(data stored in ACNUC7421 zone)

EMBL: CP001857

ID   CP001857; SV 1; circular; genomic DNA; STD; PRO; 1560622 BP.
XX
AC   CP001857;
XX
PR   Project:PRJNA32583;
XX
DT   21-JAN-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Archaeoglobus profundus DSM 5631, complete genome.
XX
KW   .
XX
OS   Archaeoglobus profundus DSM 5631
OC   Archaea; Euryarchaeota; Archaeoglobi; Archaeoglobales; Archaeoglobaceae;
OC   Archaeoglobus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1560622
RX   PUBMED; 21304717.
RA   von Jan M., Lapidus A., Del Rio T.G., Copeland A., Tice H., Cheng J.F.,
RA   Lucas S., Chen F., Nolan M., Goodwin L., Han C., Pitluck S., Liolios K.,
RA   Ivanova N., Mavromatis K., Ovchinnikova G., Chertkov O., Pati A., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.J., Jeffries C.D., Saunders E.,
RA   Brettin T., Detter J.C., Chain P., Eichinger K., Huber H., Spring S.,
RA   Rohde M., Goker M., Wirth R., Woyke T., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Archaeoglobus profundus type strain (AV18)";
RL   Stand Genomic Sci 2(3):327-346(2010).
XX
RN   [2]
RP   1-1560622
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Wirth R., Huber H., Eichinger K., Klenk H.-P., Eisen J.A.;
RT   "The complete chromosome of Archaeoglobus profundus DSM 5631";
RL   Unpublished.
XX
RN   [3]
RP   1-1560622
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Ovchinnikova G., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Wirth R., Huber H., Eichinger K., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (07-JAN-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; bb9490958bdcd9fed1689199b4d65f34.
DR   BioSample; SAMN00017459.
DR   CABRI; DSM 5631.
DR   EnsemblGenomes-Gn; Arcpr_R0001.
DR   EnsemblGenomes-Gn; Arcpr_R0002.
DR   EnsemblGenomes-Gn; Arcpr_R0003.
DR   EnsemblGenomes-Gn; Arcpr_R0004.
DR   EnsemblGenomes-Gn; Arcpr_R0005.
DR   EnsemblGenomes-Gn; Arcpr_R0006.
DR   EnsemblGenomes-Gn; Arcpr_R0007.
DR   EnsemblGenomes-Gn; Arcpr_R0008.
DR   EnsemblGenomes-Gn; Arcpr_R0009.
DR   EnsemblGenomes-Gn; Arcpr_R0010.
DR   EnsemblGenomes-Gn; Arcpr_R0011.
DR   EnsemblGenomes-Gn; Arcpr_R0012.
DR   EnsemblGenomes-Gn; Arcpr_R0013.
DR   EnsemblGenomes-Gn; Arcpr_R0014.
DR   EnsemblGenomes-Gn; Arcpr_R0015.
DR   EnsemblGenomes-Gn; Arcpr_R0016.
DR   EnsemblGenomes-Gn; Arcpr_R0017.
DR   EnsemblGenomes-Gn; Arcpr_R0018.
DR   EnsemblGenomes-Gn; Arcpr_R0019.
DR   EnsemblGenomes-Gn; Arcpr_R0020.
DR   EnsemblGenomes-Gn; Arcpr_R0021.
DR   EnsemblGenomes-Gn; Arcpr_R0022.
DR   EnsemblGenomes-Gn; Arcpr_R0023.
DR   EnsemblGenomes-Gn; Arcpr_R0024.
DR   EnsemblGenomes-Gn; Arcpr_R0025.
DR   EnsemblGenomes-Gn; Arcpr_R0026.
DR   EnsemblGenomes-Gn; Arcpr_R0027.
DR   EnsemblGenomes-Gn; Arcpr_R0028.
DR   EnsemblGenomes-Gn; Arcpr_R0029.
DR   EnsemblGenomes-Gn; Arcpr_R0030.
DR   EnsemblGenomes-Gn; Arcpr_R0031.
DR   EnsemblGenomes-Gn; Arcpr_R0032.
DR   EnsemblGenomes-Gn; Arcpr_R0033.
DR   EnsemblGenomes-Gn; Arcpr_R0034.
DR   EnsemblGenomes-Gn; Arcpr_R0035.
DR   EnsemblGenomes-Gn; Arcpr_R0036.
DR   EnsemblGenomes-Gn; Arcpr_R0037.
DR   EnsemblGenomes-Gn; Arcpr_R0038.
DR   EnsemblGenomes-Gn; Arcpr_R0039.
DR   EnsemblGenomes-Gn; Arcpr_R0040.
DR   EnsemblGenomes-Gn; Arcpr_R0041.
DR   EnsemblGenomes-Gn; Arcpr_R0042.
DR   EnsemblGenomes-Gn; Arcpr_R0043.
DR   EnsemblGenomes-Gn; Arcpr_R0044.
DR   EnsemblGenomes-Gn; Arcpr_R0045.
DR   EnsemblGenomes-Gn; Arcpr_R0046.
DR   EnsemblGenomes-Gn; Arcpr_R0047.
DR   EnsemblGenomes-Gn; Arcpr_R0048.
DR   EnsemblGenomes-Gn; Arcpr_R0049.
DR   EnsemblGenomes-Gn; Arcpr_R0050.
DR   EnsemblGenomes-Gn; Arcpr_R0051.
DR   EnsemblGenomes-Gn; Arcpr_R0052.
DR   EnsemblGenomes-Gn; Arcpr_R0053.
DR   EnsemblGenomes-Gn; EBG00001226675.
DR   EnsemblGenomes-Gn; EBG00001226676.
DR   EnsemblGenomes-Gn; EBG00001226678.
DR   EnsemblGenomes-Gn; EBG00001226679.
DR   EnsemblGenomes-Gn; EBG00001226680.
DR   EnsemblGenomes-Gn; EBG00001226681.
DR   EnsemblGenomes-Gn; EBG00001226682.
DR   EnsemblGenomes-Gn; EBG00001226683.
DR   EnsemblGenomes-Gn; EBG00001226684.
DR   EnsemblGenomes-Gn; EBG00001226685.
DR   EnsemblGenomes-Gn; EBG00001226686.
DR   EnsemblGenomes-Gn; EBG00001226687.
DR   EnsemblGenomes-Gn; EBG00001226688.
DR   EnsemblGenomes-Gn; EBG00001226689.
DR   EnsemblGenomes-Gn; EBG00001226690.
DR   EnsemblGenomes-Gn; EBG00001226691.
DR   EnsemblGenomes-Gn; EBG00001226692.
DR   EnsemblGenomes-Gn; EBG00001226693.
DR   EnsemblGenomes-Gn; EBG00001226694.
DR   EnsemblGenomes-Gn; EBG00001226695.
DR   EnsemblGenomes-Gn; EBG00001226696.
DR   EnsemblGenomes-Gn; EBG00001226697.
DR   EnsemblGenomes-Gn; EBG00001226698.
DR   EnsemblGenomes-Gn; EBG00001226699.
DR   EnsemblGenomes-Gn; EBG00001226700.
DR   EnsemblGenomes-Gn; EBG00001226701.
DR   EnsemblGenomes-Gn; EBG00001226702.
DR   EnsemblGenomes-Gn; EBG00001226703.
DR   EnsemblGenomes-Gn; EBG00001226704.
DR   EnsemblGenomes-Gn; EBG00001226705.
DR   EnsemblGenomes-Gn; EBG00001226706.
DR   EnsemblGenomes-Gn; EBG00001226707.
DR   EnsemblGenomes-Gn; EBG00001226708.
DR   EnsemblGenomes-Gn; EBG00001226709.
DR   EnsemblGenomes-Gn; EBG00001226710.
DR   EnsemblGenomes-Gn; EBG00001226711.
DR   EnsemblGenomes-Gn; EBG00001226712.
DR   EnsemblGenomes-Gn; EBG00001226713.
DR   EnsemblGenomes-Gn; EBG00001226714.
DR   EnsemblGenomes-Gn; EBG00001226715.
DR   EnsemblGenomes-Gn; EBG00001226716.
DR   EnsemblGenomes-Gn; EBG00001226717.
DR   EnsemblGenomes-Gn; EBG00001226718.
DR   EnsemblGenomes-Gn; EBG00001226719.
DR   EnsemblGenomes-Gn; EBG00001226720.
DR   EnsemblGenomes-Gn; EBG00001226721.
DR   EnsemblGenomes-Gn; EBG00001226722.
DR   EnsemblGenomes-Gn; EBG00001226723.
DR   EnsemblGenomes-Gn; EBG00001226724.
DR   EnsemblGenomes-Gn; EBG00001226725.
DR   EnsemblGenomes-Gn; EBG00001226726.
DR   EnsemblGenomes-Gn; EBG00001226727.
DR   EnsemblGenomes-Gn; EBG00001226728.
DR   EnsemblGenomes-Gn; EBG00001226729.
DR   EnsemblGenomes-Gn; EBG00001226730.
DR   EnsemblGenomes-Gn; EBG00001226731.
DR   EnsemblGenomes-Gn; EBG00001226732.
DR   EnsemblGenomes-Gn; EBG00001226733.
DR   EnsemblGenomes-Gn; EBG00001226734.
DR   EnsemblGenomes-Gn; EBG00001226735.
DR   EnsemblGenomes-Gn; EBG00001226736.
DR   EnsemblGenomes-Gn; EBG00001226737.
DR   EnsemblGenomes-Gn; EBG00001226738.
DR   EnsemblGenomes-Gn; EBG00001226739.
DR   EnsemblGenomes-Gn; EBG00001226740.
DR   EnsemblGenomes-Gn; EBG00001226741.
DR   EnsemblGenomes-Gn; EBG00001226742.
DR   EnsemblGenomes-Gn; EBG00001226743.
DR   EnsemblGenomes-Gn; EBG00001226744.
DR   EnsemblGenomes-Gn; EBG00001226745.
DR   EnsemblGenomes-Gn; EBG00001226746.
DR   EnsemblGenomes-Tr; Arcpr_R0001-1.
DR   EnsemblGenomes-Tr; Arcpr_R0002-1.
DR   EnsemblGenomes-Tr; Arcpr_R0003-1.
DR   EnsemblGenomes-Tr; Arcpr_R0004-1.
DR   EnsemblGenomes-Tr; Arcpr_R0005-1.
DR   EnsemblGenomes-Tr; Arcpr_R0006-1.
DR   EnsemblGenomes-Tr; Arcpr_R0007-1.
DR   EnsemblGenomes-Tr; Arcpr_R0008-1.
DR   EnsemblGenomes-Tr; Arcpr_R0009-1.
DR   EnsemblGenomes-Tr; Arcpr_R0010-1.
DR   EnsemblGenomes-Tr; Arcpr_R0011-1.
DR   EnsemblGenomes-Tr; Arcpr_R0012-1.
DR   EnsemblGenomes-Tr; Arcpr_R0013-1.
DR   EnsemblGenomes-Tr; Arcpr_R0014-1.
DR   EnsemblGenomes-Tr; Arcpr_R0015-1.
DR   EnsemblGenomes-Tr; Arcpr_R0016-1.
DR   EnsemblGenomes-Tr; Arcpr_R0017-1.
DR   EnsemblGenomes-Tr; Arcpr_R0018-1.
DR   EnsemblGenomes-Tr; Arcpr_R0019-1.
DR   EnsemblGenomes-Tr; Arcpr_R0020-1.
DR   EnsemblGenomes-Tr; Arcpr_R0021-1.
DR   EnsemblGenomes-Tr; Arcpr_R0022-1.
DR   EnsemblGenomes-Tr; Arcpr_R0023-1.
DR   EnsemblGenomes-Tr; Arcpr_R0024-1.
DR   EnsemblGenomes-Tr; Arcpr_R0025-1.
DR   EnsemblGenomes-Tr; Arcpr_R0026-1.
DR   EnsemblGenomes-Tr; Arcpr_R0027-1.
DR   EnsemblGenomes-Tr; Arcpr_R0028-1.
DR   EnsemblGenomes-Tr; Arcpr_R0029-1.
DR   EnsemblGenomes-Tr; Arcpr_R0030-1.
DR   EnsemblGenomes-Tr; Arcpr_R0031-1.
DR   EnsemblGenomes-Tr; Arcpr_R0032-1.
DR   EnsemblGenomes-Tr; Arcpr_R0033-1.
DR   EnsemblGenomes-Tr; Arcpr_R0034-1.
DR   EnsemblGenomes-Tr; Arcpr_R0035-1.
DR   EnsemblGenomes-Tr; Arcpr_R0036-1.
DR   EnsemblGenomes-Tr; Arcpr_R0037-1.
DR   EnsemblGenomes-Tr; Arcpr_R0038-1.
DR   EnsemblGenomes-Tr; Arcpr_R0039-1.
DR   EnsemblGenomes-Tr; Arcpr_R0040-1.
DR   EnsemblGenomes-Tr; Arcpr_R0041-1.
DR   EnsemblGenomes-Tr; Arcpr_R0042-1.
DR   EnsemblGenomes-Tr; Arcpr_R0043-1.
DR   EnsemblGenomes-Tr; Arcpr_R0044-1.
DR   EnsemblGenomes-Tr; Arcpr_R0045-1.
DR   EnsemblGenomes-Tr; Arcpr_R0046-1.
DR   EnsemblGenomes-Tr; Arcpr_R0047-1.
DR   EnsemblGenomes-Tr; Arcpr_R0048-1.
DR   EnsemblGenomes-Tr; Arcpr_R0049-1.
DR   EnsemblGenomes-Tr; Arcpr_R0050-1.
DR   EnsemblGenomes-Tr; Arcpr_R0051-1.
DR   EnsemblGenomes-Tr; Arcpr_R0052-1.
DR   EnsemblGenomes-Tr; Arcpr_R0053-1.
DR   EnsemblGenomes-Tr; EBT00001795518.
DR   EnsemblGenomes-Tr; EBT00001795519.
DR   EnsemblGenomes-Tr; EBT00001795520.
DR   EnsemblGenomes-Tr; EBT00001795521.
DR   EnsemblGenomes-Tr; EBT00001795522.
DR   EnsemblGenomes-Tr; EBT00001795524.
DR   EnsemblGenomes-Tr; EBT00001795525.
DR   EnsemblGenomes-Tr; EBT00001795526.
DR   EnsemblGenomes-Tr; EBT00001795527.
DR   EnsemblGenomes-Tr; EBT00001795528.
DR   EnsemblGenomes-Tr; EBT00001795529.
DR   EnsemblGenomes-Tr; EBT00001795530.
DR   EnsemblGenomes-Tr; EBT00001795531.
DR   EnsemblGenomes-Tr; EBT00001795532.
DR   EnsemblGenomes-Tr; EBT00001795533.
DR   EnsemblGenomes-Tr; EBT00001795534.
DR   EnsemblGenomes-Tr; EBT00001795535.
DR   EnsemblGenomes-Tr; EBT00001795536.
DR   EnsemblGenomes-Tr; EBT00001795537.
DR   EnsemblGenomes-Tr; EBT00001795538.
DR   EnsemblGenomes-Tr; EBT00001795539.
DR   EnsemblGenomes-Tr; EBT00001795540.
DR   EnsemblGenomes-Tr; EBT00001795541.
DR   EnsemblGenomes-Tr; EBT00001795542.
DR   EnsemblGenomes-Tr; EBT00001795543.
DR   EnsemblGenomes-Tr; EBT00001795544.
DR   EnsemblGenomes-Tr; EBT00001795545.
DR   EnsemblGenomes-Tr; EBT00001795546.
DR   EnsemblGenomes-Tr; EBT00001795547.
DR   EnsemblGenomes-Tr; EBT00001795548.
DR   EnsemblGenomes-Tr; EBT00001795549.
DR   EnsemblGenomes-Tr; EBT00001795550.
DR   EnsemblGenomes-Tr; EBT00001795551.
DR   EnsemblGenomes-Tr; EBT00001795552.
DR   EnsemblGenomes-Tr; EBT00001795553.
DR   EnsemblGenomes-Tr; EBT00001795554.
DR   EnsemblGenomes-Tr; EBT00001795555.
DR   EnsemblGenomes-Tr; EBT00001795556.
DR   EnsemblGenomes-Tr; EBT00001795557.
DR   EnsemblGenomes-Tr; EBT00001795558.
DR   EnsemblGenomes-Tr; EBT00001795559.
DR   EnsemblGenomes-Tr; EBT00001795560.
DR   EnsemblGenomes-Tr; EBT00001795561.
DR   EnsemblGenomes-Tr; EBT00001795562.
DR   EnsemblGenomes-Tr; EBT00001795563.
DR   EnsemblGenomes-Tr; EBT00001795564.
DR   EnsemblGenomes-Tr; EBT00001795565.
DR   EnsemblGenomes-Tr; EBT00001795566.
DR   EnsemblGenomes-Tr; EBT00001795567.
DR   EnsemblGenomes-Tr; EBT00001795568.
DR   EnsemblGenomes-Tr; EBT00001795569.
DR   EnsemblGenomes-Tr; EBT00001795570.
DR   EnsemblGenomes-Tr; EBT00001795571.
DR   EnsemblGenomes-Tr; EBT00001795572.
DR   EnsemblGenomes-Tr; EBT00001795573.
DR   EnsemblGenomes-Tr; EBT00001795574.
DR   EnsemblGenomes-Tr; EBT00001795575.
DR   EnsemblGenomes-Tr; EBT00001795576.
DR   EnsemblGenomes-Tr; EBT00001795577.
DR   EnsemblGenomes-Tr; EBT00001795578.
DR   EnsemblGenomes-Tr; EBT00001795579.
DR   EnsemblGenomes-Tr; EBT00001795580.
DR   EnsemblGenomes-Tr; EBT00001795581.
DR   EnsemblGenomes-Tr; EBT00001795582.
DR   EnsemblGenomes-Tr; EBT00001795583.
DR   EnsemblGenomes-Tr; EBT00001795584.
DR   EnsemblGenomes-Tr; EBT00001795585.
DR   EnsemblGenomes-Tr; EBT00001795586.
DR   EnsemblGenomes-Tr; EBT00001795587.
DR   EnsemblGenomes-Tr; EBT00001795588.
DR   EnsemblGenomes-Tr; EBT00001795589.
DR   EuropePMC; PMC3612082; 23555835.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01125; sR4.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01152; sR1.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001857.
DR   SILVA-SSU; CP001857.
DR   StrainInfo; 159331; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085236
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Archaeoglobus profundus Av18, DSM 5631
CC   Culture Collection ID :: DSM 5631, JCM 9629, NBRC 100127
CC   GOLD Stamp ID         :: Gi02909
CC   Greengenes ID         :: 71597
CC   Isolation Site        :: "Deep sea hydrothermal vents; Mexico, Gulf
CC                            of California, Guaymas Basin"
CC   Isolation Country     :: Mexico
CC   Oxygen Requirement    :: Anaerobe
CC   Motility              :: Motile
CC   Temperature Range     :: Hyperthermophile
CC   Temperature Optimum   :: 85C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Deep sea, Hydrothermal vent, Marine
CC   Energy Source         :: Chemolithoautotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1560622
FT                   /organism="Archaeoglobus profundus DSM 5631"
FT                   /strain="DSM 5631"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:572546"
FT   gene            16..1251
FT                   /locus_tag="Arcpr_0001"
FT   CDS_pept        16..1251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0001"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="KEGG: Cdc6; cell division cycle 6 homolog (S.
FT                   cerevisiae); K02213 cell division control protein 6;
FT                   TIGRFAM: orc1/cdc6 family replication initiation protein;
FT                   PFAM: CDC6 domain protein; AAA ATPase central domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57079"
FT                   /db_xref="GOA:D2RFK4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFK4"
FT                   /inference="protein motif:TFAM:TIGR02928"
FT                   /protein_id="ADB57079.1"
FT                   /translation="MNVFERILSSSRIFKNRDVLRHTYTPDELPHRDEQINALATILAP
FT                   ALRYETPSNVLIYGKTGTGKTATVKFVARQLEEMSSKLGVRCFIHYINCELIDTQYRVF
FT                   ASIANALGRNIPMTGLPTDHVYEEMKKALDLRRQVVIIVLDEIDKLVKKGDEALYNLTR
FT                   INSELINAKVSIIGISNDLKFKSFLDPRVLSSLSEEELVFPPYNAEQLRDILEQRAKLA
FT                   FHDGVLDDDVIPFCSALAAQEHGDARKALDLLRVSGEIAEREGADRVTKEHVKKAVKKI
FT                   ESDQIAETVRTLPTHSKVLLFGMIVLTESGYRKFTTGEVYTVYRNLCKKIGLDALTQRR
FT                   VSDLISELDMLGIINSIIISKGRYGRTREIRLEMPVDDLKAVLLEDYRLEALSSYEKNL
FT                   KSLTTLDTFGEA"
FT   gene            1251..1961
FT                   /locus_tag="Arcpr_0002"
FT   CDS_pept        1251..1961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0002"
FT                   /product="5-carboxymethyl-2-hydroxymuconateDelta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   scl:sce2870 fumarylacetoacetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57080"
FT                   /db_xref="GOA:D2RFK5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFK5"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ADB57080.1"
FT                   /translation="MFGRILHRGEVYEGYFEVEGGRVVIDGYEIEDYRFLPPIKPTKIV
FT                   CIGLNYMDHAEELNMEIPEEPIIFLKPPSAVIGHEDVIVMPRISKRVDYEGEIAVVIGK
FT                   RCKNVKKEDAMDYVLGYTCFNDVTARDLQSKDGQWTRAKSFDTFAPIGPYVVTEVPEKL
FT                   KIETRLNGKVVQKSDTSNLIFDIPTLIEFISNIMTLERGDVIATGTPAGVGMLKSGDVV
FT                   EVEVNGLTLRNYVR"
FT   gene            1966..4560
FT                   /locus_tag="Arcpr_0003"
FT   CDS_pept        1966..4560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0003"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: rpr:RP687
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57081"
FT                   /db_xref="GOA:D2RFK6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022874"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFK6"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ADB57081.1"
FT                   /translation="MEKEYKAKEVEEKWLKLWKDEMYYFDWNSKKPHYIIDTPPPYPTG
FT                   SFHLGNALNWCYIDFIARYRRMKGYEVMFPQGWDCHGLPTEVKVEEIHGISKNDVPREE
FT                   FRRLCMEFTMKNIEKMRETMRRLGFSIDWSKEYITMYPEYYTKTQLSFVKMYKKGLIYK
FT                   DYHPVVFCPRCQTTIALAEIEYKKGKTKLNYIRFGDDVIIATTRPELIPACVAVAVHPE
FT                   DDRYKHLVSKKVEVPLFGYEVPIIADEDVDPEFGTGIVMICTFGDKQDVRWWKKHKLPL
FT                   RAVLNKDGRLNELAGKYQGLTTREAREKILEDLAKEGRLLKQEEIEQNVGVCWRCKTPV
FT                   EIIAEDQWFVKVEKEKIIENAKRIRWVPEHMLQRLIDWVDSMEWDWVISRQRIFATPIP
FT                   VWYCKNCGEIIVAEEEWLPVDPTKDMPKKPCPKCGSNEFEGETDVLDTWMDSSITPLVI
FT                   CGWPDLKEYPTHLRPQGHDIIRTWAFYTILRSLALVDEIPWLEIVINGMVLGEDGRKMS
FT                   KSLGNVISPEEIIEKYGADALRQWAATGVIGEDVAFSWKEVKSAYRFEQKFWSIIRFVT
FT                   MHLKEKPPYKPELLRDADRWILSKLMKLVREVDESMNAYRFDKALKAIRSFTWYEFADN
FT                   YLEIVKNRLYSGTEEEKIPARFTLYKVASTLIKLLAPITPFLAEECWHRLHEAMGEKVE
FT                   SVHLQSYPEVEGDLIDEEAERKGELIKEIVVAVRRFKHDKGMALNAPLKSVKIYASMEI
FT                   DTRDVAGALNASVELLKEMPNIEVRVKRLKPRFGVIGPMFKEKAKDLVKAVENLSDEEK
FT                   LKLFEGKSVTVSLDGRDVEVSPEWFDVEIEKIVRGENVEVLETENAIVLVEV"
FT   gene            4868..6097
FT                   /locus_tag="Arcpr_0004"
FT   CDS_pept        4868..6097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0004"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; RNA-
FT                   metabolising metallo-beta-lactamase; KEGG: similar to
FT                   cleavage and polyadenylation specificity factor"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57082"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFK7"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB57082.1"
FT                   /translation="MRMTVIQFLGGCREVGRSAILVDSIMLDYGLKPSEPPEFPLNGIA
FT                   PKSVIISHGHLDHVGVAPNLVDYDPKIYMTPPTLDLSDIILRDSMKLMRNPPYTPRQFR
FT                   QFESNVIEVDYEEPIYIDGWEVTLFNAGHIPGSASIHMSKDVNILYTGDIKLEETRLLE
FT                   PAYTDFPETDILIVESTYFGVEHPDRKELEKAFVESILETLDNKGHAIIPAFAVGRTQE
FT                   VLMILESYGITPYVDGMGRDVCSIIERYPDYVKSVRALRRAIKNAIPVERGMRERILEE
FT                   PSVIVTTAGMLNGGPALFYISRLYNDEKSKILLTGYQVEGTNGYMALNNGMIDLGNRIV
FT                   KLKMKVEQYDFSAHADDRQLKELVRRVVDRGAEVVFTVHGEDCEGFANWIREELGVEAH
FT                   APKNGDVYVV"
FT   gene            complement(6094..7524)
FT                   /locus_tag="Arcpr_0005"
FT   CDS_pept        complement(6094..7524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0005"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="TIGRFAM: oxaloacetate decarboxylase alpha subunit;
FT                   PFAM: Conserved carboxylase region; pyruvate
FT                   carboxyltransferase; KEGG: hch:HCH_06704 pyruvate
FT                   carboxylase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57083"
FT                   /db_xref="GOA:D2RFK8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFK8"
FT                   /inference="protein motif:TFAM:TIGR01108"
FT                   /protein_id="ADB57083.1"
FT                   /translation="MKVKIVDLTLRDAHQSLMATRLRTRDMLPILETFDEAGIYCFEVW
FT                   GGATFDSCIRYLNENPWERLKEIRKRIKNSLISMLLRGQNLVGYRHYPDDVVEKFVRKT
FT                   AEYGMDVFRIFDALNDVRNLVTSIKVAKECDAHVQGTICYTISPVHTIEKYVEIANELA
FT                   VLEVDSICIKDMAGLLSPKMAYTLVRTLKKEVGLPIDVHSHYTSGMASMALLKAVEAGA
FT                   KMIDTVISPLSLGTSHPPTESMVYALEELGYETGVKLDVLLEVREYFMKIREKYQGYID
FT                   WRSTIPDTNVLVYQIPGGMFSNLIAQLKEYNALDKLPEVLKEVPKVREDLGYVPLVTPT
FT                   SQIVGVQAVLNVITGERYKVVTKETKDLVKGMYGKTPTPIKEEIRKKILGDEKPIECRP
FT                   ADLLEPEFEKRRQELIEMGFENPSDEDVLIYTLFPQVGLKFLKGEAKEEPIPVGGKIEG
FT                   TFEVEIEGEKMKISVKPL"
FT   gene            complement(7556..8086)
FT                   /locus_tag="Arcpr_0006"
FT   CDS_pept        complement(7556..8086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0006"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: phosphodiesterase, MJ0936
FT                   family protein; K07095"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57084"
FT                   /db_xref="GOA:D2RFK9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFK9"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADB57084.1"
FT                   /translation="MKILVLSDTHIPERALKIPDEITAFLKRGVDLIVHAGDLTGESVL
FT                   NTLKSFGKVVAVRGNMDYLSLPKQETFEVGNLKFGVYHGHGVYPRGDRRQLTEIALEMG
FT                   VDVLITGHTHSPDVYEGEVLILNPGSATGAWGGGGGSGIPSFMVLNVEGREITVDLYEI
FT                   RDKLSLKRFKFEL"
FT   gene            complement(8089..9195)
FT                   /locus_tag="Arcpr_0007"
FT   CDS_pept        complement(8089..9195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0007"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KH type 2 domain protein;
FT                   SMART: AAA ATPase; KEGG: sfu:Sfum_2163 PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57085"
FT                   /db_xref="GOA:D2RFL0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL0"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ADB57085.1"
FT                   /translation="MLLEKITPLTRGQKEIVKALKNPDYEIIGIFGPTGTGKSLFSLAY
FT                   GIDAVSSDYKRFIVVKPVIDVVTGEELTLADGEKFLELAKAYVLDVIGQFVDWSEVERL
FT                   ISDGKIVFVDPHYLKGRTFDDSVVFLDEIQTLKPESVVEILIRMGRNSRLIVAGDPIFQ
FT                   SFKMEETQDPASMVRDILTGEENAKVVDLGIKDIVREGAKRGLRLLIEYRMRSRELSEV
FT                   EKEIFESAKVHSPDADVITVVEFCEEKERFEITSEHTPDALIIVKQGHYGRLVGRGGER
FT                   IKAIEEDVGKRIRGVELTLDFRELIRSIHPVSWIWKHIRDVDFVGQYLTVEVKGEIGAF
FT                   VGQRGLHVRFLDAVIRKLMGVGVRAVEV"
FT   gene            9278..9766
FT                   /locus_tag="Arcpr_0008"
FT   CDS_pept        9278..9766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0008"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57086"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL1"
FT                   /inference="protein motif:COG:COG3465"
FT                   /protein_id="ADB57086.1"
FT                   /translation="MNESLRLKELARLIRALENAGVYKFSIETFEDRLKLQKIVYIAKH
FT                   FGIDLGYEFNEYIRGPYSPDLADDYYSLNEKWSDLRCLEEPLTCEEVEKLIEFLRGKST
FT                   AELEGIATGLMFLKILKRKGIYGEKDLRELLVGIIKSRKPFLSNIAERLVDTVIETFN"
FT   gene            complement(9767..10378)
FT                   /locus_tag="Arcpr_0009"
FT   CDS_pept        complement(9767..10378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57087"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57087.1"
FT                   /translation="MDSNSKRRLYLDASVVIELMKFETSPSLCKKRRGNREKDKLEVLE
FT                   SNISKLNIAKSRYKLTISTLALGEVVRFIAESEKKKEYVEWLLEFLNRYNIDILPIERD
FT                   TFCKYDDQTYRFNDECNIFKIAEEIVRNEFSNQNEWWGGKMLDGDDALILAQAICDKDA
FT                   EALLTIEDRMIECVSVDIIENKKIKRNPKLKRIKDLAELF"
FT   gene            complement(10422..12509)
FT                   /locus_tag="Arcpr_0010"
FT   CDS_pept        complement(10422..12509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0010"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: sat:SYN_01979 anaerobic ribonucleoside-
FT                   triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57088"
FT                   /db_xref="GOA:D2RFL3"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL3"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADB57088.1"
FT                   /translation="MDEVSVDTEMFDHNKEYLTVRTSRNTIEKFDRERIVKSLVKETGL
FT                   DRKTAEEIALEVEETIKRLKLNFISAPLIREIVNVKLLERGLEKERANYTRLGLPVYDV
FT                   TQIIEKGVRENANLQHNPETIHKLVADWVMKEYALLKVLPLHLADAHMRGEIHIHDLEY
FT                   FATRPYCFQHDLRWFLKNGLKVDGTGENTAVAGPAKHPEVAILHAAKALAAAQTNFAGG
FT                   QGLDFFNVWLAPYMQGLSYEKIKQLAQMFVYEMSQMYVARGGQTVFSDIDIEYGVPKIC
FT                   QDLPAVLPGGVVKESVTYGDFEEEAIMFAKALTEVYLEGDYLGKPFFFPKPNYKLRKEC
FT                   FKKEGFDEFMILVHKVVAKFGSPYFLNLLAGYLPDNVFAQCCRLVLAPDNQDWEDFRKG
FT                   CMRTGSLQVVTINLPRIAYEANGDDERLFEILEQRMNLAREVIELKREIIIKRMKQGAL
FT                   PFLTQDVDGEPYYRVDKVVRSIGFVGLNEMLKAHIGQELHESRDAWKFGLEVIKRMMDI
FT                   AMEWSIETGQRWVITQTPAESCAHRLALLDLKEFNGKAIVQGNVKTGAVYYTNSSHVRV
FT                   SADVPLFERLKVEGSFHPLCNGGMMAHVWIGESSPNPELLWELTKKIATKTLIGYWAYT
FT                   KDMTFCRSCGKLSGGINRNCPFCNSNDVEWYSRVTGYYQRVSGWNDGKVQELFDRKRVR
FT                   F"
FT   gene            12741..13280
FT                   /locus_tag="Arcpr_0011"
FT   CDS_pept        12741..13280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0011"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: sfu:Sfum_2603
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57089"
FT                   /db_xref="GOA:D2RFL4"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL4"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADB57089.1"
FT                   /translation="MKALIVVDMQKDFCYPEGALYIGDHVRKIISTTKEVLEVARGKIP
FT                   IVFTQDWHRKDDPEFNIWPKHCIQNTWGAEIIDELNPSEVDYFVKKRRYSAFFGTDLDL
FT                   LLRELGVNELIVCGVVTNICVLHTVADAVMRGYKVTVLKDCTTALNEYDYEYGIKHMKE
FT                   VLRAKITSSKDLKTSF"
FT   gene            complement(13246..13428)
FT                   /locus_tag="Arcpr_0012"
FT   CDS_pept        complement(13246..13428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57090"
FT                   /db_xref="GOA:D2RFL5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57090.1"
FT                   /translation="MKEVVASIYPPTLALSIAFFTFLVSYILTESVTLSLLASLIAGVL
FT                   TYLTARKKFSNLWMK"
FT   gene            complement(13425..13751)
FT                   /locus_tag="Arcpr_0013"
FT   CDS_pept        complement(13425..13751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57091"
FT                   /db_xref="GOA:D2RFL6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57091.1"
FT                   /translation="MYQNLIGAILSAIMVISSVLLTWRWFSVVHGEVDPYIILCAFLLT
FT                   LSLGLLLLNTLYIMRRTVEEIENAKRVVSIGYKEIEERLETKLSKGLRDIEESINDIRR
FT                   MMYR"
FT   sig_peptide     complement(13656..13751)
FT                   /locus_tag="Arcpr_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.671) with cleavage site probability 0.327 at
FT                   residue 32"
FT   gene            complement(13789..14733)
FT                   /locus_tag="Arcpr_0014"
FT   CDS_pept        complement(13789..14733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0014"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="KEGG: sun:SUN_0294 AsnC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57092"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57092.1"
FT                   /translation="MSRELSSEDLELLMELQYNFPISETPYTDLAYRLDLDPDSVISKL
FT                   SNFKKIGIIKRVGANLNYKAIGFIKVACLVAFACKDNDVQRIARVINESFPDINLKHNY
FT                   LRDHERYKVWFTVKGESLEKIFEEVERVAKACDVKDYLILPSKRVYKMSVKYDLYKGIS
FT                   WSYGVERDPETVEDRDLIDLIIRLQNIPILERPFKFEGYSETEVVDIIKEMIKKGVFRD
FT                   FYGVLRERAIGFKENGMNLVRTDEPEKIARKLLKYPQITHLVERGVPENWKYPIYFMVH
FT                   ASEREKIEDFKREVSEELGVEILTLYSVANLKD"
FT   gene            complement(14711..15406)
FT                   /locus_tag="Arcpr_0015"
FT   CDS_pept        complement(14711..15406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0015"
FT                   /product="siroheme synthase"
FT                   /note="TIGRFAM: siroheme synthase; PFAM: TrkA-N domain
FT                   protein; KEGG: aha:AHA_4121 siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57093"
FT                   /db_xref="GOA:D2RFL8"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL8"
FT                   /inference="protein motif:TFAM:TIGR01470"
FT                   /protein_id="ADB57093.1"
FT                   /translation="MRVPIYVEFEGKNVLVIGGGGVGTFRAKKFLNAGANVKVLSLEFS
FT                   DELKELQREGKVELVKGDVRDLERLERLIEKSNLVVVALPFTDLNDTIVELAKKYKTLV
FT                   NLANDAKKTEVVIPFEGEFEGIRFAVTTEGKSGIVARRVKDLFLKALEEDEDVVFFLKA
FT                   MDHLKKYMKSRNIPIQLRMKLYFAVSDDEQFRKLVKEGDVESAKKWAEKLVDEYVSGKR
FT                   ELNVKGIEF"
FT   gene            complement(15403..15795)
FT                   /locus_tag="Arcpr_0016"
FT   CDS_pept        complement(15403..15795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0016"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: oan:Oant_0816 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57094"
FT                   /db_xref="GOA:D2RFL9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFL9"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADB57094.1"
FT                   /translation="MDDIEEIRRKKLEKLAKKIRGDRMVGKPVKLDSTNFKKFIEENEN
FT                   VVVDFWAEWCGPCKLISPIIDELAKEYAGKVAFGKLNIDEDRTIAMQYGISAIPTLIFF
FT                   KKGKAVSMIVGAYPKSELKRWIEKYL"
FT   gene            15873..16508
FT                   /locus_tag="Arcpr_0017"
FT   CDS_pept        15873..16508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0017"
FT                   /product="ribonuclease HII"
FT                   /note="TIGRFAM: ribonuclease HII; PFAM: ribonuclease
FT                   HII/HIII; KEGG: hypothetical protein; K03470 ribonuclease
FT                   HII"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57095"
FT                   /db_xref="GOA:D2RFM0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR004649"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020787"
FT                   /db_xref="InterPro:IPR023160"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM0"
FT                   /inference="protein motif:TFAM:TIGR00729"
FT                   /protein_id="ADB57095.1"
FT                   /translation="MIAGIDEAGKGPVIGPLVICGVLCDEETVEYLKSVGVKDSKKLDR
FT                   RKREELYNIIKSLCKVKVLKISVEDLNRLMEYMSINEILKRAYVEIIRSLMPKVVYIDC
FT                   PDINVERFKHEIEERTGVEVFASHKADEIYPIVSIASIVAKVERDFEIDKLKKIYGDFG
FT                   SGYPSDLRTIEFLRSYLREHKSFPPIVRKRWKTLKRLTTHTLSDFFEV"
FT   gene            16547..16621
FT                   /locus_tag="Arcpr_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            16547..16621
FT                   /locus_tag="Arcpr_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(16625..17770)
FT                   /locus_tag="Arcpr_0018"
FT   CDS_pept        complement(16625..17770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0018"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase;
FT                   Nicotinate phosphoribosyltransferase-like; KEGG:
FT                   noc:Noc_1009 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57096"
FT                   /db_xref="GOA:D2RFM1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM1"
FT                   /inference="protein motif:PFAM:PF01729"
FT                   /protein_id="ADB57096.1"
FT                   /translation="MRFLIVEEEDIKHGLTTDKYFLWTEQVLKAKGVNPKVVAEITTSS
FT                   WGIFVGINDVLKLLEGKPVDVYAMPEGCLFFPHEPVITIVGRYLDFARFETAILGFICH
FT                   PSAVATEAFKFKLASGGKRILSFGTRRMHPAISAVIERSAYIGGVDGVSNVSAEKYLGI
FT                   ESIGTMPHALIICFGNQVEAWRAYDEVVDKSIPRVMLVDTYYDEKTEAILAVENVDRVD
FT                   GVRLDTPSSRRGNMRKIVEEVRWELDIRGKRDVKIVVSGGLSLRDVMELRDLVDAFGVG
FT                   TAIAGAKPIDFAMDIVEREGKFVAKRGKRGGMKQVYRIWDELRDEIKLFNEKGEGEPLI
FT                   QKVMENGKILKTFNMHEARELVLKQIEIIRELGIEDRFLNE"
FT   gene            complement(17767..18057)
FT                   /locus_tag="Arcpr_0019"
FT   CDS_pept        complement(17767..18057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0019"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   ftm:FTM_0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57097"
FT                   /db_xref="GOA:D2RFM2"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM2"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ADB57097.1"
FT                   /translation="MRIGDFQKLIKELYYERDLKRGKEKTMLWLVEEIGELAEAVRKND
FT                   LNSIREEMADVFAWLVSLANLYDVDLESAVKEKYPGRCIKCGRIPCECDER"
FT   gene            complement(18059..18874)
FT                   /locus_tag="Arcpr_0020"
FT   CDS_pept        complement(18059..18874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0020"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: gsu:GSU3095 imidazole glycerol phosphate
FT                   synthase subunit HisF; TIGRFAM: imidazoleglycerol phosphate
FT                   synthase, cyclase subunit; PFAM: histidine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57098"
FT                   /db_xref="GOA:D2RFM3"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM3"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADB57098.1"
FT                   /translation="MLAKRIIPCLDVTLNEKGAMVVKGVEFVNLREAGDPVELAKRYDE
FT                   EGADELVFLDITASPEGRRMMIDVIERTAEQVFIPFTVGGGIRSIDDINAILSAGADKV
FT                   TINTSAVKNPELVREASEIFGSQCIVIAIDCRRNFDLSKGENVVTLEDGRKAWYEVVIY
FT                   GGRKPTGIDAISWAKKVEELGAGEILLTSMNRDGTKLGYDIPITRAISEAVNIPVIASG
FT                   GAGKPEHFYEGFVEGKADACLAASIFHYREISIAEVKEYLAERGIPVRW"
FT   gene            19046..19702
FT                   /locus_tag="Arcpr_0021"
FT   CDS_pept        19046..19702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57099"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57099.1"
FT                   /translation="MKTVHLIPLGKRCEIILESVRMSGKPIQKAYLIVSRDGNCLKEVE
FT                   NALKNFIEVEVVKLSNDVYEAAIELLKIIKRELDEGNDVYINLSDAPKELCIAGLISAQ
FT                   ISRSKVYMAITSNGKVEKVIDLKVPPIKSLGEDKIALIKALEENGGEVESINRLIEIIE
FT                   GKTDDQKKYMAQRARMSYHLKGLETDGLIEMKREGKNVRIRLTPLGKAYAIMLLQ"
FT   gene            complement(19723..20325)
FT                   /locus_tag="Arcpr_0022"
FT   CDS_pept        complement(19723..20325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0022"
FT                   /product="RNase P subunit p30"
FT                   /note="PFAM: RNase P subunit p30"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57100"
FT                   /db_xref="GOA:D2RFM5"
FT                   /db_xref="InterPro:IPR002738"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023539"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM5"
FT                   /inference="protein motif:PFAM:PF01876"
FT                   /protein_id="ADB57100.1"
FT                   /translation="MNVDFVRFCPEIKYDYDNFVVFSENPDDLKGDFLKGYLIRADSPK
FT                   ELLQKLRRAKRDWFVGVVGNLKVLKYAVMRWRVDLILDFDGRELDYSLIKIAKEKDVAI
FT                   EVSFSKFLRCKGFERSQLFEEVIETLKIIKKFDTPFVLTSGANDFYELRPKRQIIEFFE
FT                   YLGADVERAEYWIRRLVRRYTDPNYIMDGLEIVGDDP"
FT   gene            complement(20322..20759)
FT                   /locus_tag="Arcpr_0023"
FT   CDS_pept        complement(20322..20759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0023"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57101"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM6"
FT                   /inference="protein motif:PFAM:PF01877"
FT                   /protein_id="ADB57101.1"
FT                   /translation="MKIERILVSAVVYSTEDREKVAMAMATLFPFEFEIVRVPATGHFG
FT                   NPIEYLEVEITKKKQIKEFWNNLIKLLGDQKEYIINTLEERIDDQGQLYIRFDKQKAYL
FT                   GEIYVTDKGDAIVVKAKLVTYPAKKEKIIEFAREILEKGYK"
FT   gene            20798..21298
FT                   /locus_tag="Arcpr_0024"
FT   CDS_pept        20798..21298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57102"
FT                   /db_xref="GOA:D2RFM7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57102.1"
FT                   /translation="MRVGLVNALLLAGISLTVVAAYECRTLSNPLRLIALTVCWFAMIY
FT                   FPHCLAHYIVGRFLGVEFSHYTISKSMLSKVGIPIISKLFSARIFLTLRIKKRAGKRAM
FT                   FAMFLAGPLASMLCPLVVVYIAYSYDRVSATLLAILTIFNILFAGYFSCKHGCIRKALN
FT                   SLR"
FT   sig_peptide     20798..20860
FT                   /locus_tag="Arcpr_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.708 at
FT                   residue 21"
FT   gene            complement(21287..21565)
FT                   /locus_tag="Arcpr_0025"
FT   CDS_pept        complement(21287..21565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0025"
FT                   /product="MazG nucleotide pyrophosphohydrolase"
FT                   /note="PFAM: MazG nucleotide pyrophosphohydrolase; KEGG:
FT                   ftm:FTM_0547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57103"
FT                   /db_xref="GOA:D2RFM8"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM8"
FT                   /inference="protein motif:PFAM:PF03819"
FT                   /protein_id="ADB57103.1"
FT                   /translation="MDLKEVRKAIKEKYYEIDARSGELFLLAVLFEEVGELAEAVRKRD
FT                   VKAIEEELTDVLFMVLSLANYFNVDIESRLVEKYIKGDPSGRWDLPE"
FT   gene            21605..23029
FT                   /locus_tag="Arcpr_0026"
FT   CDS_pept        21605..23029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0026"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; phosphoesterase DHHA1;
FT                   phosphoesterase RecJ domain protein; KEGG: mxa:MXAN_2984
FT                   DHH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57104"
FT                   /db_xref="GOA:D2RFM9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFM9"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADB57104.1"
FT                   /translation="MEEKFSHEYIVIGCGATGFSVVKELVRKGKKVLAIDISKERVEVL
FT                   RDENYDAIVGDATDESLYQDIDFSKVSIVMVLTSDTEANKRAVEIVRSISKDVFIIARS
FT                   QSSKTKEELEQAGADFVVVPSEAMKTIVLEVIRKADTYRKLKLLAKVIESCRGRLGIFT
FT                   HDNPDPDAISSALALKEIARYYGVEADILYYGDIMHQENRAMVNLLEIEMLKADEVDLS
FT                   IYDKFAIVDCSKPGVNNSIPQNIHISIVIDHHPAEDVMADFVDIRTDVGACATILTEYL
FT                   KEMRITPSRTLATALFFGIKTETNNFKKNTRTADFLAAAFLYPFVDHELIEKMEGPAIS
FT                   TETLDVLATAIKNRQVYSSFLISFAGYITNRDVLPQAADFLLRLEGISTVLVFGILKDK
FT                   VYISARNKDVRINIGEVLKRAFGDVGSAGGHAHSGGAQIPLGIFGEVTDRDALAKLVTE
FT                   AIKKRFLNALGVEVKE"
FT   gene            23060..23242
FT                   /locus_tag="Arcpr_0027"
FT   CDS_pept        23060..23242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57105"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57105.1"
FT                   /translation="MRTFDWKSWKNKGLEKEKLKEEKELKDELEGLKEDAKHPETDLEK
FT                   VANEVLKEDEEEHEG"
FT   gene            23232..23441
FT                   /locus_tag="Arcpr_0028"
FT   CDS_pept        23232..23441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0028"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57106"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN1"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ADB57106.1"
FT                   /translation="MKVKIKFLGGFDKTEEEVEVEKGKRYSDLLKMLGINPETVVVVRN
FT                   GKPVPVDDFVEEGEIVVMRVISGG"
FT   gene            23481..25637
FT                   /locus_tag="Arcpr_0029"
FT   CDS_pept        23481..25637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0029"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; Ig domain
FT                   protein group 1 domain protein; SMART: PKD domain
FT                   containing protein; KEGG: sde:Sde_3605 glycosyl hydrolase
FT                   family chitinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57107"
FT                   /db_xref="GOA:D2RFN2"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN2"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADB57107.1"
FT                   /translation="MDSKGVTPLIGFILLLLIGMVFLSLVQTKLVPSILKDVEMKHMNK
FT                   VIEEIYEFDRDVIKGEEGIVSFDLGVEYPNYLFLMTPTTGASSISIEQMTINVSGEIRI
FT                   DDRVINKLSYNTNRITVGLNYFANPNYKIIYENTAIFKMFDHTIMVSGEQKMFCRRYVN
FT                   IYMINTSFSSISSNRPTSVVIVPISVPKDVGGAWISNANLTFKSVYPEYWNSTLKGLNY
FT                   SVDVNESNGTISATLKNVTLRVYYLYVMTGVGLSAEQVEEAYRSLRSETLHPSYVVRLN
FT                   PSEITLSQGESIVLGVRVLDQYFNPMGNVNLSVSASGGSVNPQNAFTNERGEAYFTFTA
FT                   SNAGTATVKIECVENKSVSVTYTIKVTPVGSAPCPYSIKWNVNSYDWNVSLEGNTKSFF
FT                   LHAEYENSPLIGANIDLSKNSTIVAIPDSVTTNESGDAEVSITANDNGSVAVVASYSCA
FT                   YAILHLNIYGFGINEQPVAIFTYTPSYPAVGEVITFDASSSYDPDGVIVEYRWDFGDGN
FT                   AVTTTSPTVTHTYSNWGAYKVTLTVVDNGSLVNSTSVWIWVGDLIYNNDALALDGPDSP
FT                   WPRRDRAGGVEFTITNRFNTTVEIDYIYIEPQSAQITTLSDEVFPNNQPRYCEVYVDAS
FT                   IPSYVDYYGGTSLPVKVDLGVSGDENSGTDAYMNADSTAKIYLYEFYNRHGGNIDMSGE
FT                   TIYIEIGYSANGEHKVKSFTITPQ"
FT   sig_peptide     23481..23561
FT                   /locus_tag="Arcpr_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.546 at
FT                   residue 27"
FT   gene            complement(25624..26646)
FT                   /locus_tag="Arcpr_0030"
FT   CDS_pept        complement(25624..26646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0030"
FT                   /product="translation factor pelota"
FT                   /note="TIGRFAM: translation factor pelota; PFAM: eRF1
FT                   domain 1 protein; eRF1 domain 3 protein; eRF1 domain 2
FT                   protein; KEGG: hypothetical protein; K06965"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57108"
FT                   /db_xref="GOA:D2RFN3"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN3"
FT                   /inference="protein motif:TFAM:TIGR00111"
FT                   /protein_id="ADB57108.1"
FT                   /translation="MRIVEESLKGRKGEIKVIPESLDDLWHLKYIIEPKDVVYSWTKRI
FT                   RESGDKLRSDKEKVTVRLGVEVEKVEFHRFANRLRITGRIVGGVEDSGYHTLSITVGKE
FT                   LSIIKEEWKEEQLKRLREATQKKPEVAIVTIEEGEAVVGVVREWGVEEIFNVRKSYGKD
FT                   SSERIEFFHEIMRQLENLEFNYLVIAGPGFTKEDFAEFLKEKKPEWKILTCDASSIGVR
FT                   GFIEVLKRGVLDRIGREIRLKEEAEYVERLLEGIAKGDRVAYGLDEVKKAYEYGAIEVL
FT                   LVVDEFLREERERWDIDNFLRDVESLGGKVVIVSSEFEPGKMLMSLGGIGALLRFSIEV
FT                   "
FT   gene            26754..27342
FT                   /pseudo
FT                   /locus_tag="Arcpr_0031"
FT   gene            complement(27353..28009)
FT                   /locus_tag="Arcpr_0032"
FT   CDS_pept        complement(27353..28009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0032"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: gsu:GSU1524 protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase;
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57109"
FT                   /db_xref="GOA:D2RFN4"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN4"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADB57109.1"
FT                   /translation="MDPFEEKRRRMVERLKEELGISDKVAKAMLKVPRHLFVPKAYERE
FT                   AYVDTPLPIGFGQTISAPHMVAIMCDLLDLKEGEKVLEVGGGSGYHAAVVAEIVGKKGK
FT                   VIAIERIPELAERAKEVLRLLGYDNVKIVVGDGTKGYPEEAPYDKIYVTASAPDIPKPL
FT                   IEQLKPGGRMVIPIGRYEQHLYVVDKDESGKIHKRVWGPVRFVPLVGEYGFKEWE"
FT   gene            28057..28911
FT                   /locus_tag="Arcpr_0033"
FT   CDS_pept        28057..28911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0033"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: bab:bbp182 homoserine kinase; TIGRFAM:
FT                   shikimate kinase; PFAM: GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57110"
FT                   /db_xref="GOA:D2RFN5"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR010189"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN5"
FT                   /inference="protein motif:TFAM:TIGR01920"
FT                   /protein_id="ADB57110.1"
FT                   /translation="MKAQAYSAGTIINALATGYGCAFGLDLKLKVRVDFEVNDNVVVEN
FT                   GIERRSIVLDTVLNHFGLNAVVEVESEIPKGSGLGSSSAFLNALLLAVYKYISKSLNAG
FT                   DILRLNAKLSLECGISYTGAFDDASASLLGGIVLTDNTSMQMLRWEFKRAKAVILIPEF
FT                   GRGRIDLNEIRRDLTLVRKALKFARRGDYKSAMYYNTLHYCKAIGYPIEVVEIVKDSNC
FT                   CCGLSGNGPCFVAFGDVKEVKKVWEAYGNVIETKIVNEPCDDIVITHDLFSYSELQSRQ
FT                   SDE"
FT   gene            complement(28829..29158)
FT                   /locus_tag="Arcpr_0034"
FT   CDS_pept        complement(28829..29158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57111"
FT                   /db_xref="GOA:D2RFN6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57111.1"
FT                   /translation="MLRKVICAVGLVVCGYLLYLTEYVGICLDHCDPFNYSLGLAWFLI
FT                   GLILKERGLQIWALAGLLGIAYFVIRELFEGFCLYCTFIHLIALTAVLSTKTDRALSRY
FT                   HRKVR"
FT   gene            complement(29143..29526)
FT                   /locus_tag="Arcpr_0035"
FT   CDS_pept        complement(29143..29526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: PDIA5; protein disulfide isomerase family A,
FT                   member 5; K09583 protein disulfide isomerase family A,
FT                   member 5"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57112"
FT                   /db_xref="GOA:D2RFN7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57112.1"
FT                   /translation="MKKLIALLLVLTIALLGCSQKSALETGSKACNYSNIEVYFYYSPT
FT                   CPHCEKVKPYIDKLREKYKDVKFIYCNVSDKNISKACYTYAYYVIGVPTVVVHAGNVTT
FT                   ALAGDRDIIGLENLIRSLACCGK"
FT   sig_peptide     complement(29452..29526)
FT                   /locus_tag="Arcpr_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.491 at
FT                   residue 25"
FT   gene            29596..30270
FT                   /locus_tag="Arcpr_0036"
FT   CDS_pept        29596..30270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0036"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   atc:AGR_C_2426 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57113"
FT                   /db_xref="GOA:D2RFN8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN8"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB57113.1"
FT                   /translation="MKITWLGHACFLLEGTKKIIIDPFLTGNPTAPVKPEEIDVDLILV
FT                   THGHGDHLGDAEAISKRCKAPIVAVYELAVYLAKRGCETIGMNIGGTLDYEGVKVSMVN
FT                   AVHSADIVGNEIVSGGKAVGYVVEDGVSVYHAGDTDVFMDMQLIGEIYKPKVALLPIGG
FT                   FYTMSPKTALKAIELLKPEIVVPMHYNTFPPIKQDPEEFKREAEKLGVKVVILKPGESF
FT                   EV"
FT   gene            complement(30271..31785)
FT                   /locus_tag="Arcpr_0037"
FT   CDS_pept        complement(30271..31785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0037"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP- binding;
FT                   biotin carboxylase domain protein; RimK domain protein
FT                   ATP-grasp; phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: mxa:MXAN_5767 acetyl-CoA carboxylase, biotin
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57114"
FT                   /db_xref="GOA:D2RFN9"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFN9"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ADB57114.1"
FT                   /translation="MFEKVLVANRGEIAIRVMRACRELGIRTVAVYSSADRRALHRLYA
FT                   DESYYIGKADARESYLNIDRIIEVAKKADVDAIHPGYGFLAENPEFAKRCEEEGIVFIG
FT                   PSSDVIAKMGSKVMARKLMQEAGLPVVPGSPALEDVDSAFKWAEKIGYPVAIKASGGGG
FT                   GIGITIVNSEDELEQAFYKSKKLGEKYFGDATVYIEKYLPKPRHIEFQVLADEHGNVIH
FT                   LGERECSIQRRHQKLIEECPSPAVDDETREEMGKLVVKGTKYIGYTNAGTMEFLYQDGK
FT                   FYFLEMNTRLQVEHTITELVTGIDIVKYQIKIAYGEELYHDQEDVVMRGHAIECRINAE
FT                   DPIEFLPRSGRIVHYRSPGGIGVRVDSGVHMGYVIPKEYDPMISKLCVWGENRLEAIYR
FT                   MRRALWEYVIVGVETNIPFHLAVMHNDAFVRGETHTKFVDEQDIREEVRTYMVKYHPIM
FT                   KRLDEVFREEIKEEDIAVALALAEYQRYEEPRISTWKMHARLENVK"
FT   gene            complement(31809..32303)
FT                   /locus_tag="Arcpr_0038"
FT   CDS_pept        complement(31809..32303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0038"
FT                   /product="chromosome segregation and condensation protein,
FT                   ScpB"
FT                   /note="TIGRFAM: segregation and condensation protein B;
FT                   PFAM: chromosome segregation and condensation protein ScpB;
FT                   KEGG: rpa:RPA2850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57115"
FT                   /db_xref="GOA:D2RFP0"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP0"
FT                   /inference="protein motif:TFAM:TIGR00281"
FT                   /protein_id="ADB57115.1"
FT                   /translation="MKEEIEAILFSSPEPVDVRDIAKILRTKVEDVEEAVNELIKDYES
FT                   RSTALEIIRLGNRVLMRVKPKYQHLVSGERDLDRSTLRTLAIIAVNQPIELSKLAKMRG
FT                   NRCYEQVKRLEELGLVKSEKKGRTKILTTTEAFIKYFGLNVSSIDEIKDVLRRRLESLN
FT                   L"
FT   gene            complement(32287..32898)
FT                   /locus_tag="Arcpr_0039"
FT   CDS_pept        complement(32287..32898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0039"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpA"
FT                   /note="PFAM: chromosome segregation and condensation
FT                   protein ScpA; KEGG: geo:Geob_3015 chromosome segregation
FT                   and condensation protein ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57116"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP1"
FT                   /inference="protein motif:PFAM:PF02616"
FT                   /protein_id="ADB57116.1"
FT                   /translation="MAKKGEIDPWNIDIVDLTDKFLQKIEDLRVSGRIILYASILLRMK
FT                   SEVLLNEIYGEEDEDYELDFNSDLNNVDLFNDVRIDIPIVRRKVKRYTTLDELVRELRR
FT                   IERLKERRAKRKRVEKRIVSFENVPHEEDVEEKIVEVYKSLLSLGMKEISFLNLVRGFD
FT                   KPKKVTYYISILHLAYRKKLKVEQEKPYEDIRVILNERGD"
FT   gene            complement(32907..36314)
FT                   /locus_tag="Arcpr_0040"
FT   CDS_pept        complement(32907..36314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0040"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="TIGRFAM: chromosome segregation protein SMC; PFAM:
FT                   SMC domain protein; SMCs flexible hinge domain protein;
FT                   KEGG: SMC family, C-terminal domain containing protein;
FT                   K06675 structural maintenance of chromosome 4"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57117"
FT                   /db_xref="GOA:D2RFP2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP2"
FT                   /inference="protein motif:TFAM:TIGR02169"
FT                   /protein_id="ADB57117.1"
FT                   /translation="MFIRKIKLRNFKSFKKAEIEFRDNFTVITGPNGSGKSNIIDSILF
FT                   CFGISSSKTLRADKLTDLIKHGQKEAEVTIELDGYIVRRRVKKTDKGYYSYYYINGKSV
FT                   SYSDIERLIEKLGLNTEYNIVMQGDVTRVAEMTPIQRRKIIEDIAGISEFEEKKEKALE
FT                   ELEEVKRNIEKVEITIKEVDDRLSQLKVEREEAIKYKNLVEERELLLNYKRIHEYLRLV
FT                   NTANSLRKRLEELNEERDQILKAITDINSRLVNLNEEVKEIVDRIESFKDSRLKRINEE
FT                   INVVSNEISGLKKLISLFSSEVEDLNREKEKTLISLQRAEEEIKRINEELRDIDVKMES
FT                   LENILNEKISYLNALKIKYDEITSRFRAQREELESKLNLLNELKEKRTSLLKEREKILE
FT                   GLRRIGMEIDDMELSREKIDLSRIFDEIAEDERNLAILKNEMDKLKLKLFEIDGEIFKL
FT                   RDEIAKIDKEIREKEIELAKVSAIQKPRAVEVVLKAKEEGKLEGIYGTVSQLCSVDEKY
FT                   ALALEIAGGNALNFIVVEDEDKAIRAVKYLKDVDGGRASFIPLNRINISLNLDKSVLSV
FT                   EGVIDYAVNLIECDRKFRKVFELVYKDALVVEDIDTAKKFMNKFRVVTLDGDLIEKSGV
FT                   ITGGSIKKKATLGLFDRERRLREDIENLKRSRSELESKLSEVELERKDLEKRIEKLNED
FT                   ITSLKSKISTSGAKVDEFSKLLKDIEEKLKEKRREAEILNSKALEVEEEINKIEENIRC
FT                   IEREVKELESKLKDDRIVKLNTKIEEIRGEIERLKDLKSVLSSKQSSLVAKREQLIKAI
FT                   EEYKSSLNDLEKKITERLNGIEDAKAKILELERRLESLREEERRINKEVGDLREKRDEL
FT                   LKEIDKLEKEKSQKTLAEKLLEERIKDLKEKLADVEKTLESYDIEIPKDLPSLEYVERK
FT                   LLQVEEELKSFGEINMKAIQEYEDVKKRLDELIEKKKTLERERKEIIEKIKRIEKMKKE
FT                   AFLSTFNSINEKFKEIVKELADGEGEIYLDKDDPFQSGLHIRFKPFGKPIQRLEAMSGG
FT                   EKSLLTLAFIFAIQRYKPAPFYAFDEVDMFLDGVNVGRLAKMIKKLSKDAQFIVVSLRK
FT                   PMLQEADHVIGVTRGGEEESIVTAIQLR"
FT   gene            complement(36316..36678)
FT                   /locus_tag="Arcpr_0041"
FT   CDS_pept        complement(36316..36678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0041"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57118"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57118.1"
FT                   /translation="MERDILLERLEKKLAEKEKEVEELRKMLSSKALEDLKNELREEFK
FT                   KDLKAIEAKVAELSKSVEALMNEVLFIKSEIKSYEKKETEIVDIPLEKEESEIEVAEKK
FT                   EEKRYELDDDEIIIVD"
FT   gene            complement(36769..37734)
FT                   /locus_tag="Arcpr_0042"
FT   CDS_pept        complement(36769..37734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0042"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="PFAM: Methionine synthase vitamin-B12 independent;
FT                   Cobalamin-independent synthase MetE domain protein; KEGG:
FT                   bbt:BBta_2188 methionine synthase (B12- independent)"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57119"
FT                   /db_xref="GOA:D2RFP4"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR022921"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP4"
FT                   /inference="protein motif:PRIAM:2.1.1.14"
FT                   /protein_id="ADB57119.1"
FT                   /translation="MKTTVVGSYPKPKWLLRMIRLHKEGKVDDKVMDEAYKDAVKAVVK
FT                   DHEIAGVDIIWDGEMRREEMTSYFAERIDGFVIYGEVRVWGNAYYPKPSIVGELRYRDE
FT                   LAIKDFLYLRSVTDKEIKVPITGAYTIVDWSFNEYYPSKEEAVYALAEVLNKEFRELVK
FT                   VGANYIQIDEPAIPTHPEEIEIAKNAVEIMVKGVKAYIGMHMCYGNYRAIFPEILDFKV
FT                   DQIDFEFANRNFEDLAILKEYDYDKDLGFGCIDVHSKRVETVEEVKRAIYMALEIVKPD
FT                   QLYVDPDCGLKLLPRDIAFEKLKVMVQATNEVRKELGLER"
FT   gene            complement(37731..38678)
FT                   /locus_tag="Arcpr_0043"
FT   CDS_pept        complement(37731..38678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0043"
FT                   /product="Cobalamin-independent synthase MetE domain
FT                   protein"
FT                   /note="PFAM: Cobalamin-independent synthase MetE domain
FT                   protein; Methionine synthase vitamin-B12 independent; KEGG:
FT                   hypothetical protein; K00549 5-
FT                   methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57120"
FT                   /db_xref="GOA:D2RFP5"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP5"
FT                   /inference="protein motif:PFAM:PF08267"
FT                   /protein_id="ADB57120.1"
FT                   /translation="MDVVATVVGNYPRPEWFREYLRKVEGLQKDLDVEVEREVLRKAIA
FT                   EVIDEQKKAGIELYTDGQLIWHDFLLTIASRLEGFEMNGLVRYFDNNLYYRIPIAKSKI
FT                   KRTKKILYDFEIAFEIEKNIKAVLSCYTVAKLSRNEFYPKFEDFLWDICEAIKEEIKEL
FT                   EERGVKYIQIDEPALLYAEKSELEVLKDVYKELTNTKMETILMTYFDSAERIFPEVLDF
FT                   GFDVIGLDFVEGYEENLKVVEEYDFSAINVGLIDGRNTKMESLEELKVKFEEITSKGNF
FT                   KKVYISPNTGLEFLPRIKAFEKMQLVAKLKGVVE"
FT   gene            complement(38683..39504)
FT                   /locus_tag="Arcpr_0044"
FT   CDS_pept        complement(38683..39504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0044"
FT                   /product="translation initiation factor 2, alpha subunit"
FT                   /note="PFAM: translation initiation factor 2, alpha
FT                   subunit; RNA binding S1 domain protein; SMART: RNA binding
FT                   S1 domain protein; KEGG: SUI2; Alpha subunit of the
FT                   translation initiation factor eIF2, involved in the
FT                   identification of the start codon; phosphorylation of Ser51
FT                   is required for regulation of translation by inhibiting the
FT                   exchange of GDP for GTP"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57121"
FT                   /db_xref="GOA:D2RFP6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022964"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP6"
FT                   /inference="protein motif:PFAM:PF07541"
FT                   /protein_id="ADB57121.1"
FT                   /translation="MSEEKEERLIIKRDGYPSPGEIVIGTVTRVMDFGAFVSLDEYENK
FT                   EGMVHISEVAPGWIKDIRDHVKKGQKVVCKVLGVNPKRGHIDLSIKDVTERQKREKWQE
FT                   WKNELKAFKWLEIIGEKLGLSREQLIEIGKKLIKEYDSVYEAFVECAYEGYEVLAKIVG
FT                   EEFAKEMAEIARENIKPPRVKVRGYFELKSYAGDGVERIKKALMKAYDVIKKFPNIKAE
FT                   IEYVGAPRYRIVLEADDYKVAEKALKSVVDTVLKTIKRLGGEGNFVREHIG"
FT   gene            complement(39546..40535)
FT                   /locus_tag="Arcpr_0045"
FT   CDS_pept        complement(39546..40535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0045"
FT                   /product="Transcription factor TFIIB cyclin-related
FT                   protein"
FT                   /note="PFAM: Transcription factor TFIIB cyclin-related;
FT                   Zinc finger TFIIB-type domain protein; SMART: Cyclin domain
FT                   protein; KEGG: hypothetical protein; K03124 transcription
FT                   initiation factor TFIIB"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57122"
FT                   /db_xref="GOA:D2RFP7"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP7"
FT                   /inference="protein motif:PFAM:PF00382"
FT                   /protein_id="ADB57122.1"
FT                   /translation="MVEKEKVREVEKEKEKEKEEVKEIEKEEIIEVCPECGSPRIVRDY
FT                   KRGELICQDCGYVIEERYIDAGPEWRAFDSEQREKRSRVGAPITYTIHDKGLTTIIDWN
FT                   NKDYYGKAISVRTRAQLFRLRKWQRRIRISNATERNLAFALSELDRMASALGLPKSVRE
FT                   TAAVIYRKAIEKNLIRGRSIEGVVAAALYAACRQAGVPRTLDEIAQYSRVDRKEIGRTY
FT                   RFIARELGLKLMPTSPADYVPRFCAALGLSGEVQRKAIEIIKKAEERELTSGRGPTGVA
FT                   AAAIYIASILCGERRTQREVAEVAGVTEVTIRNRYKELAEKLGIDIIL"
FT   gene            complement(40597..40788)
FT                   /pseudo
FT                   /locus_tag="Arcpr_0046"
FT   gene            complement(40887..41666)
FT                   /locus_tag="Arcpr_0047"
FT   CDS_pept        complement(40887..41666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0047"
FT                   /product="ExsB family protein"
FT                   /note="PFAM: ExsB family protein; PP-loop domain protein;
FT                   thiamine biosynthesis protein; KEGG: gur:Gura_3906 PP-loop
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57123"
FT                   /db_xref="GOA:D2RFP8"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP8"
FT                   /inference="protein motif:PFAM:PF06508"
FT                   /protein_id="ADB57123.1"
FT                   /translation="MSKIEKLKEFISKIGKNGVVVMFSGGVDSVTLTKLCKDVIKRVFA
FT                   VTVVSEVLSKYDVEYAKSVAKEIGVDHYILEIDLLNDENFVRNDENRCYFCKKKMIRMV
FT                   KEFASAVGVECIVEGTNVSELNEYRPGYRAVVEEGVYSPWIEVGIDKEEIRSIAKKLGL
FT                   SVHDNPPTTCLATRIPFGHRITHERLRRIEKAESIVRDLDFKVVRVRDYGDIAIVEVGR
FT                   EERSKFFNVDLMDYLSKSLKDLGYKYVTLNLEGYSRF"
FT   gene            41748..42329
FT                   /locus_tag="Arcpr_0048"
FT   CDS_pept        41748..42329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0048"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   SMART: iron dependent repressor; KEGG: dat:HRM2_42740 TroR"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57124"
FT                   /db_xref="GOA:D2RFP9"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFP9"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ADB57124.1"
FT                   /translation="MERVEEYLEAILDIQEKEKRVVRTSDIAKRLNVKPSSVTEMFIKL
FT                   KDMGYVDYVPYRGVVLTEDGRRIAEKIKRYYKIFEKFFKFLGVDEEKAKELSCELEHHA
FT                   DEKVVERICTIISSVCDICDECKFEELPLSEAGKGKYVVLIAPKSAKDLIKVGDRIEVI
FT                   ENNDTIKIKVGEEIFELSKDFGKKIIVRKA"
FT   gene            complement(42326..42520)
FT                   /locus_tag="Arcpr_0049"
FT   CDS_pept        complement(42326..42520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57125"
FT                   /db_xref="InterPro:IPR020073"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57125.1"
FT                   /translation="MTKIVHAQTVLPEDVLEELKRKTGESTTKDALAKAVEHYLRCPYI
FT                   HEDTFEKKIEEIIKKKKKS"
FT   gene            complement(42639..42713)
FT                   /locus_tag="Arcpr_R0002"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(42639..42713)
FT                   /locus_tag="Arcpr_R0002"
FT                   /product="tRNA-Met"
FT   gene            complement(42704..43228)
FT                   /locus_tag="Arcpr_0050"
FT   CDS_pept        complement(42704..43228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0050"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   nam:NAMH_0643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57126"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ1"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADB57126.1"
FT                   /translation="MMYAECVVRGLKVRIPFVCRMCGECCKKLSKVVYDPKTGKVYVEG
FT                   IELDCIDGLDEFKEFSHPIKVPCPFLKDNKCTIHEIRPKSCREYPLLTGDLGVNCPALR
FT                   SFNKFLKAFNPDKVEYKVDEKDIKPVKIPMKFYELFISLEPSKEELAAFLKLNELEKNL
FT                   NLELSNTIKGP"
FT   gene            complement(43225..43572)
FT                   /locus_tag="Arcpr_0051"
FT   CDS_pept        complement(43225..43572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57127"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57127.1"
FT                   /translation="MILYKQFGLSAREAAEITADVVEIIRRKLDDEKAVEFLKSKYSGD
FT                   KLLFAILMIGRITGMSLALQDIEKARMIVADFSRLVRILEEKGRDELVKTLEKDILEET
FT                   YAEEELRKGYA"
FT   gene            43655..44065
FT                   /locus_tag="Arcpr_0052"
FT   CDS_pept        43655..44065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0052"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   afw:Anae109_2751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57128"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ3"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADB57128.1"
FT                   /translation="MIKVVEVELDTNEMADITDEVRRFVKESGKDEGAVLVFSKGSTGA
FT                   VTTIEYEPGLKKDFPRVMERIAPYDDYYEHHKTWGDDNGSSHVKSAIVGTSLVVPFKNG
FT                   ELLLGTWQQIVVINFDTRRRRREVILQLLQAL"
FT   gene            complement(44048..44593)
FT                   /locus_tag="Arcpr_0053"
FT   CDS_pept        complement(44048..44593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0053"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57129"
FT                   /db_xref="GOA:D2RFQ4"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ4"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ADB57129.1"
FT                   /translation="MKVYFVTSNEGKFREVREIGKKYGIEIDWIRRKYLEPQGSDLEEI
FT                   ARISAQLLAEEIKEPFFLEDSGLFIEALKGFPGPYSSYVFKTIGNEGILKLMEGVEDRR
FT                   AYFLAVIAFWDGEKVLTFKGRVDGKIAREMRGDKGFGFDPIFEYGDRTFAEMGEEKNEV
FT                   SHRRRALESFFEYLKSLK"
FT   gene            44640..45260
FT                   /locus_tag="Arcpr_0054"
FT   CDS_pept        44640..45260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0054"
FT                   /product="protein of unknown function DUF121"
FT                   /note="PFAM: protein of unknown function DUF121; KEGG:
FT                   rpb:RPB_4422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57130"
FT                   /db_xref="GOA:D2RFQ5"
FT                   /db_xref="InterPro:IPR002835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:D2RFQ5"
FT                   /inference="protein motif:PFAM:PF01983"
FT                   /protein_id="ADB57130.1"
FT                   /translation="MLVLIPFKPVNPKTRLSKVMRKNERENFARCMLLDVLDALSSFDC
FT                   DIKIISTHPFKIESYDVVVDSRELDDAINSRIEGETAVIMSDIPLINSRILRRFFESEG
FT                   DVVIAPGRKGGTNMIIIRDRKFKVRYYYCSFLRHLEFAKSLDLKCTVFDSFYASVDIDT
FT                   PDDLLELMIHGEGKKSYEFLYSIGFRIKYEKEPKLVRISNTFP"
FT   gene            complement(45235..45756)
FT                   /locus_tag="Arcpr_0055"
FT   CDS_pept        complement(45235..45756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0055"
FT                   /product="PEBP family protein"
FT                   /note="PFAM: PEBP family protein; KEGG: nis:NIS_1307
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57131"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ6"
FT                   /inference="protein motif:PFAM:PF01161"
FT                   /protein_id="ADB57131.1"
FT                   /translation="MRWITALILAFLIFGCAQKSVEKVDVKSVFENGEFIPKKYTCDGD
FT                   DINPPLILKNLDPKAKSIVIIVEDPDAPMGTFTHWIIYNVPPISEIPEGIPRGKLIEKP
FT                   FKAMQGKNDFGFYGYGGPCPPSGVHRYYFKVYVLDTVLEWKEYSKDELKRAIENHVIQY
FT                   GEIMGKYSRS"
FT   sig_peptide     complement(45697..45756)
FT                   /locus_tag="Arcpr_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.917) with cleavage site probability 0.591 at
FT                   residue 20"
FT   gene            45795..46907
FT                   /locus_tag="Arcpr_0056"
FT   CDS_pept        45795..46907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0056"
FT                   /product="Sep-tRNA"
FT                   /note="TIGRFAM: Sep-tRNA; PFAM: Soluble liver antigen/liver
FT                   pancreas antigen; Orn/Lys/Arg decarboxylase major region;
FT                   aminotransferase class V; KEGG: ppr:PBPRB0227 putative
FT                   ScrA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57132"
FT                   /db_xref="GOA:D2RFQ7"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR013375"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ7"
FT                   /inference="protein motif:TFAM:TIGR02539"
FT                   /protein_id="ADB57132.1"
FT                   /translation="MFVERKVKDFINIDPLQTGGKLTEDARRMLVEWGDGYSVCDFCMG
FT                   DLHGIKNPPIADFIKDLAEFLGCDVARVTHGAREGKFMIMHSLAKKDGIVVVDSNAHYS
FT                   TFVSAERAGLNVVEVENSGYPEYKVIEERYEDAIVEARRKGDVVLAVLTYPDGNYGNLP
FT                   DVKAVAEICHDKGVPLLLNCAYSIGRMEIKAEKLGVDFVVGSGHKSMASAGPIGVVGMF
FT                   EDYAKVVLRKSERFKNKEVELLGCSVRGVPLMTLMASFDHVKERVKRWNEEVEKARWFV
FT                   REFESLGFELLGEKPHNHDLLHFKTDKIYEISKKVKKGGYFLYHELKKRNIHGIKPGRT
FT                   KSIKLSTYLVPKDDLRKVVQAFEEILDKYG"
FT   gene            complement(46943..47353)
FT                   /locus_tag="Arcpr_0057"
FT   CDS_pept        complement(46943..47353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57133"
FT                   /db_xref="GOA:D2RFQ8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57133.1"
FT                   /translation="MIWSYRAVNNRVARKKWLALGFGLIVVGLIYTIFRIIYSSKLISS
FT                   LAIFTIFALMVFLYTIITLGKVRYYFIEGNEIVYKPFRTKIEDVEGYEVDRDNMVIRLK
FT                   LKRPKIFAVRTLYFDKEEEFEDVLRFLKRVLG"
FT   gene            complement(47350..47904)
FT                   /locus_tag="Arcpr_0058"
FT   CDS_pept        complement(47350..47904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0058"
FT                   /product="TATA-box binding family protein"
FT                   /note="PFAM: TATA-box binding family protein; KEGG: global
FT                   transcription factor; K03120 transcription initiation
FT                   factor TFIID TATA-box-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57134"
FT                   /db_xref="GOA:D2RFQ9"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFQ9"
FT                   /inference="protein motif:PFAM:PF00352"
FT                   /protein_id="ADB57134.1"
FT                   /translation="MTRDFKIKIENVVASTQIGENIDLNKIAREIPDADYKPKQFPGLV
FT                   LRTKEPKAAALIFRSGKVVCTGSKSVEDARRVVKQIVKIVGSLGIPVIEEPEVKVQNIV
FT                   ASADLGTDLNLNAIAIGLGLENVEYEPEQFPGLVYRLRDPRVVVLIFGSGKMVVTGGKT
FT                   PDDARRAVEKIAEELESLGLL"
FT   gene            47991..49259
FT                   /locus_tag="Arcpr_0059"
FT   CDS_pept        47991..49259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0059"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pca:Pcar_1374
FT                   ATP-dependent dsDNA exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57135"
FT                   /db_xref="GOA:D2RFR0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR0"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADB57135.1"
FT                   /translation="MKFAHLADAHLGYEQYHLPFRAEDFAKSFKFAVEKAIEEDVDFAI
FT                   ISGDLFHRSNPNPKTIKQAIDILSMLKEENIPIFAIEGNHDKTVKDVSIYDLLESLGLL
FT                   YKLGLRRKLVEGEFVRSKSFGDYNLVYGVFEDFKIFGDTHRSSHQFKSLMEEKYIPSCD
FT                   IAVLHLSVKEVVDLDIKDDYVTISDLPRAKYYALGHVHIPIKKNVNGSWFVYPGCPERS
FT                   DAREYSIKIDYFDDFCVSEGCKKGLFIVENFKPRFVEVSCRDLISANISAKDQRDAVNR
FT                   VKEILDYLNSESILILRIFSESVIDLEDLVKIVERRVRHVKISLERISKEREIKIERPS
FT                   EFFTEFELSLLEFLKRPDFDNFINTVIGLIEKEFKLRDFKVLDDFKVKSVGVENEDKKE
FT                   DKKDEKKKLVRKNRRTLFDFVEG"
FT   gene            49262..51868
FT                   /locus_tag="Arcpr_0060"
FT   CDS_pept        49262..51868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0060"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; Rad50 zinc hook domain
FT                   protein; RepA / Rep KID repeat-containing protein; SMART:
FT                   AAA ATPase; KEGG: sun:SUN_0726 DNA double-strand break
FT                   repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57136"
FT                   /db_xref="GOA:D2RFR1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR1"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADB57136.1"
FT                   /translation="MLIKYVEIENFKSHRSSRVEFDRGVNLIVGRNGAGKTSILEAIAV
FT                   ALYGVKHGVKPSGVKKDDLIRDSASRYEIRLGFDFNGRDCLIVRSSDGNSYLRCDKLLE
FT                   GDERIREWVERNVAPSHVWLNAIYVRQGEIDEIVKDDERREKIIKRITQIEDYERAWEN
FT                   LGKVIKHFKEEKSRLEKEIKAESDVENRIKEVKEELEAKKRELDKKMIELRDVEEKLAE
FT                   AEAEKERVEKLREKFEELNREKESIEKHAGKIEERIRGLRERRNGLKKEIEELKSRVRR
FT                   LEEIRGYAEKYIELREEYEKTLKVERELKETLARLESERNGVIRLLSDLENKKKRLNEL
FT                   KGKLEEVEKRKSEIEGKALKYEEIKVKLERLRELEKTCRPLEEIERELEEVERAKLKLK
FT                   DVEKDERNLLDMKARLESEIERLKEALNALKSAKGVCPTCGRLLSEDDRLNLIKSYTKK
FT                   LENVRKDLIEIENKLEDIKNVKKELESVISEESRILREYELAKELENLKKSTKGFEEAE
FT                   AAWKEYRKLEELALKLSADISVIESDLKSEQELNSKLIELNSKIDEVEEKLSNLKKIDE
FT                   STLKELESYYNEFNRLVSAKHDLERKLEELKSCESEIVKAEDELSETLKRLESLKNEIE
FT                   ALGYSDETYRNVYNLYTELRSRYFGLREGVERLKDHIKTLEKSAEDLENRVKKLREKRE
FT                   RVEKIGREVLPKLEEIREKFRKYKVSLTEYAFKEVEKIASEIFEEMTDGKYSGIVLKRE
FT                   EKRKEKVTVKVLYQGAERDISFLSGGELIALGLAFRLALSVFMIQGKIPLLILDEPTPF
FT                   LDDERRRKLVDIMNRYLKKIPQVIVVTHDEELRDVADKVIRVELHGGVSKVMEGFE"
FT   gene            51865..52977
FT                   /locus_tag="Arcpr_0061"
FT   CDS_pept        51865..52977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57137"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR2"
FT                   /inference="protein motif:COG:COG1630"
FT                   /protein_id="ADB57137.1"
FT                   /translation="MRRLSDAIFQDLPDRLEEILKSVENAILSFEDLFHWNELPNARKC
FT                   KAFGVDGSRSMEKRCGVVVYAVSSVGVGDRILELHDLSVVEPIKHIEKRVEMHMQTNEA
FT                   RIGIFADGLILLDGALSNLLFLIKRPRITELYDIEKQINDKTMNILKDFANELDEWIDS
FT                   LNEGISKGLFQRRTLLSRDKDSDLRILFEFVEFLHAYDRLLEKEVVSIAKNVYESRLSM
FT                   LKNNFEYYRVTDQAVVDYLVAKEFGFEKAGFFKFSYNVRGEESMIADLVKELEFKNIEK
FT                   LRVYPCYVRFRDYGNVYLMESNVEIEKVLPMVVGLEVDGYPFPLIHAHRYAEIKKAEMK
FT                   AMMVTLMNALANKPEFRILLKHPRSSLEGH"
FT   gene            complement(52960..53727)
FT                   /locus_tag="Arcpr_0062"
FT   CDS_pept        complement(52960..53727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57138"
FT                   /db_xref="GOA:D2RFR3"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57138.1"
FT                   /translation="MWVGYNPLFKDPFYVADLIADYVDFVGFGVVTVDFGCKDILRRFR
FT                   NLVEEHRDTTFALGIGAGELRGYSGLKAVLDCLKSLRKEVDLLFCGCSGPKITSEASKI
FT                   VDGILFNYAHPEHLSWIIGFLKREVYKVAYAPSLILPSEFEFDLLIACAMVSCSNRNFV
FT                   KTFKYDGMCREISKLDFLRVIADRKSLNVIPDEIKRYKDVLIDKFAIAGDFESLVGRLK
FT                   EVLKICDHVVLGDPFFRDPNSVEQFEKILVSLK"
FT   gene            complement(53793..54053)
FT                   /locus_tag="Arcpr_0063"
FT   CDS_pept        complement(53793..54053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0063"
FT                   /product="translation initiation factor eIF-1A"
FT                   /note="KEGG: eukaryotic translation initiation factor eIF-
FT                   1A; K03236 translation initiation factor eIF-1A; TIGRFAM:
FT                   translation initiation factor eIF-1A; PFAM: S1 IF1 family
FT                   protein; SMART: initiation factor 1A (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57139"
FT                   /db_xref="GOA:D2RFR4"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR4"
FT                   /inference="protein motif:TFAM:TIGR00523"
FT                   /protein_id="ADB57139.1"
FT                   /translation="MPDRSKGEMFGIVTAMLGGGHVKVKCEDGKERLGRIPGKLRKRIW
FT                   IREGDVVIIVPWPFQDDRCDIIWRYTNPQVEWLERKGYLTF"
FT   gene            complement(54088..55056)
FT                   /locus_tag="Arcpr_0064"
FT   CDS_pept        complement(54088..55056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0064"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase class Ib; KEGG: tyrosyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57140"
FT                   /db_xref="GOA:D2RFR5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023617"
FT                   /db_xref="InterPro:IPR023684"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR5"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADB57140.1"
FT                   /translation="MDLESKLQLIKRNAVEIVTEEELLELLQTKEKPRAYVGYEPSGEI
FT                   HLGHMMTVQKLIDLQQAGFEIVVLLADVHAYLNEKGDFDEIRKIADFNKKAFIALGLDE
FT                   SKAKFVLGSEYQLERDYVLDVLKMARITTVNRARRSMDEVSRRKEDPMVSQMIYPLMQA
FT                   LDIAHLGVDLAVGGTDQRKIHMLARENLPRLGYKAPICLHTPILLGLDGQKMSSSKGNY
FT                   ISVRDSAEEVEKKIRKAFCPAGEVENNPIIQIALYHIFPRFGEFKVEREEKYGGDVTYK
FT                   TPDELISDFKSGKLHPLDLKKAVAKYLNKILEGVREKLERG"
FT   gene            complement(55112..55699)
FT                   /locus_tag="Arcpr_0065"
FT   CDS_pept        complement(55112..55699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0065"
FT                   /product="Ribosomal protein L15e"
FT                   /note="PFAM: Ribosomal protein L15e; KEGG: hypothetical
FT                   protein; K02877 large subunit ribosomal protein L15e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57141"
FT                   /db_xref="GOA:D2RFR6"
FT                   /db_xref="InterPro:IPR000439"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR020925"
FT                   /db_xref="InterPro:IPR020926"
FT                   /db_xref="InterPro:IPR024794"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR6"
FT                   /inference="protein motif:PFAM:PF00827"
FT                   /protein_id="ADB57141.1"
FT                   /translation="MASSMYAYIREMWKRPWEGIVGQLMWERLQKWRREPAVVRIERPT
FT                   RLDRARALGYKAKQGVIVVRVRVRRGGRRATRPNKGRKVGNLMVNRKTPKKNLQWIAEE
FT                   RANRKYPNMEVLNSYWVGEDGRYKWFEVILVDRSHPAILSDPQLSQIAKQRGRVYRGLT
FT                   SAGRRARGLRRKGKGAEKIRPSLRANFRKKKD"
FT   gene            complement(55738..56472)
FT                   /locus_tag="Arcpr_0066"
FT   CDS_pept        complement(55738..56472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_0437 hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57142"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR005645"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57142.1"
FT                   /translation="MFLDTTIGRNFVRIYAENVVVICHGLPYEPLPVIAKGYDELAEFF
FT                   GEKGLNSIIFDFSGTGLSKGKFEILNWVEDLIEIVEKFKSVHLVAFSLGGVPATYVARL
FT                   KAVKSLALLATPCCFDVMRKDLIKKAYDHAIIRKSLKGVGSFEEFYENFKRDVEDFAPI
FT                   KWIDKVRCPILLVHGDKDDVIPFESSKRLYENAKDAYFLEVRNGGHRLREYGIVMESVA
FT                   KWVAGNYVKGEAWEERWRVVEV"
FT   gene            56560..57111
FT                   /locus_tag="Arcpr_0067"
FT   CDS_pept        56560..57111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57143"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57143.1"
FT                   /translation="MRYRLNWTYPNLGSYHGYKPPLRGSLKERLRDALSLGIMRIEVPF
FT                   DLIRRENKEFIKLNKNVGDIPTKDDFSILYDVSGFDGNYILHTDPELKPYHKLYWNKRE
FT                   WRQKYLGSIIDFVDFVGTNPSAIEFHPSSKKRSNGLLPLILESFDIFDSHGISSVILIE
FT                   NRTRKYIYLRFLICLNSMNC"
FT   gene            57087..57413
FT                   /locus_tag="Arcpr_0068"
FT   CDS_pept        57087..57413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57144"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57144.1"
FT                   /translation="MLKFYELLKINLSEKELKLFGFCIDVSQLYKQIKSDPTEELKEFP
FT                   KELIKAWHLHFEHKCPSDHDPINWREIIRLIHPEDFCLPEVLSSKRNVVKTIKYFENLV
FT                   SKTF"
FT   gene            57436..57678
FT                   /locus_tag="Arcpr_0069"
FT   CDS_pept        57436..57678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0069"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: rsp:RSP_2127 component of
FT                   phosphoribosylformylglycinamidine (FGAM) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57145"
FT                   /db_xref="GOA:D2RFS0"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS0"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADB57145.1"
FT                   /translation="MIAEVFIELKKGVMDAEGEAVKKALRLLGFKKVKGVSSVKVYRIE
FT                   IDTNSKEEAEREVREMCEKLLANPVIQNYRIVLKE"
FT   gene            57684..59969
FT                   /locus_tag="Arcpr_0070"
FT   CDS_pept        57684..59969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0070"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="KEGG: ade:Adeh_4214
FT                   phosphoribosylformylglycinamidine synthase II; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase II; PFAM: AIR
FT                   synthase related protein domain protein; AIR synthase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57146"
FT                   /db_xref="GOA:D2RFS1"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS1"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADB57146.1"
FT                   /translation="MYREIYPQVYEINVINAGDEDLMKISDELGLALNLNEMRKIKDYF
FT                   TKKGRNPTDIELQSIAQAWSEHCCYKSSKCYLREYLFGIEKDYVISAIKEDAGVVEFDN
FT                   EYAYVVALESHNHPSAIEPYGGASTGIGGILRDVLCMGAQPIALVDPLFFGNLDIKDLP
FT                   KGVKHPLYLLFGVVAGIRDYGNRVGIPTVGGMVFFDESYVTNCLVNVGCVGIVRKDRIV
FT                   HSRVGNVGDLFVLVGGATGRDGIHGVTFASKELSEKSEEERGAVQLGNPIMKEPLIHAC
FT                   LEVVEKGLVTGMKDLGGGGLSCVISEMSYAANCGAEVYLDKVHLKEEGMAPWEIYISES
FT                   QERMMLTVNPKHVDEVLDVFKKWDVPAVVVGKAIPDKVVRVYWKGYKIYELDLDFLLGA
FT                   VEYCRPYVVKRIERIDETSKPSDLKGVLLKMLEHPNVACREWVIRQYDHEVRACTVLKP
FT                   LQGRINRETHGDCAVIKPTDSWRGLALTTDVNPWMTKMDPFWGTASSFDEMVRNLVAVN
FT                   SIPHSFADCLNFGNPEKPERMGEFVQSVRALGWMARGFGLPCVSGNVSFYNETPYSAVA
FT                   PTPTLMGIGIVEDIRKVVSSNFKGKGEIVLVGETLKEFGGSLYCAVTGQRSTVVPKTSP
FT                   KRLKRYVNAMLQAFKEFKVYACHDLAEGGLAVALAEMCIGGFGCKVDLSELRGEDYVKL
FT                   FSESNTRWLVEVDNAEDFVKFMKSKGLSVYAIGVVEGDEIVVKNCFRVSVEEVEKVWRN
FT                   GLVRFTGW"
FT   gene            complement(60047..60598)
FT                   /locus_tag="Arcpr_0071"
FT   CDS_pept        complement(60047..60598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0071"
FT                   /product="methylase"
FT                   /note="TIGRFAM: methylase; PFAM: methyltransferase small;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57147"
FT                   /db_xref="GOA:D2RFS2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS2"
FT                   /inference="protein motif:TFAM:TIGR00537"
FT                   /protein_id="ADB57147.1"
FT                   /translation="MDFTLDTVYPPAEDSELLLEVALREVREDDEVLEVGVGSGFVAEK
FT                   IKEKCQFLLATDINPFACKMAREKGIDVVRTDLVKGIRKKFTLILFNPPYLELDEIERK
FT                   GDWLEKAIDGGKGGIEVICRFLDLVRDVLDERGRIILIVSSFNVPHVFEKIEKRGFRWK
FT                   IVAKRYLFFEELYALKIESL"
FT   gene            complement(60540..60803)
FT                   /locus_tag="Arcpr_0072"
FT   CDS_pept        complement(60540..60803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57148"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57148.1"
FT                   /translation="MIEEAVKKFNRIHEPEVRAELVEKGENYFIVKFSGRILYYSCGLY
FT                   DYFEDLIWLSDLDAEIEGYEEREDGFYVRYRISAGRRFGTLA"
FT   gene            complement(60800..61555)
FT                   /locus_tag="Arcpr_0073"
FT   CDS_pept        complement(60800..61555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0073"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: dimethyladenosine transferase, putative;
FT                   K02528 dimethyladenosine transferase; TIGRFAM:
FT                   dimethyladenosine transferase; PFAM: ribosomal RNA adenine
FT                   methylase transferase; SMART: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57149"
FT                   /db_xref="GOA:D2RFS4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS4"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADB57149.1"
FT                   /translation="MKLLKSKGQHILVDKKYLYKIVRYADLSYNDVVLEVGCGLGNLTR
FT                   LLLRSVKKVYGIEIDSRFCKILREKFADEIESGRFVLIEGDALKVDFPKFDKFVANIPY
FT                   QISSPLTFKLLKHDFKLAVVTYQKEFAERLVAREGSKKYGRLSVVAKAYCRAEILDIIP
FT                   PKAFRPRPKVESAIVRIFPEPEVVVENKEIFEDLVRFAFSRRRKKFGKIVEEWCKERGY
FT                   KAEVPEEYRDKRPEEIPAKVYAKIADEVA"
FT   gene            complement(61552..61644)
FT                   /locus_tag="Arcpr_0074"
FT   CDS_pept        complement(61552..61644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57150"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57150.1"
FT                   /translation="MYSKKLILDSLALEIALKKFNIEAVPRSIA"
FT   gene            61690..62817
FT                   /locus_tag="Arcpr_0075"
FT   CDS_pept        61690..62817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0075"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: asparagine synthase; KEGG: asparagine
FT                   synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57151"
FT                   /db_xref="GOA:D2RFS6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS6"
FT                   /inference="protein motif:PFAM:PF00733"
FT                   /protein_id="ADB57151.1"
FT                   /translation="MSIYAFAEMEEGRAKRIYASTRYPSKQIGNIFADCDDEINLKYAD
FT                   ELPLRIQGCYALVAFRPSHILLSRDVLAGKPLYFDNTTLTFSSFKHYFEEEPLEVLGGE
FT                   VVKISYEGYVLERKRFKFEDVFKPAEIEIEEAKERILRLLESYRSKIKNGCIAFSGGVD
FT                   SSLLAGLYDLPLVTVTASKEEKEWVKECARKLGREIEIYEFDENVVKEVLPDVMKAIEM
FT                   QDKLQLSIAVPVYLCMRFAKSLGFSEIVFGQGADELFGGYKRYESMDYRDLEFELRKDL
FT                   MEIGEKNLVRDNKIAYTNEIKLHTPYLQWDLIRIAMSIPVELKIKRNGEVIRKLILREV
FT                   AKEVIPEEMAYRDKKAIQYSTKTAKMLKKVLRDLQ"
FT   gene            62889..63275
FT                   /locus_tag="Arcpr_0076"
FT   CDS_pept        62889..63275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0076"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   scl:sce6234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57152"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS7"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADB57152.1"
FT                   /translation="MIKINCTVGGKFCGKCCHDTEMPLTEEDIERIESIGYNRRDFTIK
FT                   IDGIYRLRNVNGKCFFLDENNRCKIYEHRPLGCRIYPLVLDLDRGVVVVDKLCPKGDEV
FT                   SEENIRRAEPILRELVRKIYGLKV"
FT   gene            complement(63235..63819)
FT                   /locus_tag="Arcpr_0077"
FT   CDS_pept        complement(63235..63819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0077"
FT                   /product="Protein of unknown function DUF207"
FT                   /note="PFAM: Protein of unknown function DUF207; KEGG:
FT                   hypothetical protein LOC704515"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57153"
FT                   /db_xref="GOA:D2RFS8"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS8"
FT                   /inference="protein motif:PFAM:PF02676"
FT                   /protein_id="ADB57153.1"
FT                   /translation="MNWNEFKRSKLERLEKAKERKEVDEDIIPLLDLINSLDCFVTTSS
FT                   CSGRIVVLDVPKIGDKLNAKFLDKWHQPIDWKEIVKALEGSIRTAWLISDPPIIHVACR
FT                   DLECAKALMKIANDSGFRRCGLISLTRLVVEITSFERLEAPLAVDGRIVVSEEYIRLLA
FT                   DFANEKLLRGKEKLERFKAKLLDHRSFLQAL"
FT   gene            63901..66609
FT                   /locus_tag="Arcpr_0078"
FT   CDS_pept        63901..66609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0078"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: hypothetical protein; K01872 alanyl-tRNA
FT                   synthetase; TIGRFAM: alanyl-tRNA synthetase; PFAM:
FT                   alanyl-tRNA synthetase class IIc; phosphoesterase DHHA1;
FT                   Threonyl/alanyl tRNA synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57154"
FT                   /db_xref="GOA:D2RFS9"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFS9"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ADB57154.1"
FT                   /translation="MPNALEKEYLDITFLKENGFIRKKCPKCGKYFWTVDESREICGDP
FT                   PCDSYKFIGNPIFKKEFDLKEMREYYLRFFEERGHTRIDRYPVVARWRDDIYLTIASIA
FT                   DFQPFVTSGVAPPPANPLTISQPCIRMDDLDSIGKTGRHLSLFEMMAHHAFNYPNQHIY
FT                   WKNETVQYCTELLQSLGVKLEDIVYKEEPWAGGGNAGPCLEAIVGGIELATLVFMNLVE
FT                   DPNGDIVVKGSRYRKMENYIVDTGYGLERFVWASKGTPTVYDAVFPEVVEFILKNSDVE
FT                   KPDERIVAESSKLAGIMGELSGEKLLEFRKNLSNRLGVSLEELERVLIPMEMVYALADH
FT                   TRAILFMLGDGLVPSNAGAGYLARLMIRRSLRLAEEIGFSLSIFDLVELHRKILKEFEF
FT                   EVPLETIQEMLEIEEKKYKLTIQRGISLVERKILRKGRVDKEDLIEFYDSHGIPPEIVV
FT                   RIAKERGVEVEMPKDFYAELASRHMKAEKKVEEKKLKGSYPKTEKLYYDNPKLFEFTAK
FT                   VIGVEGDKVILDRTAFYPESGGQASDTGYFEVDGKRIKVLDVQEEDGVVYHVVEGELKV
FT                   GDVVRGVIDADRRLRHMRHHSATHLLLYSLRKLYGNHVWQAGARKERGKARLDVTHYKK
FT                   PSDEEIAEIEKLVNAEIMANKPVTWEWMDRIEAERRYGFRLYQGGVPPGRVIRVVRVGD
FT                   DVQACGGTHCNSTGEIGFFKIVRVESIQDGVIRFEFTAGESALEYVQEIERILKDASTI
FT                   LRVEPSKLPKTVERFFEEWKERGKKIERLKREIAKVKAEKLLENAEEFDSIKVVCDVMD
FT                   ASMDEMVKIAEELVKAKAVGVLMNTEGKVKVVTFSGIDVDARELMKEIGKRIKGGGGGR
FT                   KEIAQGAGQIALNKDELMTIVFEFLSRNLKA"
FT   gene            66709..67113
FT                   /locus_tag="Arcpr_0079"
FT   CDS_pept        66709..67113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0079"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_1478 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57155"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT0"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADB57155.1"
FT                   /translation="MPKRLVTVDLEKCVGCGLCVLACSRKFGYAGNDYSGILSVSLSGF
FT                   ERGATVIFCRGCEDPPCVQVCPTGALRKRKGGGVIYKEDLCIGCKNCVQACTIGAIFER
FT                   RDGKIAVCVHCGYCVNFCPHGVLALKEVKA"
FT   gene            67110..68828
FT                   /locus_tag="Arcpr_0080"
FT   CDS_pept        67110..68828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0080"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="KEGG: sfu:Sfum_1479 aldehyde ferredoxin
FT                   oxidoreductase; PFAM: Aldehyde ferredoxin oxidoreductase;
FT                   aldehyde ferredoxin oxidoreductase; SMART: Aldehyde
FT                   ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57156"
FT                   /db_xref="GOA:D2RFT1"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT1"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ADB57156.1"
FT                   /translation="MRILKINLSEYSYEIEERDDFEEWIGGTALAVKLLKEEIDPKADP
FT                   LSEDNIIVFAIGPFTPAYPLASKTVAMFKSPLTGNLGESHAGGRTAMAIANAGYRAIVI
FT                   KGRSHKPIYVVVDNDKVYFRDARVIWGIADSLVVGRIIAERERGRGMRTVMRIGGAGVK
FT                   LVRYACVTTETYRHFGRLGLGAVFGSKNLRALVVIGRGAFKVKDMKMYKEVYKEIFDLA
FT                   LKSDAMKKYHLIGTPVNVKPLNEIRALPTRNLTATKFEKADEISGEAFAEYNLGRRIAC
FT                   AHCPIACVHIATLRLPYENEPYFYRTIMISYDYELIYSLGSMLGVGSREGVLRLIHKVE
FT                   SLGLDAMSTGVCLAWATEALQKGLISENETLVKLEFGNVENYLQAIEYLYQQPNDFYRV
FT                   LAEGVERASDVYGGKEFALAFGGNEMPGYHAGYATHIGYLIGLRHSHLDNAGYALDQKS
FT                   HEYPSPEELVDKLVMEECWRQVLSSLVVCFFARGVYKPEIVSKAFKPLGYEISEDELEK
FT                   YGEDTYREKLKIKVEMGFKKPRIPERIFETECTHGKLERDYIEKALDYWWKKYVS"
FT   gene            complement(68825..69799)
FT                   /locus_tag="Arcpr_0081"
FT   CDS_pept        complement(68825..69799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0081"
FT                   /product="transcriptional regulator protein-like protein"
FT                   /note="KEGG: vsp:VS_II0120 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57157"
FT                   /db_xref="GOA:D2RFT2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014466"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT2"
FT                   /inference="protein motif:COG:COG3888"
FT                   /protein_id="ADB57157.1"
FT                   /translation="MDAEKRILEFLKRKGSALQSEIVNELGLAKSTVSEILRKLESEGL
FT                   IVRERVAGKSYRVWYFESSPKPCKILRVGILRASEYPHVILGLKKLGVRYHIKVFDSAL
FT                   ELTKEIASGRIDVGFSPFITQTVFALLLKSMRIHAVVALNGSGIAYKGDLRDCKVFATS
FT                   EFSAMESNLKLVLETLGYDIHNLTFRYFDSIDVALNSFKSCEFDAIAVWEPYLQNFERV
FT                   LHFKDVVGDYPCCSMASNVEFFRERRKELVELKNCIKDSIDEVGEDVAKDIAKLIRFDW
FT                   KIVYRSFDSYKFVCDLSAKYFRFLERYGLKLTQENVRSIADHL"
FT   gene            69852..69980
FT                   /locus_tag="Arcpr_0082"
FT   CDS_pept        69852..69980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57158"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57158.1"
FT                   /translation="MVDIAVIICMLIPFAFHSIYAYFYWIALTGLYLAYKAWRWKV"
FT   gene            69977..71305
FT                   /locus_tag="Arcpr_0083"
FT   CDS_pept        69977..71305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0083"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: csa:Csal_2927
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57159"
FT                   /db_xref="GOA:D2RFT4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT4"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ADB57159.1"
FT                   /translation="MMLLAVIIYMIIGTLISLYARRGITTQEDYFLANRRLGGIISALT
FT                   YASTTYSAFMMVGLVGLAYATGVGSAGFELMYLVGTLFLLSYYSPKFWKLGREKGYVSP
FT                   CEVFEDRYGKSVATLSAILALIALIPYTSIQIIGSAYLLQIDYTVATLIVAFVIAFWAF
FT                   LGGMRSVAITDAIQGIFMISVAIIAVIWTAKNIAVGIPESASFPNEFWTPLRFASLTVP
FT                   WFFFALTNPQVSQRMFVPKDEKALKNMVILFGAFGLIYTVLVTILGLFLRMGTEIGTFP
FT                   YVSYRDKVTPTLLTMMPEPLAIAVALSIIMASVTTANSIVLTLSSMILRDVVGEREKVA
FT                   LGRMFVVALTLALIIFAIQKPGYIVELAVLSSTILLCQLPLILGVFHFKIGGKMTGLAT
FT                   LIAGFTTAIVLSLMKVSWTSIAVFVVSFAVFFLIGAIEKAKSS"
FT   gene            71307..71930
FT                   /locus_tag="Arcpr_0084"
FT   CDS_pept        71307..71930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0084"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: sat:SYN_00073
FT                   putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57160"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT5"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ADB57160.1"
FT                   /translation="MISSMRRLTLEEGTKAVKLARKAIEVYLSEGRVIEDRLSGVFEEK
FT                   RGVFTTLTKHGELRGCIGFPYPVKRLDEAIIESAIAAATEDPRFPPVSLEEMDEITVEV
FT                   TILTPPEKLRVKPTELPKYIEIGRHGLMVKYGFYSGLLLPQVAVEYNMDAEEFLSQTCL
FT                   KAGLPPDCWFYAEVYRFEGQIFKEAVPRGDVVEVKLGGAKNCHR"
FT   gene            complement(72009..72980)
FT                   /locus_tag="Arcpr_0085"
FT   CDS_pept        complement(72009..72980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0085"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: pmu:PM0240 dipeptide transporter ATP-binding
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57161"
FT                   /db_xref="GOA:D2RFT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB57161.1"
FT                   /translation="MLKVVGLKKYFPVQKSAIEILLSRRIDYIRAVDGIDFEIEKGEVL
FT                   SLVGESGCGKTTTGRILVGLEKPTEGKIIFKGKDLTQLNKEEFRRMRRYIQMIFQDPYA
FT                   SLNPRMKIGEHLVDPLLIHGIADREEAEEIAMKMLDKVGLPADQFFDRFPYQLSGGQRQ
FT                   RVAIARAMILKPEFVVADEPVSMIDVSLRASILELLMSFKREYDLGMLFITHDLSVAKI
FT                   VGNRIAVMYLGKIVEIGDTKDVIYRPKHPYTAALISSVPSFVAKRKRIEIFGDVANPID
FT                   IPKGCRFHPRCPFAREKCRVEEPKLEGDGHKFACHYPLDIKF"
FT   gene            complement(72984..73925)
FT                   /locus_tag="Arcpr_0086"
FT   CDS_pept        complement(72984..73925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0086"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57162"
FT                   /db_xref="GOA:D2RFT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB57162.1"
FT                   /translation="MLLRIENLKTYFESKRGVVKAVDGVSFNVNRGEFVSVVGESGCGK
FT                   STLAYSIIKLINPPGKIVGGRIIFDGRDLLRFSEKEMRKIRGKEIGMVFQDPMTSLDPL
FT                   EKIGDQMAETIMEHTKVSKKEALEIAGRMLEKVGLPANRINYYPHQLSGGQRQRVMIAM
FT                   AISLNPKLLIADEPTTALDVIVQEKIMDILESMKKEGRAIILITHDFALASERSDKIAV
FT                   MYAGWLVEFGRARDLVEDPLHPYSKALIDSVPDLWIDKKIKPIPGFPPDLANPPEGCRF
FT                   RPRCPLADEKCKREPPVVDLEGRIVKCWHCEV"
FT   gene            complement(73925..74782)
FT                   /locus_tag="Arcpr_0087"
FT   CDS_pept        complement(73925..74782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0087"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpt:Bpet2850 ABC
FT                   transporter inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57163"
FT                   /db_xref="GOA:D2RFT8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB57163.1"
FT                   /translation="MEVRNLATTIFGVIPKTEGRYMVLAGMAIVATVVIMAVFAPFIAP
FT                   YDPIKSSGDILQPPSLKHIMGTDNLGRDIFSRIVFGSRVVLSVVLSASLASMIVGVPLG
FT                   LISGYFGGKLDRVLSMLMDSMYAFPGLILAIAIAAVLGPSVVNAIVAISVVYIPTYFRM
FT                   IRGQTLSIKAQLFVEAAKAIGATDFKIMRKYILPNLIPTLVVVFSLSVADAILTEAGLS
FT                   FLGFIVSAPTPDWGFELASGRPYLPAGYWWMITFPGLMVMLLSLGFALIGEGLSEIYAP
FT                   RRER"
FT   gene            complement(74792..75802)
FT                   /locus_tag="Arcpr_0088"
FT   CDS_pept        complement(74792..75802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0088"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmw:Mmwyl1_0113
FT                   nickel-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57164"
FT                   /db_xref="GOA:D2RFT9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFT9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB57164.1"
FT                   /translation="MASLKAYIITRALLVIPTVLILLTIVFFILRIIPGDPITAMVGQK
FT                   VPPEVLEKLKHEAGLDKPIYIQYIEYLKGVLTGDLGRSMIWGKRPVIEEIMDHFPATLE
FT                   LTIFGFIISVLLGVLTGAIAAFKRGSKIDASMRIYSIVAYTLFIPWFGMLLQMFFGVYL
FT                   KLLPIGGRITPGNAPETITGLYVIDSILTLNFNALVDALSHLVLPSLTLGIVLSGAYTR
FT                   ILRNNLIDVLSQDFITAYRARGVSEWKVIKHAMKNAFIPVVTLMGLQFAILLAGAVLTE
FT                   TTFSWPGMGTFLIERIEYRDYTSVQGAIVFYAVFVALISLIVDIVYALLDPRIRY"
FT   gene            complement(75882..77477)
FT                   /locus_tag="Arcpr_0089"
FT   CDS_pept        complement(75882..77477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0089"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: ecm:EcSMS35_1686 putative ABC transporter
FT                   periplasmic-binding protein YddS precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57165"
FT                   /db_xref="GOA:D2RFU0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADB57165.1"
FT                   /translation="MRVKSILALALIVVVAVALLGCAQQKPEVTPTTTKPTETKPAETE
FT                   ELVIGVTDKITELDPANAYDFYTWEVMYNIMGGLMRYKPGTTELEPYLAESYEVKENGT
FT                   VYIFHLRKDLKFADGTPCTAHDVVRSIKRVMKISGDPSWLVNDFVKDVEALDDYTVKFT
FT                   LKKPASYFLALVATPPYFPVHPNYNPDEIDPDQTAGGVGPYKIVKWVRDQELILEENPY
FT                   FFGEKPKTKRVIIRFYKDATTLRLALERGEIDIAWRTLTPVDIKTLKQNPDLKVIEAPG
FT                   GFIRYLVLNANETKDYPTKNKLVRQAIACAIDRNDIVNRVYMGTMEPLYSLIPNGMWSH
FT                   IDIFKELYGDGNIEKARELLKQAGYSEENKVKIELWWTPTHYGDTEKDLAQVLKEQLEK
FT                   TGMMEVELKSAEWSTYVDYARKGLMMASLFGWYPDYIDPDDYTTPFLKSDANNWLGYPY
FT                   SNPEVDELLEKAQVTQSKEEREQLYKKVQEILGEDAPIIPLVQGKLTIVTKKNVEGIVL
FT                   DPTMILKYYTIYKT"
FT   sig_peptide     complement(77406..77477)
FT                   /locus_tag="Arcpr_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.769 at
FT                   residue 24"
FT   gene            77559..78875
FT                   /locus_tag="Arcpr_0090"
FT   CDS_pept        77559..78875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0090"
FT                   /product="tRNA adenylyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: tRNA nucleotidyltransferase, substrate binding
FT                   domain protein; DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57166"
FT                   /db_xref="GOA:D2RFU1"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU1"
FT                   /inference="protein motif:PRIAM:2.7.7.25"
FT                   /protein_id="ADB57166.1"
FT                   /translation="MEDVIKRALELVVPSKEEIEIAKKAEEELKRRLDDALEDYPMLEY
FT                   RFLGSYARNTWLRGNLEIDVFILFPEDTPMEELEKIGLEIGKAVVDEYELRYAAHPYVH
FT                   GKVLGVEVDVVPCYKLKSPDKIKSAVDRTPFHHDWLKDRIKGKENDVRLLKQFLKANGI
FT                   YGAEYKVRGFSGYLCELLVVFYGSFLDVVKNAVKWRRDTVIDVPNGKVYRKKGGSFFVV
FT                   DPVDPKRNVAANLSLDNLAKFVQLCRDFLKRPSLDFFLSKEFDLDEDAFRRENRVVVVV
FT                   AFEKPNIVEDNLYPQLEKACRVVVNNTREFQPLRFGFTADDRCYLIFEFGIRELSRFYK
FT                   HMGPIFEDEENVERFLKRNEKVFIENGRFWAFKERMHVKPNEAVADVIKKNWQGMGKDV
FT                   GEKLREGFEIYVGEDVLKIESKEFRKKLAEVLCIKRPSS"
FT   gene            complement(78856..80754)
FT                   /locus_tag="Arcpr_0091"
FT   CDS_pept        complement(78856..80754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0091"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: gur:Gura_0004 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57167"
FT                   /db_xref="GOA:D2RFU2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADB57167.1"
FT                   /translation="MPISSTFLAMSDYTAEAIEVLDDIQAVRKRPGMYVGSTGSRGFHH
FT                   LLWEIVDNSIDEALAGYCNRIVVTLHKDGSASVEDNGRGIPVEEHPIFKKPALEIVMTK
FT                   LHAGGKFSKKAYKVSGGLHGVGLSVVNALSEWLEVWVKRNGKIYYQRYERGKPVTPLKV
FT                   VGETKETGTKIRFKPDPEIFEVKEFDYDVVAERLRELAFLNKGLRIKLIDERTGKVKEF
FT                   YSEEGIVGFVKYLNKGKDVITDVVYISGEKNGINVEIAFQFTNEDFENLLAFANNIHTI
FT                   EGGTHVSGFRAGLTRAINEYGKKHVKKFTPISGSDIREGLTAVLSVKVPEPQFEGQTKT
FT                   KLTNSDVKTVVESLVYNNFLRWLEEHPSEAQRIIEKCLLAMKAREMARRARELVKRKAE
FT                   ISLTLPGKLADCSSKNVEERELFIVEGESAGGSAKQARDRRFQAVLPIRGKIINVEKAG
FT                   MLRALKNEEIKAIASAIGGGIGKDFDLSKVRYGKIIIMTDADVDGAHIRTLLLTFFYRY
FT                   MRPLIEAGMVYIALPPLYRVKKGDKVYYVYSEKELRDVLKKIGKAEVQRFKGLGEMNPE
FT                   QLWETAMNPKTRKLVKVTIEDALIAEKMFRILMGENVDERKEFILNHAKEVKNLDV"
FT   gene            80828..81418
FT                   /pseudo
FT                   /locus_tag="Arcpr_0092"
FT   gene            81411..82368
FT                   /pseudo
FT                   /locus_tag="Arcpr_0093"
FT   gene            82372..82959
FT                   /pseudo
FT                   /locus_tag="Arcpr_0094"
FT   gene            82956..83228
FT                   /pseudo
FT                   /locus_tag="Arcpr_0095"
FT   gene            complement(83233..84000)
FT                   /locus_tag="Arcpr_0096"
FT   CDS_pept        complement(83233..84000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0096"
FT                   /product="protein of unknown function ATP binding protein"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   hypothetical protein MGC130873; K06883"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57168"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU3"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ADB57168.1"
FT                   /translation="MEQIFVYFIGTAGSGKTHLTKAFSDYLDFKKVSHIIVNLDPGAEE
FT                   LPYEPDVDVREHFTLDTIMEKYKVGPNGAQIIGADLVGTIADDLKDDIELYDAKIVLVD
FT                   TPGQMELFTLRRSGEVIVRCFGRENGVMVYLFDPVVSKTPSGFISLVFMASSAVFRLNI
FT                   PQILVLAKADVLEEREVETIVRWSSDPEELYSDLTLESEKALSLDLFLMLKDIGLFRPL
FT                   IPVSSMTGQGMDDIYDGIQEIFYGGEDLEKIFG"
FT   gene            84247..85329
FT                   /locus_tag="Arcpr_0097"
FT   CDS_pept        84247..85329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0097"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: geo:Geob_1997
FT                   phosphate ABC transporter, periplasmic phosphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57169"
FT                   /db_xref="GOA:D2RFU4"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU4"
FT                   /inference="protein motif:TFAM:TIGR00975"
FT                   /protein_id="ADB57169.1"
FT                   /translation="MKRRYSLLLLLALAPLFCGCAQKHTTPEQNVITIYGSGATFPQPQ
FT                   IEKWISLYEKINPNIKIEYQGKGSGGGQNDFKEGLVDFAATDPPVKENLWRELERKGQP
FT                   LQFPIIVGAVVVVYNVPGVDNLRLDGKTLADIFMGKIEYWDDPAIKALNPNANLPHEKI
FT                   IIIHRSDSSGTTKIFTTYLCLVSEEFEKKVGSGKLVNWPVDELGRGLGGKGNAGVVATL
FT                   KQTRYSIAYTELAYALKENLKMVALKNKAGKFVIANETTIKSAVGAVKAYIPSPEEGYK
FT                   EDIRQFLNAEGENSYPIVAFSHILLWKSYPKEKAGAIKEFFTWVLTEGQKSENVVEGYV
FT                   GLPKDVAEIGLKAVQSIEGV"
FT   sig_peptide     84247..84318
FT                   /locus_tag="Arcpr_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.800 at
FT                   residue 24"
FT   gene            85326..86231
FT                   /locus_tag="Arcpr_0098"
FT   CDS_pept        85326..86231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0098"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: xfa:XF2142 ABC
FT                   transporter phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57170"
FT                   /db_xref="GOA:D2RFU5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU5"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ADB57170.1"
FT                   /translation="MKADKFKLALLPVASTVFGIFALMLIVFFSASIPIFQREGLAIYT
FT                   TNVWKAVEEGEEFYGVLSAIYGSVYTSVIAILIALPLSIGFAVFVIDYAPRKLKEPLII
FT                   ATDIMAGLPTILYGIWGAFVLVPLLRDYVMKPLYGHLSFIPLFSYPPITGYSYFSAGVL
FT                   LAIMVTPFASAIVREAYRMIPRVYREGAYALGLTRYEATKVLLGYIKPAILAGTLLAFG
FT                   RAIGETVAVSLVVGNTFNIHPSLFAPGYTISSLIANQFGNAFIYEYMPSALFASGLALF
FT                   IIGLTVNVAGLILLRRWKYA"
FT   sig_peptide     85326..85394
FT                   /locus_tag="Arcpr_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.318 at
FT                   residue 23"
FT   gene            86224..87060
FT                   /locus_tag="Arcpr_0099"
FT   CDS_pept        86224..87060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0099"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mpo:Mpop_5254
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57171"
FT                   /db_xref="GOA:D2RFU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU6"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ADB57171.1"
FT                   /translation="MLRRLKERVFLCSVAVATFLTIVPFFHILFSVFANGLPVLINGGI
FT                   EFLTGTLAPPDNGLGGIGPSIVGTFVLTFLASLMGLPIAVLTGVFSAEYPNSIIGKATR
FT                   TLLLIMMEFPTILVGLFVMNILVLPMGTYSAIAGALALAIVMMPYVAVYTEHALREIPF
FT                   IYKEGAFALGLKRATVVFKIMMGMARKGVVTGILIGMAKVAGETAPLLFTAGGSSRIYF
FT                   AGMDRPVGAIPLLIYQLVQQPYENYHQIAWGASLILMLIFLAIFIPIRLSIKEVKL"
FT   sig_peptide     86224..86328
FT                   /locus_tag="Arcpr_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.979 at
FT                   residue 35"
FT   gene            87057..87809
FT                   /locus_tag="Arcpr_0100"
FT   CDS_pept        87057..87809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0100"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: pmy:Pmen_0182 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57172"
FT                   /db_xref="GOA:D2RFU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU7"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ADB57172.1"
FT                   /translation="MNAIETVNLRVWYGNNEVIKGVDLLIPQNVCFAIMGPSGCGKSTL
FT                   LRTFNRLLELNEIARVEGDVKLFGRSVYKMNAVEVRRRVGMVFQIPNPFPHMSIYDNVA
FT                   LGVKYNKLVKSKKELDEVVEWALKKAALWDEVKDRLKDKASQLSGGQMQRLCIARALAL
FT                   KPDVLLMDEPTANLDPVSASKVEELIYELKKELTIVIVTHSPAQASRVSDYVAFLYMGK
FT                   LIEIGKTEEVFENPKNELTERYLTGRMG"
FT   gene            87814..88413
FT                   /locus_tag="Arcpr_0101"
FT   CDS_pept        87814..88413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0101"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: PhoU family protein; KEGG: sat:SYN_00060
FT                   phosphate transport system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57173"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU8"
FT                   /inference="protein motif:PFAM:PF01895"
FT                   /protein_id="ADB57173.1"
FT                   /translation="MIAERRLEKIREEVLKLHDVAKRSVEICLEGLRGNDEIRRKLEDL
FT                   EMEADIIHSDIDYDCVTFIALFQPVARDLRFVVGMMKTSSGYERITDLALEVGYYYCYD
FT                   EELLSLFEEMRKNLLEMFKVLEDSYAGSEVGIVHMLKRHDNVVDECYEKAIVYLKNKCK
FT                   VEPVLVARHLERMGDILGKIGSTVVFIESGKRIWIK"
FT   gene            88401..89381
FT                   /locus_tag="Arcpr_0102"
FT   CDS_pept        88401..89381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0102"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: PhoU family protein; SpoVT/AbrB domain
FT                   protein; KEGG: mca:MCA1075 phosphate transport system
FT                   protein PhoU, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57174"
FT                   /db_xref="GOA:D2RFU9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFU9"
FT                   /inference="protein motif:PFAM:PF01895"
FT                   /protein_id="ADB57174.1"
FT                   /translation="MDKVTAMIENRKIYLSGGNSYIITLPKKWVENNGLKAGDHIRMEI
FT                   SGDVIVLRAKDSERAKRVVTVDSKDLCHDCLIRRIVAYYLAGYDSVRVKVYSEEHRRAV
FT                   SLASDMLIGAEIIEDLGKEIVLEIFIDPNRFRIDYIVERIGNMCITMLSDFKQLLKSLD
FT                   GYIHSSIVMRESEIDRLHFLALRLLKSEISGRPEDLLEYRTIIRALERISDHCVKMSES
FT                   LMRVKVPLPKLVELVEICEKILKITMKSYYKKSSDLADEVINEVENFYSIEEKYSNILF
FT                   ELLEDFWRKKESIEKSANLRMILDSLSRIAGYCSDIAEAVINMCI"
FT   gene            89412..91058
FT                   /locus_tag="Arcpr_0103"
FT   CDS_pept        89412..91058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0103"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: nam:NAMH_0458 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57175"
FT                   /db_xref="GOA:D2RFV0"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV0"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADB57175.1"
FT                   /translation="MFQLFKRDVLKCLKRICEDERFVKESDHADLACTIAFKLAKEQKR
FT                   NPIEVANEIAENLEPIGYIGKIEVVNGYINFFASEEFLEDTINTILDTDENYGSLNMRG
FT                   KVLIEHTSANPDGPIHIGHMRNSIIGDSLARIFRKAGFDVTTHYYVNDMGRQIAIAVLG
FT                   YRLFGLDESKKPDHAVVEAYVKANQEIEKNPELEKEVEMLMIKYENFSDDVVGDFRYIV
FT                   SKALEGIRQTLRELNIHHDDYVWESEFLKNGYVDRILSMLDERNLIKKEGAWFVELDEK
FT                   PVILRRENGTTLYITRDLAYHLWKNENFERFVNVLGADHKLYGRQLCKLLELINLKPPE
FT                   IVFFEFVSLPEGSMSTRKGKFISADELIAKVYDEARKIVEKRDLSREEKERIAKAVAMG
FT                   AIRFDFVKIAPEKPMVFDWEKALDFERQTASYVQYAHARCCSILRKAVESGMPDLEFRP
FT                   EICTKVERDLVMILSKFPYVIEKVIKDLKPNYVAEYLLSVANTFNDFYREHRVLDEVAE
FT                   IRMHRLAIVDAVRIVLRNGLELLGIEALERM"
FT   gene            complement(91061..91867)
FT                   /locus_tag="Arcpr_0104"
FT   CDS_pept        complement(91061..91867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0104"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   cco:CCC13826_2047 DNA polymerase III epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57176"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB57176.1"
FT                   /translation="MIKLENVVVYSGRFMVNTVIWKDYAFDPSVGSNVYHNVKTVFITH
FT                   GHADHFSDAHLIDAKVVAPKLEANMIEKPDINWRGHFNWALLPKELVTPYFIGKGVKVD
FT                   DFAENYPFSIPLPGHTYAHTGYLIENVLIAGDCIYPIDYWERFGVLYYTDPDALIESLN
FT                   RIVELDWDYLIPGHGEVLCRDEGVKLARENIRRIMEVDKTILSIVDENTECEILAEVIR
FT                   VYGAENVKAVFNILKPVVSGHLSSLYQRKLITVEMDDKKGVIFKKT"
FT   gene            92095..92946
FT                   /locus_tag="Arcpr_0105"
FT   CDS_pept        92095..92946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0105"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57177"
FT                   /db_xref="GOA:D2RFV2"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV2"
FT                   /inference="protein motif:PFAM:PF03703"
FT                   /protein_id="ADB57177.1"
FT                   /translation="MSRYLEYANYDSKTVLITRPSVLGFMRRYLLCLTPFIVLVIYKFV
FT                   NTYIDSLLTPLKALGLDFLLTTFNLTIFLLILLALAWVLRSTEVEGSVGLSLLISLIFV
FT                   LAKVRFGNFKALTDAFNVYLESIPTAIPIAVTIMLIRTEIYRKTINYKLTDLGVEISGG
FT                   IWRRQEQSIPYNQIGRVVLEQSLFGRLLNYGTIVLVSSAEWGSEYYTRAVGAGGSGKIT
FT                   AGVGYARTLKEVSRDPLKCLYGVKNPKKIKEIIERMMTAQFRAEIDQVEYLKRIYEEIS
FT                   RK"
FT   gene            complement(92933..93802)
FT                   /locus_tag="Arcpr_0106"
FT   CDS_pept        complement(92933..93802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0106"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; KEGG: hypothetical protein; K07566
FT                   putative translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57178"
FT                   /db_xref="GOA:D2RFV3"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV3"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADB57178.1"
FT                   /translation="MTKIYKVDPRNPDESVLREVAHMIKEGKLVAYPTETVYGLGTNAL
FT                   DENAVKRLFEVKGRPKKPVSVVVSDLDHVERIAEPNETALKLMEKFFPGPITIIVKKKK
FT                   VIPPIVTAGTDKIGIRLPDYKIPLKLAEFSGVPVTSTSANVSGKPSPTKPEHIMVDFMG
FT                   KIDAILDAGETPLKIESTVIDTTTEPPRVLRVGALPLNEIEKVVGEVEVLDYRAYKPKA
FT                   KVVAVFKGDVEEVASRFEGRVCIIKEVKDLMDVLRRCKDCDVIVFECIDLSEAVRARIM
FT                   SIADVIYD"
FT   gene            complement(93821..94843)
FT                   /locus_tag="Arcpr_0107"
FT   CDS_pept        complement(93821..94843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0107"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: hhe:HH1243 NADH dehydrogenase Ndh"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57179"
FT                   /db_xref="GOA:D2RFV4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV4"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ADB57179.1"
FT                   /translation="MKVVVAGGGIGGLELINNLRGLDVTLVEPRERMVCQALLPEYIVG
FT                   KVGDDEVSISIPEFCDRHGVNWVRDAVLKVEGNRVITERDEIEFDCLVISIGAKPFVFE
FT                   NTCSLGNLEDAKMCKKAVEDAESVVVIGSGATGVECAFELREMGLNVTLVEYLDRVLPT
FT                   FNPRVSSYVKKLLEKEGVKVATSCKVIGVNEVVKTNKGDLDCDVAISCAGVIPNTIEGL
FT                   RREKGGIVVDEYLRARENVFAIGDCALVKVNGKIATKTAFEAEMQARYTAKNLMRIANN
FT                   ESLVKYKIHSSVDRPIAFITLARERAILIYKGIFIPKPMKILYKVKKRVLEEFMKRYKV
FT                   "
FT   gene            94990..95862
FT                   /locus_tag="Arcpr_0108"
FT   CDS_pept        94990..95862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0108"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: sfu:Sfum_2753 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57180"
FT                   /db_xref="GOA:D2RFV5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV5"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ADB57180.1"
FT                   /translation="MGAGALGCLYGYLLQRKFEVVFVARGKQFEALKRGLKVTGLVEDF
FT                   VRVNAVDRPCDADITFVTVKSYDTEEVAKSLRNVDCGIVVSLQNGIGNEEILSTYLGRV
FT                   LGGVTTYASNLIDYGWIEFAGVGETFIGSMDGKICEDVLVVVEVLRECGINAEAVSDIV
FT                   RRKWIKTVINSVINPITAILRVRNGAIVEIEELWKLASAVLREGEEVLKAMGFDVELEE
FT                   VLKDVVTKTARNRSSMLQDIERGKRTEIDFINGAIVRKAEELGIDTPYNRALLLLVKSL
FT                   EKFLTKCRS"
FT   gene            95867..96319
FT                   /locus_tag="Arcpr_0109"
FT   CDS_pept        95867..96319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0109"
FT                   /product="putative small multi-drug export"
FT                   /note="PFAM: putative small multi-drug export; KEGG:
FT                   similar to small multidrug export protein qacE"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57181"
FT                   /db_xref="GOA:D2RFV6"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV6"
FT                   /inference="protein motif:PFAM:PF06695"
FT                   /protein_id="ADB57181.1"
FT                   /translation="MDWLEVLIVSALPISELRGGIPLALYLGFDPLKAYIFSILGNLLP
FT                   VPFLLIFLNLIERIALRTPLSRFYTRIVERTRRKKDLIEKYGYLGLSIFVAIPLPVTGA
FT                   WTGCLLAFLLGLNRMKSFFYIALGVAIAGIIVLASSLGVFKVMGKA"
FT   gene            96341..97342
FT                   /locus_tag="Arcpr_0110"
FT   CDS_pept        96341..97342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0110"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sat:SYN_01240 pyruvate
FT                   formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57182"
FT                   /db_xref="GOA:D2RFV7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57182.1"
FT                   /translation="MHPARAWRRVGNKVVCQLCYHFCRLKEGDFGKCNARFVKDGKPYT
FT                   LTYGNISAMESRPMEIKPFFHFLPGKTAITFSTYSCNLDCPWCQNWHISKRNPPMSYSV
FT                   VKPEEVVEKALIFGDVATCASFNEPTLLYEYLLDLFPLARSRGLFNTIVSNGYMTPLAL
FT                   RELVSAGLDAMNVDLKGDDRVYELCGGKAKNVLKTIETAKKLGVHLEVVCLLITDLNDD
FT                   EDSVRWVVENHLRYAGAEIPLHFTRYFPAYLFERPPTPIERIERAIEIAKREGVEFVYI
FT                   GNVPGHIYENTYCPNCGELLIKRYSFRVLDVRLKDGRCWRCGKEIYGLFIEE"
FT   gene            97390..98265
FT                   /locus_tag="Arcpr_0111"
FT   CDS_pept        97390..98265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57183"
FT                   /db_xref="GOA:D2RFV8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV8"
FT                   /inference="protein motif:COG:COG4342"
FT                   /protein_id="ADB57183.1"
FT                   /translation="MFESFEAFDSSERLSGPGGFEPPTAGLRGFTIDYKEIRADFIDWI
FT                   YSRVDRATADKYVKLLDRFLTEPITSPSDVSNIIKSIDKRGVRRWFINAFRNLLKFLEY
FT                   EREWDEALINKYRKVAKTERSGVREVFITTEELLEAYENILPKYRILFKLIVYSGMRLD
FT                   QACDMLAGYEPENLVIKEDLELARYPMASIGKGFKRAYWAYMPIRFVSELERTFIKYGT
FT                   AKKAIYYKRVSALSIRKWHLNFMIENGVPESVADFIQGRASVTVGSTHYLNKTKQADQF
FT                   YSKLVDKFPL"
FT   gene            complement(98373..98570)
FT                   /locus_tag="Arcpr_0112"
FT   CDS_pept        complement(98373..98570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpc:RPC_0589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57184"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFV9"
FT                   /inference="similar to AA sequence:KEGG:RPC_0589"
FT                   /protein_id="ADB57184.1"
FT                   /translation="MVSVEFDPEVNALYIRLKDGKVKTSEPLADNIIIDLDENDEVLGI
FT                   EILLPAKSEISKRLAEALIS"
FT   gene            complement(98551..98805)
FT                   /locus_tag="Arcpr_0113"
FT   CDS_pept        complement(98551..98805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57185"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57185.1"
FT                   /translation="MKIRLSKHALNRAKERSIDLKQIEEVLRNPTETIDVKFGRKASYK
FT                   RCDDKFIVVIFEEQDDEIVVVTVLRVDEERLRRYGFSRV"
FT   gene            complement(99411..99977)
FT                   /locus_tag="Arcpr_0114"
FT   CDS_pept        complement(99411..99977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57186"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW1"
FT                   /inference="similar to AA sequence:KEGG:EHI_133940"
FT                   /protein_id="ADB57186.1"
FT                   /translation="MDAPFDGRFKTVKTRYHVTMVLPFLLADKGLTAEEIEFVIERFER
FT                   CPIRLDRLKLLFESNGRRRRWKVDNLSLDVLKEIKRLREEKGYGYQKISKEIYKKFGIY
FT                   ISGMTVRQVFKESIDQIIEEKEKEAKRIVEIETLVEEGKIKEISLKDLVWFAMRKENEK
FT                   VNAEIERRLNELVEKSYSMTVLDVL"
FT   gene            complement(99941..100669)
FT                   /locus_tag="Arcpr_0115"
FT   CDS_pept        complement(99941..100669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57187"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57187.1"
FT                   /translation="MKGMNRCYFSKFWRMERRYFKGALNEWFGKLDSVNKRKILKRFYE
FT                   MGLESGLFEHEVNGLIYYYFGVSLFKAGNYWKRVRILRLPTWILKEVVRISGELSNLSG
FT                   RKVAHELYKKKGVWVEPGVIYLFLNRFNVEETIRVKEAHDELQVKALREVGHLEQDFIL
FT                   AVEENYRNSVSVYEEFSEKFERVNLQLLFFYVNVASYYPMLIDSALIDKVVENCELEKP
FT                   KLWRRVMERWTHRLTVVSRP"
FT   gene            complement(100670..101986)
FT                   /locus_tag="Arcpr_0116"
FT   CDS_pept        complement(100670..101986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0116"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   ara:Arad_15030 heme d1 biosynthesis protein- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57188"
FT                   /db_xref="GOA:D2RFW3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57188.1"
FT                   /translation="MKGMFSELFREYNNNNTNWLNTVENEQIKTARVVNLSLTQKCNWR
FT                   CIFCYKCCPKPLEFDPDELFMILRALEKEKMFFGLTGGEPTIYRYWRNILRLFTGYPRL
FT                   NIITNASGIRLKSDDDAHLLLTSVKSYKVSIHGVGRGAVEVTRSRAQKGLQFLEKMFDT
FT                   LNRLEESLERKTNHLSYDFVVNVAVLKENVDEIPLLIDRLATLQDEYGYLTRIDVFRPT
FT                   LVGNMKKHKSSILDLTKFAELCKELKETYSELPLTFDANIAHTPALYCWEIEPDGYVYS
FT                   DMHFARVGSWRKHRLAEIIQFAYRYGPQLIRQYKGKEFVEFPDFEPIYEKDVIYQFKPK
FT                   SNELHFFSAEDALLIYYLRNNKTYVFKGLLSYLIHTFTSCPLSQAIKLIKPIKFEDVKP
FT                   ILEFLEREGVIEKTESRFLKDFKIVNESINVKLGEREVC"
FT   gene            complement(101983..102204)
FT                   /locus_tag="Arcpr_0117"
FT   CDS_pept        complement(101983..102204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57189"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57189.1"
FT                   /translation="MVEEEREEIIEGEEALSGSFIRLVIKGDDNGMGFELTVKADDDLK
FT                   KVEKVFMRVFERVSGLINGQREKGIDVV"
FT   gene            complement(102209..102400)
FT                   /locus_tag="Arcpr_0118"
FT   CDS_pept        complement(102209..102400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57190"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57190.1"
FT                   /translation="MKAKKFDPIKMIEESGIGEVVDQYFCEFVCKKGEFGKCKYFRWIY
FT                   GIPVCIRKAVKKEKRLIR"
FT   gene            complement(102410..102769)
FT                   /locus_tag="Arcpr_0119"
FT   CDS_pept        complement(102410..102769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57191"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57191.1"
FT                   /translation="MRFRSLRAVSQLMRKGVVATMRNGKYHDLIGREIVIRDSRNIVFA
FT                   KARVIAVFENLKVFRKLLWKYSGFESLEAWEEKARELNMGRLPKYIVLLKLTEKLKTDP
FT                   LCGFESAKELLKHTV"
FT   gene            complement(102759..103199)
FT                   /locus_tag="Arcpr_0120"
FT   CDS_pept        complement(102759..103199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57192"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57192.1"
FT                   /translation="MKCPFCGNFLENSLTKALNGIQSEEGIVLTNIDYVLEVGNTIRLV
FT                   AEEKHTQRHFANIYQLITLKKVAKALRVPLLLLFVDDVENEVTVYDVPVNIKFPRRHFY
FT                   NFEREEPVFVGDYRELRRFLLKNFVYHAPSMKRSFGRWYDAV"
FT   gene            complement(103196..104293)
FT                   /locus_tag="Arcpr_0121"
FT   CDS_pept        complement(103196..104293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57193"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57193.1"
FT                   /translation="MHPFAKALDGEWGNYIASWWRMKEEYLKTWVHPLREKHIYFKLVR
FT                   GFPYEIPFVFNGAGFKNELNTPWKEAEELHDVILFAPVLRREILPWELVLDPDIENEKE
FT                   LVKKGRWIQASLEALEIEYTMGYTGNRSFHFHIIADPDTKLPEELPEGFNLRLFKEALF
FT                   NIIGYCAGFDGLDIDTAGFKAKRHAIREFFSIHEKTRCFKVPLDEVEIRKVKLGVYPGW
FT                   LEDWEGYELWKPTESQVMEILEEVERIIAQRKLQEKSFERFWRSKPRKERTIGSRWRLE
FT                   RIKKYAQILRKYGKLVNDPKLKERHGNEWNARAHLIILMIKEGFTDEEIHEVFRHSENY
FT                   DHKKTQYFIDWFRRKEIEVSRGVRR"
FT   gene            complement(104268..105893)
FT                   /locus_tag="Arcpr_0122"
FT   CDS_pept        complement(104268..105893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0122"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: cla:Cla_1056
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57194"
FT                   /db_xref="GOA:D2RFW9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFW9"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADB57194.1"
FT                   /translation="MTSQKLLRRLEVILLSEVIKIYGPPGTGKTSTLISKLREEIQNDD
FT                   LSLKDVVFISFSNSAINEVCERVGILRGSRVAPYFRTLHGLCLKNLIKTGKISPDLIRR
FT                   MQSKGFVEGLQERFCREEGIPFERDDGFGASDALGNRVFTAWNAVIGEFYPESRDIGKC
FT                   LEMLYNINYNYGSIIERWLNFKENAGFFDYVDLLIESFEEGIEIEAKIGFIDEAQDFNR
FT                   LEFEIVETTIEQLERVYLAGDDDQAIYGWKGAKPDFYLDLKGEEVILSKTHRLPSRVWN
FT                   FAKQIITQVERRKEKEIEPREDAGVVRILPKMDIREFLSCAVGTARRHPNLKVFVLFRT
FT                   NRMVYQAESILLENAIPFKRLKGFTFWDKEFVTAWNIVAKLRRKEKLNLDELKFLVENA
FT                   NPDIISEEQKEILTNLIQSGNIPITLFEALHKLPILDLIALRRKRAKKLLEKAWKPIDF
FT                   EKINLYIDTIHASKGAEADIVFLADAITSPIVSAINNGHRDDELRVFYVGSTRARKALF
FT                   VAPLVEYKSFLEEVIAYAPICQSA"
FT   gene            complement(105844..106881)
FT                   /locus_tag="Arcpr_0123"
FT   CDS_pept        complement(105844..106881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57195"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57195.1"
FT                   /translation="MDNNFNAQNCGTSGTNRTNGTSGDTQDIGLNSRFEPICVKKAREC
FT                   SSPEALKVILSWAKRRGLTESQRLSIAKTFLKVHNLDLSPDKLLELLDVPQFSCDYVRN
FT                   LGFCKEEECAESLHPADRLIIDTESVLLFHSTSELDIKIAGRREIIPIKKIAKQGKDGM
FT                   KVNVALFNELFLKCYYIPPNPPFDEESALKVYQSWVDNAVIVREPFDVESSIEEAVIEV
FT                   LTTKREFYDVKLLKEGKVPPKRGFFVEGDIILVDSELLKELLEEVGVYESMRKVAKSVR
FT                   RLLANPNRASIRLRIKEQRRYFWAFNLEAIKAILKREGEDWTPEVKKEDDFSKAIEEIG
FT                   GDFIE"
FT   gene            complement(106883..107089)
FT                   /locus_tag="Arcpr_0124"
FT   CDS_pept        complement(106883..107089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57196"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57196.1"
FT                   /translation="MSTPTAKGGNLKKKSVIDFKSFSEKCPFMIRDQRNIKNCIFNEDF
FT                   PTDCKQEVCKLIGGGDAFVPYVP"
FT   gene            complement(107092..107298)
FT                   /locus_tag="Arcpr_0125"
FT   CDS_pept        complement(107092..107298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57197"
FT                   /db_xref="GOA:D2RFX2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57197.1"
FT                   /translation="MKGVVEVGRIVVTKTVSMPLEIAYVIQKLAEKLQTSESAVVRIAI
FT                   LEKAEREGVEIPSQWKSGFERGG"
FT   gene            107403..108080
FT                   /locus_tag="Arcpr_0126"
FT   CDS_pept        107403..108080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0126"
FT                   /product="regulatory protein ArsR"
FT                   /note="PFAM: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57198"
FT                   /db_xref="GOA:D2RFX3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX3"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADB57198.1"
FT                   /translation="MVSKRELEILGFIIGGKKYFHAIQEALGLKKPIVSEYLSNLKNKG
FT                   LIIERQDPNDRRRKLYEINPEEFVFTTVNEIISFIEKYIELTEEEKKELEKVLRHPSAH
FT                   EYFKKRLELIISSGEKLSVEDEISAFVDGIVAVKLFEEAFKDIYRKFAKDFARELVKGT
FT                   SVASTSHLLEIAENLPMWFVERWSSLERFRKSAIGQALISILVATRDLLQKKDIIKKKF
FT                   LKG"
FT   gene            complement(108344..108418)
FT                   /locus_tag="Arcpr_R0003"
FT                   /note="tRNA-Lys2"
FT   tRNA            complement(108344..108418)
FT                   /locus_tag="Arcpr_R0003"
FT                   /product="tRNA-Lys"
FT   gene            complement(108451..108720)
FT                   /locus_tag="Arcpr_0127"
FT   CDS_pept        complement(108451..108720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57199"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57199.1"
FT                   /translation="MKHPCIVQIRDVEEERLENLISKAYKFNVNVEKVKGGVDVYFEDV
FT                   NDARKFISILKKLLNFEVKFSTKFAGLRKGRVRVLFVYCLRYRG"
FT   gene            108758..109417
FT                   /locus_tag="Arcpr_0128"
FT   CDS_pept        108758..109417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57200"
FT                   /db_xref="GOA:D2RFX5"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57200.1"
FT                   /translation="MDELLIKEFDIRYINAVSRKDLKEHAMIRLIISSLATHEEVYNLT
FT                   KNDIRSFNGIKTVKLNNGRKTRIAPIDSRTFEVLMEVSKGMSRRQRIFDYSKAEMDEIV
FT                   KKYSPAKRTYNVEKLRSAVIDILRDCQFFEHDYVSDMINGTNFEGVVDFVNDMHPMFSG
FT                   VWDLDDDEVAEDFIENYILLIGERNAEKIAEDICESVERVENLMRSITSRNLMFRI"
FT   gene            complement(109425..109646)
FT                   /locus_tag="Arcpr_0129"
FT   CDS_pept        complement(109425..109646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0129"
FT                   /product="RNA polymerase Rpb6"
FT                   /note="PFAM: RNA polymerase Rpb6; KEGG: rpb-6; RNA
FT                   Polymerase II (B) subunit; K03014 DNA-directed RNA
FT                   Polymerase II subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57201"
FT                   /db_xref="GOA:D2RFX6"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX6"
FT                   /inference="protein motif:PFAM:PF01192"
FT                   /protein_id="ADB57201.1"
FT                   /translation="MKRTFPFKYTRFEKVRIIGARALQIALGAPVLIETDKTDPLEIAR
FT                   EEFERGVIPITVRRRRESFVWLERYDLF"
FT   gene            complement(109665..109738)
FT                   /locus_tag="Arcpr_R0004"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(109665..109738)
FT                   /locus_tag="Arcpr_R0004"
FT                   /product="tRNA-Pro"
FT   gene            complement(109724..109936)
FT                   /locus_tag="Arcpr_0130"
FT   CDS_pept        complement(109724..109936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0130"
FT                   /product="RNA polymerase, N/8 Kd subunit"
FT                   /note="PFAM: RNA polymerase, N/8 Kd subunit; KEGG:
FT                   hypothetical protein; K03007 DNA-directed RNA Polymerase II
FT                   subunit L"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57202"
FT                   /db_xref="GOA:D2RFX7"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX7"
FT                   /inference="protein motif:PFAM:PF01194"
FT                   /protein_id="ADB57202.1"
FT                   /translation="MEGVDFPIRCFSCGAVIGHLYAEYKKKLEEGKSPKEALDEMGIER
FT                   YCCRRMFLTYKSVLEEIAKFHGAVG"
FT   gene            complement(109971..110369)
FT                   /locus_tag="Arcpr_0131"
FT   CDS_pept        complement(109971..110369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0131"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: rps16; 40S
FT                   ribosomal protein S16; K02960 small subunit ribosomal
FT                   protein S16e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57203"
FT                   /db_xref="GOA:D2RFX8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX8"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADB57203.1"
FT                   /translation="MKVVITSGKRKTAVAKAVVRDGVGRVRINKIPLEIFQPELARLTI
FT                   MEPLIIAKDLAKKVDIDVTVNGGGVMGQAEAARTAIARGLVEWSGDEELKRAYLEYDRY
FT                   LLVNDVRRKEPKKQGGRGARKRRQTSYR"
FT   gene            complement(110372..110848)
FT                   /locus_tag="Arcpr_0132"
FT   CDS_pept        complement(110372..110848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0132"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: RPL16B; 60S large subunit ribosomal
FT                   protein; K02872 large subunit ribosomal protein L13Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57204"
FT                   /db_xref="GOA:D2RFX9"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFX9"
FT                   /inference="protein motif:TFAM:TIGR01077"
FT                   /protein_id="ADB57204.1"
FT                   /translation="MAVSVKRALKTLGDDFVVINAEGHILGRLSSIIAKRLLNGEKIVV
FT                   VNAEKAIVTGDREMVFQRYKEKYDRGSKEKGPYFPRHPEKLFKRTVRGMLPWKSRRGRE
FT                   AYRRLRVFMGVPEELKDKEFEIVEQALYEKVCKTDKFVTVAEICEYLGYKFRGA"
FT   gene            complement(110855..111232)
FT                   /locus_tag="Arcpr_0133"
FT   CDS_pept        complement(110855..111232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0133"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: eukaryotic
FT                   ribosomal protein L18; K02883 large subunit ribosomal
FT                   protein L18e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57205"
FT                   /db_xref="GOA:D2RFY0"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR021132"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY0"
FT                   /inference="protein motif:PFAM:PF00256"
FT                   /protein_id="ADB57205.1"
FT                   /translation="MSKVERLTKRKTDPNLVKLIESLFKASAENKAKIWKDIAERLARP
FT                   KRLYAEVNVSKIERYAKEGETILVPGKVLGGGRITKAVTVAALSFSDSARRKIESAGGK
FT                   CLTISQLIEINPGGSGVRIMG"
FT   gene            complement(111260..111775)
FT                   /locus_tag="Arcpr_0134"
FT   CDS_pept        complement(111260..111775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0134"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: orotidine-5-phosphate
FT                   decarboxylase/orotate phosphoribosyltransferase; K00762
FT                   orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57206"
FT                   /db_xref="GOA:D2RFY1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY1"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADB57206.1"
FT                   /translation="MKEKLIDMLKEIGALKFGEFILSSGKKSNVYVDIKIACTYPEILR
FT                   TVAKLMAEKVKGIDFDKIACIELGGVPLAVALSLETNKPYVIFRKEKKSYGVGGDLIGT
FT                   IEEGERIVVVEDVTTTGKSAYSVVRRVEERGGKVVAVLTVVDRNEGARELIPNLIPIVE
FT                   LKELLENI"
FT   gene            complement(111777..112391)
FT                   /locus_tag="Arcpr_0135"
FT   CDS_pept        complement(111777..112391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57207"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57207.1"
FT                   /translation="MSVGWDASHGEFLIEDYYYFSKLKRMAKNEGIEIYQEDDFKKLGE
FT                   HDVIVFNYPEEKFRSWEIRKISNWLKKGKRIVFATYYGNMDSTAENINKVLTKLEIPIR
FT                   INGDVVVDLENNAGDMMFPICKYKTYKVVMPCASSLTTNNNALIISETGLTHPNGYRSP
FT                   VVGAMYKDKGEIIVLGTCVFWDNYSLELLDNKILALDILRC"
FT   gene            112468..112540
FT                   /locus_tag="Arcpr_R0005"
FT                   /note="tRNA-Gly1"
FT   tRNA            112468..112540
FT                   /locus_tag="Arcpr_R0005"
FT                   /product="tRNA-Gly"
FT   gene            complement(112659..113705)
FT                   /locus_tag="Arcpr_0136"
FT   CDS_pept        complement(112659..113705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0136"
FT                   /product="translation initiation factor, aIF-2BI family"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: geo:Geob_0383 translation initiation factor,
FT                   aIF-2BI family; TIGRFAM: translation initiation factor,
FT                   aIF-2BI family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57208"
FT                   /db_xref="GOA:D2RFY3"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY3"
FT                   /inference="protein motif:TFAM:TIGR00512"
FT                   /protein_id="ADB57208.1"
FT                   /translation="MRTIYWEDNAVKLIDQTLLPDEFKIITCRTVDELADAIKRLAVRG
FT                   APALEASGAYGVALACYERDFKDVDELKEHVKKRAELLASTRPTAVNLFYGIDRVLEVV
FT                   LSGSDVEEIRKKALEEAERIAEEDVRRNKLMGKYGAELLEDGDTVLTYCNTGRLATVDY
FT                   GTALGVIRSAVEQGKKIKVIACETRPLNQGSRLTCWELMQDGIDVTLITDNMVGIVMQR
FT                   GMVDKVIVGADRIVRDAVFNKIGTYTVAIVAKEHNVPFYVAAPITTFDWEKTMDEVIIE
FT                   ERSKDELIYCHIKCRKTLIAPKDVKVFNPAFDVTPLKYVTALITEKGVIYPPYEENVPK
FT                   FLKLGGSE"
FT   gene            113839..116418
FT                   /locus_tag="Arcpr_0137"
FT   CDS_pept        113839..116418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0137"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; type III restriction protein res
FT                   subunit; DEAD/H associated domain protein; SMART: DEAD-like
FT                   helicase; helicase domain protein; KEGG: mxa:MXAN_0997
FT                   putative ATP_dependent helicase Lhr"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57209"
FT                   /db_xref="GOA:D2RFY4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY4"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADB57209.1"
FT                   /translation="MLVEALREIGIKRLNDLQKVAIPRVAKGLNVLITAPTGSGKTECA
FT                   TIPILNKMLKMDCKGITFLYITPLRALNRDMIRRLKILADKLGFTIAVRHSDTSNAERR
FT                   LQSLKPPQILITTPETFQILFLGRRLRESLRNVQFVVIDEIHELADSKRGVQLAIALER
FT                   LRELANFQVIGLSATLSNAKEIAEFFGMEDVVEWNGKKVYEFRVVKGDEEEIARIVKNH
FT                   RSSLIFTNTRQTAETLGLKLKKMLKIEVHHSSLSRDVRIEAEKMFAEGKLDALVCTSSM
FT                   ELGIDIGHVDAVVQYNSPREVKRLIQRVGRSGHRLEEVSKGYIVANEFDEILESWAIVK
FT                   RAKKGLIERIEPFSKPLDVLANQIVAMLMEGYDLGAIYEIVKRVKFYDDLSEEEFNEIC
FT                   AFLEKNGLIRNGKVTRSGRRYFYSNISMIPDEKKVKVVDTATHKVIGYLDESFVSLLDH
FT                   NVFAMKGELWRIVAIDDVVRVERVESEGVVPSWLGEEIPVPFEVAQDVGKIRRWICNLL
FT                   RSFSKEEVVDILMQEFNTDEGSCKVVLDVIERCLKEGYRIATDDVVTIEGKGNVVINAC
FT                   FGHKVNETIAKLISLFLPKPFEISVEPYRIRIKGNVDADYVKDVLMKIDVDKIAELIEI
FT                   ALIDSKVMQYKFVEVAKRFGCLDDVGRINIRRLIEKMRGKPVYIEALKEVIHDRLDLDR
FT                   TAFVLKKIQSGEIEILVYEECSPLSKLSELRIGDIVGDREKAILKAFKERIENEYCYLI
FT                   CLNCGCRVKMKVKQIESLMCIKCGSALLACVNARRDLNEIDKVELYKNANLVMNYGKRA
FT                   IYALNTFGVGVNTAVKILSKFFKNEEDFLKELIEAEKRFVRTRVFWS"
FT   gene            complement(116399..117124)
FT                   /locus_tag="Arcpr_0138"
FT   CDS_pept        complement(116399..117124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0138"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: neu:NE0532 uroporphyrinogen-III
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57210"
FT                   /db_xref="GOA:D2RFY5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY5"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADB57210.1"
FT                   /translation="MTGKVYIVGAGPGDPELLTVKALKVIEMADVILYDRLVGKSIEDM
FT                   LKRMGKEIIYVGKNSYENGAERQRNINELMVKLAREGKIVVRLKGGDPFVFGRGGEEVE
FT                   YLIRNNIPFEVIPGLSSVIAVPTSAKIPLTHKGLSSTIFVITGRNLEDIGKSALNGTIV
FT                   VLMGKEKIKEICRRLIELGKDPKTPVAVIENGTLDNQRVYYGNLETIGDIVEKNVKGVA
FT                   LIVIGDVVELGKKFNSRKL"
FT   gene            117266..118519
FT                   /locus_tag="Arcpr_0139"
FT   CDS_pept        117266..118519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0139"
FT                   /product="sulfite reductase, dissimilatory-type alpha
FT                   subunit"
FT                   /EC_number="1.8.99.3"
FT                   /note="KEGG: dde:Dde_0526 sulfite reductase, dissimilatory-
FT                   type alpha subunit; TIGRFAM: sulfite reductase,
FT                   dissimilatory-type alpha subunit; PFAM: nitrite and
FT                   sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57211"
FT                   /db_xref="GOA:D2RFY6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY6"
FT                   /inference="protein motif:TFAM:TIGR02064"
FT                   /protein_id="ADB57211.1"
FT                   /translation="MPVVDGVELPETPLLDELEKGPWPSFVKEIKRAAIEQEKAMKAGK
FT                   KIKLPGAAKGLLKVLELSYKEKRTHWKHGGIVAVYGYGGGVIGRYCDLEDKVPEVWHFH
FT                   TMRINMPAGWFYSTKALRAICDAWEKWGSGLTNFHGSTGDIILLGTRTEHLQPMANALA
FT                   YLEKYGSPAPFDIGGSGSDLRTPSACMGPALCEFACYDTLEACYQFTMRYQDELHRPMW
FT                   PYKFKIKCAGCPNDCVAAKARSDFAIIGTWKDEIQIDQEAVREYAKAGVDIEKQVVKKC
FT                   PTGAISWDGNELKIDNKNCIRCMHCINVLPKALKPGKERGATILIGGKAPFLDGAIIGW
FT                   VAVPFIPADELIDKCCELLEAIWDWWDENGKFRERVGELIWRVGMQEFLKVIGQKADVR
FT                   MVYAPRNNPFIFWRELQE"
FT   gene            118531..119652
FT                   /locus_tag="Arcpr_0140"
FT   CDS_pept        118531..119652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0140"
FT                   /product="sulfite reductase, dissimilatory-type beta
FT                   subunit"
FT                   /EC_number="1.8.99.3"
FT                   /note="KEGG: sfu:Sfum_4043 sulfite reductase,
FT                   dissimilatory-type beta subunit; TIGRFAM: sulfite
FT                   reductase, dissimilatory-type beta subunit; PFAM: nitrite
FT                   and sulphite reductase 4Fe-4S region; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; nitrite/sulfite
FT                   reductase hemoprotein beta-component ferrodoxin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57212"
FT                   /db_xref="GOA:D2RFY7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY7"
FT                   /inference="protein motif:TFAM:TIGR02066"
FT                   /protein_id="ADB57212.1"
FT                   /translation="MAEEKEWEETVEPKTDFGPPHYSIMLHPVIKNNYGKWKYHEVVRP
FT                   GVIKRVAESGDVIYVVRFGSPRLLSIYTVRDLCDIADKYSDGYLRFTSRHNVEFFLTDP
FT                   DKIEDLIKEVQEKVGFPCGGTWDATKGEYGLTNIVHTQGWVHCHTPATDASGIVKAVMD
FT                   ELYEYFTDHKLPALCRISLACCANMCGAVHASDISMVGVHRKVPKIDDDAVRRTCEIPS
FT                   TVAACPTGALKPDMKRKTVILDKDKCMYCGNCYTMCPGMPIFDPENDGVAILVGGKLSD
FT                   ARYPPQLSKVVVPWLPNNPPRWPEVVQTVKKILETWAAHAEKYERVAEWIHRIGWERFF
FT                   ELTGLEFTEKLIEDYHRTPYLYTTFRTSAAFRW"
FT   gene            119695..119934
FT                   /locus_tag="Arcpr_0141"
FT   CDS_pept        119695..119934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0141"
FT                   /product="Dissimilatory sulfite reductase D"
FT                   /note="PFAM: Dissimilatory sulfite reductase D; KEGG:
FT                   sfu:Sfum_4041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57213"
FT                   /db_xref="InterPro:IPR014793"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY8"
FT                   /inference="protein motif:PFAM:PF08679"
FT                   /protein_id="ADB57213.1"
FT                   /translation="MAEEINKEELKQKVIEYLQKKPWQVRDLAKILRVKKKELDKIVQE
FT                   LINEGKAAYWSSGSTTYITTPEKLKEMEEKRSGI"
FT   gene            120053..120244
FT                   /locus_tag="Arcpr_0142"
FT   CDS_pept        120053..120244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0142"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dal:Dalk_4380 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57214"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFY9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADB57214.1"
FT                   /translation="MVEIKVDPEKCDGCGECIGVCPGEVYEIGEDGKSHPVRPEDCQEC
FT                   CSCVEACPNGAIWIDICE"
FT   gene            120341..121033
FT                   /locus_tag="Arcpr_0143"
FT   CDS_pept        120341..121033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0143"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57215"
FT                   /db_xref="GOA:D2RFZ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017271"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB57215.1"
FT                   /translation="MDHIIDVLKDKISGEIVFSDNPGKALRKWRRIFEVSQKELADKLG
FT                   ISPSVISDYESDRRKSPGISFVRKVITALFEIDKDKGYKTISKYRDLISGINLDAIIDM
FT                   KEFTKSLKFKELVEMLEGDVIVETDKVVNGYTIVDSIKAILTLNAYDFYKLYGYTSERS
FT                   LIFTKVSTGRSPMVAVRVANLKPSVVVLHGLKRVDEIAVKLAEADKVGLIVTNLPVEDM
FT                   VDRLRGVE"
FT   gene            121033..122067
FT                   /locus_tag="Arcpr_0144"
FT   CDS_pept        121033..122067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0144"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /note="TIGRFAM: hydroxymethylglutaryl-CoA synthase; PFAM:
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; Hydroxymethylglutaryl- coenzyme A synthase domain;
FT                   KEGG: pfl:PFL_5954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57216"
FT                   /db_xref="GOA:D2RFZ1"
FT                   /db_xref="InterPro:IPR004656"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ1"
FT                   /inference="protein motif:TFAM:TIGR00748"
FT                   /protein_id="ADB57216.1"
FT                   /translation="MVGIVSYGTYIPRYRIKVDEIARIWGENAEVIKNGLGVEQKSVPG
FT                   SDEDTATIAVEAGREALKRAKIDPKKIGAVFVGSESHPYAVKPTGTIVAEALGVGNDYF
FT                   CADLEFACKAGTTAMQICYAMVRAGIIEYGIAIGADTSQSRPGDPLEYTAGAGGACFII
FT                   GRDCIAEIEGTYSFASDTPDFWRREGQPYPSHGGRFTGQPAYFRHIVGATQGLLEKLGL
FT                   KPSDFTYAVFHQPNGKFPMRVAKMLGFTKEQVKQGLVVPYIGNTYSGSSMIGLASVLDV
FT                   AKPGDRILLTSFGSGAGSDAFSFVVTDKIEDFERNPTVFEKIKSCEYVDYGMYVKLRRK
FT                   IRFG"
FT   gene            122072..123226
FT                   /locus_tag="Arcpr_0145"
FT   CDS_pept        122072..123226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0145"
FT                   /product="Thiolase"
FT                   /note="PFAM: Thiolase; KEGG: gur:Gura_4354 thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57217"
FT                   /db_xref="GOA:D2RFZ2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ2"
FT                   /inference="protein motif:PFAM:PF02803"
FT                   /protein_id="ADB57217.1"
FT                   /translation="MRGVAVIGVGCSKFGELWEMGFRDIVISAGVEALEDAGLEGREIE
FT                   AVYAGNMSAGRYIGQEHIASLIADYSGLADLHVPCTRVEAGDASGGVALRQAYMAVASG
FT                   MHDIVIAAGAEKVTDVPNAMEILSSSADVEWEVFNGANLPALYAIIARAHMKKYGTKEE
FT                   DLAMVSVKNHKNATLNPKAMFKREISLEVALNSPYVAEPLKLFDCAPICDGASVVILAS
FT                   EDVAKEYTDTPVYIKACTQASDYIALHSRRDITTMDAVVHASRQAYKIAKIDPKDVDVA
FT                   EVHDSFTIAEIMAYEDLGFVEKGRGAELIREGVTALDGDLPVNPSGGLKAFGHAVGATG
FT                   VRQAVEIVLQLRGDAGKRQVDAEVGLSLNIGGTGGTAVVTIFSR"
FT   gene            123232..123618
FT                   /locus_tag="Arcpr_0146"
FT   CDS_pept        123232..123618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0146"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   dol:Dole_1602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57218"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ3"
FT                   /inference="protein motif:PFAM:PF01796"
FT                   /protein_id="ADB57218.1"
FT                   /translation="MLPKFWRKIKYRYNLIGSYCENCGGYFYPPRNLCPKCRRKGKVKE
FT                   VQFSGYGKVLSWSVVHDAVENFWMSKPYVVALIELDEGARLTAPLDCKPDEVYEGMRVK
FT                   AVFRKFGEDGEEGIIYYGTKFVPV"
FT   gene            complement(123615..124889)
FT                   /locus_tag="Arcpr_0147"
FT   CDS_pept        complement(123615..124889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0147"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   sfu:Sfum_2961 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57219"
FT                   /db_xref="GOA:D2RFZ4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ4"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADB57219.1"
FT                   /translation="MFDVAIKNGLCFVNGEFVQANIGIEGNLIAYVGRDDICGDLEIDA
FT                   REKIVIPGLFNAHTHLAMTIFRGYAEDLPLKDWLEKKIWRVEKLLEPEDVYWGSLLGIL
FT                   EMLKTGTTAFSDLYIHMDEVAKAVGESGIRAVLSYGMADRGSKEKADLELKIGTEFIKN
FT                   WDNAFNGRIRAIFGPHAPYTCTPEFLKRVKDAAIELNTYVHIHVAETKWEVEHVKSVYG
FT                   KTPVRLLDEIGFLDERTVIAHAIWLDDNEMRILKERNVSVVHCPISNLKLASGIARVKD
FT                   LHDLGINVCLGTDGASSNNTYNLFEEIKMTSLLQKVITGRADALKAKEVLKMATENGYR
FT                   AYGIKGGKLERGYLADIVLIDRRRHNYCPMYDPLHSLVYASYGCEVTHVIVDGELLVED
FT                   GIVLTLDEDKIMDKVESLKEKFEES"
FT   gene            complement(124925..126223)
FT                   /locus_tag="Arcpr_0148"
FT   CDS_pept        complement(124925..126223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0148"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: sat:SYN_02618 potassium transporter peripheral
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57220"
FT                   /db_xref="GOA:D2RFZ5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ5"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADB57220.1"
FT                   /translation="MRIVIAGAGEVGYNLAKVLCDNHDVYVIDIDEDKVENMKNLNVSA
FT                   VRGNSASIDVLKSVEIEKADVFLAVTGDDEVNMLSGLLAKKFGAKKVVVRVSNPDYVDR
FT                   PIVRDHILGFDLVVCPQLALANEIANLLMIPGAVDFVTLSGGEANVVEIKAGAGIVGKK
FT                   ISDLNLPKNVLIVAILRNGEVVIPRGETVVEEGDVLVVLGRVDEIAKVQAFGQTLVKNV
FT                   TIFGGGTIGEYIARTLETGKFKITLVDSNIDRCEILSESLRKTKVVCGDATDVEFLEEV
FT                   EVGKSDVVIATTESDERNLMISLLCKSMGARKAIAKVEKGDYIKIFEMVGVDHAISPRR
FT                   VTFLEVMKYLRLVDIRSIAEIKQKIAVLEFIAKNVDDVKIMDLKLPDCAIIGGVIRGED
FT                   FLIPRGDTVIKRGDRILVFATWDCIEELEDIFE"
FT   gene            complement(126233..126961)
FT                   /locus_tag="Arcpr_0149"
FT   CDS_pept        complement(126233..126961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0149"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: sat:SYN_00305 sec-independent protein
FT                   translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57221"
FT                   /db_xref="GOA:D2RFZ6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ6"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ADB57221.1"
FT                   /translation="MEPPEDREMPLQEHLAELRKRLLRVFVVFVIGIAIVFRFSGQMIK
FT                   DFWSYVLPDTQINVVTPTEWFMVQLTFSFSVVLIVVYPYLVYELYQFARPGLYEHERRF
FT                   VKIFLPFSYILFLVGVSLGFFIVVPRVFSISMLFNMGADPFLTAKKTLYSALKIILAFG
FT                   LSFQIPVLAVIAVRIGLIDSKWLKSKRWIVYLAVFILATNLTLDISGISQIIVLTLVVI
FT                   MYEFSIVLARIMEKNIKSTG"
FT   gene            complement(126993..127304)
FT                   /locus_tag="Arcpr_0150"
FT   CDS_pept        complement(126993..127304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57222"
FT                   /db_xref="GOA:D2RFZ7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57222.1"
FT                   /translation="MVGLIYFMIFFVSAIFELKNSYANSFVLFTISAVFLKGVVTKKDG
FT                   YCLAGSILGLAFGVLMILSAMASYADTFLGGEDANFSYGIVGISTLPYLLMMKRRLSA"
FT   gene            complement(127292..128989)
FT                   /locus_tag="Arcpr_0151"
FT   CDS_pept        complement(127292..128989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0151"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; nucleoside recognition domain protein; Miro
FT                   domain protein; Ferrous iron transport protein B domain
FT                   protein; Ferrous iron transport B domain protein; KEGG:
FT                   cju:C8J_1312 ferrous iron transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57223"
FT                   /db_xref="GOA:D2RFZ8"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ8"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ADB57223.1"
FT                   /translation="MKVALVGNPNVGKTALINALTGGNFTVGNFPGVTVEKKEGKARID
FT                   GKEVIFIDLPGIYSLQPRSIDEKVARDFLVKERPDLILNVVNASNLERNLYLTLELTDF
FT                   GIPMIVVLNMVDIAKNRGIRIRSDKLSEILGVPVVETVASKGIGIDRLKEEIIKGGKVP
FT                   KRLGRTFEEKVKIAEEIANKVIERFESKVIISELLDEAFMDKHLGIPIFLSLMWMVFVF
FT                   TYNVAQPIVDLLDAFFSALADLISSYDGILFDLLGNGVISGVGSVLVFLPNIAFLFISL
FT                   SILELSGYMPRAVYLVDSIMSKFGLNGRSIIPLIMGFGCNVPAVMATRSIEDDRIRLTT
FT                   VLVSPFMSCSARLPIYVLFVSALFRNGSAVIMSLYLFGLAVALISAFLFRKTIFKGEAE
FT                   YILELPPYILPNVRDIVLLTWNRVKHFLEKAGTVIVVMAVFIWFITSYPSENIEESFAG
FT                   IIGKAIHPLFAPMGWDYKLVLALIMGFVAKEVVVETIGLMNVDVSLLSTYQALAFMVFT
FT                   LLYVPCFATIAAIRSEAGFKWAIFSILYSFIVAYIFALLITEVGTWLA"
FT   gene            complement(129088..129435)
FT                   /locus_tag="Arcpr_0152"
FT   CDS_pept        complement(129088..129435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57224"
FT                   /db_xref="GOA:D2RFZ9"
FT                   /db_xref="UniProtKB/TrEMBL:D2RFZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57224.1"
FT                   /translation="MGGDVRILIAALSFAFFVVCPRMAGITSLIAKSTGLDLIKVTVIG
FT                   TLVAIPLVVAMVLIFSRYGLIAALAFAVLTDFLSALAMKEISPKAGIETLVIALFVLIG
FT                   AKVATYISKFI"
FT   sig_peptide     complement(129361..129435)
FT                   /locus_tag="Arcpr_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.750 at
FT                   residue 25"
FT   gene            complement(129466..129849)
FT                   /locus_tag="Arcpr_0153"
FT   CDS_pept        complement(129466..129849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57225"
FT                   /db_xref="GOA:D2RG00"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57225.1"
FT                   /translation="MRWYSAILFIMTLAAGLLEIVGGLKGEMILQLFPSDVFGGLVLIV
FT                   VSAIFLRGLTHDEHDAFFGFGSLMLAVFGVLYTLVLLTNGLDAWIVGDEWNPLNDLRVE
FT                   ILLLPLAIPGLTALNRARKTLPP"
FT   gene            complement(129850..131807)
FT                   /pseudo
FT                   /locus_tag="Arcpr_0154"
FT   gene            complement(131804..132034)
FT                   /locus_tag="Arcpr_0155"
FT   CDS_pept        complement(131804..132034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0155"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: ank:AnaeK_3367 FeoA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57226"
FT                   /db_xref="GOA:D2RG01"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG01"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ADB57226.1"
FT                   /translation="MRRLHELKPGTKAIVLDVEGNTTLKRKLLGMGLTRGAEVRIVRNA
FT                   PLKDPMEIEVRRYRLTLRKAEAEKVIVEVRE"
FT   gene            complement(132240..132722)
FT                   /locus_tag="Arcpr_0156"
FT   CDS_pept        complement(132240..132722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0156"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; regulatory protein
FT                   MarR; SMART: iron dependent repressor; KEGG: dal:Dalk_2732
FT                   iron (metal) dependent repressor, DtxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57227"
FT                   /db_xref="GOA:D2RG02"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG02"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ADB57227.1"
FT                   /translation="MLGKRAEDYLEAIYELCREKGFTRVKDIAERLNVKPATVSEMLEK
FT                   LSKGGYIIYRKRLFVALTEKGRKVARDVRERREILVKFLTALGIPKDIAEKDACTIEHV
FT                   LHSETVKQLKNFVKFIEECPAISPKWLEHFREFCRTGIHPCDRAKSERVKRKALNV"
FT   gene            complement(132703..132939)
FT                   /locus_tag="Arcpr_0157"
FT   CDS_pept        complement(132703..132939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0157"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: ade:Adeh_3291
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57228"
FT                   /db_xref="GOA:D2RG03"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG03"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ADB57228.1"
FT                   /translation="MSLIPLAMLPEGAKGKVVNIVGGIGALRKLMAMGIVPGKEIRVLG
FT                   RRGGAMLISINGTKFVIGRGLAMKVMVDVGKEG"
FT   gene            133030..134067
FT                   /locus_tag="Arcpr_0158"
FT   CDS_pept        133030..134067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0158"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: peptidase M42 family protein; peptidase M20;
FT                   KEGG: ecl:EcolC_4119 cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57229"
FT                   /db_xref="GOA:D2RG04"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG04"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADB57229.1"
FT                   /translation="MFELLKKLCDAHGISGYEDEVREIVKAELEGYVDEIKVDKLGNLI
FT                   CIKNGSEFKEMVCAHMDEIGFMVKYIDEKGFIRFTPIGGWFSQIALGQRVVLHGSKGKV
FT                   YGVIGCKPPHVMKDEERKKAIEFKDMFIDVGAESKDDVKEMGIEIGTPITIDRELVKMG
FT                   NRITGKALDDRAGLAVMIEALKRTKSDATIYAVATVQEEVGLKGARVSAFAIEPNVALA
FT                   LDVCVATDFPGAESTYMDIKLGKGPAITIVDASGRGLIATKNVVKWLKETAEKNEIPYQ
FT                   LEVAEGGTTDATAIQLTKAGIPSGVVSIPARYIHSPVEVVDMRDMENSANLVARALERA
FT                   EKYFK"
FT   gene            134102..134512
FT                   /locus_tag="Arcpr_0159"
FT   CDS_pept        134102..134512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afr:AFE_3115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57230"
FT                   /db_xref="GOA:D2RG05"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG05"
FT                   /inference="similar to AA sequence:KEGG:AFE_3115"
FT                   /protein_id="ADB57230.1"
FT                   /translation="MAKGKTYQFFTKAYYALMFMMAFVVLILLILNVYIIVKSIPNVVI
FT                   VESRRVLDELIAEILTFFVLIELTRAFTEYFAYHRVRLSLMAEIASIFILREILIKLYV
FT                   GEYDWLTLIAFSVLLISVVIVRVMCLKYSPKE"
FT   gene            134537..135412
FT                   /locus_tag="Arcpr_0160"
FT   CDS_pept        134537..135412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0160"
FT                   /product="Formylmethanofuran--tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /EC_number="2.3.1.101"
FT                   /note="PFAM: formylmethanofuran: tetrahydromethanopterin
FT                   formyltransferase (Ftr); KEGG: bph:Bphy_5933
FT                   formylmethanofuran-- tetrahydromethanopterin
FT                   N-formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57231"
FT                   /db_xref="GOA:D2RG06"
FT                   /db_xref="InterPro:IPR002770"
FT                   /db_xref="InterPro:IPR014053"
FT                   /db_xref="InterPro:IPR022667"
FT                   /db_xref="InterPro:IPR023447"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG06"
FT                   /inference="protein motif:PRIAM:2.3.1.101"
FT                   /protein_id="ADB57231.1"
FT                   /translation="MVEVEDTYCEAFSGIYTRLIVTAKYKYLLEKAVYSATALPSTVFG
FT                   ESEAGVERWLSPEETPDGRVGAVIQIWVPKTKKFMDVLLREMGKRIRQGILVVPTTRVF
FT                   NACEGEKIDVEINVGRCGDGYEWFEERWGREVIVVPIMFGEFVIERYIGYAEGVAGGNI
FT                   WYFCESEESALEVGERAVEALKDVDGVITPFDVCSAGSKPETKFPEIGPTTNHPYCPSL
FT                   KGKIPDSKVPEGVKAIPEIVINGVSLEAVKEAMKVCIEVGMNVDGVVKISAGNYGGKLG
FT                   KYKIYLRELI"
FT   gene            complement(135483..136238)
FT                   /locus_tag="Arcpr_0161"
FT   CDS_pept        complement(135483..136238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0161"
FT                   /product="diphthine synthase"
FT                   /EC_number="2.1.1.98"
FT                   /note="KEGG: hypothetical protein; K00586 diphthine
FT                   synthase; TIGRFAM: diphthine synthase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57232"
FT                   /db_xref="GOA:D2RG07"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG07"
FT                   /inference="protein motif:TFAM:TIGR00522"
FT                   /protein_id="ADB57232.1"
FT                   /translation="MLIFVGMGLWDERDISCKGLEIARKADEVYVEFYTSKLMGTNLER
FT                   IEEFVGRKIVELSRSDLEENCVWIIERAKERDVVILIPGDPMIATTHSALKYEAERRGV
FT                   KTRVVNAGSIINAVCGLTGLHNYKFGKSATVSWIKSKTPIDVINQNLSINAHTLLFLDL
FT                   HPKPMTIKDAVEILMDVESGVGDLFAVGIARAGSENPVVKCDRMKNLKDYDFGEPLHVM
FT                   VVLAKLHFMEFDCLRLFAQAPDELEEIVE"
FT   gene            136382..137446
FT                   /locus_tag="Arcpr_0162"
FT   CDS_pept        136382..137446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0162"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: TGS domain
FT                   protein; GTP-binding protein HSR1- related; KEGG:
FT                   developmentally regulated GTP-binding protein; K06944"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57233"
FT                   /db_xref="GOA:D2RG08"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG08"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADB57233.1"
FT                   /translation="MDIIQEIKRLEEEIKKTPYNKATEHHIGRLKAKLARLKEELEKQR
FT                   QKKSKAPAFSLRKEGDASVFLVGFPSVGKSTLLNALTNAKSEVGDYDFTTLKPVPGMLE
FT                   YKGAKIQIVDVPGLIEGASKGKGRGREVLSFIRNADLIVIVVDVFTLHNIDIIKRELYE
FT                   AGIRLNQKPPEVVIKKRERGGIKITSTVPLSLDESTIVEVLKENRIHNAEVIIREDLTL
FT                   DRLIDAIMGNRVYIPSITVVNKIDLYQPELPEDVIPISAERGINLDRLKEEIYRKLDFI
FT                   RIYLKPPGGKPDFDEPLIMRRGCTVADVCKKLHRGMLESFRYAKVWGKSVKYQGQRVGL
FT                   DHVLEDEDILTIYA"
FT   gene            complement(137447..137974)
FT                   /locus_tag="Arcpr_0163"
FT   CDS_pept        complement(137447..137974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0163"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: tgr:Tgr7_0813
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57234"
FT                   /db_xref="GOA:D2RG09"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG09"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADB57234.1"
FT                   /translation="MPYEHRLEAIFTRVSIRRFKPDPVPEDVIKVILEAGNAAPSAGNL
FT                   QARDFIVVRDENTKLKLAKAALKQMFIAEAPVVIVVCANYPRSMRVYGERGRLYAEQDA
FT                   TAAIENILLAAHMLGLGAVWVGAFDEVEVMEILGIPDYARPMAIVPIGYPAEKPKRRER
FT                   YPIEYLTHWEKW"
FT   gene            138045..139901
FT                   /locus_tag="Arcpr_0164"
FT   CDS_pept        138045..139901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0164"
FT                   /product="threonyl-tRNA synthetase"
FT                   /note="TIGRFAM: threonyl-tRNA synthetase; PFAM:
FT                   Threonyl-tRNA synthetase editing domain protein; tRNA
FT                   synthetase class II (G H P and S); Anticodon- binding
FT                   domain protein; KEGG: geo:Geob_3365 threonyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57235"
FT                   /db_xref="GOA:D2RG10"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG10"
FT                   /inference="protein motif:TFAM:TIGR00418"
FT                   /protein_id="ADB57235.1"
FT                   /translation="MRLLLIHADYIEYEPKEKTKFAEDWEPKKERIEECLVVFTSVEKG
FT                   DENVVDRAVEEIREVAKKLNVDKIVVYPYAHLSSNLADPDTAVAVLKEIESKLSQDFNV
FT                   HRAPFGWYKAFKLSCKGHPLSELSRSIVVEEEKEVTQALKAEEKVKSYWFILTPDKELV
FT                   EVEKFDFTGYENLRKFARYEMEKRRAVDKIPPHVELMKRLEIADYEPASDSGHLRYYPK
FT                   GRLIKSLLEEFVTLKCIEYGAMEVETPIMYDRSHPTLRRYLERFPARQYIIKGDKREFF
FT                   LRFAACFGQFLIAHDSVITYKNLPMKLYELTRYSFRKEQRGELVGLRRLRAFTMPDMHT
FT                   FVRDMEQAKQEFFNQYKLSVEVLKGIGIDPEDYEVAVRVTKDFYEQNKEFIHSLVDILR
FT                   KPILVEMWDQRFFYFVLKFEFNFVDALEKASALSTVQIDVENAERYDISYVDENGEKKR
FT                   PLILHCSLSGAIERCMYALLEKAHMNMERGKLPMLPVWLSPTQVRVIPVSERYLDRAIE
FT                   VANELSRRGIRADVDDRDETLGKKIRDAGREWIPYVAVIGEDEVKGGFLTVTIRAESTL
FT                   KEQKRVKMSIDELAERVKKECEGKPFKPLPLPMLLSKRPNFR"
FT   gene            139907..140164
FT                   /locus_tag="Arcpr_0165"
FT   CDS_pept        139907..140164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57236"
FT                   /db_xref="GOA:D2RG11"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57236.1"
FT                   /translation="MNREGLIKTGIPLILGAIAGILSFLITDGIRSRDPLGIIVLVFLI
FT                   YVNKFLLPKLGVNLEGKDWVAISFMCFAGWYITWTFLLNV"
FT   gene            140273..142042
FT                   /locus_tag="Arcpr_0166"
FT   CDS_pept        140273..142042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0166"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; metal-binding domain in
FT                   RNase L inhibitor, RLI; SMART: AAA ATPase; KEGG: abce-1;
FT                   ABC transporter, class E; K06174 ATP- binding cassette,
FT                   sub-family E, member 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57237"
FT                   /db_xref="GOA:D2RG12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG12"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB57237.1"
FT                   /translation="MTKKIRIAVVDKDRCQPKKCSQECVKYCPKVRTGAEDTIVIKDKA
FT                   EISEELCVGCGICVKKCPFKAITIVGLPHELEGKEVHRYGKNGFVLYGLPIPRKGYVVG
FT                   LLGPNGTGKTTAVKILTGQLKPNLGKEEATWEEIFERFAGTELLNYFKDLAEGKIRVSV
FT                   KPQYIEAIPRVYKGKVIDLLKRADELGILDEMVEKLELKNCLHRDVKDLSGGELQRIAI
FT                   AGCLMKDADFYFLDEITSYLDIYQRMNCAKVIRERAENKSVLIVEHDLAILDMLADFVH
FT                   ISYGEPGVYGIITNAKGVRVGINQYLRGYLAEENVRIREKPIEFDIFQPRQDVSEKILV
FT                   EYPSFTKTLNGFRLEAEAGDIRCEEVLGVVGKNATGKSTFVKILAGVLKDDEEKVKLNV
FT                   RVSYKPQYVKADVSMEVGAFLRKINPMIDSSYYKTEFIKPLGLDKLMDRNLDELSGGEL
FT                   QRVAIVACLLREADLYLLDEPSAHLDVEQRIEVARIIRRFALNFSKSVLVVDHDIYLID
FT                   MVSDRLMVFQGEPGKRGIARKPMGMREGMNTFLADLGITFRRDEETKRPRVNKIGSRLD
FT                   REQKAKGEYYYYF"
FT   gene            142095..143345
FT                   /locus_tag="Arcpr_0167"
FT   CDS_pept        142095..143345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0167"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; peptidase
FT                   S14 ClpP; KEGG: tbd:Tbd_0491 transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57238"
FT                   /db_xref="GOA:D2RG13"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG13"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ADB57238.1"
FT                   /translation="MRKTLLVILIFIFAIPQAKALIVEIDIKGEINQGTVELVRQGFDL
FT                   AMRENAQAVLIVLDTPGGLLSSTKEIVSTIMNSGIPVITYVPKGAFSASAGTIILLSGH
FT                   ISAMANGTSLGSATPVGLSEEEKNKTINYVASYLESIAEARGRPKEIVKKFVTEGISLT
FT                   AREAYEKGVIDILADSREELFEKADGWKVDLNGKNVMLHLRGERVVKVSKSLKSEIVGF
FT                   LSNPIVASLLLLIGVYALIIGFSTPGIGLEIVGIVCLILALFGLQVINFDYLGLVLIII
FT                   GAILLILELFVPAHGILAIASIVVIVLGSVMLVKEPLMPEEFYRSFLYLIAGMSIGLAS
FT                   FMSYAVIRIFQTREIRARVGEVVGEIGEIVEFSDGKGFVKVRGEIWRCKSDEELKKGDE
FT                   VVVVRREGLTLWVKRKS"
FT   sig_peptide     142095..142157
FT                   /locus_tag="Arcpr_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.863 at
FT                   residue 21"
FT   gene            143324..143575
FT                   /locus_tag="Arcpr_0168"
FT   CDS_pept        143324..143575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0168"
FT                   /product="Protein of unknown function DUF357"
FT                   /note="PFAM: Protein of unknown function DUF357"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57239"
FT                   /db_xref="InterPro:IPR023140"
FT                   /db_xref="InterPro:IPR036809"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG14"
FT                   /inference="protein motif:PFAM:PF04010"
FT                   /protein_id="ADB57239.1"
FT                   /translation="MGEKEELISETKKWLEQIKERIKKVSACNEKGEEFLRNIKAYISD
FT                   TEYFFEKGDLVRAFECVVWAWAWLEIGLNLGLLIESAD"
FT   gene            complement(143564..145474)
FT                   /locus_tag="Arcpr_0169"
FT   CDS_pept        complement(143564..145474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0169"
FT                   /product="DNA helicase"
FT                   /note="TIGRFAM: DNA helicase; KEGG: nis:NIS_1242 DNA/RNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57240"
FT                   /db_xref="GOA:D2RG15"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG15"
FT                   /inference="protein motif:TFAM:TIGR00376"
FT                   /protein_id="ADB57240.1"
FT                   /translation="MTMLNDFIDKLKELVEIERRAQIEAMLNEIRFLSGEERELRGRAI
FT                   LNLNGKVVGEEFGYKLVKYGRRRKIETNINVGDLVLISRGNPLKSDLVGVVAEKGNRYI
FT                   VVALENVPSWALKDVRIDLYANDVTFRRWIENLENLGNVALKALKFALGLEKPDEPEKA
FT                   YFEPVDERLNESQREAVALALGSNDFFLIHGPFGTGKTRTLAEIVRQEVKRGRKVLATA
FT                   ESNIAVDNLVEQLRDLNIVRLGHPSRTQLKSTTLSAKVVGHERYKDVEELRSRAERLIK
FT                   ARAKFRKPTPALRRGLSDEEILELAEKKRGARGVSWKVIRSMAEWIKLNKLIEELLNKA
FT                   RALEEEIAREVIEEAEVVLATNSTAFTIDINFDVAVIDEATQSTIPSVLIPINKAEKFV
FT                   LAGDHKQLPPTVLKAEELSKTLFEMLIEKYPEHSKMLEIQYRMNEKLMEFPNKEFYGGK
FT                   LKADESVRNITLADLRVESEDEIVNPRNVLIFLDTSKCPDRFERQRKGSTSRENPLEAK
FT                   IVTKIVKKLVRAGVKREWIGVITPYEDQVDLLRRMIDVEVNTVDGYQGREKEVIIISFV
FT                   RSNRRGEIGFLEDLRRLNVALTRAKRKLIMVGDSKTLSTHETYRRLIEFIKREGKFVSI
FT                   C"
FT   gene            complement(145471..146154)
FT                   /locus_tag="Arcpr_0170"
FT   CDS_pept        complement(145471..146154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0170"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: spl:Spea_0941 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57241"
FT                   /db_xref="GOA:D2RG16"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG16"
FT                   /inference="protein motif:TFAM:TIGR00035"
FT                   /protein_id="ADB57241.1"
FT                   /translation="MKTIGLLGGMSWESTLEYYKIINEEVAKRLNGLHSAKIILYSFDF
FT                   SEIAELQSQNRWNELGEILAEKAKILENAGADFILICTNTMHKVADYVQSRINVPLLSI
FT                   IDCVAREVVKRGIKRVGLLGTKFTMEDGFYEDGLRKYGLEVVIPDEEDRNEVHRIIFEE
FT                   LCRGIFKDSSKRKLIEIIERLKMKGAEGVILGCTELPLLVKHAEIPIFDSTKIHAVYAV
FT                   EFALK"
FT   gene            146301..147959
FT                   /locus_tag="Arcpr_0171"
FT   CDS_pept        146301..147959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0171"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: sfu:Sfum_3024 acetolactate synthase,
FT                   large subunit, biosynthetic type"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57242"
FT                   /db_xref="GOA:D2RG17"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG17"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADB57242.1"
FT                   /translation="MRVADAIVKALEKEGVEVAFGIPGGAIMEVYDALYDSNITHILAR
FT                   HEQGAVHMADGYARASGRVGVAFATSGPGATNTVTGIATAYMDSSPLIVFTGQVPRAMI
FT                   GNDAFQEADITGITMPITKHNYLVTDEKEVLKIVKEAFYIASTGRPGPVLIDLPKDVTQ
FT                   ADIDFDYPEKIEIRGYKPKIHGHPNQIKRAVELIMKSERPIILAGGGVRISNAHPEVLE
FT                   LAEKIPAFVVTTLMGKGAIPEEHPLSLGFIGMHGTKYGNLAVMDADLIIAVGCRFSDRT
FT                   VGKFDEFAPNAKIIHIDIDPAEIGKNVRVDVPIVGDAKHVLREIIKFIEFKARKEWFDY
FT                   VNELRRKYPLKYEYREDVIKPQFVIEKVYELFPDAIVTTEVGQNQMWAAQYFKVKYPRQ
FT                   FITSGGLGTMGFGFPAAIGAKVAFPDKVVIDIAGDGSFLMNIQELATAVDYGINVIVCV
FT                   LNNAYLGMVRQWQELFYNKRYSATRLRYPELSFEKIAKGFGAHGITVEKPSEVEDALKE
FT                   ARDVDKPVVIDFHVEVEENVFPFVPPGKSLREVLG"
FT   gene            147956..148444
FT                   /locus_tag="Arcpr_0172"
FT   CDS_pept        147956..148444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0172"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="TIGRFAM: acetolactate synthase, small subunit; PFAM:
FT                   amino acid-binding ACT domain protein; KEGG: sfu:Sfum_3022
FT                   acetolactate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57243"
FT                   /db_xref="GOA:D2RG18"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG18"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADB57243.1"
FT                   /translation="MKKYIAVLVENRPGVLARVASLFRRRGFNIDSLSVGTTERDDISR
FT                   MTIVVNEDEKTVEQVTKQLNKLIEVIKVSDVTENSVHRELALVKVSAPPDRRGEIIEIA
FT                   NIFRARIVDVARDSFIVEITGDEEKINAFIDLMRQYGIKEVARTGVVSMSRGSKVTSI"
FT   gene            148466..149362
FT                   /locus_tag="Arcpr_0173"
FT   CDS_pept        148466..149362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0173"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   gur:Gura_3462 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57244"
FT                   /db_xref="GOA:D2RG19"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG19"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57244.1"
FT                   /translation="MIFGYVPSRRLGKSLGVNNLPEKLCSYSCVYCQIGRTKNLTIERR
FT                   AFYKPEEIRKAVENVLKEKVDYITFVPNGEPTLDINLGRSAEILKDLGKVAVISNSSLI
FT                   WMEDVRHDLSFFDLVSLKLDTTNERLWRRINRPHRDLKLDKILEGMLEFSRNYSGTLIT
FT                   ETMLLDGFEYDFENIANFLRELKPDRAYISIPIRPPAERWVKPANPYVVMKAYEVFSKY
FT                   VKVDLLTDYEDLNFGFSGDAKRDLLSITSVHPLREEAVLEILKKDNADFSVVEELINEG
FT                   KLEVREFGGKRFYVRRR"
FT   gene            complement(149374..150186)
FT                   /locus_tag="Arcpr_0174"
FT   CDS_pept        complement(149374..150186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0174"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; KEGG: saz:Sama_1964 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57245"
FT                   /db_xref="GOA:D2RG20"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG20"
FT                   /inference="protein motif:TFAM:TIGR00417"
FT                   /protein_id="ADB57245.1"
FT                   /translation="MEFVERYNGSGLLIEVEKILYEFKGVQHIQIFQTKSFGKMLVLDG
FT                   KIQLTEKDESFYHEMLVHPAMLMHENPEKVLVIGGGDGGAVREVLKHDPKEVVMVEIDE
FT                   NVVKACKEYIGIDRGALEDPRVKVLFEDGLEFVKSCKDKFDVIIVDGTDPNPISQALIS
FT                   SEFYRDCAKICDYFVTQSQSPFAQPDYFKSIYKNARFKNKAVYLGFVPTYPHGLWSYLI
FT                   ASDRREIVLDLNVIKERFENRKIETVYYTPEVHISAFALPRWIVNLIS"
FT   gene            complement(150200..150580)
FT                   /locus_tag="Arcpr_0175"
FT   CDS_pept        complement(150200..150580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0175"
FT                   /product="putative transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: lip:LI1090 transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57246"
FT                   /db_xref="GOA:D2RG21"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG21"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADB57246.1"
FT                   /translation="MRRFGVSIPEDLAKALDDLAEKLGVSRSEVVREALRTYLAEHTHY
FT                   TVKHRCCGMITVVTRGFKDLTAVEKFKEVVNTFSHIHVEDYCISSFVVYGDSDKIAELH
FT                   KALLRVSENVRFIPLECKVFKL"
FT   gene            complement(150577..151353)
FT                   /locus_tag="Arcpr_0176"
FT   CDS_pept        complement(150577..151353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0176"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: ech:ECH_0517 putative
FT                   cation ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57247"
FT                   /db_xref="GOA:D2RG22"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG22"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADB57247.1"
FT                   /translation="MLEKWFATVVLASAMYGLISPLVYARRLQFLSAASSHTALLAVLL
FT                   SIPLSAYIPSYISAILIGLGLIYSVGYAINRGVEPNTATSILVSFTASTSVLAMYFVIT
FT                   HYEIATDIWAMILGDPLLVTWSDLKFLSTVTIFVILVTVLTYREQFHIGFDRDCAILAG
FT                   INVKLYDLAFYTILGISTVAMLKVVGFVLQHVLILLPCAIAMKFAKGSKGLIVYSVLIS
FT                   VISSIVGLSISLTLNLSPSGVIGLVMLTFYLVGWLK"
FT   sig_peptide     complement(151276..151353)
FT                   /locus_tag="Arcpr_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.881 at
FT                   residue 26"
FT   gene            complement(151326..152195)
FT                   /locus_tag="Arcpr_0177"
FT   CDS_pept        complement(151326..152195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0177"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   btr:Btr_0207 ABC transporter, periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57248"
FT                   /db_xref="GOA:D2RG23"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG23"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADB57248.1"
FT                   /translation="MQIVHIRFAMRALILMIIPLLVCKASALSIVTTFPSLKEDVKLIA
FT                   PNDSIYAIPAFSHDYELTPKDVEVIKNADIVISTAHTHFESEIAEMKERGEVKGVLFEI
FT                   PKIKGIVFLKYPESGKINPHMPIYDPYNYEIFIRALAEELQKLNPSENYIERAEKVCKE
FT                   VEDIVNKARKLNGTALVDYPYAQYAVTWMGLKVVSIAFEAPTTPETFKKVDYLVLTRNS
FT                   TKSESLLENVEYSKVIYIDSPFVEKSIPEKLKSIEVKENIAKKTPGYTAVLAILALVVL
FT                   CLRNGLRL"
FT   sig_peptide     complement(152112..152195)
FT                   /locus_tag="Arcpr_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.707) with cleavage site probability 0.525 at
FT                   residue 28"
FT   gene            152208..152969
FT                   /locus_tag="Arcpr_0178"
FT   CDS_pept        152208..152969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0178"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: nam:NAMH_1772 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57249"
FT                   /db_xref="GOA:D2RG24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG24"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB57249.1"
FT                   /translation="MVCTLEVFDVDVILNGEVILKDLNLRFESGLYQIIGPNGSGKTTL
FT                   LRTILGLIKPVKGRILLNGEDITGKPEKVGYRVGYMPQLSEDVGIPLTAFEIVLDSLLL
FT                   HRKRFPRFAKSSDIKKVEETLKLVHLPREEWNKPFNELSGGERQRVLLARALVYDPEVL
FT                   LLDEPLSAIDPLGKVEFVELIGSLAKDKLVILTSHDPILFLRYTNEIVVLNRTFYRVGK
FT                   PEDVLTVNVLREVYGDSAVKLEEHVHISDAH"
FT   gene            153003..154085
FT                   /locus_tag="Arcpr_0179"
FT   CDS_pept        153003..154085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0179"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: ses:SARI_00484
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57250"
FT                   /db_xref="GOA:D2RG25"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG25"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ADB57250.1"
FT                   /translation="MEFNDYDFFVQHADINLYYATKFKAIDLAFYIVGNDGTDLLLVPD
FT                   MEKERAVRESRVKEIASFGDLGYHDLRKELKDSRKAQAEMLIRLLKTHKARRVGIPTDF
FT                   PAYLAIPLSQAFEVKVVKSPFLKMRAVKTQKEIEYIGDTSKAIISAFEFALKLLRREKS
FT                   CDRIRERIENYLYLKGYLASDTIISSGKLSAIPHASGGIVEDHVVMDIFPRSRKHYYYS
FT                   DFTRTVIVNRNDKIEEMLNAVIEAQEKAISIIREGITAKDVHYTVCDVLESYGYKTLRQ
FT                   KANEGFIHSTGHGVGLEVHEEPRIFENETVLEAGMVFTVEPGLYYKDIGGVRVEDVVVV
FT                   RKNGCEVLTEYPKRIYLNSI"
FT   gene            154239..154856
FT                   /locus_tag="Arcpr_0180"
FT   CDS_pept        154239..154856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0180"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sat:SYN_02143 Zn-dependent hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57251"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG26"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB57251.1"
FT                   /translation="MKPIRIVTPPLGANVYLILDEKIALIDTGGDSAFLIKALQRFINP
FT                   KDLDYIFLTHSHFDHAMAVPDMKKFGCKVVMHSIEFDLLRRGLTTLGYVYYFEPDIFVR
FT                   GGETFELGEIRLEVIHTPGHTAGSVCYYEPDKKWLFSGDTVFKYGFGRYDFPSGNPYDL
FT                   LKSLELLASLDVECLYPGHEDVVEGNAKNYILKNLEVLRSVI"
FT   gene            154853..155557
FT                   /locus_tag="Arcpr_0181"
FT   CDS_pept        154853..155557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0181"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   1; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   sde:Sde_1411 RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57252"
FT                   /db_xref="GOA:D2RG27"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG27"
FT                   /inference="protein motif:TFAM:TIGR00050"
FT                   /protein_id="ADB57252.1"
FT                   /translation="MISVYLVGLKIPENVGFVARVMKNFGFEKLYLYNCKVTTVSFKTA
FT                   SHARDILRNAVVLRKFDDILDHVNMLVGTTGVTAYSYERYIRKPIFTPEEFRNFLEGKK
FT                   GEIAVAFGREDYGLFNEELELCHMLVSVPTNPEYPVMNVSHAVAVILYELSKGKYGLED
FT                   KTIVTAREIEKLVENFEKLMLETWYPRHRIERTKIALRRILGRSLITRRELAVLHGIVT
FT                   KALTYIQHLKKG"
FT   gene            complement(155514..156221)
FT                   /locus_tag="Arcpr_0182"
FT   CDS_pept        complement(155514..156221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57253"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57253.1"
FT                   /translation="MLVERVKSLPFERAEIPFLVRIAEEIEKSRLDLPVLYAGSSDDLE
FT                   HAVILGDRLIFVDSHLPETNLAEIRRKAAKFGNIIKERRVGKLGSGGKHILKFEFLGEE
FT                   IELTYYAEDATELLKNPPKEIKDGLSVYFVKVPLPKEPKVGSLRSPESLAKALKLVALN
FT                   GFYLERECPLCRVLKPEVLGFELIASGYISALSVYNEKGNLYRKVKDVENLEELLKLDL
FT                   SLSSSAECMLKPL"
FT   gene            156269..156667
FT                   /locus_tag="Arcpr_0183"
FT   CDS_pept        156269..156667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57254"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG29"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57254.1"
FT                   /translation="MELTFRDCKIAQKAALDLVKFGRVRIERCYRLRDRFEVVYKLYLD
FT                   VLWADDELIEAIKKYSENFEEDFDDVVRFLKEKNEVLRKILSLLETPKSVEELSSNLDL
FT                   SRDTVSSLLNDLEEAGCVVNVGERFQRT"
FT   gene            complement(156664..157683)
FT                   /locus_tag="Arcpr_0184"
FT   CDS_pept        complement(156664..157683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0184"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   gbm:Gbem_0234 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57255"
FT                   /db_xref="GOA:D2RG30"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG30"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57255.1"
FT                   /translation="MWTVKKIRELFEMDVHELGRIANSMNDNKVMFVINRHINYTNVCV
FT                   SKCPLCAFWKDNGYLMSKEELLQKVDEAVQRGATELHIVGSHNPEVTVEYFEDIFSEIK
FT                   RKYPNVVIKALTATEIHFLAKKEKCNVREILSRLKDAGLQMLPGGGAEILCNDIRRVIC
FT                   PNKAKAEEWLSVMKIAHEMGLKSNATILFGHIEDYRHRAIHLYKLWKLQEKTKGFVSLI
FT                   PLVFHPENTQLKRWGLVKEKTNPIDILKTIAVARIVLSNFKSIRAYWVGLGEKLAQVAL
FT                   NYGANDVDGTIMEEKVTHSAGANSPTYMTVDRIIKLIKGAGKIPVQRDSFCNVMRVFN"
FT   gene            complement(157661..158593)
FT                   /locus_tag="Arcpr_0185"
FT   CDS_pept        complement(157661..158593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0185"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   pol:Bpro_5439 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57256"
FT                   /db_xref="GOA:D2RG31"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026456"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG31"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB57256.1"
FT                   /translation="MKVTIVIPTLNEEESIGNVIDGFKKLGYSDILVIDGNSTDRTREI
FT                   AKEKGARVVIQSGKGKGQAVAEAFHIVDSDVLVLIDGDGTYLPEDVERLLEPIRRGIAD
FT                   HVVGNRFANFEKGAFTRLNLIGNKILNALFRFFYGVDLKDILSGYRALKRDVYKSVELK
FT                   KMGFEIETELTVETLAKGYRIMEVPISYKKRSGKTKLNPLKDGFKIGWTIYNLLIRFSP
FT                   ARFFLLFGIILILLGVLVGFYVVYEWFKHISHDLLAVLTTLLIVSGLQIILFGLISDFV
FT                   LRSNVQLRREIYELRRTLEELKDVDSKKD"
FT   gene            complement(158593..159183)
FT                   /locus_tag="Arcpr_0186"
FT   CDS_pept        complement(158593..159183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0186"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: URA5; One of
FT                   two orotate phosphoribosyltransferase isozymes (see also
FT                   URA10) that catalyze the fifth enzymatic step in de novo
FT                   biosynthesis of pyrimidines, converting orotate into
FT                   orotidine-5'-phosphate; K00762"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57257"
FT                   /db_xref="GOA:D2RG32"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR022854"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG32"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADB57257.1"
FT                   /translation="MKVDDLIERARKLKEKGLTIGEIASELNVSRETAMWLLAKVREDK
FT                   VISDVYVDLRAISNPYRMRNIANAMADMIYETVDKNPDVVVGIATSGIPIATFVAEALD
FT                   ADLSMYYPKKLKWEGEGSRVGGVFSENFAKVDEKNCVIVDNVITTGNTIRETIEQVKNR
FT                   KGSVLCSAVIIDKRGLSEIEGIPLLSLFKIVRI"
FT   gene            complement(159180..159650)
FT                   /locus_tag="Arcpr_0187"
FT   CDS_pept        complement(159180..159650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0187"
FT                   /product="protein; K11883 RNA-binding protein NOB1"
FT                   /note="KEGG: predicted protein; K11883 RNA-binding protein
FT                   NOB1"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57258"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR033411"
FT                   /db_xref="InterPro:IPR039907"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG33"
FT                   /inference="similar to AA sequence:KEGG:OSTLU_41444"
FT                   /protein_id="ADB57258.1"
FT                   /translation="MTIHVIDTSTIFMRKAYYENMVTIPEVVDEIRDENSQFYFSLLNL
FT                   RVEEASNRNVEKVIRVAKKTGDIHKLSNTDIKLIAKALDIKERGEDVILVTDDYSIQNV
FT                   AMSLGLKVDNIVQPKISKRFRWVKVCRGCGRSVDGDICPVCGSEAMIKKVRR"
FT   gene            159711..159935
FT                   /locus_tag="Arcpr_0188"
FT   CDS_pept        159711..159935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57259.1"
FT                   /translation="MKLKDEIIKALEDFFRSAKDYRRVQWELDNIIYPYIGNYIANGYL
FT                   TKEEGKEIFEFCEKKLKELKNQGVQPSSS"
FT   gene            complement(159996..161075)
FT                   /locus_tag="Arcpr_0189"
FT   CDS_pept        complement(159996..161075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0189"
FT                   /product="thiamine biosynthesis/tRNA modification protein
FT                   ThiI"
FT                   /note="TIGRFAM: thiamine biosynthesis/tRNA modification
FT                   protein ThiI; PFAM: thiamine biosynthesis protein; THUMP
FT                   domain protein; ExsB family protein; KEGG: cbc:CbuK_1044
FT                   thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57260"
FT                   /db_xref="GOA:D2RG35"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG35"
FT                   /inference="protein motif:TFAM:TIGR00342"
FT                   /protein_id="ADB57260.1"
FT                   /translation="MLYLIRYSEIFLKSEQVRRRWINKLIRNIRRIVGDCKFRLERGRI
FT                   WLITDRNVDDKLKKVFGIVSFSPCEHCKLDELEDFVLKFCKGKLESVRTFAVRVKRVGE
FT                   HDFTSQDVERRLGALILKNFPHLKVDLENPEKTIYVEIRNEDCYVFDEIIKGVGGIPLG
FT                   VEGKLVSLFSGGIDSPVATWLMMKRGCEVVPIYFDIRPFTSERAIERVEKVAKVLKEYD
FT                   PDFDVIVKEHGNFLMKVKDILKEKRLESYTCIFCKRRMLKVAEEVAKDVGAKGIVTGDS
FT                   LGQVASQTLDNLLVISQACSIPIYRPLIGFDKIEIEEIARKIGTFEYSTIPADCLAVPK
FT                   RPTTKADLEKVLKIEEEFE"
FT   gene            complement(161101..161310)
FT                   /locus_tag="Arcpr_0190"
FT   CDS_pept        complement(161101..161310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0190"
FT                   /product="Transcription factor CBF/NF-Y/histone domain
FT                   protein"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/histone domain
FT                   protein; Histone core domain protein; KEGG: YALI0F25883p;
FT                   K11254 histone H4"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57261"
FT                   /db_xref="GOA:D2RG36"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG36"
FT                   /inference="protein motif:PFAM:PF00808"
FT                   /protein_id="ADB57261.1"
FT                   /translation="MAELPLAPIDRLVRKAGAERVSAEAVEKLREVLEDYAIAVAKKAV
FT                   EVAKHAGRKTVKVDDIKLAVEMTK"
FT   gene            complement(161477..162265)
FT                   /locus_tag="Arcpr_0191"
FT   CDS_pept        complement(161477..162265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0191"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="KEGG: gbm:Gbem_4053 dihydrodipicolinate reductase;
FT                   TIGRFAM: dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57262"
FT                   /db_xref="GOA:D2RG37"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG37"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ADB57262.1"
FT                   /translation="MIKVAVAGAAGRMGRLIVKNVIEDEELELAQAFDVREIGKDAGEI
FT                   ASVGRIGVQITDAREMENVLNADVLVDFTVAEGAVENIRIASDKGVKLVVGTTGFTEEH
FT                   WQRIREYCKRVPAVISPNFSVGVNIFWKLVEFASKFLKDYDIEILEIHHRFKKDAPSGT
FT                   ALKTAEIVQSVIGKRKIVFGRGGICPRGEEIGVLAIRGGDVVGEHTTFFIGMGERIEIT
FT                   HRAWSRQAFASGAIRAIKWVSKVDKPGIYDMDHVLGFKQV"
FT   gene            complement(162359..162431)
FT                   /locus_tag="Arcpr_R0006"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(162359..162431)
FT                   /locus_tag="Arcpr_R0006"
FT                   /product="tRNA-Gln"
FT   gene            162522..163886
FT                   /locus_tag="Arcpr_0192"
FT   CDS_pept        162522..163886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0192"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   abb:ABBFA_002410 inner membrane protein YicO"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57263"
FT                   /db_xref="GOA:D2RG38"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG38"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADB57263.1"
FT                   /translation="MGWIEEYFEFSKYKTNMKTEILAGLTTFMTMAYIIFVNPSILSVA
FT                   IGKEAVPSLVTATALSAGIATLIMGIYAKKPFALAPGMGLNAYFTYGVCLGMGYPWQVA
FT                   LAAVFVEGLIFIVLSITKVRSAVINAIPLSQKYALGAGIGLFLTLIGLREAGIVTVSVT
FT                   NPNASVPGMLSPVDWLPTLNTAFFKLPEFWLAVFGVFLASALMVRRVPGALLISILTVT
FT                   GISVALGLTPPPKSIFSLPTLDYTFMKLDLRGLLNVGAIGVIFAFFMVDFFDTLGTVAG
FT                   LSAKAGFINEKGEIPDSEKILLTDAVGTTLGAIFGTSTVTTYIESAAGIEEGGRTGFVA
FT                   VVVGLLFLAIGLFVSPIAEIIPSFATAPALIVVGFLMLNVLSNLDFSDFTEALPAFFVL
FT                   ATIPFTYSIADGIGVGFISYCILKLVAGRAREVHPLLWILAGVFVVYFLYLGGLI"
FT   gene            complement(163921..164643)
FT                   /locus_tag="Arcpr_0193"
FT   CDS_pept        complement(163921..164643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57264"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG39"
FT                   /inference="similar to AA sequence:KEGG:Sfum_1100"
FT                   /protein_id="ADB57264.1"
FT                   /translation="MLTAKVEGWIKKFVEGEFWREPLVSFCSADTTEKLPKIVPNHLTA
FT                   EDLLPKAKSVIVYFIPFTKEVVKSNISGVKPSKLWALAYIETNRLIESLNHYLDKKLEA
FT                   EGFGSAVIKPTHNFDERTLLSMWSHKHIAYLAGLGTFGLHTMIITKKGCCGRLGSLVTT
FT                   AELDCSEPIKEEFCLYKRGRKCLECVDKCSFGALKATGLDKRRCYEILMDNTKLFDFGF
FT                   ADVCGKCACGVPCSLKKP"
FT   gene            164683..165912
FT                   /locus_tag="Arcpr_0194"
FT   CDS_pept        164683..165912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0194"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: amf:AMF_448 enolase 1 (2-phosphoglycerate
FT                   dehydratase 1) (eno); TIGRFAM: enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57265"
FT                   /db_xref="GOA:D2RG40"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG40"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ADB57265.1"
FT                   /translation="MQEELSDMIIEDVIFRIVFDSRGNETVECEVYAGDVVGRAIAPSG
FT                   ASTGTHEAVVVDPYKIDEIEEKISKALIGYSVFDQVAIDEKLREIDGTENFSNIGGNFA
FT                   IATSLAVAKAGAELLGMPLYEYLGGIFAKELPYPLGNVIGGGKHAEGSTNIQEFLVIPV
FT                   GADNFFTAQRTNAMVHKTLKKLFKKKGIFACKGDEGAWACQITDNDAFEILSEAIGIVK
FT                   DETGVDVRIGIDVAATELWNGEYYVYKDRKLTTEEQISYIAELVDRYNLLYVEDPLHEE
FT                   DFEGFAELTKEVGNRCMICGDDLFVTNINRIQKGIELKSANTVLIKPNQIGTLTDTFKA
FT                   VKIAKDNGWYVVVSHRSGETEDNTIAHLSVAFNAKLIKTGVVGGERTAKLNELIRIEED
FT                   GLNMTKLPFC"
FT   gene            165942..166208
FT                   /locus_tag="Arcpr_0195"
FT   CDS_pept        165942..166208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57266"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57266.1"
FT                   /translation="MKYRIVRIELKDEEVVIYFKKLRSQATVMPRIDSPEKMLEFSMQM
FT                   GMNLAKKVEEAFSFDGFITLEYETYCTLDLKVGDIVEVEIKPA"
FT   gene            166210..167289
FT                   /locus_tag="Arcpr_0196"
FT   CDS_pept        166210..167289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0196"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mrd:Mrad2831_3675 radical SAM domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57267"
FT                   /db_xref="GOA:D2RG42"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG42"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57267.1"
FT                   /translation="MELAINPSKIISPLCYSVLRLEPYTNCAYSCLYCYARWYRGGRIK
FT                   PRPRAIGMFAKIAKKLDLKIPFRLATLSDPLQDIEENAKVSYKLMRIAKENEIPIILST
FT                   KSDRIAKNPWKSLIEEMAKDGLVVVQVSISSLERNDLEPRAPHPQNRIEALEIIDAPKI
FT                   LRLQPLIPNYSFRNAEEFVERVKDVADQITTEPLRIEKGEIEFYNKFWSRWTHYSFEGE
FT                   LLKADCYEILEELSVACRKYGLDFGLCKEGYFHLETANCCGLHMIECKLRPTLREVYKI
FT                   LLERKEIDVNDLKFEGYLFGERLSELPRAIRKALRFHEKLFLKCLRDNSCLSHLTPLIR
FT                   FEDGKLKLISSDQNQPSEL"
FT   gene            complement(167255..168484)
FT                   /locus_tag="Arcpr_0197"
FT   CDS_pept        complement(167255..168484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0197"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: psp:PSPPH_0963
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57268"
FT                   /db_xref="GOA:D2RG43"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG43"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ADB57268.1"
FT                   /translation="MKIAIVGAGLTGLSCALELRDYNPTIFECHDVGGLLASYGRKGYR
FT                   IEKFYHHFFRWDHDLLNMIKRLGLSSKVVWKIAKTGFAIDGKIYPLNTPLEILRYPHLS
FT                   LMDKIRLARFTLKSRKRDYTIEDDRGVVEGIREELGENLLQKFFMPLLKAKFGENYERV
FT                   SYAWLLARVAIRSNRKLSGEELGYLRRGFWQLVDRMAEGLNIIRKPVENIGYFNKKYHI
FT                   HGMEFDAVVWTAPLPLLDPKIANNLNLPSISYQSSICALVGCEKPLSDLYWINVDNAIF
FT                   GAVIEHTNFMPFEDYGEHLIYLASYTTPDSELFRMSEKNLANLYLKDLERLGMKRRDVK
FT                   WIKIFKAKYSAPIYEKGYLKKIVPYRTNLKGFYLAGMFSKPNYPERSMNGSIKAGIEVA
FT                   KALKADFDLS"
FT   gene            168569..168946
FT                   /locus_tag="Arcpr_0198"
FT   CDS_pept        168569..168946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0198"
FT                   /product="Fe-S cluster domain protein"
FT                   /note="PFAM: Fe-S cluster domain protein; KEGG:
FT                   tau:Tola_2331 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57269"
FT                   /db_xref="GOA:D2RG44"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG44"
FT                   /inference="protein motif:PFAM:PF04060"
FT                   /protein_id="ADB57269.1"
FT                   /translation="MNGWGRCRRRGWGRGRGWCGGGKGRRAGWGRRWGMSFGMGISSGL
FT                   SQIISKPISAIRSLLAREPPEVIEKAQNIYALLPKRDCGACGYDNCYQCALAIAKGEAP
FT                   PDACRVVGRKIKDVVEEILRG"
FT   gene            168953..169207
FT                   /locus_tag="Arcpr_0199"
FT   CDS_pept        168953..169207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57270"
FT                   /db_xref="InterPro:IPR035205"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57270.1"
FT                   /translation="MWWRWRRYPGHGPWSDLPPWERPGWKFGRGRGWCWWYMSRYLEDI
FT                   PEYAPSKEEEIRMLEDYARYLEQELERIKRRIRELKGSE"
FT   gene            complement(169218..169868)
FT                   /locus_tag="Arcpr_0200"
FT   CDS_pept        complement(169218..169868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0200"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: spe:Spro_3199 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57271"
FT                   /db_xref="GOA:D2RG46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG46"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB57271.1"
FT                   /translation="MLKTEDLKAFYGKAQILNGVNAEVNRGEAVAILGPNGAGKTTLIR
FT                   AILGLVETEGKVFFNGTDISSLKPHERVRLGIGVCPEGRGLFPNMTVEENLLLAGDDLD
FT                   LAYSLFPKLKNRRNQLVKQMSGGEQQMVAIARALISKPKVLILDEPSMGLAPKVLKEIA
FT                   GVLKEIKREVSILIVEQNVKFAMSFADRGYVLVKGSIVKEFESKEEIEKLYFT"
FT   gene            complement(169861..170529)
FT                   /locus_tag="Arcpr_0201"
FT   CDS_pept        complement(169861..170529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0201"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: oan:Oant_4421 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57272"
FT                   /db_xref="GOA:D2RG47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG47"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB57272.1"
FT                   /translation="MLEVEGVTKRFGALVALDNVSFKVNGKRLGIIGPNGAGKTTLFNV
FT                   ISGFLKPNSGKIWFNGKDITGLRPSKIAEMGLVRTFQLLKVFKSLTVQENLSIVSDDSR
FT                   DLLELVGLWEKRNIVAGNLSQGEMRKLGIALALAKKPKMLLLDEPFSGLSPVECESLIE
FT                   VLKDVKTPMVLIEHKLGELFDLVDRVVVLNFGRVIFEGKPEEAVRNSRVVEAYIGEDYA
FT                   "
FT   gene            170584..171822
FT                   /locus_tag="Arcpr_0202"
FT   CDS_pept        170584..171822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0202"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bja:blr6446 ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57273"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG48"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADB57273.1"
FT                   /translation="MRKLLTAIVLVCALMMLGCSQKTPSETPAETTAEAEVIKIGVIGP
FT                   METKFGKAMVNGAQLAVDEINAQGGIDGKRLVIVQADGKLKPDVTGKELRRLAYDENVN
FT                   VIIGGFSSGIVIANMDTIAEIKKVWIVECASPTVTKKIAEDYDSYKYIFRLEANSSTDV
FT                   PFLLEGMNYVREKIPMKRVAIVRDQAKWVEDVDQQLKNALIENGYEVVDDIAIPPQKTD
FT                   FDDVFTRVKNERADVIVAMIAHGNAVNFIKQWKDSVNIPVIGLILPAIDPNFWNETNGK
FT                   CDKLLVLAPSSQVPIPINENMKNFLKNYKSKYGHLPEAYTAYESYEAVYVFKKAYEMAK
FT                   ANGEDPNDSDILVKYLEKINAQNPLQGVRGKIAFTKYHDIIVAKGYIVNLIIQWQNGKM
FT                   VAIYPIKTGELVW"
FT   sig_peptide     170584..170649
FT                   /locus_tag="Arcpr_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.643 at
FT                   residue 22"
FT   gene            171854..172693
FT                   /locus_tag="Arcpr_0203"
FT   CDS_pept        171854..172693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0203"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dal:Dalk_3102 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57274"
FT                   /db_xref="GOA:D2RG49"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG49"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADB57274.1"
FT                   /translation="MILPILIIGTILGGILTLVACGFTLTFGVGRIFNFAHGTFFAISA
FT                   YTAYALFPYLGYSSLLIGVLASALFGLAMHYLIKPIRRNEIMVILLTLSLALLVEQIIL
FT                   MIFGVDAISIAPIIKGSINLFGVEVTNVKILSFAITIASMIALERLIKKTRLGREISAV
FT                   SQDVESAMIVGIDIERVFMFTLLISSILAGIGGILYAQIYSLTPNSALEILLLAFAIVV
FT                   VGGLGSVNGSVVSAFIISYIKTAVSVLLGTRWSELAVLIVIIAILIVRPQGLFGVEE"
FT   sig_peptide     171854..171922
FT                   /locus_tag="Arcpr_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.399 at
FT                   residue 23"
FT   gene            172690..173619
FT                   /locus_tag="Arcpr_0204"
FT   CDS_pept        172690..173619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0204"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dal:Dalk_3103 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57275"
FT                   /db_xref="GOA:D2RG50"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG50"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADB57275.1"
FT                   /translation="MRRGLILALTAIPLIFPFVLPKSVVFMLGLAYLFVVYVVTWDLVA
FT                   GYVGEVNLGHVVFIGLGAYTSALLVLNQNVPVPISILVGAVVATLFGLGVGAVCLRLKG
FT                   YYLALVTAILPLVFVQIVNIYPQIFGGYEGLSVGIKNALHRTTEGRYYIAYAFMLASVL
FT                   VLYRVVNSKFGLRLKAIRDDPELAESLGINVFKHKVMAFCISAFVSGLAGAITAFYRLS
FT                   VGVDMFGVPLMLLIIISAVFGGLGTFFGAIIGALTIYILKNWILMEVSYSTGIMGLDNL
FT                   IIYAMLIVLILKMPHGIFGLVKRFKEKD"
FT   gene            complement(173616..174371)
FT                   /locus_tag="Arcpr_0205"
FT   CDS_pept        complement(173616..174371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0205"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: tryptophan synthase, alpha subunit, putative;
FT                   K01695 tryptophan synthase alpha chain; TIGRFAM: tryptophan
FT                   synthase, alpha subunit; PFAM: tryptophan synthase alpha
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57276"
FT                   /db_xref="GOA:D2RG51"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG51"
FT                   /inference="protein motif:TFAM:TIGR00262"
FT                   /protein_id="ADB57276.1"
FT                   /translation="MIQKPSLITYITAGDPNVDATLEFLEILSKYSEIIELGIPFSDPM
FT                   ADGKTIEKSHYRALKAGTKVKDVFRVIEEFKDNHRTPIVLMTYYNPVFVRGLDNFIGTA
FT                   KDSGVDAMLVVDLPIEEADDYLSVCEKYDMKTVFLASPNTPNDRLKAIDEASSGFVYLI
FT                   SLYGTTGARDRISSLAFDLVKRARGVCVKPLAVGFGVSKAEHVRELLKAGADGVVVGSA
FT                   IVKLIEEFGEKAGDKIEEKCRELRKGLYY"
FT   gene            complement(174368..175531)
FT                   /locus_tag="Arcpr_0206"
FT   CDS_pept        complement(174368..175531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0206"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /note="TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: tgr:Tgr7_1253 tryptophan synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57277"
FT                   /db_xref="GOA:D2RG52"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG52"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ADB57277.1"
FT                   /translation="MKFGEFGGMFVAETLVQPLKELEKAYNELKDDETFKAELDYYLKN
FT                   FAGRPTPLYYAKNLTEKIGGAKIYLKREDLLHSGAHKINNTIGQALLAKYMGKSRLIAE
FT                   TGAGQHGVATAIAGALLGLKVDVYMGAEDVERQKMNVFRMKILGANVIPVESGTKTLKD
FT                   AINEALRDWVATFEYTHYLIGSVVGPHPYPTIVRDFQSVIGKETKKQILEIEGCLPDII
FT                   VACVGGGSNAMGIFHPFIEDRKVRLVGVEAGGNGIETGKHSASLCAGKKGVLHGMLSYF
FT                   LQDEDGQILDTHSVAPGLDYPGVGPEHAYLKEIGRAEYVTVTDDEALKAFLELSRTEGI
FT                   LPALESAHALAYAMKIAEEMSRDEIIVVNLSGRGDKDLDIVMREVGF"
FT   gene            complement(175528..175902)
FT                   /locus_tag="Arcpr_0207"
FT   CDS_pept        complement(175528..175902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57278"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG53"
FT                   /inference="similar to AA sequence:KEGG:WS1407"
FT                   /protein_id="ADB57278.1"
FT                   /translation="MIEFVGEEIEIHPERFAVVKLRSLPDVNYVAVVRNKYYEVVMPEK
FT                   ELVKLEKFVECETGYRLITLDINVPLDVVGYISKVSSALANAKVPILILSLYTDRILVK
FT                   EEFLDKALSVLKELGFKVRR"
FT   gene            complement(175907..176263)
FT                   /locus_tag="Arcpr_0208"
FT   CDS_pept        complement(175907..176263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: wsu:WS1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57279"
FT                   /db_xref="InterPro:IPR016540"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG54"
FT                   /inference="similar to AA sequence:KEGG:WS1407"
FT                   /protein_id="ADB57279.1"
FT                   /translation="MKAKLHPEKFAVVKTDEIPKDFFAIVKLSEITAVVPEGALTNLKV
FT                   KEAEYGFRLITFDVDLSFDTVGFISKISRALAEANIPILVYSSYHTDHILIKEDFVEGA
FT                   IETLRNIGFLIEEG"
FT   gene            complement(176253..176876)
FT                   /locus_tag="Arcpr_0209"
FT   CDS_pept        complement(176253..176876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0209"
FT                   /product="Phosphoribosylanthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="PFAM: N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI); KEGG: gsu:GSU2378 N-(5'-phosphoribosyl)anthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57280"
FT                   /db_xref="GOA:D2RG55"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG55"
FT                   /inference="protein motif:PRIAM:5.3.1.24"
FT                   /protein_id="ADB57280.1"
FT                   /translation="MFVKICGIKSLEELEIVEKYANATGVVVECESKRRITLEKAREII
FT                   ECANIPVFVVSTLTDLNAWMRVIEKTQAEYIQIHAEVSPDLVGKVKELDIKVMKAFRVP
FT                   RLSENPERDAKSLIEKIELYDVDLILLDTGKGSGLIHDHRVSRIVAKEFDIILAGGLNP
FT                   QNVAKIVEFVKPFGVDVSSGVEKNGRKDEKLVTDFVREVRRFES"
FT   gene            complement(176866..177438)
FT                   /locus_tag="Arcpr_0210"
FT   CDS_pept        complement(176866..177438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0210"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   efe:EFER_3333 aminodeoxychorismate synthase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57281"
FT                   /db_xref="GOA:D2RG56"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG56"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADB57281.1"
FT                   /translation="MIVLIDNRDSFVWNLAEYASIFTKVKVLPNTVSLAEIKKLNPKGI
FT                   IISPGPSSPDSKRDVGISPKVVLEIDVPILGVCLGHQIIAHVFGGVVNRVKPMHGKSSV
FT                   IKHDGEGIFKGVKNPIEVGRYHSLAVLKVPKGFKVTAKVIDDDLVMGIRSRDERIEGVQ
FT                   FHPESVLTPREEGLKMIRNFVEMCHVR"
FT   gene            complement(177435..178739)
FT                   /locus_tag="Arcpr_0211"
FT   CDS_pept        complement(177435..178739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0211"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: geo:Geob_3440 anthranilate synthase component
FT                   I; TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57282"
FT                   /db_xref="GOA:D2RG57"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010116"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG57"
FT                   /inference="protein motif:TFAM:TIGR01820"
FT                   /protein_id="ADB57282.1"
FT                   /translation="MLVKKLDYVNPLKLYNVLRDEDFPFILESAGKHERKARYTYVSAN
FT                   PDFIVEVDGKGTRVDGKLISKETNPFKALKGLRVRSVDGQRFNGGFVGYIAYDAVHNYI
FT                   EGEIEEPSVFGFYSNVFVYDHISGIFYFLSLNKDDEKAKEAERIVRKAKRTKVENEEGF
FT                   SDVIRCDADKDTFVEMVERAKEYVYSGDVFQVVISREYEVDTDFSPFQIYRNLRKINPS
FT                   PYMFCLEFGKAVVGASPETMCSVEKNVVKVNPIAGTAPRGRSEEEDRAIAERLLADEKE
FT                   RAEHVMLVDLARNDVRKVSKAGSVRVTMFMKVLKYSHVQHIESEVVGELESDMFEAVEA
FT                   CFPAGTLTGAPKIRAMEIIDELEKSKRKVYGGCVGYFSVSGYADMAIAIRMVEIDDVCR
FT                   VRAGAGIVADSNPEKEFFETGNKMSAVLKALRVVE"
FT   gene            complement(178712..179686)
FT                   /locus_tag="Arcpr_0212"
FT   CDS_pept        complement(178712..179686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0212"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: cps:CPS_3524 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57283"
FT                   /db_xref="GOA:D2RG58"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG58"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ADB57283.1"
FT                   /translation="MLEKIVEGKNLSFEEAYEIFNQLIEETPIRIAGILTALQTKGYTA
FT                   EELAGFAKAMRDKAVKLDLGDVIDTCGTGGDRSFTINVSTASAIILSCFTRVAKHGNVS
FT                   ITSKSGSANLLEALGINYRLNPDQAKALIEKTNFTFLFAPLYHPTLKGVMPVRKELGIK
FT                   TIFNVLGPLANPANPSYQIIGVSSPDLVDKVANALEFLGVERAYVVYGDGLDEVNPKGE
FT                   TVVVEVNEGIEKFKLEPEDFGLKPVDIKPCHSPEESAERIRAVLAGKGKEEDRNFVLIN
FT                   SALALNLLKDDLRECVEVIEGVLGEIAIKKLEEIVCSSRSLTT"
FT   gene            complement(179679..180362)
FT                   /locus_tag="Arcpr_0213"
FT   CDS_pept        complement(179679..180362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0213"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   sat:SYN_02591 indole-3-glycerol phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57284"
FT                   /db_xref="GOA:D2RG59"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG59"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADB57284.1"
FT                   /translation="MFRLSKSIRLTEKNGKNAVIAEIKVHSPKHGDLLRGRDPIDILRA
FT                   YERSGACGISYITEPNHFRGSFKFLKELCKLTDLPVLRKDFITNKFEIEKTAEVEASAV
FT                   LLITRILKDRTAEFVDFAKEHGLDTVVEVHTPQELEIAINTDTTIVGINNRDIGQLEKD
FT                   DGNVSLTEKLAPLIPNKFVKLSESGIRSLDDLKRALRFADAVLIGTAFMLAEDTESFVR
FT                   CFVHA"
FT   gene            complement(180473..182176)
FT                   /locus_tag="Arcpr_0214"
FT   CDS_pept        complement(180473..182176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0214"
FT                   /product="glycyl-tRNA synthetase"
FT                   /note="TIGRFAM: glycyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; KEGG: glyS; glycine-tRNA ligase; K01880 glycyl-
FT                   tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57285"
FT                   /db_xref="GOA:D2RG60"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022960"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG60"
FT                   /inference="protein motif:TFAM:TIGR00389"
FT                   /protein_id="ADB57285.1"
FT                   /translation="MSELMEMLTRRGFFWQSFEIYGGMAGFVDYGPLGNALRRKIENIW
FT                   RKHFVVRERAVEIDTPTVCVEEVFVASGHVSCFTDVAIECESCGRVFRADHYIKDVLGI
FT                   EIEPNIETVKEIIETYDLKCSCGGKFKEPFLFNLMFSTTIGPGKGKKGYLRPETAQGIF
FT                   IDFRRLLEYFRHKLPFGVAQIGRAYRNEISPRQGVIRLREFNQAELEYFVNPREKRHPN
FT                   FARYANVVVKLLDKNDVLHEVTLKEAVEKGIVCHELMAYFIGKTREFLLEVGIDEAKLR
FT                   FRQHKDDERAHYAIDCWDAEVLTAYGWIEIVGIADRTDYDLKKHMEHSGEDLRVFVQFE
FT                   KPIKVKRKKVIPNMKKLGPVYRQKAKEIAKKLEEIEVDGDVESITIDLDGEKIEITKDF
FT                   FEIVEVEEEIHGEKIVPHVIEPSFGLDRITYAVLEHSFDKDVVEGEERRVLRLKRWVAP
FT                   IPVAVLPLLSREPFTSKAKEIVQMLRENGFYTEYDDSGSIGRRYRRFDEIGTPFCITID
FT                   HQTFEDETVTIRDRDTTKQVRVKISELPKVLNELLTSDKDITEFGEIFKE"
FT   gene            182414..183580
FT                   /locus_tag="Arcpr_0215"
FT   CDS_pept        182414..183580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0215"
FT                   /product="Protein of unknown function DUF650"
FT                   /note="PFAM: Protein of unknown function DUF650; Protein of
FT                   unknown function DUF651"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57286"
FT                   /db_xref="GOA:D2RG61"
FT                   /db_xref="InterPro:IPR006978"
FT                   /db_xref="InterPro:IPR006979"
FT                   /db_xref="InterPro:IPR033167"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG61"
FT                   /inference="protein motif:PFAM:PF04894"
FT                   /protein_id="ADB57286.1"
FT                   /translation="MKCAICKGYRLLCGRNFCPILRKVRIIKSVFSDLKLDKVVFGSSP
FT                   PSIFVGEKGYPKVRVAPLVPPIEGDTSSLDSPLKWEDVTLEDAIKRRAVLVMGERVCNV
FT                   KTSLDFDGLVMSVKPVDAEMVLSKKPVLKIDLSEISAVVNPKAELEKLKVVGNPRVPKA
FT                   VDKIVGDEIKAQKAMVDLYERGFDEYYIIRLLSAGLLGIDKKLVPTRWSITAVEDTIGE
FT                   HLKREIVNYKPIDRYEVYRAEFLGNVYTILMIPSAYAFELLEVWLPKSLFGFSGVLRDY
FT                   EFFKKRGYANETLGAYYSARLSVLEFLRKKRRQAKVVVFREVTEEYYAPIGSWQIRVGV
FT                   RKALKNKVGTFDDLSSALSFLRNLLRHRLEDYLRRDVVLKARTIDSYF"
FT   gene            183614..184096
FT                   /locus_tag="Arcpr_0216"
FT   CDS_pept        183614..184096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0216"
FT                   /product="protein of unknown function DUF265"
FT                   /note="PFAM: protein of unknown function DUF265; KEGG:
FT                   GE22362 gene product from transcript GE22362- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57287"
FT                   /db_xref="GOA:D2RG62"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG62"
FT                   /inference="protein motif:PFAM:PF03266"
FT                   /protein_id="ADB57287.1"
FT                   /translation="MTGRPGIGKTTLCMKVFKSLDDVEGFVTLEVREKGRRIGFKLHDL
FT                   KSGEELWLAKVGEGYPKVGKYVVFLESIDRFAEMLKGYSGNLVIVDEVGPMELKSERFV
FT                   RAMEDLIESPKNLLVTVHYRSRHPLVERIKREFELYVIDEKNRDEVAREIIRRFRG"
FT   gene            184093..185139
FT                   /locus_tag="Arcpr_0217"
FT   CDS_pept        184093..185139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0217"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase"
FT                   /note="KEGG: similar to ENSANGP00000010185; TIGRFAM:
FT                   N2,N2-dimethylguanosine tRNA methyltransferase; PFAM:
FT                   N2N2-dimethylguanosine tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57288"
FT                   /db_xref="GOA:D2RG63"
FT                   /db_xref="InterPro:IPR002905"
FT                   /db_xref="InterPro:IPR022923"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042296"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG63"
FT                   /inference="protein motif:TFAM:TIGR00308"
FT                   /protein_id="ADB57288.1"
FT                   /translation="MIVEEGKVKIKLDRDVFYNPRMRFCRDLDVLVWRVLDDKREFLDA
FT                   LAGTGVRGIRAKVEGGYDVVYFNDRNPKAVELIKENMKLNGIEAEVFNKDANILMREKK
FT                   FWHIDLDPFGSPAEFMDSASFSVKKYLSVTATDTAAFCGSATESGLRKYFVFAEMTDIY
FT                   PEIGLRALIGYVARELAKYEKGIEVLVCWTKEHYYRIHLKVRKSLRASKDTVKKLGYML
FT                   YCPNCMNRDFVGVGECFERCECGGRFRIYGPIWLGDVKDAEIVRKMLEYAKGKAEKFVK
FT                   AIAEELNTPLAYNIHALSKKLKINPPKMEKILTDLRENGFTASRVHYSGTVLKTNAKIV
FT                   DLISLLNS"
FT   gene            complement(185122..185307)
FT                   /locus_tag="Arcpr_0218"
FT   CDS_pept        complement(185122..185307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57289"
FT                   /db_xref="InterPro:IPR035258"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57289.1"
FT                   /translation="MGKTGSVTWVKIKKRNSNEYRLVPTKWQYYKKPGPNQKYTSDGKK
FT                   RRRIKRSPKSILGVKQ"
FT   gene            185488..185634
FT                   /locus_tag="Arcpr_0219"
FT   CDS_pept        185488..185634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57290"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57290.1"
FT                   /translation="MIIMSYQIKTTDEFEEQFKKLTRKNKALAEMFAKAILKLKENPML
FT                   VSL"
FT   gene            complement(185730..185924)
FT                   /locus_tag="Arcpr_0220"
FT   CDS_pept        complement(185730..185924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57291.1"
FT                   /translation="MIKQEILKDLIEIKEKLDSIIETLEIISDEELMESIKRAREQPPK
FT                   RDFEDFLREIGIDSLSMSD"
FT   gene            186243..188228
FT                   /locus_tag="Arcpr_0221"
FT   CDS_pept        186243..188228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0221"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein; KEGG: slo:Shew_1573
FT                   methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57292"
FT                   /db_xref="GOA:D2RG67"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG67"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADB57292.1"
FT                   /translation="MKLVTCGLPYANGKAHIGHLRTYIPADVYVRYLRLLGEKVLFICG
FT                   SDCHGTPIVVNAEKEGISPKELVDRYHEHFQKVFKELEVEFDFYGRTDAEYNHRRTQEI
FT                   VKTLMDKGYIYAKEIELAYCPKCDRFLPDRYVEGICPYCGAVARGDECDQGCGRHLEPG
FT                   EILQPKCKICGSPAVFKKQKHYFFKLTAFKDFLMDYLENKLQGTSNALNYAREWVRREL
FT                   KDWCITRNLEWGVKFPGENLVVYVWVDAPIGYISFTEQACKLKGCNWEDIWKNGEISDI
FT                   THFIGLDIVYHHCIFWPAMLKGADYSLPKAVVASGMVKVEGKTFSKSRGYVVWVEDDYL
FT                   KAGFHPDYLRYYIVSYTSHEKDLNFSWRVFKDKVNNELIGTFGNFIYRVLHFAWKNFGR
FT                   VRMNVDKETLEKISNVKDKIVESLKVWEFKEICDAFMELATFGNEFFQSKKPWELIKTN
FT                   REECERVLANAIQLVKALLIFAYPVMPKSMENVAKVINLDLKNARLDDALKVDDVVELS
FT                   KPKIPFEKVEDKKIEEMERIMIERIRRAESGEKEKEEELVDIKDFTKLDIRIGKIIKAE
FT                   RIKGSKKLLRLEVDIGGEIRQIVAGIAETYSPEDLIGKLVPVLVNIKPAKLMGVESRGM
FT                   ILAVDVDGKAVLLQPEKDVPVGSKIR"
FT   gene            188225..188764
FT                   /locus_tag="Arcpr_0222"
FT   CDS_pept        188225..188764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0222"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57293"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG68"
FT                   /inference="protein motif:PFAM:PF04266"
FT                   /protein_id="ADB57293.1"
FT                   /translation="MKHLEFKDKYKELLLSGRKRATIRLQCYVKEGDEVFVHCGGKIIG
FT                   TAKIKKVEERSLEEIDDELAKADGFNSKEELINEIKKLYGCPKKVYVIWFDFKPFKNEI
FT                   DPHEMYYSDADLVEVAKKALENLSLSEGDKRILELFIKTQSIRKTAMKLGGIKKRGVVR
FT                   KVLRKCLNELRKRGLI"
FT   gene            complement(188765..190975)
FT                   /locus_tag="Arcpr_0223"
FT   CDS_pept        complement(188765..190975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0223"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; ERCC4 domain protein; helix-
FT                   hairpin-helix motif; type III restriction protein res
FT                   subunit; SMART: DEAD-like helicase; helicase domain
FT                   protein; Helix-hairpin-helix DNA-binding class 1; KEGG:
FT                   hypothetical protein; K10896 fanconi anemia group M
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57294"
FT                   /db_xref="GOA:D2RG69"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="InterPro:IPR041755"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG69"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADB57294.1"
FT                   /translation="MEYVHHPLIRENTIERRSYQIAITATALMRNTLVVLPTGLGKTVI
FT                   ALLVIASRLHNKGGKALVLAPTKPLVEQHANFFRKTLKIPSNEIVALSGEVPPDKRYQL
FT                   WNKAKVVVSTPQVIENDLISGRISLEDVVHVTFDEAHRAVGNYSYVFIAKAYMEQAKDP
FT                   LILAITASPGSDIERIEEVIKNLYIEDVEVRTELDEDVKPYIHERAIEWVRVEMPKELK
FT                   EVRDLLNECVELRLMRLEGLGVKARGLSKKELLALQEALQSEAYESGDQRLFEALSVLA
FT                   EILKIHHAIELIETQGLDALKHYLRRIVVEAKSRGGSRASKSIIADPKFKKAVVKALKC
FT                   EVDHPKLEKLKEIVSSQLKEKPESRIIVFTNFRDTAEVISRELQSMGVPAVRFVGQANR
FT                   ENDRGLRQREQVEIVERFRAGDIKVLVATSVGEEGLDIPEVDLVVFYEAIPSEIRSIQR
FT                   KGRTGRKKEGRIVVLVTKGTRDEAYFYISLRKERAMFERLRDLKFMLKRTQKSLEEFKV
FT                   GNLKDVTVYVDSREMRSEVVKKLYEKANVRVGNFNADYVVSDRVAIERKTADDFVDSII
FT                   DRRLFDQLIELKKHYLKPVLIVEGDGIYRRLNPNAIRGALATVIVDFGIPVIFTKSPEE
FT                   TAEFIVSLARREQLAKDREVSPHYGKTKMTLKEQMEYVVSSISDIGPVIARNLLEHFQT
FT                   IENIAKASVEDLMKVPKVGKKTAEKIVRIMKTPYSEADKFVE"
FT   gene            191022..191489
FT                   /locus_tag="Arcpr_0224"
FT   CDS_pept        191022..191489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0224"
FT                   /product="MGS domain protein"
FT                   /note="PFAM: MGS domain protein; KEGG: hypothetical
FT                   protein; K00602 phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase / IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57295"
FT                   /db_xref="GOA:D2RG70"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG70"
FT                   /inference="protein motif:PFAM:PF02142"
FT                   /protein_id="ADB57295.1"
FT                   /translation="MNVLISVSRKDKLERFAKALVNLGYTLYATEGTAKFLENCGIPVR
FT                   RLSEITHLSESEDLKTLHPEVFKRIYGGFFSLIVVNLYEDKVDVGGVALIRAGIKAGVP
FT                   VVCYPEDYEKVLEDLKNGRDLSWLDLKALLYLIYNDLELLKRKLYISRDIA"
FT   gene            191494..192006
FT                   /locus_tag="Arcpr_0225"
FT   CDS_pept        191494..192006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0225"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57296"
FT                   /db_xref="InterPro:IPR014517"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG71"
FT                   /inference="protein motif:COG:COG4860"
FT                   /protein_id="ADB57296.1"
FT                   /translation="MRRVKLVNDVVDLVPILYMFSTTTYKNVYSALLDDWYTLNELKEM
FT                   FGEGVEEALKILKSAGMLEVRWRMPKDPAGKPEKEYHVTYTHLNASFYVSLIELNKVLE
FT                   VIFMPEDEFEEVVKKVIDEIKAGRMSVQHISRDLKLEPIVVRAIAKRSLKLNLKGNIVE
FT                   IAKEEEI"
FT   gene            192003..192248
FT                   /locus_tag="Arcpr_0226"
FT   CDS_pept        192003..192248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0226"
FT                   /product="Protein of unknown function DUF504"
FT                   /note="PFAM: Protein of unknown function DUF504"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57297"
FT                   /db_xref="InterPro:IPR007547"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG72"
FT                   /inference="protein motif:PFAM:PF04457"
FT                   /protein_id="ADB57297.1"
FT                   /translation="MKIKEILDKFKWHPNYDISKVTVVYIDRPKGFSEIRGDEIEKAGY
FT                   KFLYLKSGLMIPVHRVVEIRYDKEVVWRKGDVEKQV"
FT   gene            192229..193641
FT                   /locus_tag="Arcpr_0227"
FT   CDS_pept        192229..193641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0227"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: hch:HCH_00294 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57298"
FT                   /db_xref="GOA:D2RG73"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG73"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ADB57298.1"
FT                   /translation="MLRSRFKKQMDPLALEFTSSIDQDRYIFYYDILVDLAHVLGLLKC
FT                   GHISRDDAKAIIRALLEIRDKGYEAIPKEYEDVHEAIEAEVTKLTQAGKKMHTARSRND
FT                   EVATCLRMFARDRLLSIASAILDLRRVLLKRAEESIDVIMPGFTHLQYAQPTRLSHHIL
FT                   AYHDMLKRDFDRVIETFRRVNLSPLGACAFAGTSFELDRNYTAELLGFDGVVENSCDAV
FT                   ASRDFLIESVFVATQLMLTLSRMAEEIVLWCSEFDFIDLPEEYASTSSIMPQKKNPDVA
FT                   ELIRAKAGRLIGNLTGVMSIYKAMPLTYNRDFQEMNEILFKSLEIADLSTILMAGMFEK
FT                   IVFKTDVMREKVLKSFTVASEIADRLTKAGIPFRDAHRIVGRAVAEGDLSKVLDIAKEM
FT                   SYDVKVDLDVSVEEVVEGRKNIGGTSKSEVLRMIEDRLAMLEKDYDTLNSIIDSIVLKL
FT                   EKLYGEVEQLLK"
FT   gene            193867..195099
FT                   /locus_tag="Arcpr_0228"
FT   CDS_pept        193867..195099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0228"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, subunit D"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase,
FT                   subunit D; L-asparaginase, type I; PFAM:
FT                   Asparaginase/glutaminase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57299"
FT                   /db_xref="GOA:D2RG74"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG74"
FT                   /inference="protein motif:TFAM:TIGR02153"
FT                   /protein_id="ADB57299.1"
FT                   /translation="MTLEGKRVRIKAKGRIFEGIVMPSFTDCLVLKLDNGYNVGFKDYE
FT                   VLEILEEKPISFPKPKIEKKEELPNVMIISTGGTIASKVDYRTGAVTSQFTAEEIVGDV
FT                   PELLDVCNVDAMLLYNILSENMKPKHWIELAREVYKAIKKGYEGVIVTHGTDTMHYSAS
FT                   ALAFMLSTPIPIVFTGAQRSSDRPSSDASMNVFCSAVTAVSDLGEVVVVMHGTTSDDYC
FT                   LIHRGVKVRKCHTSRRDAFRTINYTPLGKVHYPSGEIEWIGERFKRGERELELRDKLEE
FT                   KCVLIKFFPGLSPDILEYYYERGYRGFVLEGTGLGHVSTDWVDTIKRIAEDSLIVMTSQ
FT                   CLWGRVCCRVYDTGRYLLRAGVIEGEDMLPEVALVKVMWLLGNYDLEEAKKLVKENLVG
FT                   EITPSTRYDYS"
FT   gene            195119..195259
FT                   /locus_tag="Arcpr_0229"
FT   CDS_pept        195119..195259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57300"
FT                   /db_xref="GOA:D2RG75"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57300.1"
FT                   /translation="MDIATLMRAGLGLIVLLLLLSGIRIVKIFRLSRLVGEITNFTKYD
FT                   F"
FT   gene            195408..196870
FT                   /pseudo
FT                   /locus_tag="Arcpr_0230"
FT   gene            196890..197642
FT                   /locus_tag="Arcpr_0231"
FT   CDS_pept        196890..197642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0231"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   gsu:GSU2430 SPFH domain-containing protein/band 7 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57301"
FT                   /db_xref="GOA:D2RG76"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG76"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ADB57301.1"
FT                   /translation="MEIATLIGAGLGIIVLLFLLSGIRIVKEYERGVIFRLGRLVGARG
FT                   PGLFYVIPIIETMVVVDLRTVTYDVPTQEVVTKDNVTVRVNAVVYYRVVDPEKAVTEVA
FT                   DYRYATAQIAQTTLRSVIGQTELDELLSEREKINVKLQQIIDEATNPWGIKVTAVEIKD
FT                   VELPEEMRRIMAMQAEAERERRAKIIRADGELQASKKLLEAAQVLEQSRGAMMLRILQT
FT                   LNEVASEQNTTIILPIPIEILEYFKRKN"
FT   gene            complement(197708..198811)
FT                   /locus_tag="Arcpr_0232"
FT   CDS_pept        complement(197708..198811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0232"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: fph:Fphi_1022 signal recognition particle-
FT                   docking protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54 G- domain; GTP-binding signal
FT                   recognition particle SRP54 helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57302"
FT                   /db_xref="GOA:D2RG77"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG77"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADB57302.1"
FT                   /translation="MFKSLKEKLSAFKKKLDEKFKKKEEVVEAVETPTKAEVKKTEVKE
FT                   AKSEVVKTVEGRVESSKDEKPKKVGLKDKIVALVKDREVVIDEKSVEEILEDLEIILLE
FT                   SDVALEVVEEISRQLKDRLVGRRRKIGEKISDIVINELKLIILDILDRNRFDFDEFVES
FT                   KLKEKRPLNIVFVGVNGTGKTTTIAKVAKRLIDFGYSVVLAAGDTFRAGAIEQLEEHGK
FT                   RLGVKVIKHKQGADPCAVIYDALKHAESKGIDIVLADTAGRMHTKKNLIDQLAKIKRVT
FT                   KPDLVIFVDESIAGNDAVERARMFNEAVGIDGTILTKIDADPKGGTAISISYVTGKPIL
FT                   FLGTGQGYDDLVKFDSRWLVERIFGGI"
FT   gene            complement(198811..199221)
FT                   /locus_tag="Arcpr_0233"
FT   CDS_pept        complement(198811..199221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0233"
FT                   /product="prefoldin, alpha subunit"
FT                   /note="TIGRFAM: prefoldin, alpha subunit; PFAM: Prefoldin
FT                   alpha domain protein; KEGG: similar to Prefoldin 5; K04797
FT                   prefoldin alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57303"
FT                   /db_xref="GOA:D2RG78"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG78"
FT                   /inference="protein motif:TFAM:TIGR00293"
FT                   /protein_id="ADB57303.1"
FT                   /translation="MEKEVEEKLYILQQLQSEAEAIQRRIIELELVDSQLEKTIESLEY
FT                   FNSLDGTVEALMNLGGGIFAYVDVKNAKKMLVDVGAGVVVEKEVGEAIEFLKKKRELIQ
FT                   KNVANLEQVLQQIIEKVRQIQVELAKKEEEKK"
FT   gene            complement(199232..199405)
FT                   /locus_tag="Arcpr_0234"
FT   CDS_pept        complement(199232..199405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0234"
FT                   /product="Ribosomal LX protein"
FT                   /note="PFAM: Ribosomal LX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57304"
FT                   /db_xref="GOA:D2RG79"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG79"
FT                   /inference="protein motif:PFAM:PF01911"
FT                   /protein_id="ADB57304.1"
FT                   /translation="MKFEVEGVFRNGMVWQKFRKVVEAHNEKFALEKVYSLLGSNHKVK
FT                   RNLIKIKSIKAV"
FT   gene            complement(199418..200071)
FT                   /locus_tag="Arcpr_0235"
FT   CDS_pept        complement(199418..200071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0235"
FT                   /product="translation initiation factor eIF-6"
FT                   /note="KEGG: eukaryotic translation initiation factor 6;
FT                   K03264 translation initiation factor eIF-6; TIGRFAM:
FT                   translation initiation factor eIF-6; PFAM: translation
FT                   initiation factor IF6; SMART: translation initiation factor
FT                   IF6"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57305"
FT                   /db_xref="GOA:D2RG80"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG80"
FT                   /inference="protein motif:TFAM:TIGR00323"
FT                   /protein_id="ADB57305.1"
FT                   /translation="MPKLLAIKGVPLIGLYIRATEDFAILGVDDEKAKEYLREELDVDV
FT                   VVTTIMGSELVGALACANSNGVLVNSQISSKELEIIRKVAEVKTVESNVTCLGNVVCVN
FT                   DKGAIIHPEVDKAIENAVIDFLNVEAARGTIGGVKTVGMSAVVTNRGGLLNPNSSEWEI
FT                   ERVEKVMKVEVGTGTVNFGVELVGTGLVANSKGYIAGKDTTGFELGLIEEALFP"
FT   gene            complement(200064..200393)
FT                   /locus_tag="Arcpr_0236"
FT   CDS_pept        complement(200064..200393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0236"
FT                   /product="Ribosomal protein L31e"
FT                   /note="PFAM: Ribosomal protein L31e; KEGG: rpl31; 60S
FT                   ribosomal protein L31; K02910 large subunit ribosomal
FT                   protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57306"
FT                   /db_xref="GOA:D2RG81"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG81"
FT                   /inference="protein motif:PFAM:PF01198"
FT                   /protein_id="ADB57306.1"
FT                   /translation="MAKVEVERVYSIRLKHKLKRYPRWLRAVKAMRYIRRFLSRHMKVS
FT                   EENIKIDPSINLKIWERGIQKPPAKIRIRAVKFDDGIVEAELYTGEVKSEVKEEKKEEV
FT                   EGQHA"
FT   gene            complement(200397..200549)
FT                   /locus_tag="Arcpr_0237"
FT   CDS_pept        complement(200397..200549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0237"
FT                   /product="Ribosomal protein L39e"
FT                   /note="PFAM: Ribosomal protein L39e; KEGG: Rpl39; ribosomal
FT                   protein L39; K02924 large subunit ribosomal protein L39e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57307"
FT                   /db_xref="GOA:D2RG82"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG82"
FT                   /inference="protein motif:PFAM:PF00832"
FT                   /protein_id="ADB57307.1"
FT                   /translation="MGKKTVGVKRRLAKFLKANRRPPLWVIIKTNRRFVRSPKQRHWRH
FT                   KKLKV"
FT   gene            complement(200555..200884)
FT                   /locus_tag="Arcpr_0238"
FT   CDS_pept        complement(200555..200884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0238"
FT                   /product="DNA-binding TFAR19-related protein"
FT                   /note="PFAM: DNA-binding TFAR19-related protein; KEGG:
FT                   dsDNA-binding protein PDCD5, putative; K06875"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57308"
FT                   /db_xref="GOA:D2RG83"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG83"
FT                   /inference="protein motif:PFAM:PF01984"
FT                   /protein_id="ADB57308.1"
FT                   /translation="MDERELEEIRRRKMMELQKMREEEIQKEQMKQQIELQKKAILRQI
FT                   LEPEARERLARLKLAHPDIAEAVENQLIFLAQSGRIKNRISDDVLVAILRQIASRKREP
FT                   RIIRK"
FT   gene            complement(200895..201344)
FT                   /locus_tag="Arcpr_0239"
FT   CDS_pept        complement(200895..201344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0239"
FT                   /product="Ribosomal protein S19e"
FT                   /note="PFAM: Ribosomal protein S19e; KEGG: hypothetical
FT                   protein; K02966 small subunit ribosomal protein S19e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57309"
FT                   /db_xref="GOA:D2RG84"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="InterPro:IPR027548"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG84"
FT                   /inference="protein motif:PFAM:PF01090"
FT                   /protein_id="ADB57309.1"
FT                   /translation="MATVYDVPADMLIHRVAERLKEMPEFTPPEWAKFVKTGVHKERAP
FT                   EQEDWWWIRVASIFRKVYIDGPVGIERLRTAYGGRKNRGVKPEKFRKGSGSIIRKALQQ
FT                   LEKAGFVTKTKEGRVVTPKGRSFLDKIAAEMKKELVQEIPELAKY"
FT   gene            complement(201349..201573)
FT                   /locus_tag="Arcpr_0240"
FT   CDS_pept        complement(201349..201573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0240"
FT                   /product="protein of unknown function UPF0044"
FT                   /note="PFAM: protein of unknown function UPF0044; KEGG:
FT                   ppd:Ppro_1188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57310"
FT                   /db_xref="GOA:D2RG85"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG85"
FT                   /inference="protein motif:PFAM:PF01985"
FT                   /protein_id="ADB57310.1"
FT                   /translation="MITINIGKRGITEGVINEINQALEKHGMVKVRMLRNFRTITMKGM
FT                   DRRELAKEIAKHVNGKLVDLRGFVLTFKR"
FT   gene            complement(201580..202392)
FT                   /locus_tag="Arcpr_0241"
FT   CDS_pept        complement(201580..202392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0241"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ppd:Ppro_1945 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57311"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG86"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB57311.1"
FT                   /translation="MEVVILADNKVVDLRPQGLKAEWGFSALIKAKENILFDTGQTGVA
FT                   FENMLILKEDKPAKVILSHGHYDHTGGLIQFLKAFNLIIYAHPDAFLPRFYKGDYIGIP
FT                   FKREQISAYSKIIEHREPVEVAKNIWALGEIPRKHKPALLSNSYIVRNGEKEFDEIMDD
FT                   QSVAIKTENGIALILGCCHAGLRNTVEYAEEVVGDEVKYIVGGTHLIALKRNELLDTIS
FT                   WLDKKVELIAPCHCTGLENEFLIKSKLGDKCKIVGVGSVVKFFNKSKN"
FT   gene            202487..203248
FT                   /locus_tag="Arcpr_0242"
FT   CDS_pept        202487..203248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0242"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   gbm:Gbem_0332 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57312"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG87"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB57312.1"
FT                   /translation="MRVTLLGTGDSTGIPIIGCHCKTCEDARKKGWERKRFSVMIQNEG
FT                   KILLIDTSPDMRRQLLDTNVDRVDAVIWTHCHFDHFGGFGNFYRVQSDVKVYTTPKIHD
FT                   DIGKFMSFMEYKPIEVECYEPFELIGLKITLFEVNHPPVDAIGVKIEWNGYKIVVSGDT
FT                   NADIPKRSLEEMEEPDLFIVEALAPRGRFKKHMNAEEALSLAKKIRARKTVLTHVGHFF
FT                   PPHDIAVKKYPIGYDYQSFEFSNVKLTRFFK"
FT   gene            203267..204601
FT                   /locus_tag="Arcpr_0243"
FT   CDS_pept        203267..204601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0243"
FT                   /product="Hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /note="PFAM: MOFRL domain protein; KEGG: dol:Dole_1573
FT                   hydroxypyruvate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57313"
FT                   /db_xref="GOA:D2RG88"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG88"
FT                   /inference="protein motif:PRIAM:1.1.1.81"
FT                   /protein_id="ADB57313.1"
FT                   /translation="MNADELLHGDVDAKKVALKLLEAVLDLSNPYKVVINSVRLEGDTL
FT                   KVEDKSFPIRGKVYVLGFGKASCPMAKALEDLMIDKIEEGLVITKYGYSLPLRKIEVVE
FT                   AGHPIPDENSLKGALKGVELAKKVDKDDTLIVLISGGGSALFILSEDGISLEDKIKTNE
FT                   LLLKSGAKIHEINTVRKHISKVKGGKLAKLVKGTLIGLIISDVVGDNLEVIASGPTVKD
FT                   PTTFRDAYRILKLYDLWDRIPESVRRHIELGLEGKVEETLKEDLPNVHNFLIASNRILC
FT                   EGVAERCSKMGYDAHILTTTLEGEAREVATAFGSIIQEIYSFNRPFKKPCVLIAGGETT
FT                   VTIEGESGLGGPNQEFALSVARKIAGLRGVAVLAMDTDGTDGPTDSAGGLVDSYTVELL
FT                   EKEGVDVDEYLKKHNSYEALKKARALLLTGPTRTNLNSIVIAVVL"
FT   gene            complement(204582..204725)
FT                   /locus_tag="Arcpr_0244"
FT   CDS_pept        complement(204582..204725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57314"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57314.1"
FT                   /translation="MDDVFKTFKEITKNDLSGWQVEEYLELKKTSKEDLSFSLDHVKEQ
FT                   QR"
FT   gene            complement(204786..205232)
FT                   /locus_tag="Arcpr_0245"
FT   CDS_pept        complement(204786..205232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57315"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57315.1"
FT                   /translation="MEEVARLLMNDGYTIKKRIKIDTAQNFKISVANAFLGKCSPWVNV
FT                   YNPDSGTMFDIVGLFHADCDELPLEALLLNKNKDEYEIALRTMIVVIDKSIEKALEKIE
FT                   TIDKNIPWSFFPGRKVIIWLEGGRVGKLGEISILIPEKYKLKDD"
FT   gene            complement(205457..205530)
FT                   /locus_tag="Arcpr_R0007"
FT                   /note="tRNA-Met2"
FT   tRNA            complement(205457..205530)
FT                   /locus_tag="Arcpr_R0007"
FT                   /product="tRNA-Met"
FT   gene            complement(205613..205825)
FT                   /locus_tag="Arcpr_0246"
FT   CDS_pept        complement(205613..205825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0246"
FT                   /product="Transcription factor CBF/NF-Y/histone domain
FT                   protein"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/histone domain
FT                   protein; Histone core domain protein; KEGG: predicted gene,
FT                   OTTMUSG00000016790; K11251 histone H2A"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57316"
FT                   /db_xref="GOA:D2RG91"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG91"
FT                   /inference="protein motif:PFAM:PF00808"
FT                   /protein_id="ADB57316.1"
FT                   /translation="MELPLAPVERILRRAGAQRVSEAAKTELAKAIEEMAIKIAKRASE
FT                   LAKNAGRKTVREEDIKMAAQEILKV"
FT   gene            205942..207117
FT                   /locus_tag="Arcpr_0247"
FT   CDS_pept        205942..207117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0247"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: dal:Dalk_3566 CBS domain
FT                   containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57317"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014651"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG92"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADB57317.1"
FT                   /translation="MDVEKLKSLIREDYEVIDANETISKVVPMLEKWESKSAILVEENG
FT                   EVIGVIRERDLLRGCVMVNPHETKIKHFVIPTGILSLDDLTPEKVARRFVEDSTPFVVV
FT                   RLNGRYGVINIDDFLNLLKSELSDVRAKDVMNPEVITVLRDATVAKALATMRTNGVDRV
FT                   VIIDENYKVVGIITGKDIIDRIFAPRKKARTGDFSGEKEKSLSIKVESIMSYPVITAEK
FT                   NDSISEIIDKMIENNISSVVITKDGFPEGIVIKKDILEYYLKQVTPVKYTYQVVLKDVE
FT                   LDEFEMDRINKDLENFLDRFKEYFGEAILFVYMKRHKEFYRGLPLIYVRLKLASDKGVF
FT                   FATGEGWGAEYALHAGLRRLERTILEHKDLQMDKKMIKRFYEDVFSDFVSI"
FT   gene            207231..208460
FT                   /locus_tag="Arcpr_0248"
FT   CDS_pept        207231..208460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0248"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: aeh:Mlg_0262 isocitrate dehydrogenase, NADP-
FT                   dependent; TIGRFAM: isocitrate dehydrogenase,
FT                   NADP-dependent; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57318"
FT                   /db_xref="GOA:D2RG93"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG93"
FT                   /inference="protein motif:TFAM:TIGR00183"
FT                   /protein_id="ADB57318.1"
FT                   /translation="MQLKPPEEGEKIEYKDGKLIVPDNPIIPFIEGDGIGVDVTPAAIK
FT                   VLNAAAEKIGKEIVWFEIYAGEKAYKLCGEYLPKETLDAIKEYRVALKGPLTTPVGGGY
FT                   RSLNVAIRQILDLYACVRPVYYLKGVPSPLKNPEQVNIVIFRETTEDVYAGIEWKAGSE
FT                   EALKVINFLEKEFGIKVRRDSGIGLKPISEFATKRLVRMAIKYAIENGRKSVTLVHKGN
FT                   IMKYTEGAFREWGYEVALEEFRDYVITEEELWNNYNGEVPKGKIVIKDRIADNMFQQLL
FT                   TRTAEYDVIATMNLNGDYLSDMAAGLVGGLGIAPGSNIGDGIGVFEPVHGSAPKYAGQN
FT                   KANPTAMILTGALMFEFLGWREGSEIIKKAVEMTIQQGIVTYDIHRQIGGKLVGTREFA
FT                   EAVIENIQSL"
FT   gene            208493..209830
FT                   /locus_tag="Arcpr_0249"
FT   CDS_pept        208493..209830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0249"
FT                   /product="RNA methylase, NOL1/NOP2/sun family"
FT                   /note="TIGRFAM: RNA methylase, NOL1/NOP2/sun family; PFAM:
FT                   Fmu (Sun) domain protein; KEGG: ppd:Ppro_3242 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57319"
FT                   /db_xref="GOA:D2RG94"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG94"
FT                   /inference="protein motif:TFAM:TIGR00446"
FT                   /protein_id="ADB57319.1"
FT                   /translation="MYRIKERDFVILTEVLRKADEIKPSQYAKRMVFEKYNILGTHIDR
FT                   ILTAVYYKIMKRLGVIDKIIRDVVGVHPNILDPWLRSALRVTIEFLVFEKKYTKHLDKE
FT                   RVKKVVADFLSNVTHPYVGMYYFETFERIASYKLEPKDEIERLEFEYLLPAWYIRKMKE
FT                   LLGEEAEELFKAFNREPMISIRVNTLKATVKEVIDHLRRQGKEVIVSSVVPTVLKFEGP
FT                   YDFDKSKLYRKGKFVVQEEASALASILLDPKPNETVVDLCAAPGGKTIHMAELMRNRGV
FT                   IHAFDVDELRLKRMEELIKRCGVKIVKIYKMDARKAVDVLGESIADKVMLDAPCTSDGT
FT                   LMKNPELRWRIREEKIEEIAQLQYELLNTGIDLLKPKGRILYCTCSIFREENEDVVERV
FT                   LKERDDVKLVPLEGYYSEGFLKVTIRAFPHKHNTIGFFYALLEKTE"
FT   gene            complement(209934..211031)
FT                   /locus_tag="Arcpr_0250"
FT   CDS_pept        complement(209934..211031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0250"
FT                   /product="protein of unknown function DUF1646"
FT                   /note="PFAM: protein of unknown function DUF1646; KEGG:
FT                   hhe:HH0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57320"
FT                   /db_xref="GOA:D2RG95"
FT                   /db_xref="InterPro:IPR012443"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG95"
FT                   /inference="protein motif:PFAM:PF07854"
FT                   /protein_id="ADB57320.1"
FT                   /translation="MEIPQEPVLHISLGLAVILLLVLIFPFRVRIVEENLEPFFLIMGI
FT                   IAVTISGQWSYELIVEALKEPVWLPNTPVPIGIFQVVLIFGLIIYKFNRQIYNGFLSLL
FT                   RIVGIRVFAFMIITLLGLISSIISVIVTAVILSEIALILPLDRRKKIEFVVIACFAVGL
FT                   GAALTPVGEPLSTIAVSKLKGEPYHADFFFLLRLLGIYVIPGVLALALYGAYRIGSVSV
FT                   DRMEVPIYEESLRNVIVRAIRVYTFVSALILLGKGLSPLAVWYFSKVPPVGLYWLNTIS
FT                   AILDNATLVAVEIEPEMSLMQIKSALISLLISGGMLIPGNIPNIVSAGRLKIRMNEWAR
FT                   VGVPLGVVLLTVYFVILMAECSFNL"
FT   gene            complement(211036..211554)
FT                   /locus_tag="Arcpr_0251"
FT   CDS_pept        complement(211036..211554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0251"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: dal:Dalk_2813
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57321"
FT                   /db_xref="GOA:D2RG96"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG96"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADB57321.1"
FT                   /translation="MHCLIVIDFQERLVKHIQNVEDIINNSIKLIKAYKVFGLPILITE
FT                   QKKLGGTIGVIKDLIDVKPIQKMSFSCLRCEEFYREFKRLSPKRVALIGIEAHICILQT
FT                   ALDLLKEGCEVYVAVDCIGSRKQIDKDVAVLRMMQEGVKLCTAESLIYEIMKTAEHEKF
FT                   KEILEIVKG"
FT   gene            complement(211610..213613)
FT                   /locus_tag="Arcpr_0252"
FT   CDS_pept        complement(211610..213613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0252"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: mxa:MXAN_2570 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57322"
FT                   /db_xref="GOA:D2RG97"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG97"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADB57322.1"
FT                   /translation="MIKRRGLMKKDKSIESLLKVEEVYEPPKEFREKAWVKDESIYEKA
FT                   EKDWIAFWDEIARTEVEWFEPYKKVLDDSNAPFYKWFIGGKINITHNCLDRHVKTWRKN
FT                   KAAIIWQGEPENDKRVITYYELYRRVCRFANALKNLGVRKGDRVTIYMGMVPELVVAML
FT                   ACARIGAIHSVVFGGFSSMALRDRINDAKAKVVITMDGFYRRGKIVETKKIVDEALEDA
FT                   PSVEHVIVYDRLGLDVNMVEDRDFWWDDVQYGSSWKCEPEVMDSEDPLFILYTSGTTGK
FT                   PKGVLHVHGGYNVGTHITTKWIFDIKDDDIYWCTADIGWITGHSYVVYGPLSNGATVLM
FT                   YEGAPDYPKPDRWWSIIEYYGVTVFYTAPTAIRYFMRLGEEWPKKHDLSSLRLLGTVGE
FT                   PINPEAWKWYYRVIGGERCPIVDTWWQTETGMIMITPLPGVTKLKPGSATKPFPGIKAE
FT                   VWDDEGNPCPPNVGGKLVITRPWPSMLRTLWGDPDRYIKTYWSAFEGKLVYFTGDGAKI
FT                   DEDGYFWIMGRIDDVLNVSGHRLGTMELESVLVAHKAVSEAAVIGKPHDIKGEVPVAFV
FT                   VLKDGYEPSVELKRELREWVRKKIGPIATPEEIIFVTKLPKTRSGKIMRRLLRAVLAGQ
FT                   PLGDVTTLEDEKALEEIKKSYEELKRALEEQI"
FT   gene            complement(213858..214649)
FT                   /locus_tag="Arcpr_0253"
FT   CDS_pept        complement(213858..214649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0253"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="KEGG: dvm:DvMF_3206 FAD-dependent thymidylate
FT                   synthase; TIGRFAM: thymidylate synthase, flavin-dependent;
FT                   PFAM: thymidylate synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57323"
FT                   /db_xref="GOA:D2RG98"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG98"
FT                   /inference="protein motif:TFAM:TIGR02170"
FT                   /protein_id="ADB57323.1"
FT                   /translation="MEDNLSYLSEVDKNLKVIQLTLFMVKVELLRYTPDGIKLIAESCR
FT                   VSGIPPDISDEEVVRMVVENDYSSVLEHIVFTFDVSEISVALSRELLEHRIASHTARST
FT                   RYHDERNFGYVIPPPIRNDPELVEMFKQAMESAREHYVKVFDKMIEKGYSKEKAREVAR
FT                   YVLPMATHTHYVWTINARSLINFLGLRLCKRAAPEIRELAQKIYDIVVKIYPEIFENIG
FT                   CRGYNLGLCPENEARPKDCPYAKIIPTKKKIKETWKGKVQK"
FT   gene            complement(214634..214840)
FT                   /locus_tag="Arcpr_0254"
FT   CDS_pept        complement(214634..214840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57324"
FT                   /db_xref="GOA:D2RG99"
FT                   /db_xref="UniProtKB/TrEMBL:D2RG99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57324.1"
FT                   /translation="MYILDGFIIKSRFDNSLRKIILFQLSMGLIFLFVPVFLIALNITT
FT                   AVIVWAVWIISYVSWLIPPWRII"
FT   gene            complement(214923..215198)
FT                   /locus_tag="Arcpr_0255"
FT   CDS_pept        complement(214923..215198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57325"
FT                   /db_xref="GOA:D2RGA0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57325.1"
FT                   /translation="MNATNLSLHDLNLSLVSLHTQFIGLAFIILTFVILFYAQALSRER
FT                   KAENFVDWVRNYALVWIGLSVPIIFCDNCFYFIIFVGIYMRFLQSR"
FT   gene            complement(215195..216379)
FT                   /locus_tag="Arcpr_0256"
FT   CDS_pept        complement(215195..216379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57326"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57326.1"
FT                   /translation="MRLILEYIKDSVKEAGLRPKLYYRTSLGWVDVLCLGREKLICDIS
FT                   MHPNAERYRKLGKCVVVTNFKNVEDDVIFTTLDNVHRAFSTVLSKDFTPYEDWLKSYVD
FT                   RDKAFYEKAFAFMCDRYGRTIGKKLIEAIVFLYTAGQALESTEQKVPYSALFPYLNEMG
FT                   LIVRETKEIVKPKNITASLTLDGVRIAKCAIYDRIDEGKIYKIAKKFGFGKLFVAVMGL
FT                   SDRRGMVVRDIDFESTSNFYDLIARIDAHSLIKLARGRTPLEGLCSALCYTVLYNDVVE
FT                   LFEELARMGLAFRCPVHDVYGTFLGVVYRTPREVASVLSSMSFCEIDRSYVERFKEIVD
FT                   MSQKRFGRGVEFDRALELGVVEVREGGIKLNEKFENFVKVRLAKLLSEVYEEIE"
FT   gene            complement(216376..216708)
FT                   /locus_tag="Arcpr_0257"
FT   CDS_pept        complement(216376..216708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0257"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57327"
FT                   /db_xref="GOA:D2RGA2"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA2"
FT                   /inference="protein motif:PFAM:PF04434"
FT                   /protein_id="ADB57327.1"
FT                   /translation="MELVREVEEALKKGLSLDLYKALVRFYGKRGKKAFRYVVERRVKK
FT                   YKDFFIVVGGEEYIVDEWFCTCRDFQLNLKFQKPCAHIIAVEVAKRLNLYDFVDAYYID
FT                   YLEVSK"
FT   gene            216762..218591
FT                   /locus_tag="Arcpr_0258"
FT   CDS_pept        216762..218591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0258"
FT                   /product="serine protease-like protein"
FT                   /note="KEGG: pzu:PHZ_p0070 ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57328"
FT                   /db_xref="GOA:D2RGA3"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA3"
FT                   /inference="protein motif:COG:COG1750"
FT                   /protein_id="ADB57328.1"
FT                   /translation="MKKAVILLLAFMLIIFPVNAKTVNIKAVAVKSGEKPEGAVIDITV
FT                   TVTDGEGKVFVSTSPYTEIDMQGSAQLAALTACDLLGLDFTKYNFYYEIEADAPIVGGP
FT                   SAGGVMTVATICVLKNLTPRSDVFMTGMIYPDGYIGPVGGIPYKLEAAAKSGAKIFLIP
FT                   EGQRIVYITKTVEEKKGPFVFIRQVTEPVDVVELGKNLGVKVIEVETIEQALWYYTGYT
FT                   ISKPQLKINLAKYSDILKILATKMENETINLRNVVGEVKEADELIEKAKRHLEERYYYT
FT                   ATSEFFQAKIILRKEYYSKTLKSDEDLENAFKDVESEIAELKNYLREVEDNVGVESFQI
FT                   VGAGEERVAWAEKYLENAKASGNWYSAIDYLALAKERVESAKVWLSLLQTIEEDVPLNK
FT                   GELKKRTEFYIRIVQSLIVYANSVGGYSNLIDRAEQSLQIAQNLYNDGFYSGAQIACMD
FT                   SMVEAGLAVELIAPSSVFEDILKSKLERVEKAAETSIAEIEQAVTPILPVAYFEFAKSY
FT                   YESYMSTNDVRDAVYALIYYKLSERLAKVMLLVSKAYEERQIIKTEIPPFTPSEYSKTS
FT                   IERIEYIEVPGYSALVCVIAVGLAYYKRKKSRR"
FT   sig_peptide     216762..216824
FT                   /locus_tag="Arcpr_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(218556..219695)
FT                   /locus_tag="Arcpr_0259"
FT   CDS_pept        complement(218556..219695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0259"
FT                   /product="protein of unknown function DUF92 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF92
FT                   transmembrane; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57329"
FT                   /db_xref="GOA:D2RGA4"
FT                   /db_xref="InterPro:IPR002794"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA4"
FT                   /inference="protein motif:PFAM:PF01940"
FT                   /protein_id="ADB57329.1"
FT                   /translation="MLEILSLSMLISPLSTDLVILLAVIATVTAHIRKYKDFDAVFLSL
FT                   ILLLLTKIGLSNVVSFTSIFILIGHRFVRGAISSIAVYFALSLAYLLYLNVFLNWEINY
FT                   IILLALIASLSASLMESIKAKPMLILLAVSTSLAVFHVYALNAPLWQIALAFVLSFILS
FT                   LLALKAKIADESGLMSATLIGLITIVYTDIRYFLVLLTFYVVGSAVTKYRYSLKVERGI
FT                   AEQAGGARGFANVFSNSLPALFFAMNYGVFRMEAFSVAFTASIATALGDTMASEIGKTA
FT                   DNVYLITNFKKVKPGESGGISLIGEVSAFLGCFIISLIAFLLGVIDLRGLIVATILGFF
FT                   GVHVDSVLGATLERKGFLNNAGVNLLATLSSGLLALIVC"
FT   gene            219704..220249
FT                   /locus_tag="Arcpr_0260"
FT   CDS_pept        219704..220249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0260"
FT                   /product="Di-trans-poly-cis-decaprenylcistransferase"
FT                   /note="PFAM: Di-trans-poly-cis-decaprenylcistransferase;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57330"
FT                   /db_xref="GOA:D2RGA5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA5"
FT                   /inference="protein motif:PFAM:PF01255"
FT                   /protein_id="ADB57330.1"
FT                   /translation="MDGLFKNVSDFLLRVYIKKLERELMKGRMPKHIMIVADENFLNRL
FT                   QEFVRWCKKFGVEELTVCVRRGEKKVETSLLNGVKVNYVIGYSGKDEIVDAVRELARLV
FT                   DKGVLKAEDVDEKVVERFLKIRSSPDLIINVGDEIPEFLIWQSIYSELYFADISQFRYV
FT                   DFLRCLRDYQRRERRYGR"
FT   gene            220239..220712
FT                   /locus_tag="Arcpr_0261"
FT   CDS_pept        220239..220712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0261"
FT                   /product="PUA domain containing protein"
FT                   /note="PFAM: PUA domain containing protein; SMART: PUA
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57331"
FT                   /db_xref="GOA:D2RGA6"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029402"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR038250"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA6"
FT                   /inference="protein motif:PFAM:PF01472"
FT                   /protein_id="ADB57331.1"
FT                   /translation="MGVEEKLLKMVRVIADYQFGRGAGKALFPDKCKFVLSPTTGKVRQ
FT                   IKYEGVRLATLKADTGLFTLSIEGAKRLHRAFDYPKLRVVVLKDVAEFIAKGRNVFAKH
FT                   VVNVDESIRANDEVLVVDEDDNLLATGRAVLSAREMMEFDRGMAVMVRQGIKQ"
FT   gene            220733..221728
FT                   /locus_tag="Arcpr_0262"
FT   CDS_pept        220733..221728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0262"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57332"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA7"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADB57332.1"
FT                   /translation="MPVMREIVKEVAELIRVGEPILALNYVISKAPEDIKEKAKHIFDD
FT                   PKIIEEIEDDWGKLLALIYYSHMLKVSSSDMSRRGIAGQAVSALTGAKLSRQLESKELE
FT                   AMFLLSGGKALSLMGMKDRAEVCYVKAEELVRELIKEDKSWLKELSDILNDLGIIYVES
FT                   GDREKGKALLEEALEIRRKLAEENPAFKPMLAQTLNNLASLYKDLRIYDKSEEYFAEAE
FT                   SIYRELAEANENYRVDLAVVLCNYASLFRVIKEHKKAEELYLEALSIFEELAKKNEFYK
FT                   SAIADVCMYLSGLYKDMGNYEKSKEYFERANKTFAEFTAKMTASSESSAS"
FT   gene            complement(221685..222758)
FT                   /locus_tag="Arcpr_0263"
FT   CDS_pept        complement(221685..222758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0263"
FT                   /product="Dehydrogenase (flavoprotein)-like protein"
FT                   /note="KEGG: nam:NAMH_1575 geranylgeranyl hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57333"
FT                   /db_xref="GOA:D2RGA8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA8"
FT                   /inference="protein motif:COG:COG0644"
FT                   /protein_id="ADB57333.1"
FT                   /translation="MILIVGGGPAGSLSAIALKNYDVTVVEEHSSAGFPVQCAGLISER
FT                   CYRELKKFSDCKVNDIRGAVFFSPNNSVELEGKVGAVVVERKLLDRDLLAKASEYANVM
FT                   IKTKFLGVEKGKAVLRSMGKKIELDYDYIIGADGVYSTVSNVFNFKKPEVYSALQITCR
FT                   FECISDDLVEIYFGFSDYFCYAIPFDEFAKIGVISSQNPMPVMRRLLRWLGKRVKGSVL
FT                   ELNAGAIPIGLVDFVKDRVMLIGDSAGMVKPYTGGGLYYILKAVEKLKHFPNLKKVQKE
FT                   YVKDLRIEYKVGTKIAKLYRTLEPEDYDYLIGVAREHGDLARELDMDRPSTLLKLIPLI
FT                   LKIVKRRKILMKLSSLL"
FT   gene            222802..223323
FT                   /locus_tag="Arcpr_0264"
FT   CDS_pept        222802..223323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0264"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: sfu:Sfum_3444 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57334"
FT                   /db_xref="GOA:D2RGA9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGA9"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ADB57334.1"
FT                   /translation="MHALEYLYPMRTFLITSGTMEKPNVMTADWVTPLSLNPPLVGAAI
FT                   AHKRYTKKLIDEYGEFVVSVPTIELLKDVWIAGTVSGANVNKAEKLSLTFVPSKKVKAP
FT                   SIKECQANLECKVVNAVETGDHVLYVGEIVEVTHEDAFKDKPDVKNYKFILHVGFGNMF
FT                   TTNSSEIFKA"
FT   gene            complement(223300..224139)
FT                   /locus_tag="Arcpr_0265"
FT   CDS_pept        complement(223300..224139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0265"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: dvl:Dvul_1297 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57335"
FT                   /db_xref="GOA:D2RGB0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB0"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADB57335.1"
FT                   /translation="MEFVKMHGNGNDFVLIDEFESVKVPDNRKSEFVRVVCDRRFGVGG
FT                   DGAIFVQKSDIADAKFVFYNSDGSRAEMCGNGIRCFARYIVERGYAKPGVVKVETLAGV
FT                   LKLDVWFDEMWWIRVNMGRPKFGKDVPALKDVWGEVFEIDGRKFEVYAVNTGVPHAVIF
FT                   VDDFDFDFYKVAREIRYSKLFPEGTNVNFAKVLSRNSVFVRTYERGVEDETLSCGTGSC
FT                   AVAVVGNRLGILDKVVEVQTKGGILKIEVNDEIYMNGTAAKVFEGRLLELSGFENFG"
FT   gene            224190..224271
FT                   /locus_tag="Arcpr_R0008"
FT                   /note="tRNA-Ser1"
FT   tRNA            224190..224271
FT                   /locus_tag="Arcpr_R0008"
FT                   /product="tRNA-Ser"
FT   gene            224373..226010
FT                   /locus_tag="Arcpr_0266"
FT   CDS_pept        224373..226010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0266"
FT                   /product="thermosome"
FT                   /note="TIGRFAM: thermosome; PFAM: chaperonin Cpn60/TCP-1;
FT                   KEGG: oca:OCAR_5651 thermosome alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57336"
FT                   /db_xref="GOA:D2RGB1"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB1"
FT                   /inference="protein motif:TFAM:TIGR02339"
FT                   /protein_id="ADB57336.1"
FT                   /translation="MATLQGVPVLILKEGTQRTTGRDALRMNITAAKVIAEAVRTTLGP
FT                   RGMDKMLVDSLGDITITNDGVTILKEMDVEHPAAKMIVEVAKAQDSEVGDGTTTAVVLA
FT                   GELLKKAEELLDQDVHPTIIAKGYRLACDKAMEILEEIAIPVSKDDEETLKLIAKTAMT
FT                   GKGAEVALEKLADIVVKAVKSVAQERDGKIVVDPEDVKIEKKPGASIEETMLVDGIVLD
FT                   KEVVHPAMPKRVENAKILLIDSALEVKETEIDAKIRITDPEMLQKFIEQEEKMIKEMVD
FT                   RIVQAGANVVFCQKGIDDLAQYYLAKAGILAVRRVKKSDIEKLAKATGAKIVTNLRDLK
FT                   PEDLGEAELVEERKVGEDKMVFVTGCKNPRAVTILVRGGTEHIVDEIARGIEDAVRAVS
FT                   CALEDGKVVAGGGAPEIELSLRIREWAPSLGGREQLAAEAFAQALEIIPRTLAENAGLD
FT                   PIDILVELRKAHEEGKVTYGVDVFEGKVTCMKEKGVLEPLRVKKQAISGATEAAIMILR
FT                   IDDVIAAKGLEKEKEKEKGGEEFSSPEF"
FT   gene            complement(226066..226725)
FT                   /locus_tag="Arcpr_0267"
FT   CDS_pept        complement(226066..226725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0267"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="KEGG: esa:ESA_03885 triosephosphate isomerase;
FT                   TIGRFAM: triosephosphate isomerase; PFAM: triosephosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57337"
FT                   /db_xref="GOA:D2RGB2"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022891"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB2"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ADB57337.1"
FT                   /translation="MGVIIINFKAYAEGSGKKAMEIARAVLEVSDKVDDYIAVAPNFLD
FT                   LAEIARIGVDVYAQHVDPIEFGSYTGRITAEMIKEKGAKGSLINHSERRLKLADIDFLI
FT                   QKFKKVGLVSIVCTNNVNTTKAVAVLDPDYVAVEPPELIGTGIPVSKAEPEVVENSVKA
FT                   VKDLNPKVKVLCGAGITTHEDYVRALDLGAEGVLLASGIVKAKDPKRALEELVGLR"
FT   gene            226758..227657
FT                   /locus_tag="Arcpr_0268"
FT   CDS_pept        226758..227657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0268"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: bbt:BBta_0036 PfkB
FT                   family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57338"
FT                   /db_xref="GOA:D2RGB3"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB3"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADB57338.1"
FT                   /translation="MDAVGFGALNLDKVFLVSEIPKAEEESYVIDLQFSAGGSSANTIV
FT                   GLAKLGLKTGFIGKVGKDKEGEFLIRDLKSYGVDTGNVIVSEGRTGCAMVFVDRDGRRA
FT                   ILIDPAVNDTVGFDEIDLEFVNQFKLLHLSSFVCKVSWKSFEAQKRLVEIFNGIVSFDP
FT                   GSVYAKFGLEKIKPIIKHTNIFMPNEIEVKLLTGLNYKEGAEFFLKWCDIVVVKRGEEG
FT                   CYIASNEGCYEVPAHKVRVVDTTGAGDAFNAGFLYGLLRGKNLEECAKLGNYLASLCIQ
FT                   HVGARTYLKHIDKRYLPL"
FT   gene            227664..228662
FT                   /locus_tag="Arcpr_0269"
FT   CDS_pept        227664..228662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0269"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: geo:Geob_3642 N-acetyl-gamma-glutamyl-
FT                   phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57339"
FT                   /db_xref="GOA:D2RGB4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB4"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADB57339.1"
FT                   /translation="MTMKVGVIGGSGYTGGELLRLLYNHPKVEVSVVTSRKLAGKDVWK
FT                   VHRHLKGFYDLKFVEPEMKYFEECDVAFTAVPHGEAMKYVPQLLEVGIKVVDLSADYRL
FT                   PKDVYEKVYGLKHEGYVEAVYGLTELHRDEIAKANLVANPGCYPTGCILAVAPIAKYAE
FT                   RVVFDCKSGITGAGVKPTEFTHYPNLHESVVPYKVTNHRHYYEIVQELKPFNSEIAVSF
FT                   TPQVFPGSRGILTTSHIFLKENLSLEEIVRIYEDFYRDCYFVRLQDEVRLSYVRGSNFC
FT                   DIALFKGEDRIVAVSAIDNLVKGASGQAIQNMNVMMGWDEKLGLDFPPLFP"
FT   gene            228694..228879
FT                   /locus_tag="Arcpr_0270"
FT   CDS_pept        228694..228879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57340"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57340.1"
FT                   /translation="MRVTRVRFVGRIWKPSFLKDLLSLFENICEEIRINSFLANITSIF
FT                   DKLVIEYYHLTINETH"
FT   gene            228932..230092
FT                   /locus_tag="Arcpr_0271"
FT   CDS_pept        228932..230092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0271"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; KEGG: noc:Noc_1199 transposase
FT                   IS605"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57341"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB6"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADB57341.1"
FT                   /translation="MGDEVTLTGTVEMTVRAEPLFNLVRNYTNALRFVVHEILRDPSKY
FT                   GRWRYVKKTRRIRWEQDIKKIHEFYETLKRRFNLPPKFAIGCEREASMIAKAVINNENN
FT                   GENKCVIKSYRARCDYQSYSVKFDGNKCYLRLQGLGEFEIKGFNKKWIDKYKDWKFGDL
FT                   IMKIQGKMIKLYVTLKKVVKIANPSEKVVAVDMNFEEVVVGNDKTEARFRTPLQRIIHI
FT                   KKNHIEKTQKMYNKQWLHVRGIRKAISRWWRRINGVTNNFVKQISRKIVAFAKERGYDT
FT                   IVLEDLNGLRDKQAKLKKSWSERFTFFVYRKLQSWIEWQAKKEGLAVVYVNPKNSSRTC
FT                   PKCKSLNTKFENRTLVCKNCGFTMDRDSVAIINLTGKWLGVLKCGA"
FT   gene            230158..230388
FT                   /locus_tag="Arcpr_0272"
FT   CDS_pept        230158..230388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57342"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57342.1"
FT                   /translation="MLSSDIDEDDNIQTNLPITDFDLFAEVDVEDLKEKVVEILEKHGY
FT                   NARRLLLSVKRVESVEVVEEKHDRTLQEFMD"
FT   gene            230422..232773
FT                   /locus_tag="Arcpr_0273"
FT   CDS_pept        230422..232773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0273"
FT                   /product="DNA polymerase Pol2"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: DNA polymerase delta catalytic subunit; K02327
FT                   DNA polymerase delta subunit 1; TIGRFAM: DNA polymerase
FT                   Pol2; PFAM: DNA polymerase B region; DNA polymerase B
FT                   exonuclease; SMART: DNA-directed DNA polymerase B"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57343"
FT                   /db_xref="GOA:D2RGB8"
FT                   /db_xref="InterPro:IPR006133"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB8"
FT                   /inference="protein motif:TFAM:TIGR00592"
FT                   /protein_id="ADB57343.1"
FT                   /translation="MIKAWLLDVDYVTENDRAVIRLWCKDDKGVFVAYDRNFLPYFYVI
FT                   GCKAEDVMKVKVRTNEGIITPLKVEEIEAKSLGKPIKALKVYTRHPQHVPKLREEIKKF
FT                   AEVREADIPFAYRYLIDKDLACMDGIEIEPIAVKEGVLRAYEVRSVRRVEKKGFPDLKI
FT                   LAFDCEMLAQFMPDPEKDPIIAIAVKCGDFEEVLHGDERDILRRFVSIIKEQDPDIIVG
FT                   YNQDNFDWPYVKKRAEKFGIRLDIGRDRSEISFRGGRPKIAGRLNVDLYDIALKIPDVK
FT                   IKTLKKVAEFLGAKVEEEDIEGRDIYKCWMRGEKEKVFKHVLNDVLTTYRLALELLPMH
FT                   YELSRMIRLPLDDVARLGRGKQVDYFLLSEAKKINEIAPNPPEIEESYEGAFVLEPARG
FT                   LHENVACLDFASMYPSIMINFNISPDTLVKGECEDCYVAPEVGHKFRKSPDGFFKRILK
FT                   MLIEKRREMKRQMKELDPDSEDYKLLDIKQQTLKVLTNSFYGYTGWNLARWYCRECAEA
FT                   TTAWGRYFIKRAVKIAESMGFEVLYGDTDSLFIKKNKLNLKDLEKECLKLIDVISKELP
FT                   IQLEIDEFYKAIFFVEKKRYAGLTDDDRIVVKGLEVRRGDWCELAKRVQREVIEIILRE
FT                   RNPDKALKFVKNVIEEIKEGKFKLEDYVIYKGLTKKPDKYESKQAHVKAALRAMEMGIY
FT                   YPIGTKVGFVIVKGGGSISDRAYPIELIEEFDGENLKIRTPSGIMVKKIDKDYYIDHQI
FT                   IPAVMRILERFGYTEASLKTTIQKTLFDFT"
FT   gene            232814..233704
FT                   /locus_tag="Arcpr_0274"
FT   CDS_pept        232814..233704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0274"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="KEGG: sde:Sde_3057 branched chain amino acid
FT                   aminotransferase; TIGRFAM: branched-chain amino acid
FT                   aminotransferase; PFAM: aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57344"
FT                   /db_xref="GOA:D2RGB9"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGB9"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADB57344.1"
FT                   /translation="MQELLVYIDGKFVPKSEAKVSVFDHGFLYGDGVFEGIRAYNGRVF
FT                   RLKEHIDRLYDSAKAIALEIPISKEEFMEIILETLRKNNLRDAYIRPIVTRGVGDLGLD
FT                   PRKCGKPTIIVIAQPWEKLYGDLYEKGIKAVTVTVRRNAIDSLPPNIKSMNYLNNILAK
FT                   IEANVKGGDEAIFLDHNGYVSEGSGDNIFVVKNGVIMTPPTINNLKGITREVVIEIIHE
FT                   LGIPFKETNLSLYDLYTADEVFVTGTAAEVCPIVWIDGRVIGDGKPGEITKKIMEEFRK
FT                   KTEKEGVPVYADDGS"
FT   gene            233685..234173
FT                   /locus_tag="Arcpr_0275"
FT   CDS_pept        233685..234173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0275"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   eba:ebA3463 putative threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57345"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC0"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADB57345.1"
FT                   /translation="MLTMVVELEDKPGQLIKVLEPISKLGGNIISVTHRRDEITPLGKI
FT                   PVRIAVQIDEKKIDQLIREIESRGICIRNYNRVKHTVTTSLLLIGHIIHTDLRSTVDAV
FT                   DRTGFAEVVEMRIVMPELNKPSTAFIKLSAVNDEKLRESVRILKEVCKAKGIKVVEPL"
FT   gene            234170..235162
FT                   /locus_tag="Arcpr_0276"
FT   CDS_pept        234170..235162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0276"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: rlt:Rleg2_5063 homoserine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57346"
FT                   /db_xref="GOA:D2RGC1"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC1"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ADB57346.1"
FT                   /translation="MRIAIIGFGSVGRGVAEVLIEKRDYLKRYLGDYKVVAVTDSKGGV
FT                   FDENGLDLREVLEMKKRGSLPKRVTSIEVVRELDFDVCIEVTPTNIENGEPGLTHIKEC
FT                   LKRGIDVVTSNKGPLAVAFKELMSLAEKNNARLMFEATVGGAMPVIKLAKVDLAGNEII
FT                   SVKGILNGTCNYILSRMEKELLPYEMILEEAKELGIAEADPTYDVEGIDASAKLVIIAN
FT                   AIMGLDAKFEDVERVGISDLTPEAFKVALENGYTIRLIAEATSEYLRVSPRLIPLNHPL
FT                   AIYGTLNALEIETDLAGEVFVIGRGAGSRETASAIISDLICLSKPLKCL"
FT   gene            235132..235815
FT                   /locus_tag="Arcpr_0277"
FT   CDS_pept        235132..235815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0277"
FT                   /product="Peptidase A24B, FlaK domain protein"
FT                   /note="PFAM: Peptidase A24B, FlaK domain protein; peptidase
FT                   A24A prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57347"
FT                   /db_xref="GOA:D2RGC2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR009655"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC2"
FT                   /inference="protein motif:PFAM:PF06847"
FT                   /protein_id="ADB57347.1"
FT                   /translation="MLVETVKVLVTLLIFIRASIEDLKTREIDDRIWLFMIALAIPLNV
FT                   IQYIQEPFNLTFALIQFVLIFILANVMYYLLNFGGADCKALISLSIMFPIYPEIFEFTV
FT                   KGFIFALSVLTDSVIFAPLISLYFFVRNALKGDFAKTMFIGYKVKIDEIPKFHNLLEWV
FT                   ENGKVVRSLRGIEFDSKVVEELKSLGVKEVWVTPALPFLVFMTFGFIVAVTLGDLIFLI
FT                   LNRIT"
FT   gene            235847..237202
FT                   /locus_tag="Arcpr_0278"
FT   CDS_pept        235847..237202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0278"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: Phosphoglucomutase/phosphomannomutase, C-
FT                   terminal domain containing protein; K01840
FT                   phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57348"
FT                   /db_xref="GOA:D2RGC3"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC3"
FT                   /inference="protein motif:PRIAM:5.4.2.10"
FT                   /protein_id="ADB57348.1"
FT                   /translation="MTRIGAVGELFGTDGVRGVANEELTPEMAMNLGRVMGTLKRKVAV
FT                   AMDTRISSYMLKSAVIAGLTSCGCDVVDLGIAPTPALQYYVKSKDEIEGGIVVTASHNP
FT                   REYGGIKFIQEDGREFTRDMDAECERIYKSKSFRFASWDNIGQVYYDEYRRLYINGILS
FT                   KVDVDAIAGKGFKVVIDCGNGAGYVTSPYILKELGCNVISINAHPDGRFPQRNPEPVEE
FT                   NVGLLKRVVKEVGADLGVAHDGDADRATFVDEKGRFIPEDIMLALMAKYYVEKNNGGKV
FT                   VTPVSSSKCVEDVVVEAGGEVIYTPVGSPVVAETMLKVKAVFGGEGNGGLIFPEHLLAR
FT                   DGAMSFAKVLELMALENKPISELVKGIPKYYMIKTKLPCRDKIKLLKGLEEKFPDANFT
FT                   DGARIDYEDSWILIRPSGTEPIVRIFAEAKSKKKAKELVEFGIKVVKEILGE"
FT   gene            complement(237257..237348)
FT                   /locus_tag="Arcpr_R0009"
FT                   /note="tRNA-Tyr1"
FT   tRNA            complement(237257..237348)
FT                   /locus_tag="Arcpr_R0009"
FT                   /product="tRNA-Tyr"
FT   gene            complement(237391..237927)
FT                   /locus_tag="Arcpr_0279"
FT   CDS_pept        complement(237391..237927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0279"
FT                   /product="Adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57349"
FT                   /db_xref="GOA:D2RGC4"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC4"
FT                   /inference="protein motif:PRIAM:2.7.4.3"
FT                   /protein_id="ADB57349.1"
FT                   /translation="MLIALTGTPGVGKSTVAEILRKRGYIVLSVNELAEKFNCIIGEEE
FT                   GCKIVDVEKLAENVRKVVKGLTIIEGHLSHLLNPDLAIVLRCNPLELKRRLERKGWSEE
FT                   KILENVEAELVDVILIEALDSVEKVYEIDTTNLTPEEVANAVEEILRGESEKYKPGRID
FT                   WLSEVGDKLDELIRR"
FT   gene            237946..238641
FT                   /locus_tag="Arcpr_0280"
FT   CDS_pept        237946..238641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0280"
FT                   /product="phosphoesterase"
FT                   /note="TIGRFAM: phosphoesterase; PFAM:
FT                   metallophosphoesterase; KEGG: mxa:MXAN_6076
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57350"
FT                   /db_xref="GOA:D2RGC5"
FT                   /db_xref="InterPro:IPR004376"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC5"
FT                   /inference="protein motif:TFAM:TIGR00024"
FT                   /protein_id="ADB57350.1"
FT                   /translation="MGIKFTPERALIVGRTAVIADLHLGLENVLIEKGIAIPKVQLDEI
FT                   LERLDRVSKEVERVVIAGDLKHEFGKNLPYEWEDVKAVIDFLLSKDLEVVVVRGNHDNF
FT                   LKAILAKFGIDLLDHYDVEGWRIVHGHKACDADKIIMGHEHPAIKVRVDGVYTFHCFLR
FT                   VRKDGREIIVLPAFSPLVQGSDVTSCEFISPILAEVDCEEVEVYAVNDEVLYLGTIADI
FT                   KNLKIHQPF"
FT   gene            238646..239185
FT                   /locus_tag="Arcpr_0281"
FT   CDS_pept        238646..239185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0281"
FT                   /product="protein of unknown function DUF46"
FT                   /note="PFAM: protein of unknown function DUF46; KEGG:
FT                   dat:HRM2_23690 putative Ser/Thr phosphatase- family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57351"
FT                   /db_xref="GOA:D2RGC6"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC6"
FT                   /inference="protein motif:PFAM:PF01864"
FT                   /protein_id="ADB57351.1"
FT                   /translation="MLELIIKTIWLLLPAYIPNNFAVIFGGGKPLDLGKHFIDGKRILG
FT                   DGKTIRGFVAGVLGGIFTAHIQLIIEKSFSLSVYSSLDYASFLQLVFLLSFGAMLGDSI
FT                   GSFIKRRFGVERGGKFPILDQLTFLIIAYILASRCSAFYKLFTLDVIITGIVITPLLHL
FT                   TINVLAYKLGLKDVWW"
FT   gene            239218..239601
FT                   /locus_tag="Arcpr_0282"
FT   CDS_pept        239218..239601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0282"
FT                   /product="ribosomal protein S8e"
FT                   /note="TIGRFAM: ribosomal protein S8e; PFAM: Ribosomal
FT                   protein S8E; KEGG: similar to putative ribosomal protein
FT                   S8e; K02995 small subunit ribosomal protein S8e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57352"
FT                   /db_xref="GOA:D2RGC7"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR018283"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC7"
FT                   /inference="protein motif:TFAM:TIGR00307"
FT                   /protein_id="ADB57352.1"
FT                   /translation="MIWQGRSRRKPTGGLYRPHRKKRKYEMGRPQTETLIGERKIKLER
FT                   VRGGNYKVKLVRDKYANVYVPSEGKVVRVEIKRVVENPAHVHYARRNVITKGAIIETEI
FT                   GLARVTNRPSQEGLINAVLIEQK"
FT   gene            239601..241547
FT                   /locus_tag="Arcpr_0283"
FT   CDS_pept        239601..241547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0283"
FT                   /product="DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: hypothetical protein; K03165 DNA topoisomerase
FT                   III; PFAM: DNA topoisomerase type IA central domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase type IA
FT                   zn finger domain protein; SMART: DNA topoisomerase I
FT                   DNA-binding; DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57353"
FT                   /db_xref="GOA:D2RGC8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC8"
FT                   /inference="protein motif:PRIAM:5.99.1.2"
FT                   /protein_id="ADB57353.1"
FT                   /translation="MWLIVAEKDKSARRIARILFKDVKVLKKNQVNYYFSPSNKAFVLG
FT                   LKGHIVEYDFPEELNNWRRTPLEALLKAKFVVKVKEKNVVKTLLELAKDAERVTIATDY
FT                   DREGEFIGLTAVKLIQKVNPGVKIERVRFSALTPVDVRRAFENPTSLDLNLAKSAEVRH
FT                   KVDLLWGAILTRLLSLSANRLGRDFLSVGRVQSPTLRLIVEREEQIKSFKSKYYYNAFV
FT                   KVRGIYAKRKFEKEEEAKAVLESINTLKVLSFKKSVVEEKKPIPFNTTEFLKEASKFMK
FT                   PDKAMAIAENLYMEGYISYPRTDNTVYPKTLNLKKLVEMFLSSDFKDHAEFVLKHGIEP
FT                   SRGRKETSDHPPIHPTAVASKDELSKDEWTIYELVVKRFLATLAPKAKWEVKRVEFEQG
FT                   FKAMGKKLIFAGWRLIYDYSKPEESYIPDFKVGEVLVVEEKKIKKEKTKPPSRYTTGTL
FT                   IKVMESLGLGTKSTRHEIIKKLYDRKYIYGNPIRPTNLAFAVINALKETAEVVTLPDMT
FT                   AKLERDMTAIAEGRIDEKDVLKESVVFLSRILKSVDRERLGSIIKEGIEKDREEEMEKN
FT                   AIGSCPECGGVLLVKRANKRFIGCSNYPKCKFSRPLPQKGRLVTTSKVCEKHGVKILRI
FT                   VEKDRKWEFCPLC"
FT   gene            complement(241544..241804)
FT                   /locus_tag="Arcpr_0284"
FT   CDS_pept        complement(241544..241804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0284"
FT                   /product="MoaD family protein"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein; KEGG: sfu:Sfum_2286 thiamineS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57354"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGC9"
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /protein_id="ADB57354.1"
FT                   /translation="MRVKVQLFATLRRFGKEFEVEGNSLEEILKKLAERLGEEFYREIF
FT                   DENGKIRSDRIITVDGRNIKDERPKLKEGSVIAIFPPIAGG"
FT   gene            complement(241795..242826)
FT                   /locus_tag="Arcpr_0285"
FT   CDS_pept        complement(241795..242826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0285"
FT                   /product="DRTGG domain protein"
FT                   /note="PFAM: DRTGG domain protein; KEGG: dde:Dde_1705
FT                   cobyrinic acid a,c-diamide synthase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57355"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD0"
FT                   /inference="protein motif:PFAM:PF07085"
FT                   /protein_id="ADB57355.1"
FT                   /translation="MISSTDAFSGKSSLIIALGKILQERGYRIGYFKPFGIGKYVGREL
FT                   VEEDVSSIVSILKVDDSLETICPVVIDRPYLEFEMKVEGIKKRILEAYQRVREGKDVVL
FT                   VEGALSYEVGKFMGLSDDEIARELNLNVVMVAKFDEFVLDKIAMAKQVFGDRLKQVVLN
FT                   FVSGYMERYIKDISEKLESIGVELAGAIPKDPFLSGTFLSEIVEVLNGRYLVEPKEDVV
FT                   IEQVLIGAMTAQSALEHFRRCKNCAVITGGDRSDIIVTALEVPNIKCLILTGNLEPPSV
FT                   VLGIARSRGTPIVLVPYDTLTTVSLVSRVTGKGKMKGKKVERMVEIVKEHVDVDKLVSV
FT                   LCG"
FT   gene            complement(242823..244814)
FT                   /locus_tag="Arcpr_0286"
FT   CDS_pept        complement(242823..244814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0286"
FT                   /product="acetyl coenzyme A synthetase (ADP forming), alpha
FT                   domain protein"
FT                   /note="TIGRFAM: acetyl coenzyme A synthetase (ADP forming),
FT                   alpha domain protein; PFAM: CoA-binding domain protein;
FT                   ATP-grasp domain protein; KEGG: dal:Dalk_1024 acetyl
FT                   coenzyme A synthetase (ADP forming), alpha domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57356"
FT                   /db_xref="GOA:D2RGD1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD1"
FT                   /inference="protein motif:TFAM:TIGR02717"
FT                   /protein_id="ADB57356.1"
FT                   /translation="MEELFEPRAIAVIGATPKEGKVGNTLLKNLSKFKGKIYAVNPKYR
FT                   EVLGVECYPSVKDLPEEVDLAVIAVPAEVVPKVLEECGEKGVKAAVVISAGFREVGNYK
FT                   LEMELVEICKKYGIKMVGPNCLGIINTSNGLNATFSGVEPLRGRIALISQSGALIVAIM
FT                   DWALANNIGFSKIVSLGNKALLNECDFIEYLSNDDETEVIALYVEGIEEGRRFMEIAEK
FT                   CRKPIVAIKSGKTSAGAKAVSSHTGSLAGSYEACRTAFRQSGVVEAESVEELFDFSTVL
FT                   SYIKGFRGGVAIVTNSGGPAVMASDAVEKYNLNLASFEHETVEMLRSIAPYGNVYNPVD
FT                   VLGDADAERFCKALDIVAKDRNVGLILAILTPTATIDGVKVAEKIVGINKKVVGCFMGG
FT                   KSFEEAVRILREKGIANFNDPVRAVKAIASVQFYSRRTKRKEFVRFDVDLKKVRELLKR
FT                   GLYFEVVREYGIPVPPYGIARSAEEALEIADKIGYPVAMKVVSPKIIHKTDVGCVKLNV
FT                   TRNEVVKIFYEILKRAEEFGDVEGVMIQKMMPTGKEVIVGMKRDPSFGPLVMFGMGGIY
FT                   VDVFRDVSFRIAPISREDAEEMVREVKAYRILQGVRGEKPSDVDAIIDVILRVSQMVMD
FT                   LEEILELDINPIFVYEKGCCAVDVKVIV"
FT   gene            244940..245347
FT                   /locus_tag="Arcpr_0287"
FT   CDS_pept        244940..245347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0287"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: rsq:Rsph17025_3605
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57357"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD2"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADB57357.1"
FT                   /translation="MTVLVADIMCRKVEFIDADANVLEAIENVVLKKIGALIVKEDGKA
FT                   VGVVTLRDIVLRCLAEGLDPRDVKVSEIASKPVIAVSGDTPIDEVVKLLKEHKITRVFV
FT                   RENGTIVGYVSLAELLPVYLRKYMGLQEIVV"
FT   gene            complement(245344..246150)
FT                   /locus_tag="Arcpr_0288"
FT   CDS_pept        complement(245344..246150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0288"
FT                   /product="Protein of unknown function DUF137"
FT                   /note="PFAM: Protein of unknown function DUF137"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57358"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD3"
FT                   /inference="protein motif:PFAM:PF02006"
FT                   /protein_id="ADB57358.1"
FT                   /translation="MEELNKFYKTICNLPCMIPKDHPRYESLMMRERIVEGYKMGITVL
FT                   QGLIAHGRGEMFDYVLGEKSHDFALKAEKVAVALMMLSKRPVISVNGNTAVLVPEEISE
FT                   LSKLLNAPLEVNVFHFSKERVDRIKKYLERFGAEVLANCDAELNGLSHGRRIVDRRGIY
FT                   VADTVLVPLEDGDRCEILKKHGKKVIAIDLNPLSRTAMMADVTIVDNIVRAIPNMIKFA
FT                   KKLRDASREELEEIVKNYDNRKTLRLALETIRDNLTKIAEEKLRDI"
FT   gene            246712..247422
FT                   /locus_tag="Arcpr_0289"
FT   CDS_pept        246712..247422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0289"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: dat:HRM2_23990
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57359"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="InterPro:IPR037456"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD4"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADB57359.1"
FT                   /translation="MYKRFKFQHKETIVTVLLDDDSYYDIVVEAILTARKAIESMIKRD
FT                   PLFQVTLEPYDCDGFIVGRMCQASKIAGVGPMASVAGVIAQYAVERAVEEGAKFVVVDN
FT                   GGDIAMYLDRPIRVGVFTYSQKLCFEIDQKGFYAVCTSSGTIGHSISFGFADACTIFAR
FT                   DACVADAFATALCNEIKEGFGREEIEKTLRLFWEKAKEHILGAVVVKGDVVGFAGNVPK
FT                   IVKGVVKPDLITKG"
FT   gene            complement(247423..248658)
FT                   /locus_tag="Arcpr_0290"
FT   CDS_pept        complement(247423..248658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0290"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   hypothetical protein; K10866 DNA repair protein RAD50"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57360"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD5"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ADB57360.1"
FT                   /translation="MFTLDTKPECRACKGDEREIDDSLARDLLYSLFNPYHREKGNVNL
FT                   FNFVKEHLKNEELKQFFENFSFMLNDMIRGYKYISRFWSEKIDDYVEAKKKAWEEIKRK
FT                   LKEGELKREDLSTSELVNYFYEEIIEDLKKEGYLEDDYFRGYKFTKNAERALSKKILQL
FT                   SLQDLTGEDFGEHETEKTGVSSFLKNEIVEYDELRHSYDSIDLQETLVKCALRDPSLRF
FT                   DERDLVAREGKHMEKCVYVMLIDVSDSMRGRRIVGALESALALRKVIKKSNMDELHVVA
FT                   FNHRVRKIKDEEILNLRTRGRTDIGLALKTAREIIKKRRGSGVIFLITDGEPTSSYDPY
FT                   LTPTMCALREAEKLRKVDANLTIVMLSPEKRFLALCERIAKLSRKANLVYIENPLNMKK
FT                   FFVKSYMRRLRF"
FT   gene            complement(248633..250063)
FT                   /locus_tag="Arcpr_0291"
FT   CDS_pept        complement(248633..250063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0291"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: rpt:Rpal_1693
FT                   magnesium chelatase ATPase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57361"
FT                   /db_xref="GOA:D2RGD6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD6"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADB57361.1"
FT                   /translation="MEYIFEDVVIKPSNAPKFVLNGEEVDIWSEEFLNYHSRSIVEYVR
FT                   DAILEYEKRGEDPFPEIVGKEVEKEMVKNALMSGSNILFRGRKGYGKTTFSKAIAKLLP
FT                   EKLLAVKGCKIGCDPTHPSCFSCKKKLLENDVVELTWIPRKWIRIAGDPMMTTRQLIGG
FT                   ISIQKIREGYDLDHPEVFTPGKILKAHRGIAYFDELGAIPSALQTLLHELLEEKQITTP
FT                   EGDIIPMKIDTIVIASTNPANYKGVSDIKEPLLDRMEEIPIGPPETLEEEIEIGLRNMS
FT                   LKNGAILPEWHLKTLARIVRLARCKECRISSVIELEPSCRATIKLFDHLRASATRKGRE
FT                   CAMLIDYGKNYEIVKLALRSRMEIEYEDEISKDDVIVKLTEEALNKTCSEIYNRIPREE
FT                   FKGLMNDLAEFCFEPVDVEKVDGFENFEYLYRTLLLIAKRKEELKSAFEILLESIKRCT
FT                   GLIEKVGFGRYVYAGYEA"
FT   gene            complement(250136..250429)
FT                   /locus_tag="Arcpr_0292"
FT   CDS_pept        complement(250136..250429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0292"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   hypothetical protein; K09131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57362"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD7"
FT                   /inference="protein motif:PFAM:PF02594"
FT                   /protein_id="ADB57362.1"
FT                   /translation="MKETDKGILIEVDVSPNAKRTAITGYDPWRKALKVSVKSPPRGGK
FT                   ANRELTDFLGGIFNCKVEIVKGEKSTKKTVLLKGLSLEKALSILKELGVEVS"
FT   gene            complement(250413..250844)
FT                   /locus_tag="Arcpr_0293"
FT   CDS_pept        complement(250413..250844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0293"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: noc:Noc_2712
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57363"
FT                   /db_xref="GOA:D2RGD8"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR017939"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD8"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADB57363.1"
FT                   /translation="MLLFVYGTLMDIEKASKILKRRVKTAKKAFLPNYRIAFNVPSLYG
FT                   TGNPNIEEGGDGVWGVVYEVDEKTLELLDKVSPRYERIEVEVIVDGKPVKAWTYVGKTK
FT                   AEVKPDKSCVERVIRGARTHGLPEDYVKMLEGFLNEGDG"
FT   gene            250915..251355
FT                   /locus_tag="Arcpr_0294"
FT   CDS_pept        250915..251355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0294"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: dac:Daci_0861 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57364"
FT                   /db_xref="GOA:D2RGD9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023047"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGD9"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ADB57364.1"
FT                   /translation="MEKARMVDISEKKDVIRVAKAEGFVRLKKSTVEAIREGNVPKGDV
FT                   LTIANVAGILAVKKTPEIIPMCHPIPITSVSIEFEILDEGVKAVCTVKSVGKTGVEMEA
FT                   LTGVTAALLTVWDMVKALEKDETGNYPHTAIEYIRVLEKFKG"
FT   gene            complement(251345..251602)
FT                   /locus_tag="Arcpr_0295"
FT   CDS_pept        complement(251345..251602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57365"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57365.1"
FT                   /translation="MLWSMHCPNCDTPIDSGRVLEILLERFAENGFNIRLNALVEFVKL
FT                   CLDEYGEVGIDDVDSFCEFVEKRFGTKNVEMEHVEAYFNL"
FT   gene            complement(251627..253564)
FT                   /locus_tag="Arcpr_0296"
FT   CDS_pept        complement(251627..253564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0296"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: mno:Mnod_5236 molybdenum cofactor synthesis domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57366"
FT                   /db_xref="GOA:D2RGE1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE1"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADB57366.1"
FT                   /translation="MRKVFRELKSLDEVRRILESLTIDLDIEEISIFEAYNRVLAEDVY
FT                   AKCDVPPFDRATMDGFAVKAEDTFLAEEDKPIKLKIVGNVKAGEVPRVEVDRGCAVEIS
FT                   TGAVMPKGANAVVMVEYTTVRDGYVYVYKPVAPMENVASAGSDAMAGELIVRKGKVLSA
FT                   REIGLIASAGVDRVKVFRKPKVAIISTGDEIVEVGRPLEIGKIYDVNLYMITSKVKECG
FT                   CLAFPMGVVRDDYLEIKRTVENALKTCDIVITTGSTSAGLGDVIYRVFEELGDVFVHGI
FT                   AVKPGKPTVIAKTKNKVLFGLPGYPVSALMIFEVVVAPFLRKLTGLEVERNKVKAVLQV
FT                   KTYSDVGRREFRPVALVKTGKFIAYPFTTYSGSVSTLAKADGFIEIPENVAFLEEGEEV
FT                   DVILFGDYKPSDLVIIGSHCLGVDLLIELCSVDAKVINVGSTGGLLAVKRGEADLAGTH
FT                   LLDESGVYNIPFIKRLGLKDVILVKGYEREQGFIVAKGNPKGIRGