSAPIEPDVIDIESEDLTIGVSAEIAMQWTSAYSESVHTFANTIAT
FT                   TEGGTHEEGFRAALTSMINRYARDKNILKDKDDNLSGDDVREGLTAVISVKLTNPQFEG
FT                   QTKTKLGNSEAKTFVQRVMNEKLGDWLDAHPNEAKNIIQKALEASRARLAAKKARENTR
FT                   RKSIFESAGMPDKLKDCQSNDPSECELFIVEGDSAGGSAIQGRNPLTQAILPLRGKILN
FT                   TERASLDRMLKSDTIESLITAIGGGYGEDFDLDKVRYHKVIIMADADVDGAHIATLNLT
FT                   LFFRYMRPMITAGYVYVAMPPLYRLKWTKGPHDFVYTDAERDRVLAEGKANGRQLPKGE
FT                   GIQRYKGLGEMSYQELWETTMDPDHRILKQVHIEDALQADETFSMLMGDEVEPRRLFIQ
FT                   RNAHNARWIDA"
FT   gene            643611..646373
FT                   /locus_tag="BIF_01457"
FT   CDS_pept        643611..646373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01457"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01457"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85021"
FT                   /db_xref="GOA:D3R7D9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7D9"
FT                   /protein_id="ADC85021.1"
FT                   /translation="MADEPTNNGLDNGPVNDSGDEQHLPDGSLEPLSPQEADNTDYGLM
FT                   VGQRVQPIDLQDEMRQSYLSYALSVIVERALPDVRDGMKPVHRRVVYAMYDGGYRPDRG
FT                   YNKCSRVVGDVMGKYHPHGDSAIYDTLVRMAQSWSMRYLLVDGQGNFGSPGDDPAAAMR
FT                   YTECRMAPLAMEMVRDIDKDTVDFVPNYDGKTQEPTVLPARFPNLLVNGSSGIAVGMAT
FT                   NIPPHNMREVADGVHWALDHPEASREELLDALIERIKGPDFPTGATILGHKGIEQAYRT
FT                   GRGLITMRAVVNTEEIKGRMCLVVTELPYQVNPDRLVASIREAVRDGKITGIADMRDET
FT                   SGRTGQRLVLVLKRDAVPKVVLNNLYKHSQLQQTFGANMLALVDGVPRTLSLDAFIRHW
FT                   VSHQLDVIARRTAYLKREAEERDHILQGYLKALDMIDEVIHLIRSSQTVEIARTGLMDL
FT                   LGVDDVQADAILAMQLRRLAALERQKILDEHDELMRRIADYADILAKPERQRKIVGDEL
FT                   DEIVARYGDDRRTKILPFSGEMNVEDLIAEENVVVTVTHAGFIKRTKADEYRAQHRGGK
FT                   GIKGAKLRDDDVVDHFFLTSTHNWLLFFTNKGRVYRCKAYELPEGSRDSKGQHVANLLQ
FT                   FTPDESIQTVLSIPDYEVADYLVLATRSGKVKKTRLSEYDSPRQGGLIAVRLMQDESGE
FT                   TADELIGAALCNATDDIILVSKLGMSLKFRADDEQLRPMGRQTAGVQGMKFRAGDELLA
FT                   MDVIWGETDKDLLVVTNQGFAKRTAISEYRLQGRNGFGVKAVQLTDERGTLVGAVVVSE
FT                   EDQIMAIMKSGKVIRSNVSEVKLTGRTTQGVTLAKPDAGDEIISIARNAETEDEADGDT
FT                   VVTESSAEATATQPAQGEPVFEVKSENGMPMIEEESAAIDKTKEESREE"
FT   gene            646499..647035
FT                   /locus_tag="BIF_00814"
FT   CDS_pept        646499..647035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00814"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00814"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85022"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E0"
FT                   /protein_id="ADC85022.1"
FT                   /translation="MSNTNPLEPGQQPRAAASSAADNAPRVARSASNTPLIADRDRPEE
FT                   NRPVRPIRNRKKPHARRMNLSLTRVSAWSVAKVSFMLSLAGAIIQIIAVLFLWLLLKAV
FT                   GVFDQVTQIFSSAGLDSGSINLSNILSLPTVLSAVTIFSIVEMVIITILCTIFALLYNV
FT                   VSALVGGVHVTLGDD"
FT   gene            647191..648312
FT                   /locus_tag="BIF_00108"
FT   CDS_pept        647191..648312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00108"
FT                   /product="VanZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85023"
FT                   /db_xref="GOA:D3R7E1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E1"
FT                   /protein_id="ADC85023.1"
FT                   /translation="MFRYLGSFSQSFTLALMLWPFVSLLLTLPIVAFVYHRNHRLSFTS
FT                   AFSAYVAVLYALGLVAFTMYPMPDDPTLFCATHNLAPQLDILRFIQDAQTGLYGVLQLV
FT                   MNVVLFMPLGFMLCRWAGWRFWVTSAFALGCSIFIETSQLTGIWGIYPCAYRQFDVDDM
FT                   LTNTLGAMLGYACALLYTKLVPKKAKQLTGTNTRPGFVHRMVSMCIDFLLIALVYVPLS
FT                   ILYIFLFYLVFKSTGDGHYVWLSLTVEPRVLDYMTWITAALSFLLFEVWIPWRHHGQTL
FT                   GCRYTHMTIETRDRSRGQRIAFYAIRTLFFGVIFGGLATNHPIWGWTLLALLIFWLVKK
FT                   CMPWDLVPGTDPQTPPTSPQPQVSTLPEPNLQR"
FT   gene            complement(648393..649268)
FT                   /locus_tag="BIF_00841"
FT   CDS_pept        complement(648393..649268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00841"
FT                   /product="Conserved membrane protein (hemolysin III-like
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00841"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85024"
FT                   /db_xref="GOA:D3R7E2"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E2"
FT                   /protein_id="ADC85024.1"
FT                   /translation="MLGNMANRRANPSQRKPPRSSYLEDSRMKRNNRHIGQVTRSQKPR
FT                   KVVTAKKLRAQSKRNEQYRTKMQLRQILLEKPKLRGWLHLIAFPFSVATSVILICLAPS
FT                   GWMKVAISVYSATIILLFGNSAALHLGHGYFPKAVDDVLCRIDYSNIFLVIAGTCTPFF
FT                   FALNNTVICWVYVGVVWVTALLGTFVHLIYPVGLDWLFTIVYIVLGLAPITIIWLFWKS
FT                   PYIGPVPTILVIAGGACYIAGAVCFALRKPNPFPKWFGFHELFHLGTIGGYVCHVIALF
FT                   MVVLRMRALM"
FT   gene            complement(649666..651012)
FT                   /locus_tag="BIF_01557"
FT   CDS_pept        complement(649666..651012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01557"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01557"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85025"
FT                   /db_xref="GOA:D3R7E3"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E3"
FT                   /protein_id="ADC85025.1"
FT                   /translation="MLTDEYVKRVYAQVEARDPDQSEFLQAVQEVFESIEPVFAKHPEY
FT                   EAAGVLQRFVEPERLVKFRVAWADDNGDVQVNRGYRVQFNSAIGPYKGGLRFHPTVTES
FT                   VIKFLGFEQILKNSLTGLPMGGGKGGSDFDPKGRSDAEVMRFCQAFMTELQRHIGQFTD
FT                   VPAGDINVGAREVGYLFGQYKRLRNEFAGVLTGKGLEFGGSLARTEATGYGLCYYTQEA
FT                   LRVLRDDSFEGKTVVVSGSGNVAIFAIEKATQLGAKVVTCSDSNGYVYDPNGIDLDVVK
FT                   DIKLNKRGRIREYADRVDGAEYHEGCREVWTVPCDIALPCATQNEIDGESAQKLVDNGC
FT                   TVVCEGANMPSTPQAIEVYQKNHVLYGPAKAANAGGVAVSGLEMSQNSYRLSWSFEKVD
FT                   EELKGIMKNIVAESLDAAKEYGHDGDLMFGANVAGFTKVANAMVAQGIF"
FT   gene            complement(651125..652453)
FT                   /locus_tag="BIF_01556"
FT   CDS_pept        complement(651125..652453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01556"
FT                   /product="Transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01556"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85026"
FT                   /db_xref="GOA:D3R7E4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E4"
FT                   /protein_id="ADC85026.1"
FT                   /translation="MIMTAGNNTHRKTSSATDSATDSTQRQSNPSGYTTSAGERAAGKA
FT                   RERLITRDVALIMAATFFYMTSSMMGTPIIAGFSQSLGASGALMGFLAGALSLSALICR
FT                   PIAGNLSDRTSKRKLAVIGALIFLASNLGYYFVPNTAWLLAARILNGVGFACISVCLST
FT                   WLSMLLPISRMGAGMGLYGTMNALAQAVGPDLGIRASKAIGYRNTFLIAVGLTCCIVIC
FT                   VLLIKDGGKPPRARLGRQQGGERHHIRLDSLFEPRVIPIALIFMLFAIPYFANQSFIVD
FT                   YANARHAHVIVSLFFPCYAITLLISRIVLRNWFDTKSFLFFMVTGTICQIVMLASLTVM
FT                   RNNWFVMLAGLATVGAYGMMSSVTQARAVLIAGKARSGMANTTYYAGIDLGMFLGPLIG
FT                   GFLYGGLPIIWFYPALLLTMPVAWIVYAFAHRTIQSSERAPRI"
FT   gene            652483..652638
FT                   /locus_tag="BIF_01555"
FT   CDS_pept        652483..652638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01555"
FT                   /product="Mannan endo-1,4-beta-mannosidase"
FT                   /EC_number="3.2.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01555"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85027"
FT                   /db_xref="GOA:D3R7E5"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E5"
FT                   /protein_id="ADC85027.1"
FT                   /translation="MGAAVCGARKANGSDHKLVIQMNANGVTFEAYPSLKGKDAQVRQA
FT                   GRVERG"
FT   gene            652622..653818
FT                   /locus_tag="BIF_02200"
FT   CDS_pept        652622..653818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02200"
FT                   /product="Mannan endo-1,4-beta-mannosidase"
FT                   /EC_number="3.2.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85028"
FT                   /db_xref="GOA:D3R7E6"
FT                   /db_xref="InterPro:IPR005087"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E6"
FT                   /protein_id="ADC85028.1"
FT                   /translation="MWNVASWDKDSAGKLPNQKLLSKVGSFAIYVNDNDNELQNNAGRP
FT                   RTGDLVFDSIKLVGERDPYVPEEKSSEPSNAKLITIDDFESYADEAAMKEAWGNREHTD
FT                   VLSLTTEDDDNKYLQYSNPHGGWLDVATFIQNDTARNNWTGLGKLTFRLKHDGSNNAMD
FT                   LQIGTADGKYFHVDQKLASEDGADWKTVEIDLVNNPSLTQSWPEDENKGKTMTADDLAL
FT                   FKEVVIAGNTWNKDSPAVNFAVDDLKVVPSGDASDSKPETKPEEPSEPTEPTEPEETPD
FT                   YSADMAAGDPATCPIDFTQQDTEDPSDPSDPDQPTDTDKPAGTDKPADANKPAAGDNAQ
FT                   SGDNAQSGDNAQQSNAKADENKSVVNTGSSIAVVAAIAVALVLAGAATLVWARQRHQQ"
FT   gene            654066..654566
FT                   /locus_tag="BIF_01553"
FT   CDS_pept        654066..654566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01553"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01553"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85029"
FT                   /db_xref="GOA:D3R7E7"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E7"
FT                   /protein_id="ADC85029.1"
FT                   /translation="MIDGFKKFIARGNMVDMAVGVVMGAAVTAVVNSVVDGIINPLVAA
FT                   IFGKPDLSKTWNWTITNWAGENSVISFGSVLNALLNFLLIALAVYFCIVVPINNLRDMT
FT                   EKAMAKVKGDDSDVAAEEPDLSPEEQTVILLQDIRNALAAQQPAGAHAAPVATDTTAAP
FT                   ESK"
FT   gene            654801..655097
FT                   /locus_tag="BIF_01552"
FT   CDS_pept        654801..655097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01552"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01552"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85030"
FT                   /db_xref="InterPro:IPR007302"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E8"
FT                   /protein_id="ADC85030.1"
FT                   /translation="MKRATVAMICGLLCGSFRKICRGEDNLRIPSGASSPLFECDIERR
FT                   TTPRLFRDVRVRYKTVFFLIMVGLLCGDAVIDHTAENYGRLLTQMYGNRPYLP"
FT   gene            complement(655297..655369)
FT                   /locus_tag="BIF_tRNA11"
FT   tRNA            complement(655297..655369)
FT                   /locus_tag="BIF_tRNA11"
FT                   /product="tRNA-Ala"
FT   gene            complement(655401..655474)
FT                   /locus_tag="BIF_tRNA12"
FT   tRNA            complement(655401..655474)
FT                   /locus_tag="BIF_tRNA12"
FT                   /product="tRNA-Ile"
FT   gene            655616..656380
FT                   /locus_tag="BIF_01551"
FT   CDS_pept        655616..656380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01551"
FT                   /product="Zinc metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01551"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85031"
FT                   /db_xref="GOA:D3R7E9"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7E9"
FT                   /protein_id="ADC85031.1"
FT                   /translation="MVMPFNSVPRARSISRRAQFDRSTRAREVLNVDGLQVNVLRKKNR
FT                   NMYLRVKPPYGAIEVTAPVRMPQHTIVEFVRERRSWVDEALHKMAQARSRTFASPDLDP
FT                   DVGGSRTTVLRDARDPGSPRMETPHETSSFTWNEEYVERARRSIEQQLPDLLSKWTPIV
FT                   GKSPTKITLRTMTSRWGSCTPKTGRIRLNLQLGLMDPQFLEYVLVHELTHLWESGHGRT
FT                   FQERMSLVLPNWKELRRELNRCTIFDVPQSRG"
FT   gene            complement(656405..656863)
FT                   /locus_tag="BIF_01688"
FT   CDS_pept        complement(656405..656863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01688"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85032"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F0"
FT                   /protein_id="ADC85032.1"
FT                   /translation="MFDLQIMQGTPMAEATKHTITVDLDMFDKTPEEKTAHANEIAREF
FT                   GVGEDALAAVEDFKKELTKHNAWDLPFMGYVNEDGYGYAYVPNAAITTTPYWDAHAAFL
FT                   ALPKDAQTAFAIRMLFTHRPVDRYGADMFLHYQRGISTNFIGTGANKY"
FT   gene            complement(657468..658310)
FT                   /locus_tag="BIF_01689"
FT   CDS_pept        complement(657468..658310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01689"
FT                   /product="Putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01689"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85033"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F1"
FT                   /protein_id="ADC85033.1"
FT                   /translation="MVLREAIANAVVHREYDTLFRNDPVNIDVYSDRVEISSPGNLWGG
FT                   KTLQNLTNGVSRCRNTTLMQLLQKTPLIRGDHDGSAVEGQGSGIQFMINRMKELSLAQP
FT                   DFHPTFDRFRVILYRGGAEIAANQQWVRSHVGHDLPGRESSVLYTVRALGRASVYDIRD
FT                   RLGYDSDDIRAILATLVESGLIRQVATDIYEPPETPAITNASDAPAPPAAAPSSRQAII
FT                   DTIPTFGTISARDIAEATGKSLQTVHRILRELVDEGVITAIGKKQSRLRTYTRKQTID"
FT   gene            complement(658235..658837)
FT                   /locus_tag="BIF_02048"
FT   CDS_pept        complement(658235..658837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02048"
FT                   /product="Putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02048"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85034"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F2"
FT                   /protein_id="ADC85034.1"
FT                   /translation="MQRVPTIPIHHSVLKSDFTTHHSVSKSAFGTRHSVSHIVREGLCG
FT                   LGKKRCRDCGYACVGIGVAHRGEKALRGTHSETQQLERLNILDKNGHVRLAGLLIAGVY
FT                   PQQFFPRLYVDVAVHPGISKSQDDEVRFLDRVQCHGRLQEMVDDAVKAVLRNLRTYSLT
FT                   RGTEGAMYRRFQLWYYARQSPMPWYTGNTTHCFATTR"
FT   gene            658821..659147
FT                   /locus_tag="BIF_02047"
FT   CDS_pept        658821..659147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02047"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02047"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85035"
FT                   /db_xref="GOA:D3R7F3"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F3"
FT                   /protein_id="ADC85035.1"
FT                   /translation="MGTRCTPQALAGRVNVYNRISPTKAPCGSIRRVASIRITTAHGVQ
FT                   EHTHVTLGGIEQYVQIRGEDRRNPVILWLHGGQCTVPDYSSRSGDGALSAPTAECTRGL
FT                   YARQ"
FT   gene            659186..661687
FT                   /locus_tag="BIF_01691"
FT   CDS_pept        659186..661687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01691"
FT                   /product="Excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01691"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85036"
FT                   /db_xref="GOA:D3R7F4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F4"
FT                   /protein_id="ADC85036.1"
FT                   /translation="MAQTIDITGARVHNLKRVDVRVPIGKMVAVAGVSGSGKSSLALGV
FT                   LYAEGSRRYLEGLSTYTRRRISQSGEAKLDAIEHVPPALALHQRPSVPGIRSTFGTMSE
FT                   LLNSLRLMTSRLGNYTCPNGHMLDPTPNVALERPIICPVCGEEVQALGAEDLAFNSGGA
FT                   CPTCSGTGIVRTVNQATLIADPNLTIEQGAVAPWRSLMWSIMVDVCREMGVRTDVPYKD
FT                   LTAHEKEIVLHGPAEKRHIIYHSKKENRAGELDFTYFSAERTVLNALDKAKDAKALKRV
FT                   EPFITEEPCPDCHGTRLNKRARILPVDGKTLPEQCAMQLDNLAQWVRTVPATMPDDMHE
FT                   MAQSIVDEFTRTARRLLELGLGYLTLDRAGSTLSTGERQRIQLARAVRSELTGAMYVLD
FT                   EPSIGLHPANVDGLLGVMRDLKAQGNTVVVVDHDTRVLRDTDWIIEMGPGAGSHGGTVI
FT                   AQGTVSDIEGNPHSLIAPFLASERLQIVRPQTPANKVFDEGALEIKTAPLHTVHALDAR
FT                   VPKHRLTVVTGVSGSGKTTLVLESLVPALTAKIAGERLPEHVRALDAPGIDRVTMIDAT
FT                   PIGANVRSTVATYSGVLDDLRRLYARTDAAKARGLKAGAFSYNTGSLRCPTCDGTGQIT
FT                   LDVQFLPDVDIDCPDCHGTRYGDVAGEITWTPKNGHKPVSLPDLLAMTVDEALDIFTGT
FT                   GQRRLHAELETLHELGIGYLTLGESTPALSGGEAQRLKLASEMGRAQDGTLFVFDEPTI
FT                   GLHPLDVRTLIGVFQKLIDHGASVVVIEHDLDMIANADWIIDMGPGGGENGGEIVATGT
FT                   PVQIAENPLSVTGRYLKPCVE"
FT   gene            661947..662801
FT                   /locus_tag="BIF_01692"
FT   CDS_pept        661947..662801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01692"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01692"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85037"
FT                   /db_xref="GOA:D3R7F5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F5"
FT                   /protein_id="ADC85037.1"
FT                   /translation="MENLRHYACEFDMMRRTCRAITRRDGRRNGSVDMDYQSENAQTID
FT                   RWVDEGWQWGVPISHDAFVDAQHGSWNILLTPTKPVPHEWVGDVRGKRVLGLASGGAQQ
FT                   MPVMAALGAQCTVLDYSSRQCEREYEVADREGYDIEVIQADMTQPLPFADESFDLIINP
FT                   VSNCYIEQVKPVFRECYRVLKPGGSLIGGYDNGINYIFDNEETTLTYALPFNPLHDERA
FT                   RQLLLDEDAGMQFSHTLDEQIGGQLEAGFTLRALYEDTNGEGNLHEHHVPTFVATWSVK
FT                   PAR"
FT   gene            662850..663764
FT                   /locus_tag="BIF_01693"
FT   CDS_pept        662850..663764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01693"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85038"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F6"
FT                   /protein_id="ADC85038.1"
FT                   /translation="MAEYSGSSGYAEYEYLGTANGTSFAKRHPYLLWQIIGWSILLADA
FT                   VFFVVAALQDFGEWCYPVIVFPFIAALFAVIGSPFLIYFSRKAKIPQAASKREASVVRS
FT                   HITMISQIRGESHPVLMALLIIALALGLLVLTLQLGMRGYILPGFLAMVAMVVVPFVVY
FT                   AQYSAAQRKRFMAVPDAAYLVGVHYADQSRYESVELRETDALMMPVPAKPSTAMLDFVY
FT                   NWLREYLATDWLTVTVLSFDDLLRSGVVVNDSDTEDTDPTASFPLIPARQFNLDGDARA
FT                   QLDEESKAIGAFWLSRWRGYTQM"
FT   gene            664087..664686
FT                   /locus_tag="BIF_01694"
FT   CDS_pept        664087..664686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01694"
FT                   /product="NADPH-dependent FMN reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01694"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85039"
FT                   /db_xref="GOA:D3R7F7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F7"
FT                   /protein_id="ADC85039.1"
FT                   /translation="MAQLTNEERIEVNDGREMKVLMIVGSLRKNSFNKQLAAMAEQELG
FT                   DRASVSVLDWSEVPVFNQDEEFPTPKSVAEARVAVNEADAIWIFTPEYNHSVPGSLKNL
FT                   FDWLSRPLEDGTPSVLTGKVMTMSGVGGLNTLRYAFAAWMPSLTLFKMRIVPVPFTGVT
FT                   LNREMFSTDKLELNAAMRTSLKYQADATLQAIAEAE"
FT   gene            664889..665602
FT                   /locus_tag="BIF_01695"
FT   CDS_pept        664889..665602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01695"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85040"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F8"
FT                   /protein_id="ADC85040.1"
FT                   /translation="MHAPYLLAACVLMCGFIDKTFIYIIKLADFYLLEKVIAMRQWRGI
FT                   VSVIAAMAMIGGFAGCGQSQEQAGFSKSPQSSQTATGGASGEIGNMESEHHILPSSDVE
FT                   ELELRLESIGESTATGNLTLLGELHPTASYTERDGGRGMPSLQNQDELTFSDCKSYMLS
FT                   VLCMGEGSVSIEWTLGTQSEQRNLECAPKIAETALGMSNVNAKSSTVKIVAEEGSKAEI
FT                   AYRLDEIGKPGVVVD"
FT   gene            complement(665675..666709)
FT                   /locus_tag="BIF_01696"
FT   CDS_pept        complement(665675..666709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01696"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01696"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85041"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7F9"
FT                   /protein_id="ADC85041.1"
FT                   /translation="MERSLRNLCDLLFTRRVKTQLPPSLFTQKRFREISVRRRSAAAHQ
FT                   LPRTSELFLAIIAVIARRRVENVDVAAAQHHLALSELTLQFLSERRHTMQNLRHMPRAT
FT                   PWAHHLRRFHIFRIHVCVISHIRHSRRPPRFRKQHRHAFRILRFPHRSSHLLKYLYFPS
FT                   SLNFLDITESKSHPVVRSARRAVPEPARHVSRKHPHNRPPSHADVARLSEASERYVVCR
FT                   LPRSTFHGIFRKICHSQTILRHSSRKHPKGRPRRPRSTAQRTEASVRYVILRPLCGTAH
FT                   GRFRKTGRQSDIYGTAHGNIRNLCRKMRTSRPDSWKHPRNRPQNRGCMPQPVAHLLICV
FT                   KRVK"
FT   gene            666744..667019
FT                   /locus_tag="BIF_02046"
FT   CDS_pept        666744..667019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02046"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85042"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G0"
FT                   /protein_id="ADC85042.1"
FT                   /translation="MGIQEALRKAAEMQSHLQIISVVEYGPYWIFSYCEPGLTPEECPG
FT                   MPMLKMRRTDGFSTYLHVQDKDFLDIVKHATKVDLPEHTLPYSPTS"
FT   gene            667203..667472
FT                   /locus_tag="BIF_02045"
FT   CDS_pept        667203..667472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85043"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G1"
FT                   /protein_id="ADC85043.1"
FT                   /translation="MALFMLNHHVLAEVAYDSGARTYAVDFPDRQPWLPSGFSFQVCTA
FT                   YTQVVSCEDSADTTIPADEKIRQMLNEQIEIWHRDWQCTGETWE"
FT   gene            complement(667610..668014)
FT                   /locus_tag="BIF_01697"
FT   CDS_pept        complement(667610..668014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01697"
FT                   /product="Pyrophosphohydrolase, MazG family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01697"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85044"
FT                   /db_xref="GOA:D3R7G2"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G2"
FT                   /protein_id="ADC85044.1"
FT                   /translation="MHDVCAARRRCRHTHTAHTSSFATMAPMISDDTLRMIHQFSADRD
FT                   WQQFHAPANMAKSVSIEAGELLECFQWSDEPRDGDWEHVYEELADVMIYCIQMADVLDV
FT                   DLDEIIRSKMAKNAKKYPVEASRGSSAKAE"
FT   gene            667961..668311
FT                   /locus_tag="BIF_02044"
FT   CDS_pept        667961..668311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02044"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02044"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85045"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G3"
FT                   /protein_id="ADC85045.1"
FT                   /translation="MRSMSMPTTSSRSTYIVHIPACPGELDEETLHSIIESQLKQSIPA
FT                   DSVVEQHAREYLEQYPVVYIVHAEDVKQRKDSSETRYIVYVGETNDIVSPTRQHLIGDA
FT                   KNEIPTYALKEV"
FT   gene            668321..669403
FT                   /locus_tag="BIF_02043"
FT   CDS_pept        668321..669403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02043"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85046"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G4"
FT                   /protein_id="ADC85046.1"
FT                   /translation="MAGKEKIDVRILRYTENGQKRYMAASCLLVLILSIVNAYVHEIEY
FT                   MLRKKEYNYSWSELYNYFIDFYPNVNSPFSLLLELFSFLSTLAIALAVVVEGEGKMLIL
FT                   SKFSYWLCVGSCSVLAVMSRALFSGLGVIKAIAVIVSSIIILYYLGRFSIVIGQKNFIN
FT                   ARMAFDKSVSLIYLKLYERYGGERSAARSLVKVFVLLSILLIMAIGPWVLLITDALSAT
FT                   RYDNGNILSVLLVFLFIYCLTFVALLKNEEHGMNGLLLVTSCFVPLLPLLFYVFHSIHN
FT                   SIHYVIIFFIALSLSFWSLFCVACSRMSSGELSEKLRKRRPWILVAEIESIHSIKARLY
FT                   MKIHLKYIDRVEYMNGLGGS"
FT   gene            670068..671609
FT                   /locus_tag="BIF_01698"
FT   CDS_pept        670068..671609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01698"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01698"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85047"
FT                   /db_xref="GOA:D3R7G5"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G5"
FT                   /protein_id="ADC85047.1"
FT                   /translation="MNLTIGKCIATMPRVFNCELSLEHGVRRDCAIVLASKVLVVYGIT
FT                   ESTHFVVPVKLYDWGMSENALLNTKETAQYIGVSAGVVTRLANTGELEFDTCGARKVFR
FT                   KEAIDAYLERNNLIQAAVDQVSTKDFEDNICALSFFSGAGGLDLGFERAGISAALYCEN
FT                   NRECRMTLHRNRPDVALLGDITKISADEVRRMARIPQGREIDVMFGGPPCQAFSTAGAR
FT                   RAFEDPRGNVFLRYLDLASELKPRYLVIENVRGLLSTPFPVESGGKPIRGGVMRYILNK
FT                   LEEMGYGVSFNLYNAANFGAAQIRERVVIIAKRDGTKCDWLIPTHTDPDGKYVQNWNLP
FT                   SWVTFRDVVYDIEDSRQTHTDFPEKRLLYFSMLKEGQCWNKLPIEIQEEAMGKAYKLGG
FT                   GKTGFYRRIAWDRPSPTLVTSPTMPATDLCHPKELRPLSVEEYKRVQGFPDDWWIAGSI
FT                   HDQYRQIGNAVPVSLGEAIGRAILDDMRGEAHDERWRNFPYSRYAHTSDQNWNLA"
FT   gene            complement(671704..672657)
FT                   /locus_tag="BIF_01699"
FT   CDS_pept        complement(671704..672657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01699"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85048"
FT                   /db_xref="InterPro:IPR032793"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G6"
FT                   /protein_id="ADC85048.1"
FT                   /translation="MKYAFQPEILRQTLHSLIKICICRIRTLRLIHMEDQVRIYDSAAE
FT                   EEARRESARSILNAYIQSRIAFYDGTGSSSMTYERLLGKDFAIYALRGIETAEDYAREA
FT                   FHAVESSSEETAMGTRWQELIASIAENAIDTGDLTATRDGAVYVIELKSQENTTNSSSF
FT                   PNELRSLRQRMKEITGRKRASNQRVEAAICITRSTISKDEWRTFEVSGVTQENADLKNF
FT                   RYRYLSGTAMWQWLCGIDSPYGLIRPFSSINSEAVLLARESSLERVTTQLLEELDKNGL
FT                   PHTLDGVAELSDRYKAEKEAKRREREAKRNARNTGR"
FT   gene            672783..672974
FT                   /locus_tag="BIF_02042"
FT   CDS_pept        672783..672974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02042"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85049"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G7"
FT                   /protein_id="ADC85049.1"
FT                   /translation="MSICSCCGLERDHDDLVGPTLHLGSDLDAVRMSLAFMNRRIVQPP
FT                   FMSTRTAPTRHRRVYVFN"
FT   gene            673066..675540
FT                   /locus_tag="BIF_01700"
FT   CDS_pept        673066..675540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85050"
FT                   /db_xref="GOA:D3R7G8"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G8"
FT                   /protein_id="ADC85050.1"
FT                   /translation="MSHTLKCNVCLKGEENRMGSGELQTWNGHFDRGVYIDYTLEPLQS
FT                   ERHIEGTKDEASQSGSRIDEDTTIEIEDIEEENNSDQDESHRVDYMLAAGCGIISGAID
FT                   SLWVGKFDFDRAREWGSERVNEFVMAVAKMDPEYKGDDVKSAIRFLEKKYPFVGDRATS
FT                   EFGGGRQHHLRDFSHHMSLGGLAFSLLTQFTGKVYGTDQHGVFMVVPVADEELIGKTIE
FT                   EKLMLGAVRWFFHMVSDMAGSSGSAGKGTGIPGPILSLMKQLSALPLFKDAMTDEALFR
FT                   KMLSKLFNGTLLKTVDEEGKKIYRRFDLRAELGIAHELARQSVPVLVNECLVCVCYAAR
FT                   RLYTMCSNGEVHDFKSLLSVGLDALLPHGSPLGTRMVTIATGVFSVVDMTDGAIRTLMR
FT                   SGGKLNPGMVSDFLLHVNVVGVVRFVFAVHTDYKVHAKAKRETRLQAKFHGRGNGYGDD
FT                   ASVMRFFELDMAQANMVVSIEYQAARLDIEQTKNKKTREEKEREFSDWENDNCSEFILR
FT                   DKEALVNEIHRIQRYATPVWQKLVALEASQFMPYQSKKLKYDAATLDMVCSDLPGFEDK
FT                   ECTKYRKAVIKETSAIKGVKKAVLAGCVGIGVVAVATGGAAYVFAPAIAPILAGPSVAG
FT                   LSGAALTSASLAAVGGGSLAAGGLGMSGGVALIAGGGALLGAVTGGGAATLGTWVLANQ
FT                   DAYVLNTCAKLIVFCRDVLMEIDGGVELVRQVRQSVCEQLRETEPQLDFLGQLKQFIKQ
FT                   SGSRDADSDPSAKRERSEALKGIDKSEKNMKRSVKYMRKCVKELGKVTGITDENRGASG
FT                   AQWKPVAQIEKG"
FT   gene            complement(675568..676188)
FT                   /locus_tag="BIF_02041"
FT   CDS_pept        complement(675568..676188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02041"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85051"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7G9"
FT                   /protein_id="ADC85051.1"
FT                   /translation="MRLNSPHSSTGLTMVRRLVDVMAHDLGVPRRASDDPDGEALACRC
FT                   TFTALRFWMQAYCIDDGYGGAAGIAQTAVEQKSLAWIKQMSALYPQLRSKFTPALIHQY
FT                   CSALTAIGDLAETSEGMLRCTKPHDLRIPYSGGTFVIAQLGLRDLTVQDWEGCVLSDAV
FT                   VFAGVSKHNGIVGFDPDMIGWELPYRDELLFLAKWQEASNALR"
FT   gene            complement(676130..678265)
FT                   /locus_tag="BIF_01658"
FT   CDS_pept        complement(676130..678265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01658"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85052"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H0"
FT                   /protein_id="ADC85052.1"
FT                   /translation="MSQQFNESRQSWGLFVWNDNGDGQFIRIIDYVTDSAGNGCYDWVA
FT                   YPRWWERSRNPSSDDPLDPKTLYNPKLTQIMVKSDSDFKFLQWTPNYNRPDHPFVEIFQ
FT                   GGLRTTEPPLYEVIDCPANRAEELPDVLSQGIQYSGRPTAKILLLFAENNNMLDAAVLD
FT                   RSMTTIHNGLLTLSNTAPNSVPRVILDRRHVRIINQGFNRGDRLVYNLPTQLKSHSQVV
FT                   IKPMRDLAQLYVNWYIRKEHAMNGDELMRTAGDVLEQAFEKPANLEEYLGAKPSHNDVR
FT                   ALQTAIKATIRSNTDDVSEIIYDVLKNDDDVMAEFRKQATAQLDDEFEKHKQVLCKQLD
FT                   ELRAQRDEESEKAEQATAQLAELNQQLQRKRGEIRDAQAELELQKEEQHKALQDLENNV
FT                   ALKLGLQQIAQQNHSMMEELTIRHSTAPDSSRQLRMAPMMGPAKTQAATDMQQAVAQNM
FT                   QILGCTFTGQSNRNNERITHFAAHLCRTLRTTRLLAVDTVHVPTIANTLAFALAGTPAQ
FT                   HTGIPIDFSDFTMLEEFLEHSESPVIVLDNVFDTVNESLLFALNRYSPAKSVVILPIGS
FT                   FANIRLLAPEVWNKVFYVPTTGMVELSASDKPLHHAQEALKRIDITSRSILAQMDILRR
FT                   MTSIPQNALVTPSAITAIAQDTASARQWIMPHLCIETYEYQGAEKAHELSQEPTNKTIA
FT                   AQLAALIDRIDHGSQAR"
FT   gene            complement(678292..679734)
FT                   /locus_tag="BIF_01659"
FT   CDS_pept        complement(678292..679734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01659"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85053"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H1"
FT                   /protein_id="ADC85053.1"
FT                   /translation="MDTARQFIPMAPVCTVTADQVVHDFQGDIPAGVKFRCPSCDRPVQ
FT                   FHRGSRASTTSADASGDQAPAVRRNPRSHSSRSVHRTVRPHFRHAKNDPVARFCERYQA
FT                   GLGADPRIIVPSLPMFLRKDRNRAGSGHHAQSTPTFHLEISVRRRSLGHDLISELRKDR
FT                   ATLTVDGISHNLADLVSDRKYTIHLENPSFGLRARISVPEQWQRNVGSPEDGEQAFIFT
FT                   SEFGPNGGRRLSYGASLHAGFDYYVVARPSILRALQSCFDIAVPIGEINSSHGNLLVVR
FT                   IVTLWNSLNRTQADFWLADHGFRLTSLDLDPVPVWPPQLRSNGIDEPLFSNSQQIYQTP
FT                   FASRNENPVHDDIDFPRLNCDHLNPRRVGLLGFAPHGRVRSQIEGECCFLRANRYLPWS
FT                   AYVLSHTYPEGLMLADAPHLPSSDEQPHASSTALMPELAIKQTQCQTLNKHLDIEQRRL
FT                   EQPQHHGIPLSVSLARIRSTYR"
FT   gene            679909..680112
FT                   /locus_tag="BIF_01660"
FT   CDS_pept        679909..680112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85054"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H2"
FT                   /protein_id="ADC85054.1"
FT                   /translation="MRNLDEVIAAQGEDYAQFDQQAKQSVAACASLAMSIKSVLDTPIL
FT                   DESGALTDESGTLMRGFDGNPE"
FT   gene            complement(680376..680606)
FT                   /locus_tag="BIF_01661"
FT   CDS_pept        complement(680376..680606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01661"
FT                   /product="YafQ"
FT                   /note="DNA damage inducible protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01661"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85055"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H3"
FT                   /protein_id="ADC85055.1"
FT                   /translation="MGPSKLKEVIELVIENSPASIAVLKQRHNMHTLAGKWQGRNECHV
FT                   ANAGDGPVIWSCNGKVAFFEHTGSHDELFGT"
FT   gene            680893..681507
FT                   /locus_tag="BIF_02040"
FT   CDS_pept        680893..681507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02040"
FT                   /product="PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85056"
FT                   /db_xref="GOA:D3R7H4"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H4"
FT                   /protein_id="ADC85056.1"
FT                   /translation="MRRRFACPRRCASRSGCPMIRRLRQPSKTVRLCSSPRGRQSARFV
FT                   SRILLRFSRIARSPTGPAKMISVLQRGMRVCDMCHYGDVLMVDLDPSKGHEQRKRRPVV
FT                   VVSNDAFNRNCTLTVVAAISHGRGDFELHIPFSPVPASDVSNGGSGVADGFVQLEQIRA
FT                   LDLSARNAVKIGSLRQKDMDTVTSMLLGCFIQPDMMVLPSY"
FT   gene            complement(681695..682654)
FT                   /locus_tag="BIF_01662"
FT   CDS_pept        complement(681695..682654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01662"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01662"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85057"
FT                   /db_xref="GOA:D3R7H5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H5"
FT                   /protein_id="ADC85057.1"
FT                   /translation="MPIIYLAMRNLHSGLGLEDERSDMTELEALRELVAFREYGTLSAA
FT                   ADELRITQPTMTRTMRKLERELGVPLFDRRAKNRLSLTHTGELAAQEAEQLLDAYDRFV
FT                   ETVRNDANLHNEIVVGSVAPGPLHFLEQAGERNAKWESSITVRHSLIEPDAVLDDLLLR
FT                   KETMIITDREVDDPRVESLYLGEEYLGVAIDNFNPLAQRTSVTFADLAGMDFVVAHDIG
FT                   PWRAVIEEQIPGAHFLYQQDLSALEQISKYSAFPFFYSNLTRSLRMTDERFMPHTRTAV
FT                   SIADPANRIDFYATFLGDNRRLALPIQQYLAQHRPREQ"
FT   gene            complement(682582..683013)
FT                   /locus_tag="BIF_02039"
FT   CDS_pept        complement(682582..683013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02039"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H6"
FT                   /protein_id="ADC85058.1"
FT                   /translation="MRSESSMPCFAFSYVKWSTHSLEVTKNVFARDRALRDRRTDRLLV
FT                   RICGGRIDQSVAGLQGIGDGLLAHGQIRHLKHTESELRHLVSIVQSDVLHEFSYHVYSR
FT                   FPCSPRIVKPLFGEVQCLSFILLCAICIVGSVSKTNGAI"
FT   gene            682895..683590
FT                   /locus_tag="BIF_01663"
FT   CDS_pept        682895..683590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01663"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01663"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85059"
FT                   /db_xref="GOA:D3R7H7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H7"
FT                   /protein_id="ADC85059.1"
FT                   /translation="MRRSRRARSRAKTFFVTSKLWVDHFTYEKAKQGIDDSLRKLGLDY
FT                   LDLYLLHQPYGDVAGAWRALEEAQQAGKIRSIGVSNFAPDQLINLELMSNVKPAVNQIE
FT                   VSPWYQEKDEVRFAQEQDVQVEAWAPFAEGKHHIFTDPTIAAIGEKYGKTNGQVILRWL
FT                   LQRGIVAIPKSVHKERMAENFDVFDFELSDEDMATMASLDKHESQFFDHRDPTAIVSIF
FT                   GQSLRALRS"
FT   gene            complement(683682..686066)
FT                   /locus_tag="BIF_01664"
FT   CDS_pept        complement(683682..686066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01664"
FT                   /product="Thermostable beta-glucosidase B"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01664"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85060"
FT                   /db_xref="GOA:D3R7H8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H8"
FT                   /protein_id="ADC85060.1"
FT                   /translation="MQCDNARIYDIFIHEARLRSFSCPHYAMPRTCTQLPVPDAHERSR
FT                   MPHASQQNTTPAHELPLEKRAALTSGADAWHLNGLSESTSYMITDGPHGLRKAAQSTSM
FT                   DIEHSMPATCFPPAAGMASSWNPGLVREVGVAIGEECVQEKVAVLLGPGVNIKRNPLGG
FT                   RSFEFWSEDPYFAGHEAIGIVEGVQSTGVGTSLKHFAANNQETDRMRIDARVSERALRE
FT                   VYLPAFEHIVTKAHPWTVMCAYNQLNGTPCSQNSWLLTKVLRDEWGFDGVVISDWGAVH
FT                   DRVEALKAGLNLEMPPTNTDEQVVVAVRDGLLDEDQLDRMAQGMLDLIEKAAPAMQQDD
FT                   HPYDLVNHGAIARRAAQESMVLLKNDGGILPLAADGSVSIAVIGEFARTPRYQGGGSSK
FT                   LTPTYVSSFLGSLHIRDIPVDFSPGFTLDDAKQDAALTAHAIDMAWRNDVVLFFAGLPE
FT                   EAESEGFDRETIDLPQKQLRLLADIVKVNPNVVVVLSNGSAVSVTPWRDSVRGLLEGWL
FT                   LGQEGGNALADVIFGDVSPSSKLAQTIPMSVLDDPSMPNWPGEAGHVDYGEGVFVGYRY
FT                   YDTFGRQVAYPFGYGMTYSTFEIRNLSAIPHDNTVQVSAIVTNTGQVRASEVVQLYVAP
FT                   CACDAARPAHELKGFEKITLDPGEASIVTFELDSRSFAYWSEPRNDWHVERGTYTIEIG
FT                   SSSRDIAERVQVELPGDGIRLPLTLSSTFDEWSDDPIGGPILQAAINRLSQQEGHPIIP
FT                   ESDMLRMLLGSMPMNATNVLLGSAAGRLCERIMGLYNASNQ"
FT   gene            complement(686145..686591)
FT                   /locus_tag="BIF_01665"
FT   CDS_pept        complement(686145..686591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01665"
FT                   /product="Aminoglycoside 3'-phosphotransferase"
FT                   /EC_number="2.7.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01665"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85061"
FT                   /db_xref="GOA:D3R7H9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7H9"
FT                   /protein_id="ADC85061.1"
FT                   /translation="MLRELHELPHTKHEQVATLAIPDVLADYLANAEHGVHTGRFDAQF
FT                   CGLSQDDARRIIAERPETLHSDALIHGDYCLPNIMLDDWRLAGFIDLDHAGFSDRHVDI
FT                   FWGIWTLQFNLHTDAYRDRFLDAYGRDRVDQDKLELIGAIESFG"
FT   gene            complement(686688..686957)
FT                   /locus_tag="BIF_01666"
FT   CDS_pept        complement(686688..686957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01666"
FT                   /product="Aminoglycoside 3'-phosphotransferase"
FT                   /EC_number="2.7.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01666"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85062"
FT                   /db_xref="GOA:D3R7I0"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I0"
FT                   /protein_id="ADC85062.1"
FT                   /translation="MQHTPIESIPNLPAQLRHYTAGRRLYDSSSSPEARVYALSGGTRE
FT                   NARPDLFLKTAASGTLAHEARMDDTFHMLGIGPEVLEYLPGSES"
FT   gene            687133..687627
FT                   /locus_tag="BIF_01667"
FT   CDS_pept        687133..687627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01667"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85063"
FT                   /db_xref="GOA:D3R7I1"
FT                   /db_xref="InterPro:IPR025328"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I1"
FT                   /protein_id="ADC85063.1"
FT                   /translation="MRERERHMTYATPPMQGTPMPAPPVQQMRPNAYRLPTNRSLTKFI
FT                   LLGLITFGIYDIVIMTTTAEALNTIASPRDGKKTMNYCLMYFLIGWLTLGIGWLVWFHN
FT                   FSDRIGEEQRRRGMVPTVTASTFWLWEVLGSLIVVGPFIYHYKMLHAMNDLCASYNAYG
FT                   I"
FT   gene            complement(687957..689300)
FT                   /locus_tag="BIF_01559"
FT   CDS_pept        complement(687957..689300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01559"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01559"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85064"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I2"
FT                   /protein_id="ADC85064.1"
FT                   /translation="MIEKLNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGP
FT                   GLRQIRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLPVRVRRYECVPCS
FT                   RSWSDDLEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGM
FT                   LLLEQADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQ
FT                   VLREWMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKV
FT                   RCRLQRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDA
FT                   YQRVIHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRH
FT                   PRSSNGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            689362..690888
FT                   /locus_tag="BIF_01558"
FT   CDS_pept        689362..690888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01558"
FT                   /product="Glucosylceramidase"
FT                   /EC_number="3.2.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01558"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85065"
FT                   /db_xref="GOA:D3R7I3"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I3"
FT                   /protein_id="ADC85065.1"
FT                   /translation="MMKALKTTVHYDVTAGRTHTEQTELSVMDEAMNTEHIVESNVVGI
FT                   YPDYTFQMMEGYGCSLTESACYLLSKMDSATRKEALAQWFGPAGMDAWFVRVHIDSCDY
FT                   SLSEYQAVEDPLADPELETFSIDRDRQYILPVLKEAMAMAGHPIHVLLSPWSPPAQWKT
FT                   PPEMTRNDASVYGGEEGDVIDLSKPGRCFGGRLKPEYYSSWARYLVRFISAYMAEGVPV
FT                   TMLSIQNEAAAATSWDSCLWTGDQEREFLKHHLYPAMEEAGLTDAVKIFIWDHNKERAI
FT                   EHIDEFMSDPEAAKEVGGFAYHWYSGDHFEALSMLRGKYPDKVLMHSESCGLHIPGKVT
FT                   MLDMTDEQIEALPDGDYKTMVQTTTPNEMDFNDATAYAHDIIGDLNHGMQRWIDWNMIV
FT                   DRQGGPRHTPGGFAAPIVAEDDGRYTLTISYRYIREIAQAIKPNAVVLGTSTYSRDIEA
FT                   VSARNADGSIGVVLLNQAERDIPVNIRMGGLLVADVPLPARTLSTLVFTE"
FT   gene            complement(690993..693152)
FT                   /locus_tag="BIF_01474"
FT   CDS_pept        complement(690993..693152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01474"
FT                   /product="Beta-galactosidase"
FT                   /EC_number="3.2.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01474"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85066"
FT                   /db_xref="GOA:D3R7I4"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I4"
FT                   /protein_id="ADC85066.1"
FT                   /translation="MPPHRSPCTTHSGTKERHMARAYTDPILFGAAYYDEYIPRDLDRI
FT                   DTDMEMMTRAGINVIRIGESTWSTCEPQPGHFDWTHIDRALDAATNAGINVIVGTPTYA
FT                   VPTWLVAMYPDVLATTPAGEPHYGARQIMNIVNPAYRLYGERVIRSLISHVAQQPCVIG
FT                   YQVDNETKYYDSVSHDMQVMFIKQLRHEFKNDLEALNEAYGLDYWSNRINAWEDFPDLT
FT                   GSINESLRARFDRFRRDQVAEYLAWQASIIREYMRDDQFITHNFDYEWRGHSYGLQPAV
FT                   DHFRAARALDICGVDIYHPSEDALTGKEIAFGGDMARSAGGGNYLVLETQAQGQHGWLP
FT                   YPGQLRLQAYSHLASGADGIMYWHWHSIHNSFETYWRGLLSHDFESNPTYEEAGRFGRE
FT                   IGDPRIGDTLSHLSKRNAVAILASNESLTALSWFHIETGFPMGGTLTYNDVLRSIYDAL
FT                   FELNVEVDFLPADASADQLAGYSLVIAPALYTTDQQTIDRLARYVKNGGHLLATMRSFV
FT                   ADENVKVWHDKAPHHLVDIFGMTYNQFTRPMGVSLKCPDTLADLAGASANDFIEMLSPA
FT                   PETHVLAWYDHYAWDSYAAITRHAFGSGDAQWVGTQLQADAWRTVLAEALSNAGVHTPG
FT                   MELAGTVCVRSGTNTAGDTVTYLLNYSGSPITFRAPASGTFLLGHPTDDGEQAVTAETP
FT                   VTVGDAVTLPRWGVDIIVGRQPTMN"
FT   gene            693334..694662
FT                   /locus_tag="BIF_01473"
FT   CDS_pept        693334..694662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01473"
FT                   /product="Transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01473"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85067"
FT                   /db_xref="GOA:D3R7I5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I5"
FT                   /protein_id="ADC85067.1"
FT                   /translation="MVVKCVLRNPSSSSLVLLSKEIEMSTVSLEQTSSALSRSDRIRLL
FT                   ASFLVFPLLWCSGLFMVAAVLLPQRLRDVMGADAATAAFGVINACTAFISLLSNLVVGN
FT                   LSDHTRSRFGRRTPWVISGGIVGGVSLALVGFLDNVWLIGISYCVCMIGLNMMIAPVIA
FT                   TLSDRVPANMRGTMSAFLAGGTAVGSALGQMLGSRFLSNQIPGFLLSGTLMGLAGICTV
FT                   LVWPKEPSSKHLAKTSNGFGDMLKSFIPPTKGARDFWLAFVGRSLFIFAYYMILNYQLY
FT                   VLEDYVGQSAQQAGNTIAVMSMVSMIVGLVSSLAGGPISDRIGKRKIMIVLASVLMAVG
FT                   FVLPWILHSPLSMILFAGFSGFGYGLYGAVDQALNVDVLPNKEEAGKDLGILNIATTLG
FT                   QMVGPIVTSAVVAATGGYTVVFPVAIGFAAFASLFIMLIKSVR"
FT   gene            complement(694717..695358)
FT                   /locus_tag="BIF_01472"
FT   CDS_pept        complement(694717..695358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01472"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01472"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85068"
FT                   /db_xref="GOA:D3R7I6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I6"
FT                   /protein_id="ADC85068.1"
FT                   /translation="MQPSVEESVNTRTRKSPQQREEEILRATVKLISQRGYNGISLRDV
FT                   ASEVGMTQQGVLHYVGNKAGLAAMVMKEFYDPTSMPGDFLASGLPGSDRDAPHFPAYLR
FT                   YVVRENAKRRDLVQMFAILQAESIDPDHPAHDYFEHRPAIIWQTLSNYQWKLPPQIGTW
FT                   ENFKPLHRMALEAMDGIQLRWLRSDPIDLYDEWIAFERILFPSPVWDNYR"
FT   gene            complement(695511..695999)
FT                   /locus_tag="BIF_01657"
FT   CDS_pept        complement(695511..695999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01657"
FT                   /product="Non-specific DNA-binding protein Dps"
FT                   /EC_number="1.16.3.1"
FT                   /note="Iron-binding ferritin-like antioxidant protein;
FT                   Ferroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01657"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85069"
FT                   /db_xref="GOA:D3R7I7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I7"
FT                   /protein_id="ADC85069.1"
FT                   /translation="MHMALSFIIPGLDEVASEKIIGILQERLSQEQEAALVLKHAHWNV
FT                   AGPNFIAVHEMLDPQVDEVLAMADETAERIAALGGSPSGRPDDIVRYRTWDKFELEGRQ
FT                   NTLDYLRALDKYYDSFIKADRTAIKELDDLDVISSNIVQDHVLKLEQFQWFMRSFLID"
FT   gene            complement(696118..697473)
FT                   /locus_tag="BIF_01656"
FT   CDS_pept        complement(696118..697473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01656"
FT                   /product="CorC"
FT                   /note="Magnesium and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01656"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85070"
FT                   /db_xref="GOA:D3R7I8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I8"
FT                   /protein_id="ADC85070.1"
FT                   /translation="MSLGLNILLIFVFLLLGSVFAGTELALVSLRGSQIDQMEQEDARG
FT                   KRVAKIARDPNTFLSTVQIGVTLSGFLSASFGESSISPFIVPVVEGWGVPSNVAAPLTT
FT                   IVLTLVISYCSIVISEMVPKRIAMQRNEQIARAVVPAISAFAKVCRPIIWLIGKNTNGI
FT                   VRLLGFDPNETESEVSDEELRVLVSSNTNLTKDERTILDDVFDASETIVAEVMRPRADV
FT                   VFLDGDTPLADAAAQVRELPYSRYPVIGKSFDDVLGFVHVRDLLDVRDPNAKTVADVTR
FT                   EGISLPGTSKLLPSLSLLRKRGIHLAVVIDEYGGTDGIVTLEDMTEELVGDIRDEYDLP
FT                   EDTPKDKLPTDVFVDGVATIDGGMTIEDFADLTGIELEDGPYETVAGYFLAHSGKMGEV
FT                   GDHLVVDDAYTMTITKVDGRRIETIEVRKGTANGGTEVSDDQQANDPEHSDK"
FT   gene            complement(697757..698479)
FT                   /locus_tag="BIF_01655"
FT   CDS_pept        complement(697757..698479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01655"
FT                   /product="Carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01655"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85071"
FT                   /db_xref="GOA:D3R7I9"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7I9"
FT                   /protein_id="ADC85071.1"
FT                   /translation="MMYRNPADIEAIRGIMTDSTQETTANSTWSRMLAGNRRFAEGNAE
FT                   HPWRDKETRESLIDTQNPDAAVLSCSDSRVPPEIIFDAGLGDMFTVRTAGEMLDQAVLQ
FT                   TLEYAVSSLHVSLLVVLSHQHCAAVAQAEKELDALTEHLTHEITDAQERERIMEDLDEV
FT                   IASSSSEFLKNIGISVWQARMAGLDSRDDYEQVHIAHTIEQLVTSSEMIRDALAHERLM
FT                   IVGARYRLDTGLVEVLSF"
FT   gene            698501..699643
FT                   /locus_tag="BIF_01654"
FT   CDS_pept        698501..699643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01654"
FT                   /product="Transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01654"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85072"
FT                   /db_xref="GOA:D3R7J0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J0"
FT                   /protein_id="ADC85072.1"
FT                   /translation="MMCSRAEVAMAGHRGAKRPSIFEVAKLAGVSHQTVSRVINHSPNV
FT                   AEATRAKVEHAIAELGYHPSNSARSLASNRTRTVGMIAGGQRFYGPVSALASIEATARA
FT                   HGMFVSVAMVHEAECTQQEFDDLCGMFMQQGVDAFIFLTPTDEMFKVACKSQVSQPCVI
FT                   ITSSHGGVSVSEGLHMFNARQRRRVSLVGIDQWAGMASVMRLIRKHGHRNVLFFAGPGQ
FT                   WRDASTRLMAWNKLCAQNTVNSVTVQCGDDWESADAYRRMNHILDNIGSNGGRLPTCAV
FT                   CSNDVMAIGVIRALLEHGVRVPDDMSVTGFDDMPGMSNLYPPLTTVRQDFDDLGTMAMK
FT                   EALFLMGEEAEPGYPNSQHGVGLVSADLIVRQSVRAAPRR"
FT   gene            complement(699696..699923)
FT                   /locus_tag="BIF_01653"
FT   CDS_pept        complement(699696..699923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01653"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01653"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85073"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J1"
FT                   /protein_id="ADC85073.1"
FT                   /translation="MNINSTARARLYALTAVACAIWLFQNCVEANASGDLLSWSNIILS
FT                   ICLIIVTGYCAVNAVLGWNTKSADTEDPSK"
FT   gene            700036..700950
FT                   /locus_tag="BIF_01652"
FT   CDS_pept        700036..700950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01652"
FT                   /product="Sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01652"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85074"
FT                   /db_xref="GOA:D3R7J2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J2"
FT                   /protein_id="ADC85074.1"
FT                   /translation="MAGWMACCRPTGLQSLALLALGEDVHRHGAQEHKTLDRLHHCGVD
FT                   AHDRQALVDDAHDQCADNGAGKSTLVHVLAGLEQPDAGSIAVGGETVRLDGVAKAIDLG
FT                   IAPAFQQPQFCENLDVSANIFLGREMRQGFASRDDEGMYNKAREVLNTLSTSVRAGQSI
FT                   ASLSGGQRQTIAIARTLLNDPSLIVLDEPTASLSVTQTAEVLDYIVRLRSDDRSVIMVC
FT                   HDLPNVFAVADRIVVMRLGEIRAVHNTSETSYEEDIAEIAGVGGSGTTPSRPCERASRA
FT                   RMPIARESHPRPSRGGDRDGTMA"
FT   gene            701151..701492
FT                   /locus_tag="BIF_01651"
FT   CDS_pept        701151..701492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01651"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85075"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J3"
FT                   /protein_id="ADC85075.1"
FT                   /translation="MGAAEIVVTVVTAVACLGMGVFLGSLPFKRDELTEWHMKYQQLGG
FT                   VLACGIVIVLMLLGYDLASWLAIAALAVGVAVSRIPVVRRGLLARFPELHPAERQSPLR
FT                   KGTSKKRRS"
FT   gene            complement(701487..702521)
FT                   /locus_tag="BIF_01650"
FT   CDS_pept        complement(701487..702521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01650"
FT                   /product="Transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85076"
FT                   /db_xref="GOA:D3R7J4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J4"
FT                   /protein_id="ADC85076.1"
FT                   /translation="MAKGVTIKDVAAEAGVSFKTVSNVINGTGSMRESTRGRVLEAMDK
FT                   LNYTINLSARSLKTGTTGLLGLAIFDFSQPFASYLADQIIVCAREHHYGVIINTYGQNE
FT                   HGLARAMRQANNLAADGWIVFADHAMGQHSKMLDQSYPLVLTGDWDAYGKVDQVTMPNV
FT                   EAMRYTTNRLLDSGYRSIALFGADGSLGARHYRQATEGTQELRVQGYMQAYEEHGIEAR
FT                   MDMLFSGGLLTSDSGVRATNLMMDQGVRPDAIICLNDAMALGALHQLQVRGIRVPDDVQ
FT                   VVGFDNVPEATYANPSLTTIDPHIDSYARHAVDMLIERIQGYDGAKRVYTSDFTLVERS
FT                   STSL"
FT   gene            complement(702639..704213)
FT                   /locus_tag="BIF_01649"
FT   CDS_pept        complement(702639..704213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01649"
FT                   /product="Alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01649"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85077"
FT                   /db_xref="GOA:D3R7J5"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J5"
FT                   /protein_id="ADC85077.1"
FT                   /translation="MHSVQQRGKHTMPQHSEAQARLVVDDEFRVGPVHDRVFGSFVEHL
FT                   GRCVYTGIYEPGHPTADAEGFRQDVIDLVKELGATTIRYPGGNFVSGYQWEDGIGPKEN
FT                   RPRRLDLAWHSTETNQFGLHEMVSWLNKAGGNELMEAVNLGTRGLPEALDLLEYANVPE
FT                   GTARSEERIRNGADNPFDIRMWCLGNEMDGPWQLGHKDAEAYGKLAASVAAGMRMLDPD
FT                   LELVVCGSSNHTMDSFGKWEETVLEHTFDKVDFVSAHAYYFPQLMENGSRDMASFLASG
FT                   VDMDGFIKDVGAAIDATKARLKSDHNVYISFDEWNVWYYEEEPSKNPEGIGNWPVAPRL
FT                   LEDVYTVADAVVVGDLLITLLQNADRVHAASLAQLVNVIAPIMTEPNGPAWRQTTFYPF
FT                   SLTAAWAKGGDVLEPKIESTQYHTNRYGNVNSTNAVAVRGKDGSVSVFVTNRSLDDGCD
FT                   FEIKLPEGFTPTELDVRTLHDDDMLATNTVNHQDRVVPHPNDTASIQDGMVTVTLPPVS
FT                   WTAIHLR"
FT   gene            704439..706118
FT                   /locus_tag="BIF_01648"
FT   CDS_pept        704439..706118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01648"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01648"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85078"
FT                   /db_xref="GOA:D3R7J6"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J6"
FT                   /protein_id="ADC85078.1"
FT                   /translation="MSANIYMTHEFIAELNPEAGGTMADSKAIAQAIRDGRTSLGIEFG
FT                   STRIKAVLIDDERNTITTGDYGWQSHLVDGLWSYDVDKIWRGLQSVYADVADRVEADYG
FT                   LKLTRIGQIGFSAMMHGYLAFDADGELLVPFRTWQNTNTSEAHEKLSELFQYNIPERWS
FT                   IAHLYQAVLDNEPHIGSVRYFTTLSGYVHWKLTGRKVLGIGDASGMFPIDPNTKTYEQG
FT                   FIEQFDALPEVAAQPWKLNDLLPEPLVAGTPAGELTPEGAALLDPSGVLQPGTMLAPPE
FT                   GDAGTGMVATNSVRRRTGNVSAGTSIFATVVLEHKLSKLRPEVDLVTTPAGDLAGMSHA
FT                   NNFTADLNGWVDLFRQFSQLNGRNVDDGTLYGELFRAAIGEDADPDAGGLLAYPFRTGE
FT                   FLAGLAEGRPLFVRGPEARFSLANFMRAQLFGAFSPVTIGMNVMTEDEGVEIDSLVGHG
FT                   GIFATPVVAQRILAAAFNTPIRVMTTASEGGAWGMAVLADYLRHADLTLADYLDDVVFA
FT                   GAESVTEAPRPDDVDGFQRFFARFVKALPVERSAVEHVEIGG"
FT   gene            706033..706866
FT                   /locus_tag="BIF_01647"
FT   CDS_pept        706033..706866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01647"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01647"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85079"
FT                   /db_xref="GOA:D3R7J7"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J7"
FT                   /protein_id="ADC85079.1"
FT                   /translation="MDSSDSSPDSSRRCRWSAVPLSTSKSVGESAAYGSAQVSETVQKG
FT                   TTMATLADYGPEVRAEVKQVREVVAALHEQLIKWNLVVWTAGNVSQRLRTADLMVIKPS
FT                   GLRYEYLTPSSMVVCDLDGNVVDGAESPSSDTASHAYIYRHMPEVYGVVHTHSTYATAW
FT                   AATGQNIPCGLTMMGDEFGGPVPVGPFRLIGSEAIGEGVVETLKAYPKSPAVLMQNHGP
FT                   FTIGKDAEAAVKAAAMTEEVAHTMWAAKQLGDIIPIPQEDIDKLNDRYQNVYGQH"
FT   gene            707130..708647
FT                   /locus_tag="BIF_01646"
FT   CDS_pept        707130..708647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01646"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01646"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85080"
FT                   /db_xref="GOA:D3R7J8"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J8"
FT                   /protein_id="ADC85080.1"
FT                   /translation="MAMENPFEGKEIWFGVGSQDLYGEEALRQVAQQSAEIVDSLNASG
FT                   RIPVKLVLKPTLKSSDGVRRFMVDASADDSCIGVITWMHTFSPAKMWIRGLEALRKPLL
FT                   QLNTQHHFEIPWETIDMDFMNLNQAAHGDREYGYIVTRLGIPRKIVVGHYTDPAVADKI
FT                   GVWARACAGWQASNTMNVMRWGDNMRNVAVTEGDKTEAERVFGASINTWAVNELVAAYD
FT                   AVKENQIKDLIEDYKAKYEIAPELLDKDYDSLFIAAREECAMVNMMRANGCTAGVDNFE
FT                   DLGALPQLPGVGPQRFPSEYGWGFSAEGDWKTAVLVRIGAVMGYGLEGGASLMEDYSYN
FT                   FTPGNEMIMGSHMLEVSPSVGTIAKPRLEIHPLGIGGKADPVRLVFTVAPKKDAVVVSL
FT                   ADVRTRFRMLMNVVDVVEPLGSLDKLPCARALWKPEPNLEISAECWLRAGGSHHTCMTT
FT                   SVGREAWEDFARIAGVELAAIDAETTPREFERELEIEDVFHELANRH"
FT   gene            708782..709645
FT                   /locus_tag="BIF_01298"
FT   CDS_pept        708782..709645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01298"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01298"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85081"
FT                   /db_xref="GOA:D3R7J9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7J9"
FT                   /protein_id="ADC85081.1"
FT                   /translation="MSTLADQTPDIPLITLHDGSRIPQIGLGVLRIDDEGVVPVVESAL
FT                   AIGYRHIDGAAGYNNEEGVGRALAATGYNTGEQRESLWMTTKLRDSEQGYDSAMHAFDR
FT                   SLELLQLDYVDMYMIHWPTPFDWRSGETWKAFAKLREDGRVRTLGVCNFMPEHLDRLYE
FT                   ETGEYPTVNQIELHPTWQQRDVVEYCHAHDIAVEAYSPMARGADLANGVIERIAEAHGV
FT                   TPAQVILRWHIENGTIIIPKSVHTERQRENLDLFGFSLTPQEHAEIDALDGPTRAGHDP
FT                   MTFTYA"
FT   gene            complement(709886..712732)
FT                   /locus_tag="BIF_01297"
FT   CDS_pept        complement(709886..712732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01297"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01297"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85082"
FT                   /db_xref="GOA:D3R7K0"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K0"
FT                   /protein_id="ADC85082.1"
FT                   /translation="MGSQRSAPRTAEEPQKTDRPSNPMFGERGRMTDQEQTITPADATI
FT                   VSSGLGTKGPEERTLPATLQEDMDLCLNILRQVLSEYDENLLKTFDTVRQYAVDASAER
FT                   FSGVLTDTHPERDDLEMAVKTIDAMNLHDAQLLARAFATYFHLANLCEENYRVAVLHER
FT                   EAKVDDTQAIDPVNEMTKAYHQLISEMGPAKAKELLERLEFHPVFTAHPTEARRKAVEG
FT                   KIRRIAQLLEAHRLLGGSDKKEDSRRLYSEIDALFRTSPIALKKPTPVEEADTILDIFD
FT                   NTLFHTIPMVYRRFDDWMLGDKAGIEPPACPAFFHPGSWIGSDRDGNPNVTAKVSRQVA
FT                   RKFSDHVLAALEEATRTVGRNMTVESETTPPSDELRALWNQQKEISERLTGKASLISTK
FT                   ELHRAVLLVMADRLHYTIKRDTDLMYHNCDDFLADLRVVQRSLAEAGDKRAAYGPLQDL
FT                   IWQTETFGFHMVEMEFRQHSVVHARALDDIREHGLHGERGPLQPMTHEVLDTFRALGAI
FT                   QKRNGVKAARRYIISFTKSAKNVRDVYELNRLAFSNPDDAPVIDVIPLFEQLEDLEHSV
FT                   SVLDEMLKIPEVQARLKQTGRKMEVMLGYSDSSKDAGPTTATLALHSAQERIAKWADEN
FT                   DIDLTLFHGRGGAVGRGGGPANRAVLAQPKGSVKCRFKLTEQGEVIFARYGNPVLAIRH
FT                   VESVAAATLLQSAPSVEKTNTEMTEKYKPMANQLSEVSHETFLDLLNSEDFAPWFSIVT
FT                   PLTEIGLLPIGSRPAKRGLGAKSLDDLRTIPWIFSWAQARINLAAWYGLGSACESFGDL
FT                   ATLRKAYEEWPLFSTFIDNIEMSLAKTDERIAKMYLALGDRPDLSKKVLDEMELTRKWV
FT                   LKIVGDEWPLQHRHVLGQAIRIRSPYVDALSVTQVLALRSLRKKVDKEELSESQQAGFI
FT                   YLILCTVSGVAAGLQNTG"
FT   gene            complement(712639..712950)
FT                   /locus_tag="BIF_01939"
FT   CDS_pept        complement(712639..712950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01939"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01939"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85083"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K1"
FT                   /protein_id="ADC85083.1"
FT                   /translation="MRCAGHDHACRRWWLQILLRSCSHLYFYYPRANIRDGRRQRRNLT
FT                   LRPPLPKRNKRVSCSYLQYKRNFTEHGLWARNDRRQELRRSRRRPIDRATQCLEKEVE"
FT   gene            712881..714629
FT                   /locus_tag="BIF_01010"
FT   CDS_pept        712881..714629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01010"
FT                   /product="Threonine/Serine Exporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85084"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K2"
FT                   /protein_id="ADC85084.1"
FT                   /translation="MSKSEEESATTTDDMHGHDRHSARVHWRSRPVKSAAGAVRRFHSH
FT                   AIPLDMEDIERDWDKPITDAGIAAKASVIVRVGMLDLGAGTGSFRVREMMHRIAYPLGV
FT                   HVRADVNLTDVQASCTDGKERITEVVNLPTTGVNTERIWLLEHFADWFSVNLGAGTMYH
FT                   RRTEVSRQLMQPNTLGTRDASQISAETAKQLRERLRQEARAQKLAAKRASLRSRVAERV
FT                   AERAKKKLPEDEYAEHFDHLEEHAEKRVRESGPITVGQVHKRLDLIERRKPLYSSAFSG
FT                   FAAACACAAFVFLLGGAPYDMIGAFIGAGLGQWARRRLFAHHLNQFFVTFVAVAVAALA
FT                   CVGTLRLIGIFDPVALHHDTAYIGAMLFVIPGFPLITGGLDMAKIDFPSGVQRIAYVCC
FT                   IILMATLAGWMVAVLVHLNPQGFDTPPLNPWATGALRALFAFVGVWGFSVLFNSPQRMC
FT                   LVAATIGMITDTLRLEIVDWGVPAEAGAFIGALLAGLIASAWRSAVRHGLLAPHLGYPR
FT                   ICLTVPSIVIMVPGLYMYRAMFYLGQFNTLLALDWAFRAFMVIICLPIGLAMARVITDK
FT                   SWRYDV"
FT   gene            complement(714720..716063)
FT                   /locus_tag="BIF_01938"
FT   CDS_pept        complement(714720..716063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01938"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01938"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85085"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K3"
FT                   /protein_id="ADC85085.1"
FT                   /translation="MIEKLNEETRPEPEFSVFDPQRFLGLDEMGLRVLSWRRLGRPDGP
FT                   GLRQIRCEPDSHDARWCPSCGAYARVRSSWLRTLAHVPYGDDAVHLLVRVRRYECVPCS
FT                   RSWSDDPEAVGAGRGVLSVPAVMWALRRVCLDSMTVSACARLLHVAWAVVDRAVRERGM
FT                   LLLEQADRFSSVRAIGVDEHVWRHGAFGDRYVTVIVDLTPRCDGRPARLLDMVPGRSAQ
FT                   VLREWMQARGGEFTRRVGVVAMDAFAGWKQAVESVVPHAVEVIDPFHVVQLAAARVTKV
FT                   RCRLQRDATGRRGVKGDRLYDCRRALLTSDEYLGARGRARLMALFAIQANRDLMLAHDA
FT                   YQRVIHAYRCDDRRRGERMMRELIDDLTGPGRYKGCRELASLGRVLKRRMRDILALFRH
FT                   PRSSNGPTEAINGRLETLRGNAMGFANTTSYIQRCLIHSSQLKDILTH"
FT   gene            complement(716206..717348)
FT                   /locus_tag="BIF_01081"
FT   CDS_pept        complement(716206..717348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01081"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01081"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85086"
FT                   /db_xref="GOA:D3R7K4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K4"
FT                   /protein_id="ADC85086.1"
FT                   /translation="MQTHAYRREEATGMTDDMNAQLTAAGNEMSASFLAAKKRSDETLA
FT                   KLKANPGKFTMLTGDRPTGRLHLGHFFGSIRERVAMQNLGVNTNIIIADYQVITDRDTT
FT                   EHIDDNVLNLVLDYMAAGIDPEKTMIFTHSAVPAENQLMLPFLSLVTEAELHRNPTVKS
FT                   EMESSGHALTGLLLTYPVHQACDILFCKANVVPIGKDNLPHVEITRTIARRFNERYAKK
FT                   NPVFPEPAAILSEAPEIPGLDGRKMSKSYGNSIMLGATAEETAKLIKKSPTDSERTITF
FT                   DPVNRPQVSALLTTAGLVTGRDPSEIAAEIGNAGAGALKKYVIDSVNEFLAPHRERRAE
FT                   LAKDMDSVRDILHDGNARANAIANQTLDEVREAMGMRYDR"
FT   gene            717470..717817
FT                   /locus_tag="BIF_01080"
FT   CDS_pept        717470..717817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01080"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85087"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K5"
FT                   /protein_id="ADC85087.1"
FT                   /translation="MGRGRQKAKQQKIARKLKYMTTDTDYDELAKELGAHEPGTGSFDP
FT                   FADVENDEFEAQDVDETVDDLDEYAKWAAEAAAKATTGEMPETHAQPKPKPHKPIPMPV
FT                   PETFKHTDQQE"
FT   gene            complement(718016..718471)
FT                   /locus_tag="BIF_01021"
FT   CDS_pept        complement(718016..718471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01021"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01021"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85088"
FT                   /db_xref="InterPro:IPR041629"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K6"
FT                   /protein_id="ADC85088.1"
FT                   /translation="MGKQPIVIERSMQNHSMAAIRKQDMMRGMQAYDDWCTAARAAAET
FT                   TPALDIAPRLDRATMAMAVRYSLHQLEIKAPGPGVEVRVAPYAVVKILEGPASDPHNLT
FT                   PPDVIELDPQVWLRVASGITTWHEEQKAGRISAVGERDDLSPLLPLG"
FT   gene            719001..721457
FT                   /locus_tag="BIF_00871"
FT   CDS_pept        719001..721457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00871"
FT                   /product="Glycogen phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00871"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85089"
FT                   /db_xref="GOA:D3R7K7"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K7"
FT                   /protein_id="ADC85089.1"
FT                   /translation="MTELTAPKSPLTANEFADEIRQALKYTQGVTPEQAKTADVYVATA
FT                   TVVRRHLMDSWMKTQQDMINGDTKAVGYLSAEFLMGKQLRNALLNAGLTPQFEEAVRGL
FT                   GFDPQAVVDAEYEPGLGNGGLGRLAACFIDSLASLGVPAFGYGIQYKYGIFRQEFDDEG
FT                   RQIERPDYWLSNEDPWGHIDYERDQRVNFGGKVVEENGKRVWKPSWAVRAIPVDYMVPG
FT                   YASGRVNTLRLWQARSYDEFDLLTFNKSEYLDAVKPQVKAEDISKVLYPEDSTEVGKEL
FT                   RLEQQYFFASASIHDAIRVFYPDTDKPDLTTFADKITFQLNDTHPVIGIPELMRIMIDE
FT                   YGYDWDTAWEVTHKTFNYTCHTLLPEALEVWPASLIGKLLPRHLEIIERINKQFVSELE
FT                   AKGASEDQIKRMLILTDDEHPVVRMAYLATYAGSNVNGVAELHSQLLKDVTLRDFSDVY
FT                   PAKFKNVTNGVTPRRFIKLANPRLSELITEGLGTDKWLEDLDLLEGLAPLAQDDEFVKK
FT                   FAAVKHENKVAFADFSKQRYGAELDANTMFDTMIKRLHEYKRQALKILEIIATYSDIKS
FT                   GKVNVQDITPRTYIFGAKAAPGYYLAKMTIQLINNVAKVIDNDPDVNGKIKIFFPWNYN
FT                   IEVAQMLIPATELDEQISQAGKEASGTSNMKFALNGALTVGTLDGANVEIRERVGADNF
FT                   FLFGMTVDEVEKMYEQGYDPSKYYEADPRLKAAIDMVADGTFSNGDRNTYAPLVSDWLT
FT                   KDWFMTLADFSAYHDIQADIDALYADQLEWNRKAILNVANSGYFSSDRSIKDYLDRIWH
FT                   TRSLDK"
FT   gene            complement(721698..721925)
FT                   /locus_tag="BIF_01955"
FT   CDS_pept        complement(721698..721925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01955"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85090"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K8"
FT                   /protein_id="ADC85090.1"
FT                   /translation="MEKKSSNGWKFFALLFGGLLAAVVGLYIYKQQNPDYDPWEEPWEN
FT                   SSSPVDLTLAQDKTEDDLDQPAADAAKDAA"
FT   gene            722103..722969
FT                   /locus_tag="BIF_00591"
FT   CDS_pept        722103..722969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00591"
FT                   /product="Integral membrane protein (Rhomboid family)"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85091"
FT                   /db_xref="GOA:D3R7K9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7K9"
FT                   /protein_id="ADC85091.1"
FT                   /translation="MCLAVRIRQENKRASRPSTVGAMPRRGFSLFPDSPSARRIFSAES
FT                   LRARWRSGEPVVTSAIILVCVAVWLLETLFRFVWPAGLAGMLGFGMMQPASMTREPWTL
FT                   VTAMFLHQPASLWHIGFNMLTLWSVGPVLERLMGHWAFLILYMVSGIGGDAGMMIWALL
FT                   NRSGEGWFTSSYGASGALFGLFAAILVVYRKVGQDLTSMIVWMAINFLMPVIVPNIAWQ
FT                   AHVGGFVIGGLFTILMTDGVRALRRRPVLERALIYGAVLLVLLLVVCYACNTANPMRTG
FT                   SWIPFLD"
FT   gene            complement(723015..723350)
FT                   /locus_tag="BIF_00590"
FT   CDS_pept        complement(723015..723350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85092"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L0"
FT                   /protein_id="ADC85092.1"
FT                   /translation="MLCQSETRLAQPTSRTDTRERRTAYHTEDSVQYATDSHLNGSICG
FT                   SIRRIRRECTPRRHISRNLPNNLPERCPEMACFAEPSESSTAESTEMARHTEASAHRAI
FT                   AVPCKRG"
FT   gene            723514..723735
FT                   /locus_tag="BIF_02036"
FT   CDS_pept        723514..723735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02036"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85093"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L1"
FT                   /protein_id="ADC85093.1"
FT                   /translation="MRRRGETAQCSTRHCTCADLQVPRRRGLATAGKQVFDCGAVICGV
FT                   GKYEFEHVFELHACSFPQMWKTLWITWV"
FT   gene            723922..725373
FT                   /locus_tag="BIF_01564"
FT   CDS_pept        723922..725373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01564"
FT                   /product="Methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01564"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85094"
FT                   /db_xref="GOA:D3R7L2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041497"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L2"
FT                   /protein_id="ADC85094.1"
FT                   /translation="MLCQKRGLCPQLWITMCIYAGGYAPRNAYVGLQLIPRHALRRRRN
FT                   GMWLARISHIEEKTAAHEMANGCGTGSLVGMANLQMSQETREFIRAHAGEDVRELALHT
FT                   KRDVPGLDLPFALDQIAGREIARTKLPQWAACEGIVYPPHLAMEQCSSQFTAEYKAQVA
FT                   AQLVEEESEPTLVDLTGGFGVDFSAMVRGFAHGTYVERQERLCEVARHNLRELGLGGRA
FT                   DVVCGDGVDHLAQMPPATLIYLDPARRDEHGARTYAIEDCTPNALALRGQLLDKAPFVM
FT                   IKLSPMLDWRKTIADFVGSVAQVHITATGNECKEIVVVLARGEHERVRVVCVNDAQRLE
FT                   FEVGADSAGSWQRADVLDACELGAQRYLYEPNAAIMKAGAFGEITRNYDVRQIGANSHL
FT                   FVSEHPVADFPGRAFEITALGTMNKRDVRQVLGGISAANVSVRNFPLTVQQLRRKLKLR
FT                   DGGDVYLFATTVAGGHMLLRTRKLA"
FT   gene            725763..727106
FT                   /locus_tag="BIF_01565"
FT   CDS_pept        725763..727106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01565"
FT                   /product="Hypothetical protein ylxX/ylxW"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01565"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85095"
FT                   /db_xref="GOA:D3R7L3"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L3"
FT                   /protein_id="ADC85095.1"
FT                   /translation="MNAQNSGTNQLGLAFVPLIDSSTRFVFSCWRLTMRRICGDMSFSS
FT                   IVELSTAWILSSERSSASSSETTAASSARFSLSSARFSSRSAFFSESVCGSSVTVSDST
FT                   ATASPSESVAASTTTSSVTVALLSAASFAETSASVLCSSSSAICVVSFNRLPVIIVGMW
FT                   ESGPRASATSAKQPYLEVAMAKHGARHVRKTSVVGSMAVLVVVALVGYLVVTNLRVNKS
FT                   ATVSNDAAELIEHRVQRVDELQSEVNKLGSQIDDYNTLLRNNEMQSGNSEEAGQSTMLP
FT                   AVTGPGVTVTLNDSSMWRSAVDSSGSTADIDKYVVHQQDVEAVVDALWAGGAESMQIMD
FT                   QRVLPTSAVICSGNVLLLQGRKYSPPFTISAIGPVDGMLQSLDDSRAIQIYKQYVDAFG
FT                   LGYDVEVNRSLTFQRTPLVLNPLRYAKAFESGGSNESANGGQTTSATN"
FT   gene            727194..728348
FT                   /locus_tag="BIF_01566"
FT   CDS_pept        727194..728348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01566"
FT                   /product="Putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01566"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85096"
FT                   /db_xref="GOA:D3R7L4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L4"
FT                   /protein_id="ADC85096.1"
FT                   /translation="MKHGGRRGNASARQDGRIDRLPEVGGKRSVMRSVVMILAEILLTV
FT                   GLVCALYVVWMQWWTGVQSENRQIEERQSVGWAQPASDGANAKIAHPQQGDPPLQPEHA
FT                   SIGELIGRVYIPRFGDAWERNLVQGTDLAELNLHGLGHYVDSQMPGQVGNFAIAGHRNG
FT                   YGQPLGDVDKLQPGDAVVVRTKDYWYVYTYTNYTIVTPDETSVISANPEDPSAPPTKRL
FT                   LTMTTCEPKYTAPTHRWISFGEFKYWAKVSDGVPAELAKKGADGATKFISNEQTPFFAK
FT                   LKTLQPVIWGALIAYAIIFIAAAIAWRWPLLRAIREGRRPRPDVDIYGVLVRHQPGPAP
FT                   IRWLLALLLFVAVSLAIIEWACPWAASHIEILREMSNYTAVNTQ"
FT   gene            complement(728501..728608)
FT                   /locus_tag="BIF_02201"
FT   CDS_pept        complement(728501..728608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02201"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85097"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L5"
FT                   /protein_id="ADC85097.1"
FT                   /translation="MRAESVISLLTVSAPILPAGTPHRACMSTHHFITA"
FT   gene            728523..729236
FT                   /locus_tag="BIF_01567"
FT   CDS_pept        728523..729236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01567"
FT                   /product="Anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /EC_number="2.6.1.85"
FT                   /note="Para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01567"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85098"
FT                   /db_xref="GOA:D3R7L6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L6"
FT                   /protein_id="ADC85098.1"
FT                   /translation="MDMQARCGVPAGRIGADTVRSEMTDSARILVIDNYDSFVYTIVGY
FT                   LKTLGATVTVVRNDALDPHEDGVLDDYDGVLISPGPGAPSESGVSEDVIRLCAQTGTPM
FT                   FGVCLGMQALAEVYGCTVSHAPTIMHGKTSLVEHVDDEIFAGVANPMTATRYHSLAAEP
FT                   DSVPDELQVTAWTVDDHIVQGIRHRELPLFAVQFHPESVLTQDGYRLFANWLAVCGQES
FT                   AVEKSLGLQPKLAAE"
FT   gene            complement(729546..731735)
FT                   /locus_tag="BIF_01568"
FT   CDS_pept        complement(729546..731735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01568"
FT                   /product="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01568"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85099"
FT                   /db_xref="GOA:D3R7L7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L7"
FT                   /protein_id="ADC85099.1"
FT                   /translation="MPVPIPPAMRSPEALEGASMSSMPTTLDNGRYQLGQLVGRGGMAE
FT                   VHIALDTRLGRTVAVKIMRADLAHDEIFLTRFRREAHSVAQMNNPNIVNIYDSGEEVVT
FT                   LDNGQTEHLPYLIMEYVQGQTLRDIIKANGALSVSDTEHVMIGVLNALEYSHRMGIIHR
FT                   DIKPGNIMISEQGIVKVMDFGIARALDDSATTMTKSQGVVGTAQYLSPEQARGENVDMR
FT                   SDLYSAGCVLYEMLTGRPPFTGDSAVAIAYQHVSEVAAKPSSIVPGLNPMWDQIVAKAM
FT                   AKDRQNRYATATEFKNDILTYMNGGLPSAAAFNPLQDLSTINATKTQTMAAANDYPANE
FT                   GSTRVYNPVTGQFQTVPQDPNAAAGDTDTMVKSRSQKRLEAARKRKRNTIITVVVLVVL
FT                   ALAAAGGWYAWAHMQPPKKEYVTVPTFSATTTEERAKAQLAELGLQASIKQDTDSREPA
FT                   GTFTKQAPAGGRSVEKGSTVTVWFSAGPKSVPVPNVTGQSQADARAALEAAGFEVNSSV
FT                   QTEDSATIERDHVTRTDPAAGTSAEQGTTVSLWVSSGMTKVPSGLIGKSKDEAVDELQK
FT                   NGFAVEINTENSSQPENTVTRIEPNEGTSVERGASVTIWVSNGKVAVPNVVGRTLGEAK
FT                   AALTDSALNLKWKVAANSKDNDDAVVTASNPSAGSQVNPGTEVTLTTEPKESPSPSPSP
FT                   SNSNGSSGSNGNSGNGDSNSGSQSSQNQQNSDNKH"
FT   gene            complement(731671..732696)
FT                   /locus_tag="BIF_01569"
FT   CDS_pept        complement(731671..732696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01569"
FT                   /product="Serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01569"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85100"
FT                   /db_xref="GOA:D3R7L8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L8"
FT                   /protein_id="ADC85100.1"
FT                   /translation="MRLIEGQLIHCRYRLDSRLAQGGMGEVWKGYDIQLGRPVAIKALR
FT                   KDTTNQESKLRRLRAEARNSANLAHPNIAALFEYYEHDGIGFLIMEYVPSKSLADLYHE
FT                   LDGPMDPIRLLPILIQTARGLFVAHSHGVIHRDVKPANIMVSDNGEVKITDFGVSYSTN
FT                   QEQITQDGMVVGTAQYISPEQAQGQQATPQSDIYSLGVVAYEGLCGHRPFTGATPVDIA
FT                   AAHVNNPVPPLPNTVDFQLSQFVMSMLAKDPADRPQDALTVARVLSRIERRLLDQQTAL
FT                   SDTTMVNINGRVPRRVTSAPHHDLQTYQSAFPFAQQTQRDAGTDSPGHAIAGGFGRSIN
FT                   E"
FT   gene            complement(732693..734168)
FT                   /locus_tag="BIF_01570"
FT   CDS_pept        complement(732693..734168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01570"
FT                   /product="Penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85101"
FT                   /db_xref="GOA:D3R7L9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7L9"
FT                   /protein_id="ADC85101.1"
FT                   /translation="MPSMNKTLRQLFTAVIVLFVILGISSSIIMVNRANRLSHDSRNTR
FT                   ALYQTYGAPRGSILASDGTIIAKSDPVNDSFSYQRSYPQGDIYAPITGYFSIAQNADRG
FT                   IEASENELLTGESNALFWQHVKALFTGKENKGASIETSIDPKLQTAAMEALKNNDGAAV
FT                   AIEPKTGRILAMASTPSYDPNELASHDTGSVSKAYTELVTNPSNPMLNRAISELYPPGS
FT                   TFKTVVAAAALDSGKYQLDTQIPAGASYTLPGTQTQLTNAEEPGNGTDGKISLKDAMAW
FT                   SSNTAFAQLGVALGDESVSNMAKKFGFDKPIVIDGTDSNGLPMQAVASRFPTNVGDDRL
FT                   ALASIGQGDTVETPLQNAMIAAAIANDGKVMKPTLVDRVRFSDLSVMPDTKPQVMDTAF
FT                   SADTANKLTEAMEAVVTDANPNLEIPGVKVAAKTGTAQIGANNSSIDGWVMGFAPADDP
FT                   KIAVAVVVHNVDLYGSFAAGPIMTAIMKEALQQ"
FT   gene            complement(734152..735900)
FT                   /locus_tag="BIF_01057"
FT   CDS_pept        complement(734152..735900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01057"
FT                   /product="FtsW"
FT                   /note="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01057"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85102"
FT                   /db_xref="GOA:D3R7M0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M0"
FT                   /protein_id="ADC85102.1"
FT                   /translation="MIMAARVRYLLQIIFALLISALGFFQLSERMNGKPTSGSVVMQIV
FT                   CAIMFLVAWGLMSRFQKFGNQSIFACVLMLTSIGILMISRIDGEMDTAVAIRQMMWLCL
FT                   ALVCCYALFAFMKDYRILRRFSYVSMVIGLALLLSPMIPGLGREIGGARIWIGVGSYQL
FT                   QPGEFAKLFLAFFFASYLFNHRDQLAVGGRKVLGLQLPRLRDLGPIVIVWVASMGVLIL
FT                   QHDLGTSLMFFAMFVAMLYVATGRASWLIIGFLAFAIGCVAAAHLFAHVGYRVDAWLHP
FT                   FDSEIYNRYPGGSSQIVQGLFGLAAGGLFGTGLGEGHPAITPLANSDFIFASAGEELGL
FT                   VGVFAILMLYLLIIAAGMITAMKIKDGFGKLLASGLVFTMAFQVFTVVGGITLVIPLTG
FT                   LTMPYMAAGGSSLIANYILAALLIIISNAANKPQNDLMTDTFRMEAVHALSSRKPRQRK
FT                   ASGNATQVTKPRGNREEEPRPRTSQLPVTSAAVQQSAAVSASPAQDDSATQVVSPQPIV
FT                   APQQTSEPVSNTRNIPVSPQQATPSAGEETEAMAPLNPSVPPLPQQPHTPTNHQATTSE
FT                   GGAEHE"
FT   gene            complement(735897..737450)
FT                   /locus_tag="BIF_01058"
FT   CDS_pept        complement(735897..737450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01058"
FT                   /product="Protein phosphatase 2C"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01058"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85103"
FT                   /db_xref="GOA:D3R7M1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M1"
FT                   /protein_id="ADC85103.1"
FT                   /translation="MADLYMYSTTVSDVGTVRSNNQDSSFAGEHLVAVCDGMGGHAGGD
FT                   TASTIAIRSLAHIETDSAGGDVAKAAAIIEASTLAAHDAIVGKAKRERKLAGMGTTVTA
FT                   ITLVSDYWVIAHIGDSRAYLLRDGKLMRLTTDHSYVQHLIDTKRINEVEARNHPQRNVV
FT                   MRVLGDFDIDAHPDISIRRAEAGDRLLLCSDGLCGVLEDSTIEETLSHFTDPEECAQTL
FT                   VSMALKAGSTDNVSAVIADSTIALDADSFDLPHQTPLIGGAASATLEPIADIIHEPVAS
FT                   APALITRSSPAERAAALIASDSNKAAQSEEHDATQQVAQPSTVREENGELQDPDTGEIP
FT                   VIRKSDGRYSADPNDPEVARAIHHEHLQEKKQARSRRFRGKIIGSVVAVAIVAVLALGT
FT                   WAAYAWSQTQYYLASDNGVVTVYQGVPTNIFGYELSHAIEHTDLKVDELPEQWQDRLRQ
FT                   GISVDGYDEALSHVELIRTQFNDLKKEQEQKAKEDADAKAKQQKQANDSKSPTKSAQSR
FT                   "
FT   gene            complement(737457..738002)
FT                   /locus_tag="BIF_01059"
FT   CDS_pept        complement(737457..738002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01059"
FT                   /product="Hypothetical exported protein with FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01059"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85104"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M2"
FT                   /protein_id="ADC85104.1"
FT                   /translation="MITELTFAVLKYAFLILLWLFVWFITRSLYRDVAAFSPRKSRARR
FT                   RKEREVRKSNDALAVSASAQPLPVSAPTPSAAAPSDTAPTPTLLVIIDGPLAGTSVPLN
FT                   SSVITLGRAASNTVVLDDEFVSSHHARVYPDPNTGVWAIEDLHSTNGTVVNQQRISAPT
FT                   ILGPRVPVRIGATTFELR"
FT   gene            complement(738021..738722)
FT                   /locus_tag="BIF_01067"
FT   CDS_pept        complement(738021..738722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01067"
FT                   /product="hypothetical signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01067"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85105"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M3"
FT                   /protein_id="ADC85105.1"
FT                   /translation="MSVLDRFEKSVEGAVNGVFAKFGSKDLQPVDLSSALEREIDAEAM
FT                   PVGRDRTVAPNEYRFKLSTPDFDRIESWGSEAMANELADNLTQYAKSQHYAFVGPVVVI
FT                   FEEDLQLTKGNFKLTSESVQGNAVPVTTDEQAEDCPMLEVNNNQYLLTKDKTILGRGSG
FT                   CDIVIDDPGISRKHLEIDITDNGVIARDLGSTNGTYVEGHQVPAATLLDGNTITIGRTR
FT                   ILYWASSQDQR"
FT   gene            complement(738755..739228)
FT                   /locus_tag="BIF_02035"
FT   CDS_pept        complement(738755..739228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85106"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M4"
FT                   /protein_id="ADC85106.1"
FT                   /translation="MHGNIRKTDHGDTDLRHSLRKHPQIRPQRHPFTAWFTETSENHAT
FT                   AALIYGTAYGTIRKICRLRTHLQTTPRNLPKTRPSPRLSAAPLTEASAIQTANTSAERL
FT                   RIPVGPAHSRQCGNRGNKVGPYACSETANRCNPYAPRGKRGGPMRLKIHTVDI"
FT   gene            complement(739084..739248)
FT                   /locus_tag="BIF_02202"
FT   CDS_pept        complement(739084..739248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02202"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85107"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M5"
FT                   /protein_id="ADC85107.1"
FT                   /translation="MTFPAAHCTETSERLTTATLIYGTACGNIRRFGHNGTHLRHGSRK
FT                   HPKTMPRQR"
FT   gene            739487..741901
FT                   /locus_tag="BIF_01502"
FT   CDS_pept        739487..741901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01502"
FT                   /product="Xaa-Pro dipeptidyl-peptidase"
FT                   /EC_number="3.4.14.11"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01502"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85108"
FT                   /db_xref="GOA:D3R7M6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M6"
FT                   /protein_id="ADC85108.1"
FT                   /translation="MESAIEEYPVRKAKTVRFTCGAPRSPKLIGDGSRMLFLRSAGEQD
FT                   TENSLWLAICGEDAYAEVELVNAGELVNTLGSDDVPAAERARRERARESATGIVAYSVD
FT                   GLGNHVAFTVNGELFVTTIDWDALAYTVGDDGVRAQVGAGVRTEHLVPQFADSAQNEFA
FT                   GPVLNPRMSPDGKRVAYATGSAVVVVDVQTAVANAVFTVSPQDRETMRAGLAEFAAGEE
FT                   MDRYDGFWWGPDSRTLLVECFDSSPEPVWTISDPADPAARGIQHRYPRALTENAVVDLF
FT                   AVRLGDDGTSVQKTAMIDWDNVAYEYLAVVDWQAERPVLRVLDRLQQHEQILRVAMPAE
FT                   NEWGDLRALDGNVMALLPVEVIAEHHNDQWIDLVGGTPCVTPSGAVVCSVNDMEADTNR
FT                   LSVDGRVFTPAGWQVREVLDAGTDDVLCVVQRTAERAAEVPEQWADSTAERYHDARSFD
FT                   IVTISYADGSVRAVSDEPGVWRASRRGDGLVVWGRTMDSAKAVMRLSYGAEGARTGHDV
FT                   CNVAAEPDFVPNVRFVRLGERKLFTAIVAPSASSRFAGAAELPVLMHPYGGPGHQEVVM
FT                   SRAAYLDAQWWADQGYLVVIADGRGTTGRGPVWDREVYLQMKRVSLADQVDAVHALAGA
FT                   VDELNRMGGAAEGCEFGGHDDAARPLPKPDLERVAMIGWSYGGFLSALAVLDAPDTFAA
FT                   ACAGAPPTDWTLYDTCYTERFLGLDPQVYADNSIVLDAPKLVRPLMLIHGFADDNVTIA
FT                   HSLRLSQALMEAGRPHTFLPLTGITHMTNDPDVARNLLILQRDFLSDALAR"
FT   gene            741943..743043
FT                   /locus_tag="BIF_02034"
FT   CDS_pept        741943..743043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02034"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85109"
FT                   /db_xref="GOA:D3R7M7"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M7"
FT                   /protein_id="ADC85109.1"
FT                   /translation="MNQETHDEDQHESDDVDGGEHRAGPQHRRDGGGHRLDRRQKRRAH
FT                   RADAHDARHEQPERDHRAHNHREGHEPPAARVEMRHVLPWFDERQQYESGNEESKAVEG
FT                   EIAVAGDEPHRNDGEAGAGECVHKAPEQAGQRHRQRAQLAAGGQQPHAHERQGDADHLA
FT                   FRGPALRPHAHIDEHHEQIHRLQHGSGARVRPMDREQVGHLHERHAGERRAHELRVFTP
FT                   AGHRRPERVRCADHGGHEEDDPRDDLAHTGDPQRSRVVFLHEDLRHRAIDAPACAADEH
FT                   ACNADGHFPRRLLEGGRLLSFARHRLLDEHVARISLLGGRRPRQHLMEFLRRIHIACAV
FT                   VVLWIAVFRHRGSFRSSLARIVSRRP"
FT   gene            complement(743077..744162)
FT                   /locus_tag="BIF_01504"
FT   CDS_pept        complement(743077..744162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01504"
FT                   /product="Lysophospholipase L2"
FT                   /EC_number="3.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01504"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85110"
FT                   /db_xref="GOA:D3R7M8"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M8"
FT                   /protein_id="ADC85110.1"
FT                   /translation="MEIAMINEHEFQQDLEATALPALDSCMHDGYMDPAVSDWHGHRLR
FT                   TLHPADGTPNKLHVVRYDVEKFHALQIPGSSRQTHGTVLISHGFTEFAAKYKEMAWYFL
FT                   LAGFSVCILEHRGHGYSARDVRNDQIVYIDTWHRYVADLAKCARTIARPMAADKPLVLF
FT                   AHSMGGGIAAAMLERYPNIVDKAVLSSPMIEANLHTPNWLAALVCGAACDFGHAKSMAP
FT                   GQRAFTPLIDIKDNQGACMQRLEWMKKLRIADTHYQTSAAANEWVRQAIRLSIAMQDPH
FT                   MCERIETPILLFQAGNDHWVRNKAQNRFVKRVGKDGGDIRMVRVPGSVHEIFTMPNSVM
FT                   APYLKEILTFLQTSEPVTVLV"
FT   gene            744341..744679
FT                   /locus_tag="BIF_01505"
FT   CDS_pept        744341..744679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01505"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85111"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7M9"
FT                   /protein_id="ADC85111.1"
FT                   /translation="MVAQNIIMTVLNVIVLVALLVFGVYAVYNNKPNFELTPAHLYDQQ
FT                   MGQKYGIWVFICVIISWLVTLPGLFGPLSNTWNQILWWVELIFNIATLVFCVLASFYYS
FT                   RLNTRPHD"
FT   gene            744759..745712
FT                   /locus_tag="BIF_01506"
FT   CDS_pept        744759..745712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01506"
FT                   /product="23S rRNA m(1)G 745 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01506"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85112"
FT                   /db_xref="GOA:D3R7N0"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N0"
FT                   /protein_id="ADC85112.1"
FT                   /translation="MSPEKLARFADSWKYFVCPLCREELRLEGTSLRCERGHTYDVARQ
FT                   GYVNLAPGARQSEYYSRESFEHRGQILSAGYYSHIVDAVLSAVGRYCGQIAASIDFAGL
FT                   RTRSGAQLRGARGRADLRSSGPQMRAPVILDVGCGEGFYARAVQAAHPDATVLAFDISK
FT                   DSVQLAAREDAGCAVRWFVGNLAELPVRDGAVDCVLDVFSPVNYAEFTRVLGGSGVVIK
FT                   VVPGARHDEQLRELARGQLRHGDYSNEQVVGQFAEHFDVLERRLVSQTFPMPADDVLAF
FT                   ARMTPLLFNVDVDSLDLSRIHELTVEAEILVGSVCG"
FT   gene            complement(745770..746084)
FT                   /locus_tag="BIF_02203"
FT   CDS_pept        complement(745770..746084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02203"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85113"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N1"
FT                   /protein_id="ADC85113.1"
FT                   /translation="MEATQSCTQQHNLRKKRQLGRLTVPNYAIQDSDAFQAFRGDGIFQ
FT                   NLRKKRHLCSLNMSQITQAKTCALRKSANPQIRNSATLQLCVKRDILCIFLSLFTQRWV
FT                   "
FT   gene            complement(746214..746468)
FT                   /locus_tag="BIF_01956"
FT   CDS_pept        complement(746214..746468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01956"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01956"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85114"
FT                   /db_xref="GOA:D3R7N2"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N2"
FT                   /protein_id="ADC85114.1"
FT                   /translation="MHWLWVLIVGAIIGAIAGAITHHSGAMGRISNIIAGLVGSALGEA
FT                   LLGHWGPQLAGMAIIPSLIGAIVVVAVVSFFLMRSSAKN"
FT   gene            complement(746740..746997)
FT                   /locus_tag="BIF_01957"
FT   CDS_pept        complement(746740..746997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01957"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01957"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85115"
FT                   /db_xref="GOA:D3R7N3"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N3"
FT                   /protein_id="ADC85115.1"
FT                   /translation="MDTMFWIWTLIVGAVIGAIAGAITNNGHSMGWISNILAGLAGSAL
FT                   GQGLFGSWGPSLGGMAVVPSVLGAVIVVAIVSFIVMKVRA"
FT   gene            complement(747031..747516)
FT                   /locus_tag="BIF_01508"
FT   CDS_pept        complement(747031..747516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01508"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85116"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N4"
FT                   /protein_id="ADC85116.1"
FT                   /translation="MLCRRGLFRQQFSKIREPSEGHSRTIWEHPHHHRSLSVTGCHYSL
FT                   RDVWTLMASLISAIESTISQHTERGKHHTDALFAQFRTTISRTRHPVRNNDIPQTTRHE
FT                   YPGLARVAHRQACFLNVTRAQGHRRAPRTYCALKTAEFQTKQNITTAQSDTRPSHLP"
FT   gene            complement(747553..747638)
FT                   /locus_tag="BIF_tRNA13"
FT   tRNA            complement(747553..747638)
FT                   /locus_tag="BIF_tRNA13"
FT                   /product="tRNA-Leu"
FT   gene            complement(747768..749216)
FT                   /locus_tag="BIF_01138"
FT   CDS_pept        complement(747768..749216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01138"
FT                   /product="Ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01138"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85117"
FT                   /db_xref="GOA:D3R7N5"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N5"
FT                   /protein_id="ADC85117.1"
FT                   /translation="MTQDSELRIAVIGAGPAGVYSSDIFLRQLAKLGDELGLGTDARID
FT                   LFEKLPVPFGLVRYGVAPDHPSIKFIASALEKTLDNPNIHLYADVEFGKDVTLEDLLER
FT                   YDAILFATGAIKDKPLAIPGADLDGVYGAARFVEWYDGYPTGVREWPLEAERVAVIGGG
FT                   NVAMDVARELMRNADDLRAKTDIPDNVYEGIKNNKAKELHLFIRRGVAQAKFSVQELRE
FT                   MEKLPGVQLIIDEDDFELDDDTVEEAGKDKLTRQMVEELFVIRDMAEDMEDDGDVDFEG
FT                   NPADRKYYIHFNSAPTEILGEDGKVRGIRVERTETGADGKMHRTGEFTDYPVEAVYHAI
FT                   GYKPESVPGIAYDEGGAHLANANGDGRITVDHENGEVRERLYATGWAKRGPVGLIGSTK
FT                   SDALMIVTAMLEDLAQNKENARLAPDRDPESIDRLLAERGVRPIDFAGWKRVDAYERAE
FT                   GAKEGREHKKVIDPDQFRALAHGE"
FT   gene            complement(749406..751640)
FT                   /locus_tag="BIF_01137"
FT   CDS_pept        complement(749406..751640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01137"
FT                   /product="Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01137"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85118"
FT                   /db_xref="GOA:D3R7N6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N6"
FT                   /protein_id="ADC85118.1"
FT                   /translation="MKKIIDLCKEVPLLPLTILAAIPLALIPQWRPWGHIHPAFDPGVG
FT                   EWIIILFVAWTIYTSIREMIDSIRHGHIGVDLLAIVALVSTVCVQQYWASWAVVLMVAS
FT                   GEAIESYAQNKARGNLTALIKAAPQQAHVVTLPGVADGGEAQLTEEGFRKVQQAVEQAQ
FT                   REGKPITMGNGHFDTVPVNDVKLGSVLIVLPGEIVPVDGQLLSGTASVDLSNINGEPVP
FT                   RTLFVGAKVLSGSINGSTTMMIRTTSLAADSQYQQILKLVSSAEESRAAVVRTADMLAV
FT                   PFTIISFAIAIVAWIVSGTGLRFAQVLVLATPCPLLIAAPVAYVAGTARLAKQKILIKS
FT                   QDVLENLGRVTHVFFDKTGTLTVKQPQVVRVEKAKDMPANVSEDEILMLAGMVEGFSVH
FT                   VLAKGIVAAGKEAMARLHRLPSSSGKTAADGAGQRELPNPNENYPVVGNVSETPGKGVT
FT                   GTVDGHKVEVGRFAFVTEQSIASEEVHTAQEEERNEKAMEQADREAAKLWPTELEPDEM
FT                   ATYIAIDGKLAARIVLRDVPRYNAKQSIAQLRELGVKEETMLTGDKKASAMIIANEVGI
FT                   TDVRYELLPQDKVNAVREAAAAEKTGRESGWKRFLAKLLGEPIHRDVTMMVGDGVNDSP
FT                   VLAVADIGMAMTDGTSTAASESAEVVIMNDDIGAVPLGVKIARQTKQRMLQAVLIGIAL
FT                   AIVGMVCAAFNLIPVVVGAFLQEAIDVVSILWALTALFNRKQASHAGIRT"
FT   gene            complement(751949..753790)
FT                   /locus_tag="BIF_00686"
FT   CDS_pept        complement(751949..753790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00686"
FT                   /product="DegP"
FT                   /EC_number="3.4.21.-"
FT                   /note="Endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00686"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85119"
FT                   /db_xref="GOA:D3R7N7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N7"
FT                   /protein_id="ADC85119.1"
FT                   /translation="MADDNNNWPTGTPDQNAGSDEHHTDANIGANTEDLNTAPAAPADE
FT                   QPTSVLTPVSGSATEQGEKNDSTSVDGTRKPEPYRLAPQYGAYAPTSQQETTRIPTPPQ
FT                   QGAPNAQQSGLPYQTQNNPQNMPYGVRVDQNQPNAPQGAPNAQNRNPYGVPTGNPFAPS
FT                   NGTPAGPGNPNGPTQSPFGPGSPQQGQPARTPSNIIVAVVAALVAAAICLGVGYAALTN
FT                   GWVKIPTSSSLSSVSSNNHGSGSATVEGGQAPNWASVSANVSKSVVSIQTVVDQGEAKG
FT                   SGAILDKEGHIVTNNHVVSGAKQIQVTLDNGDIYSAKVVGTDSTTDLAVIKLDNPPKDL
FT                   TPITFANSDSLTPGEPIMAIGNPLGYDGTVTTGIVSALNRPVTVMDEENNNAIVTNAVQ
FT                   IDAAINPGNSGGPTFNAAGQVIGINSSIASTASSTQTAGSIGIGFAIPANLVKRVADEI
FT                   IQNGKVEHVALGVTIQSATVEADGVTRGGAVVKSVVANSPAAKAGVKTGDTIVGFNGLA
FT                   VNNNYSLLGFVRAAAMGSTAKLTVVRDGHTMELNVTFDQAEAAVNGSNRNENQNNQNGQ
FT                   NDQNNNGQNDQNNNDGNSDNNNRNRNNDGLIDPFGMW"
FT   gene            753965..754579
FT                   /locus_tag="BIF_01958"
FT   CDS_pept        753965..754579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01958"
FT                   /product="2-haloalkanoic acid dehalogenase"
FT                   /EC_number="3.8.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01958"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85120"
FT                   /db_xref="GOA:D3R7N8"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N8"
FT                   /protein_id="ADC85120.1"
FT                   /translation="MQTDFSAVVFDYFDVLVDWRPHRVVGAFYPPGVTDMFFDDHDPHG
FT                   YEFCRARAAAGVPDGKILDDYTREHGPAVGWILRLLLQHRALGFYDMPVGMPTLLRELR
FT                   AAGVRMVGLANCSETAVEQMQVKYPWLGLLDGTMVSARECIAKPDPALFERAIRAFHLD
FT                   TAHTLFVENTAANAAAACELGLHAVRFESAEQIRALLLPVS"
FT   gene            755059..756606
FT                   /locus_tag="BIF_01591"
FT   CDS_pept        755059..756606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01591"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85121"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7N9"
FT                   /protein_id="ADC85121.1"
FT                   /translation="MVWDSDMEDFEFLHEHEKGFEPSGEFIESRSKVPILEYGMDYYCF
FT                   ADIVIGPVLPAVYLTNPLFATDNEGKPHYYGRERVGRYPGGTWWDWGPDEPKSSTMRIE
FT                   PVPISPVNVMGETVVPYERWVESYRNLPGTPFYSSLDDSGDYCDKASVFDPHGREAYRR
FT                   AMFYMEEAMRVHRAYSDEDERQRFHDCVKLAEILFRHAAGRGDARAWVALGKIYKEDLN
FT                   NGDYFNSYYTASIKGHPPMIEQPPIGERARICFERAAELGDPEALVFLGDLRIEGMVCE
FT                   RDESAAFELYRRAYALVDERHAMHYIKASAALRLARCLEYGVGCEIDLMQARDLYRFAH
FT                   TYLRAIARTYFWWFARERREAMAHDQDLTQLLSHPSHVQRVALSRMGTPHPYESVTKFL
FT                   PMLESMGEFGDVVNPFYVSYNGIVLRFMDEVNRVLDRQPDLGFFDYLGLLHAKLLDAPI
FT                   DVVDPADYDARTVMAMIIYVVRQEKFGEGLMLHSLNHGLIQRWLRRLVQIDDERASS"
FT   gene            756631..758043
FT                   /locus_tag="BIF_01590"
FT   CDS_pept        756631..758043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01590"
FT                   /product="Queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85122"
FT                   /db_xref="GOA:D3R7P0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P0"
FT                   /protein_id="ADC85122.1"
FT                   /translation="MRRAVASVGVRNLFTRTTARLRIAHMTANTESIVQAPAPQLVEHP
FT                   RGAEPGKPGDRSAFRFEQTTRLPDSPNGKGKGGARYGRTGILHTPHGDIKTPAFVPVAT
FT                   QGAMKAVLPESMTQLGAQCLLSNAFHLYERPGEDVLDEAGGLAKFMNWNGPTFTDSGGF
FT                   QVLSLGAGFKKTLAMDVKGMKSDDVIAEGKERMAFVDEDGVTFKSPLNGSLHRFSAEIS
FT                   MNIQHKLGADIMFAFDELTTLMNTRRYQENSVERTYRWAQRCVAEHERLTQSRLGKPYQ
FT                   ALYGVVQGANYEDLRRHAASQIASLDFDGVGIGGAMEKRIIGDICAWICDEMPESRPRH
FT                   VLGIAAVDDIFACVENGGDTFDCVAPARCGRNGAIFTRDGRYNIKRAQYKHDFGPLEEG
FT                   CQCYTCTHYTRAYVDHLLRAHEMNGFTLATIHNEYFFVHLLDDIRASIDGGYFDEFRDE
FT                   TLARFYANGSRG"
FT   gene            complement(758103..758176)
FT                   /locus_tag="BIF_tRNA14"
FT   tRNA            complement(758103..758176)
FT                   /locus_tag="BIF_tRNA14"
FT                   /product="tRNA-Gly"
FT   gene            complement(758271..759242)
FT                   /locus_tag="BIF_01589"
FT   CDS_pept        complement(758271..759242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01589"
FT                   /product="HtpX"
FT                   /EC_number="3.4.24.-"
FT                   /note="Endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01589"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85123"
FT                   /db_xref="GOA:D3R7P1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P1"
FT                   /protein_id="ADC85123.1"
FT                   /translation="MTGKLHLHNHYNGLKTAVLFAIMWAIIMIIWWATGARTSTLGIYL
FT                   AIGVGTSFISYWFSDKLAIASMHAQPVTEQQAPELYRIVRELSQRAGKPMPRIYIAPTE
FT                   TPNAFATGRNENHAAVCCTQGILRILDEREIRGVLGHELMHVYNRDIRTSAIAGAMATV
FT                   LTYLGYSMMYIGNSSSSNRDRDNGAGLLGLIGILLSTVLAPIAASLIQMAISRTREYDA
FT                   DEDGSELTGDPLALASALRKISGGVDANPLPKTSTDTSTAAMMIESPFRGADVSRLFST
FT                   HPPTEDRIARLNQMAVDMGQIAPGAASPQVAGYAQYSQYRQH"
FT   gene            complement(759292..760554)
FT                   /locus_tag="BIF_01588"
FT   CDS_pept        complement(759292..760554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01588"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85124"
FT                   /db_xref="GOA:D3R7P2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P2"
FT                   /protein_id="ADC85124.1"
FT                   /translation="MDGFARVARRCANMDCRFPFLFERAVTRRQVRRDMRLFADRPSQA
FT                   DGSRARIASAILNWERSLAHWKRVLTVIFSALLTVIAVVCLGVGLNIVGLGRDTQAIPP
FT                   APVTEVEAPQLPVPLTDDAIKAAGLHEATPTVSVSQMTATALDNLSAVDGSSALDTVAI
FT                   SLSSDQREQIEQNLQAFADAGAQVSFAVADLGSGGVIAANGGVARYPASSIKAPYIVSL
FT                   LQEGAVNLDETASGSTLSAQINADHIAGVLRYSDNDGYDALWNAHLNSAIIPWSEGLVE
FT                   NPERMRGFQYPDVSAVELAKMWVKTYGYLFADAEGEPNAGETASAPAREWLASSMHHSL
FT                   NSSIDAAHGGEENPDGTVVLSKAGWINGEGDYYALNDAGIVLPSGESGNEPGYAIAIMS
FT                   NACGRNDLLADLAGTLHNILS"
FT   gene            760586..761251
FT                   /locus_tag="BIF_02033"
FT   CDS_pept        760586..761251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02033"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02033"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85125"
FT                   /db_xref="GOA:D3R7P3"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P3"
FT                   /protein_id="ADC85125.1"
FT                   /translation="MRADYSGGMCAHYLGLTDAELERLVDELTMQCQRSRARVGADDEF
FT                   AGVGVEAYPKSVVPIIVPKFDTAVGVPELEPGSLETARAQWGFEQQWTPQPVFNTRIES
FT                   ADKPMWRAPMEHDRCVIACRWFYESHGSEMAVSARTGRKIKQQYVFRVPDEPVMLIGGV
FT                   RRGSQFSMVTTQANADMEPIHPRMPLIVRQGELDLWLGPDYRALADRSDIPLESKPVR"
FT   gene            761354..762598
FT                   /locus_tag="BIF_01587"
FT   CDS_pept        761354..762598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01587"
FT                   /product="Putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01587"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85126"
FT                   /db_xref="GOA:D3R7P4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P4"
FT                   /protein_id="ADC85126.1"
FT                   /translation="MTGATNMATRADRGGKQGRTGGNGLGLFALAAGAFVLGAAEFVMM
FT                   GILPQTAQTLQVSIPTAGHFISAYAIGVCVGTLMLVFGRRIPPRTLIVMFMVIACAGNA
FT                   LSAMAVNAPMLVGARFLAGLPHGAFFGTATLVAKLLARKGKEARAVASMVTGQTVANML
FT                   GVPAGTLLAEHMSWRLAFVALAVCAAVTAVLARAWIPSVAPVRDAGLRGQFRFLRQPGP
FT                   WMVLIAVFVGNTGIFCWWSYVSPWLQKVGGWPNNTISALMMLAGFGMVVGGLIGGRIAD
FT                   RWVPGGTSALGQCIACVGLLAVFLVPGSRWSTALFAFVISFALFFVSAPQQLLMAEAGK
FT                   GGGELIGGATVQIAFNFGNAVGSMVGGGVLDASHMNYHYPALSGVPFAALAVLLLVLYS
FT                   VRYERRGRDENPLRA"
FT   gene            complement(762681..763055)
FT                   /locus_tag="BIF_01586"
FT   CDS_pept        complement(762681..763055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01586"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85127"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P5"
FT                   /protein_id="ADC85127.1"
FT                   /translation="MVMHVRHMVVRTAGSRYRQCAHTVFAQTPRNTAQGDSMGILFING
FT                   GEIGGNTAHLGHAFLEGRDFTQIDLAGKRLFFLFRGGAPTQQMYERGEYTINRFAGLYG
FT                   MDYMGMARNASEARALAAKL"
FT   gene            complement(763094..763192)
FT                   /locus_tag="BIF_02204"
FT   CDS_pept        complement(763094..763192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02204"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85128"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P6"
FT                   /protein_id="ADC85128.1"
FT                   /translation="MAIVTHIKALPLLEQPAHDLRIAGEQPRAPAP"
FT   gene            complement(763257..763583)
FT                   /locus_tag="BIF_01585"
FT   CDS_pept        complement(763257..763583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01585"
FT                   /product="DNA-damage-inducible protein J"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01585"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85129"
FT                   /db_xref="GOA:D3R7P7"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P7"
FT                   /protein_id="ADC85129.1"
FT                   /translation="MHYISYTMADIYFISQKTIGVRMSETATVSFRTDPKVKEEAKALY
FT                   ESMGMDLSTALNVFLRQSIRDNGMPFKITREQPESIEARRQTEAHEGRSFTSSESLMKD
FT                   LMDA"
FT   gene            complement(763615..764094)
FT                   /locus_tag="BIF_01584"
FT   CDS_pept        complement(763615..764094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01584"
FT                   /product="O6-methylguanine-DNA methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01584"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85130"
FT                   /db_xref="GOA:D3R7P8"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P8"
FT                   /protein_id="ADC85130.1"
FT                   /translation="MQGFATYASEYGPVRVDWQDDAVVRLRIIPQADYDADGAGETTGL
FT                   TDETFRELEQYFAGELRRFTVPIAFASGTPFQQAVWRALLQIPYGETRTYAQIAEAVGH
FT                   PKAVRAVGSANNRNPIPFIVPCHRVVGANGNLVGYAYGVEMKRSLLQMEMRTLGQ"
FT   gene            764338..765708
FT                   /locus_tag="BIF_01583"
FT   CDS_pept        764338..765708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01583"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85131"
FT                   /db_xref="GOA:D3R7P9"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7P9"
FT                   /protein_id="ADC85131.1"
FT                   /translation="MGRERQSQETARGNGFHRVRAIIIACVVVIGLLAGVAVRLSTWWH
FT                   AYRVPSMTGQTIARVSADSSVTDDVSQWYSQWKGRRQEIGVAPQYQLSSVRIRTVQRLP
FT                   NIASRYDQSDGRNIYVRLDATVRPRFASIQRITDVHGCQTYAVESGINESCVFTSEPRQ
FT                   DGYRIAQVMEPIMYQRLAYPEQFEKTEPDPTAPVLDGRNGYRLSKERLEVTYDGGTTWR
FT                   EVPDGVARIVGGINANTTLWLEPSRYVITPQFTAFVGYDEGTHTAQLLYSWDAGSTWLT
FT                   SALGHGVQAPSYISVVGDRIGVAYGYGDTLGSVGYAMVAGTLPELRADAEAVWRQIPMY
FT                   MQYPSDLTMAGWVNDTTVIVGQAGSLHVSSDSGATWRELGIPKEPGLEGKLGYYPFDTP
FT                   THVWVEDGTAYLAMGQGEDADYAPNGTVVEAVFSYDPATDACTFIRQQPAPTPMPAG"
FT   gene            complement(765668..766504)
FT                   /locus_tag="BIF_02205"
FT   CDS_pept        complement(765668..766504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02205"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /EC_number="4.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02205"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85132"
FT                   /db_xref="GOA:D3R7Q0"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q0"
FT                   /protein_id="ADC85132.1"
FT                   /translation="MARTGGRGILPLAQVKQYAKESGMAGITEQPNERLKETDPQFAER
FT                   MLHFADVEVARDPETELEPTTRYLAILATLLGCQGADEFRIQLGRALDAGLTPVQAKEV
FT                   VHQAVDYLGIGRVRPFLAITNEVLEARGVALPLPDQTTTTMENRLEAGNAKQVELFGEG
FT                   MDKSYERSKVNYWLADNCFGDYYTRTGLTNLQREMITFCYLAAQGSVEPQLLAHTKANI
FT                   ALGNTADFLRTVVLQNLPYIGYPRTLNALRIVAEADKAKQGAAFNLQALAWGRAVA"
FT   gene            complement(766459..767010)
FT                   /locus_tag="BIF_02206"
FT   CDS_pept        complement(766459..767010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02206"
FT                   /product="Hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02206"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85133"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q1"
FT                   /protein_id="ADC85133.1"
FT                   /translation="MQYMIFHHLLHATVRRITLTDMPSAAYEKAYEKRQAMNNYPIPVG
FT                   VPTAYAQSLMFPVGEPNDAYAQYFTGRSWLAPVSGEQVSMANVTFEPGCINHWHIHHAT
FT                   KGGGQMLICVGGRGYAQIEGQEPIAMTPGTVVHIPANTKHWHGAAPGSWFSHIAIDVPG
FT                   EGKSNDWLEPVDEAFYRSLK"
FT   gene            complement(767044..768039)
FT                   /locus_tag="BIF_01581"
FT   CDS_pept        complement(767044..768039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01581"
FT                   /product="Dienelactone hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01581"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85134"
FT                   /db_xref="GOA:D3R7Q2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q2"
FT                   /protein_id="ADC85134.1"
FT                   /translation="MNAMTALELTPVWDKTFPQSDKVEHGKITFHNRYGIELAADVYKP
FT                   KRVPANGRFKAIAVSGPFGAVKEQASGLYAQTLAERGFLTIAFDPSFTGESGGSPRAVA
FT                   SPDINTEDFSAAVDYLANRTDVDPEGIGIVGICGFGGLALNAAANDPRIKATVASTMYD
FT                   MSRVTANGYFDADDSAAKRNEMRTQLAKQRTEDYANGDYARAGGVIDPLPDDAPQFVRD
FT                   YHAYYKTPRGYHARSVNSNAGWNVTSSLPFMNMPLMTYIGEIENPALLIHGEKAHSLYF
FT                   SKAAYEKLEHGVNPANKELLIIPGANHTDLYDNLNAIPFDTIAGFFTRNL"
FT   gene            768165..769034
FT                   /locus_tag="BIF_00364"
FT   CDS_pept        768165..769034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00364"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85135"
FT                   /db_xref="GOA:D3R7Q3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q3"
FT                   /protein_id="ADC85135.1"
FT                   /translation="MEIRELRAFLEVAREENMTRAAGNLHMSQPSLSKLIKSLEHELGA
FT                   KLFVRRSFGLTLTKEGRVLRERARDLVGMANRIEDEFASLGNITGGTLYFGLAESYQIQ
FT                   YLARQIKILREQAPDLRYHVESGVSAQVLEHLDQGSLDFAVLAQDPDLTKYEALTFPGV
FT                   DRWGIIVPADHRLASRSYVELDDLVGEPLFCSQQGWKHEIARWAGSRMPDLRLEATFGL
FT                   AYNAAVFAREGLGVLLTFDRIVDTSADSGIVFRPLKPALETKLHLVWRRNRPLSPIAER
FT                   FLDQLRRA"
FT   gene            complement(769075..770100)
FT                   /locus_tag="BIF_00723"
FT   CDS_pept        complement(769075..770100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00723"
FT                   /product="Oxidoreductase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00723"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85136"
FT                   /db_xref="GOA:D3R7Q4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q4"
FT                   /protein_id="ADC85136.1"
FT                   /translation="MQYTTLGPSDLEVSRICLGCMSFGDAGNGQHSWTLDEESSRAIVQ
FT                   QALDAGINFLDTAIVYQNGTSEEYLGRALSSMAARDDVVVATKFLPRTDEEIENGVSGQ
FT                   QHVRDNLDMSLRHLGMDHVDLYIYHMWDWRTPIEEIMEGFANAVAAGKTRYIGAANIAA
FT                   WQLEKANAIAREHGWPQFISVQNHMNLLFREDEREMLPCAQEEGIALTPYSSLASGRLS
FT                   RRPGETSRRLREDSFAHGKYDAAAAMDADIIDEVRRIAEARGVTMTTVSLAWLLTKVTA
FT                   PIIGATKPHHLDGAVAAVDFELSDSEIAALERPYQPHPIVGVMAQNTKENAAVAKSWER
FT                   K"
FT   gene            complement(770157..770339)
FT                   /locus_tag="BIF_01959"
FT   CDS_pept        complement(770157..770339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01959"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01959"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85137"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q5"
FT                   /protein_id="ADC85137.1"
FT                   /translation="MRIRHGHLFTRLAIAAIAALRDAGVSVETHEMNGWPHGFGADGGW
FT                   IDQYFAPWLTTVFAR"
FT   gene            complement(770393..771694)
FT                   /locus_tag="BIF_00724"
FT   CDS_pept        complement(770393..771694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00724"
FT                   /product="Vanillate O-demethylase oxidoreductase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00724"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85138"
FT                   /db_xref="GOA:D3R7Q6"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q6"
FT                   /protein_id="ADC85138.1"
FT                   /translation="MPMKRIAIRRFPIQAVLVWAAALVVVPMPFTAIPWATLGPMYRSM
FT                   LTPITAGIYAYIWMLECVWLGCRPRWLDRIIGLPGIYVLHGVLGTGALALVVYHQYVLP
FT                   SFGPAKTTGEIAFWTLVGIVALALVMMAGWLDTLVPPLATVRSWLERVFRHEFTVWLHR
FT                   IVLVAVVLACLHFNLVFYIKDLTAFIVTMDVTTGLVLAWYAWVKLRDRMFAARGKVVSA
FT                   RRVSNDIVEILVDCPAMHSWEYGDFVFLRLPRERGMHGSHPFSIANLPGEHGDAMRFAV
FT                   RINGDFTERLYRTARAGMRVDVIGPFGMYERFIARHDAHAPIVVYAGGVGITPIIPTIM
FT                   ALSGTNRPVTVMYTAKRADDLLYADELRKWSASEAHTPHMQVGRWSKTELAEQITDGAI
FT                   YLIAGPSGMIRDVRRMLLRHGVPGSRMFYEPFTR"
FT   gene            complement(771725..772381)
FT                   /locus_tag="BIF_02032"
FT   CDS_pept        complement(771725..772381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02032"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02032"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85139"
FT                   /db_xref="GOA:D3R7Q7"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q7"
FT                   /protein_id="ADC85139.1"
FT                   /translation="MNTTSTRSRGLLALLLALAMVLGFSACGSTSGSSSNSSGSSTASN
FT                   DSGNNTGTSGDTPTVTKGSNGKALIAYFSKTGTTQRAAEEIQKLTGADMFRIEPVQAYP
FT                   EEYQRTTEIARDELNQNARTQVKGKVDDMAQYDTIFVGYPIWWMEPPMPVLTFLESYDL
FT                   NGKTVIPFATSASSGIDGTLDMLRSSAKGANVTEGLRVTSNDEIQPWLQKIGVLK"
FT   gene            complement(773173..773646)
FT                   /locus_tag="BIF_00462"
FT   CDS_pept        complement(773173..773646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00462"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85140"
FT                   /db_xref="GOA:D3R7Q8"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q8"
FT                   /protein_id="ADC85140.1"
FT                   /translation="MSKQLVVYISATGTTRRVAQNLAKAIDADLAEIVPVPPFTAQDID
FT                   WTDPTSRASRQHADRAMRPPISASPSADGYDEIFVGYPLWWDTAPREVRTWLESHDFTG
FT                   KTITTFATSSSSTRGALGEQLHDSAPDAHWVNGRRFAANASEAELKTWADSIA"
FT   gene            complement(773714..774502)
FT                   /locus_tag="BIF_00461"
FT   CDS_pept        complement(773714..774502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00461"
FT                   /product="Predicted nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85141"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7Q9"
FT                   /protein_id="ADC85141.1"
FT                   /translation="MKPTHVLVVGASGSIGRHAVEKARAAGYRVRALVRDPSRIHFGCG
FT                   VEVVQGDLTSVESMRQALDGIDGIVFTHGSNGGPTLTETVDYGAVRNALEALDGRPARI
FT                   ALMTSIGVTNMDNDYNRSTEAHDWKRHSERLVRASGNEYTIVRPGWFDMEGADEHQLKF
FT                   EQGDRRDPMGPQDGSAARRQVAQTLVDALGCKEADHKTLELIDVAGTAQTDAELASMFA
FT                   ALQPDTGLDGVLDRDNFPECTQPKRVREQIARIETMRAEQ"
FT   gene            complement(774520..775653)
FT                   /locus_tag="BIF_00993"
FT   CDS_pept        complement(774520..775653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00993"
FT                   /product="Alcohol dehydrogenase [NADP+]"
FT                   /EC_number="1.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00993"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85142"
FT                   /db_xref="GOA:D3R7R0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R0"
FT                   /protein_id="ADC85142.1"
FT                   /translation="MHSQSRALPITPMCGPERMERERTTMAENMMKAAVFVEPEHVGVR
FT                   EVERPRIEKPTDAIVRVLKACVCGSDLWWFRGISERPHNTLVGHEAIGIIDEVGADVHD
FT                   MKPGDFVIVPFTHCCGHCEACEKGYDGNCFNMEPGGNAGYQAEYMRATWAGTALIKIPG
FT                   TPADYTDEQIASLLALSDVMATGYHAAWSSRIEPGDTVVIYGDGAVGLCAVIGAKLLGA
FT                   GRIIMMSRHEDRAALAREFGATDIVPERGDEAVARIMEMTNGAGADRVLECVGSEQSIE
FT                   SAVRSGRPGAYVSRVGVPHDNSIDVNALFWRNVSLTGGIASVATHDKSTLLKAVLDGEI
FT                   NPGKVFTASFDLDHVQQAYEAMDGRRAIKSMIDIAEA"
FT   gene            775769..776668
FT                   /locus_tag="BIF_02207"
FT   CDS_pept        775769..776668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02207"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02207"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85143"
FT                   /db_xref="GOA:D3R7R1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R1"
FT                   /protein_id="ADC85143.1"
FT                   /translation="MDIRTLRHFVAVVQEEGISAAADVLRMSQPALSRQMKELENELGV
FT                   TLFERGNRGRSISLTKEGRVFYRRARQIIELADRARAEVHMHDEIAGTIHITAAESNLM
FT                   NIVALAIAQTRLLYPRITFDIHDDNGPNNVERLNNGIADFAVIMQPIDMTRFDHLSLPG
FT                   ANPLGIGMRADDPIAANETITNELIRDMPLITSTGANQRRDLSGWLTQGTTLNIVSHVN
FT                   LAYNAACLVRNGVGYMLTVNDLTEFSDPEHDLVWRPLDPPLDIRLSVIWRKDRDLSRVC
FT                   QLFLQQLRTVITQIRTAQ"
FT   gene            complement(776671..778005)
FT                   /locus_tag="BIF_00991"
FT   CDS_pept        complement(776671..778005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_00991"
FT                   /product="Chitooligosaccharide deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_00991"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85144"
FT                   /db_xref="GOA:D3R7R2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R2"
FT                   /protein_id="ADC85144.1"
FT                   /translation="MAVARRLKMDREDHVAGKDAERIPDYENEEAGRAEFEHEVEDLSF
FT                   GDNVHAPKPKHRHPALFSAVTTLIVLLVLALGAGAWYMWQYHWRTLSIEVDGTAYSAKA
FT                   DTTVAAFMRDHRDFERKPGRLLSVEGKVLEPSGGNTVSVKFDGKQIEPADWDHTRFEKN
FT                   GTLTVTPGTDLTEEHTVEQRKVPFKTDINLNGGPVQIVTQQGEDGLQEFWVGRQSKKTA
FT                   AKTVIRKQEPLIVKSFAPRPEGKKVIALTFDDGPSIYSDKILDILKQNKVKATFFELGE
FT                   QSLEFPKVEQRIVREGHQIASHSVSHPYFPNMSAQEQRQEIESSLSDIKKASDVSTRTF
FT                   RAPYGAFGVDEWKNNATLIDRNVLWDVDTLDWKRPGEKQITKEVVDYVHNGAVVLMHSG
FT                   GGDRSQTVKALPEIIKQLKKKGYSFVTIDELCKMAGLPEAAEPSR"
FT   gene            778125..779189
FT                   /locus_tag="BIF_01437"
FT   CDS_pept        778125..779189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01437"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01437"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85145"
FT                   /db_xref="GOA:D3R7R3"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R3"
FT                   /protein_id="ADC85145.1"
FT                   /translation="MSIATPEQYAHMLDAARAGGYAYPAINVTSSQTLNAALQGLADAE
FT                   SDGIIQVSVGGAAYFSGQRVNNRVTGSLAFAAFAHEVAKQYPNITVALHTDHCAKQYLD
FT                   EWVNPLLDIEIDEVKHGREPMFQSHMWDGSTVPLKENLDIAEKLLEKSRLAHTVLEIEI
FT                   GAVGGEEDGHSAEINEKLYSSVADGMAVADRLGLGERGKYMAAFTFGNVHGAYKPGVVK
FT                   LRPELLHEIQQGVWNAAKSGELNAVLNSDMPDGKPFELVFHGGSGSTAQEIAEAVSYGV
FT                   IKMNIDTDTQYAFTRAVAGHMFRDYDGVLKIDGEVGNKKQYDPRSWGREAEDSMAARVV
FT                   EACEELGSAGRALK"
FT   gene            779742..781028
FT                   /locus_tag="BIF_01438"
FT   CDS_pept        779742..781028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01438"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01438"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85146"
FT                   /db_xref="GOA:D3R7R4"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R4"
FT                   /protein_id="ADC85146.1"
FT                   /translation="MPGIVLIGAQWGDEGKGKATDLIGTKVDYVARFNGGNNAGHTVVV
FT                   GDESYALHLLPSGIISPTATPVIGNGVVVDPEVLLEEIEGLESRGIDCSRLLVSESAHV
FT                   IAPYHRMIDKVTERFAGKKKIGTTGRGIGPAYADKINRVGIRIADLFHEDVLRDKVSNA
FT                   LHQKNQMLVKLYNRRAFDVEATVQELLEVGVKLKPYVANTSLILNNALDDGKTVLFEGG
FT                   QATMLDIDHGTYPFVTSSNPTAGGACTGTGVGPTKIDRVIGVSKAYVTRVGEGPFPTEL
FT                   FDENGEWLRAQGHEYGVTTGRPRRCGWFDAVVNRYATQVNGLTDIVLTKLDVLTGLDEI
FT                   PVCVAYDVNGVRYDDMPTDQSAFAAAKPIYGMMPGWSEDISQVHAFEDLPQTCQDYVKR
FT                   LEELSGCRISAIGTGPQRDHIIEVHSLLD"
FT   gene            781136..782101
FT                   /locus_tag="BIF_01439"
FT   CDS_pept        781136..782101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01439"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85147"
FT                   /db_xref="GOA:D3R7R5"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R5"
FT                   /protein_id="ADC85147.1"
FT                   /translation="MAGNRDEAIRAMTTRPEHLTHADATSPGDVDASSAAAEPGDSDAH
FT                   LHLYDSQSFSPATGAPHEPVTPDFRKEMLQPHPTGAAAARRPPSIPLSPRKRMQAKFNP
FT                   LADGMMYLVIFIGGMLGTVLRYSLWLLWPQPLSKGGLLMAFHPATLIANLCACFIFAVL
FT                   VSYMSQAVWVKKRTRQLANGGFGMGMCGGFSTLSAMMVEDITSLHSHSYLGFFLYTLFT
FT                   FVAAFAIAWFGSWLGLRLARKRTGMHVRERMETVRKPAIGVRVPTANGVQMTPSAGDDP
FT                   NPSTDELPIISEEEHLDLLADPHMVEPLQRTAGKRDGGAR"
FT   gene            782101..782475
FT                   /locus_tag="BIF_01440"
FT   CDS_pept        782101..782475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01440"
FT                   /product="CrcB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85148"
FT                   /db_xref="GOA:D3R7R6"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R6"
FT                   /protein_id="ADC85148.1"
FT                   /translation="MGTFLLVCICGGLGAVARFMLNTSIQRWWHRAYPLSTFIINIIAA
FT                   LCAGTAAAAYFYQTVNYSTYLLFVAGFLGGFSTFSTAINEMVSLTRTRQLAVAAFYFLT
FT                   TLVVPFCAVVLGWFFGSIGH"
FT   gene            782479..782871
FT                   /locus_tag="BIF_01441"
FT   CDS_pept        782479..782871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01441"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85149"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R7"
FT                   /protein_id="ADC85149.1"
FT                   /translation="MNTVPCLIAERQDREVLSEECLRSAIYFLSHLRFTRETNQVPHTW
FT                   SVSLSAIWRDRLSARYLVCLTRRSDSAAYGKRHRGKGSVGGVPELAARGRATAQVREKS
FT                   PRGFRKRMGWHWQLASRIEPGEVHGA"
FT   gene            783034..784500
FT                   /locus_tag="BIF_01442"
FT   CDS_pept        783034..784500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01442"
FT                   /product="LivH"
FT                   /note="Branched-chain amino acid transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01442"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85150"
FT                   /db_xref="GOA:D3R7R8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R8"
FT                   /protein_id="ADC85150.1"
FT                   /translation="MEATKREGVHMASMVSQPQRRAERGRRRKGLAIVCAGIAGLLLAM
FT                   LASMIGVPNAVAAEAVDKCVPNAEHGCVSGILQTQDKTPIPDVTVTLGGEEEATATTAE
FT                   DGAWAFEVNADGEYTVSIDKAVAEKYKLGESGATVEIAKKSFSKQRAVVRFDKAAAGSA
FT                   AETESGNADSAKSGEQTAANTAQAGDDGKGSGFWSRFWQQLYSGCIFGLMLGLMAVGMN
FT                   LVYGTTGLSSFSHGEQVTLGGLMAYVGTQMLHMPVVLSAIFAVAIGALAGWVQNQLVWA
FT                   PLRHKRVGVMQQMIVTIGLSMALQYIYQFFFGGDIKGIVKSVPEGIQLGPIVTNAPTLI
FT                   AAAIALVTIVSVTVFLYCTRLGRATRAVSDNAALAAASGINVDSVVRIVWILSCGLAAL
FT                   SGVLIGIHLNGIAWNTGVTLLMLMFAAVTLGGLGTANGALVGALIVGIVADMSTLVIPS
FT                   DMRYASALAILILVLLIRPQGIFGKQKRVG"
FT   gene            784504..785487
FT                   /locus_tag="BIF_01219"
FT   CDS_pept        784504..785487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01219"
FT                   /product="LivM"
FT                   /note="Branched-chain amino acid transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01219"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85151"
FT                   /db_xref="GOA:D3R7R9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7R9"
FT                   /protein_id="ADC85151.1"
FT                   /translation="MDFMTILSNILGELFAPTTAAYALAAIGLNIHFGMSGLMNMGQAG
FT                   FMLLGAYGFAITQMNGCDLFTSVLTALVLAAIYGILLGIPTLKLGPDYLAMVTLAAAEI
FT                   IRIVGRSTSLTWLTGGSAGIAPQNFTEKFENASPLPNGSTKFLLWTYNNNIANSWWLRI
FT                   VAWVLVAIALLLCWRWFHSPWGRVLKGIREDENAIRSLGKSVTKYKMQALILGGLFGAI
FT                   AGIVFILPRSLNPDSLGRTVTFYTWTILLLGGAATIMGPVLGSCVLWVLLTAVKETMRV
FT                   TIPTTVVSSNQIEALGWVIVGVALMLLVIFRPQGILGNKKELAFNG"
FT   gene            complement(785477..786490)
FT                   /locus_tag="BIF_02091"
FT   CDS_pept        complement(785477..786490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02091"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85152"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S0"
FT                   /protein_id="ADC85152.1"
FT                   /translation="MSGIATLQSFEYGVVAEVDVGVGAQVGVDHGRVVHHRLGLAFGHD
FT                   LAFGHHGDPVGDMAHHVDVVFHEQHRGAVFAQRDDVIEQALLQRRVHAGHRLVEHDELR
FT                   VAHERTGHFEELALAAGERPGVVVLLLVEQEAVEQGLGLLAVLLLLLLPRPREQRPEHA
FT                   LAGVALRAQHHVVEYGEPAHHLGELEGAHHAAAGHFLRVHMGHVLAVELPGAGVRGVEA
FT                   GHEVEERRLAGAVRADEGRDAMTFDLEMPHIHGRHATEATGDVVSHQNRVGLVHAGLVL
FT                   HVAQVFGHLVAVGGGDELLPLRRLRSPFRDVVERFLHGGRRAGGRGLACLVGCVSH"
FT   gene            786474..787295
FT                   /locus_tag="BIF_01217"
FT   CDS_pept        786474..787295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01217"
FT                   /product="LivF"
FT                   /note="Branched-chain amino acid transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01217"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85153"
FT                   /db_xref="GOA:D3R7S1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S1"
FT                   /protein_id="ADC85153.1"
FT                   /translation="MAMPDTATLTPTEAPDVSTLDRSHIHAGEPLLDADNLVAGYLPGV
FT                   NILNGASLTLHDGEIVGIIGPNGAGKSTLLKSLFGLVHIHSGKLTLKGQDITNLRADKL
FT                   VSRGVGFVPQTENVFPSLTIAENMHMGAYQAPKLFNERFDYVCSIFPKLGDRRNQLAGQ
FT                   LSGGERQMVAMGRALMMQPSVLLLDEPSAGLSPMMQDETFIRVRQVNKAGVSVVIVEQN
FT                   ARRCLQICDRGYVLDQGRNAYSCRGRDLMNDPKVISLYLGNLEEEVEKENK"
FT   gene            complement(787365..787571)
FT                   /locus_tag="BIF_02208"
FT   CDS_pept        complement(787365..787571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02208"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85154"
FT                   /db_xref="GOA:D3R7S2"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S2"
FT                   /protein_id="ADC85154.1"
FT                   /translation="MPSPLDATLFDDPPDAPPDEPHPDSASSAAAVIAVNIFILFASRI
FT                   SVFSLLRRSPAHLSSHNIFHLQL"
FT   gene            787438..788703
FT                   /locus_tag="BIF_01216"
FT   CDS_pept        787438..788703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01216"
FT                   /product="Leucine-, isoleucine-, valine-, threonine-, and
FT                   alanine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01216"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85155"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S3"
FT                   /protein_id="ADC85155.1"
FT                   /translation="MRLANKMKMLTAMTAAALLALSGCGSSGGASGGSSNSVASSGDGM
FT                   VIGALLPLTGTLAYLAPPEVAAIKLAISDINKAGGVLGKDVTEVEADTSDGEHADQNTS
FT                   AAQSVLSKHPSVVIGPAASGVVKNVYKSIVAEKIPVISMASTSMTLSGMDPYFFRTVAP
FT                   DAVQGAVMGDLIAQDGVKKLAIACFNDEYGTGMRDIILQKLKDAGVDVVYGEKDAFDPA
FT                   ETNYSSIATAIKNSGADATLIISYDQATPLIKALASAGVDTHKLYLVDGNTVDYSKTYD
FT                   AGLLKGSKGTIPGTHVDDKFKSDLKGTGTDISDTTYAAETYDAVILAALAAEQGGSTSG
FT                   ETVAKNLSSVSGADGGEKCESFEACKALIKDKKKIQYFGKTGIGPFNKNNDPSSANIGI
FT                   FEYDGNNVNVFQDMQSGDVPTE"
FT   gene            complement(788781..790067)
FT                   /locus_tag="BIF_01423"
FT   CDS_pept        complement(788781..790067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01423"
FT                   /product="Ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01423"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85156"
FT                   /db_xref="GOA:D3R7S4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S4"
FT                   /protein_id="ADC85156.1"
FT                   /translation="MRLPEASSLRELPYRTGSSIVLPHSSRACKRSALGVSNRFDIRRF
FT                   TALCRNAVAGGRNLHIQSDSARQTGSIPRAIAHGAENEEANMVGMRDVAKRAGVSVSSV
FT                   SLVINGTGYVSRDMREKVEQAMRELDYVPNELARNFYHGKTDIIGVIVPTIQHPFFATL
FT                   TAHLQHEFADRGLQTMLCSTADSANGEAQYVDMLRRHSLDALVVAAHTTHDPQYWRAID
FT                   RPVVAFDRNLGAGITQVSSDHVHGGELIAELLVRTGAHHVVMVGGPRAQFTDLGDHSTF
FT                   PTVRYVQTLEDRLSQARIAHTYIESGEVFDIAGVRRAVREAFDTYPDMDAFVGADLAAA
FT                   FAVQEAVSRSIAVPGDVQIIAYDGTLAADCAGMPLTTVAQDFRQIAHTIAACVEHGIES
FT                   SPQRPDATDGDANMTIIPVTLHERATTRR"
FT   gene            790116..791636
FT                   /locus_tag="BIF_02090"
FT   CDS_pept        790116..791636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02090"
FT                   /product="Sucrose phosphorylase"
FT                   /EC_number="2.4.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85157"
FT                   /db_xref="GOA:D3R7S5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR015325"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S5"
FT                   /protein_id="ADC85157.1"
FT                   /translation="MKNKVQLITYADRLGDGNLASMTDILRTRFDGVYEGVHILPFFTP
FT                   FDGADAGFDPIDHTKVDARLGDWDDIAELAKTHDIMVDAIVNHMSWQSKQFQDVLANGE
FT                   DSEYYPMFLTMSSVFPDGATEEELAGIYRPRPGLPFTHYSFAGKTRLVWVTFTPQQVDI
FT                   DTDSAKGWEYLMSIFDQMSKSHVKYIRLDAVGYGAKEAGTSCFMTPKTFELISRLREEG
FT                   AKRGLEILIEVHSYYKKQVEIAAKVDRVYDFALPPLLLHSLFTGKVDALAHWTEIRPNN
FT                   AVTVLDTHDGIGVIDIGSDQLDRSLKGLVPDADVDNMVETIAKNTHGESKAATGAAASN
FT                   LDLYQVNSTYYSALGCNDQHYIAARAVQFFLPGVPQVYYVGALAGENDMELLKRTNVGR
FT                   DINRHYYTTSEIDKNLERPVVKALNALARFRNELPAFDGDFSYSVGDDESIAFSWNGFG
FT                   SSATLTFTPSKGMGVENPQSVATLVWTDSTGEHRTDDLIANPPVMQAS"
FT   gene            791693..793306
FT                   /locus_tag="BIF_01422"
FT   CDS_pept        791693..793306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01422"
FT                   /product="Transporter, MFS superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01422"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85158"
FT                   /db_xref="GOA:D3R7S6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S6"
FT                   /protein_id="ADC85158.1"
FT                   /translation="MVDEQDTHGGSAPSTGSNGYIRPGIDDRPDFDKVLSQEDKENISR
FT                   LTAPMPKKRAADSSVGDEQVQGTKLATDSQAVGSGMAALAAVDTAVPDEASAFMDMRDP
FT                   MVSADGHRPTKAELVRLGIGFTVSAVACAIPWVALSTVILPRVFELIDNSSKEAMLGLV
FT                   NSIGAIVALLANIIFGTLSDMTRSRFGKRTPWIVGGGIITGLAIGAIAFTRNEALIIFL
FT                   WCVAQMGYNMMLAPYVAVMSDRVPDKVRGTISGFYGAGIAVGQTLGSVVGAAFLRQGQS
FT                   GLFSAWMMGLGIFSLTGIFVVAMWPREKSSRFEEQSEHVTVKSVLLNFRPPRHAPDFYY
FT                   ALVGRTLMMGGYWMITTYQLYIAQDYIYAGDPNAKDKAATIIATMGVITLVVSLIAAVT
FT                   AGPITDRLGRRKLPVALASCLFAVGAAMPLFFRSPMGMYLFAAVAGLGYGVYNAIDQAL
FT                   NVAVLPNPKEAGKDLGILNLANTLSTVIGTAMTSLVVSIVKSSMHVSTTPAVAYAWVFG
FT                   VAIVIVLAAAALIMRIRNVK"
FT   gene            complement(793311..793466)
FT                   /locus_tag="BIF_02089"
FT   CDS_pept        complement(793311..793466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_02089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_02089"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85159"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S7"
FT                   /protein_id="ADC85159.1"
FT                   /translation="MRESVCRLRAPQTERVSAALRSHERGKAFETQGDMEQAGNANAAG
FT                   LRSGER"
FT   gene            793563..794291
FT                   /locus_tag="BIF_01421"
FT   CDS_pept        793563..794291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01421"
FT                   /product="Leucine-, isoleucine-, valine-, threonine-, and
FT                   alanine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01421"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85160"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3R7S8"
FT                   /protein_id="ADC85160.1"
FT                   /translation="MIAMNNAKIKSWMVTATAMAAAAMLTLSGCGSGAESKADADEATF
FT                   TAAGLLPLTGSMAYLGPANIATMKLAQNDINAAGGVLGKDIDIVSADTSDADHADQNTS
FT                   SAQSVLAREPSVVVGPPSSSVVKNTFKQVTSSQVPMISSGATSTAFSGLNDYFFRTIPP
FT                   DTVQGVVLGQIIVQDGVKNLAIAVFNDEYGTSLRDVVAKTVGDAGVNVVYGEKETFDPT
FT                   ETSFSSMVTNIKSTKPDALR"
FT   gene            794327..795625
FT                   /locus_tag="BIF_01420"
FT   CDS_pept        794327..795625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BIF_01420"
FT                   /product="Acetyl-/propionyl-coenzyme A carboxylase alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:BIF_01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADC85161"
FT                   /db_xref="GOA:D3R7S9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT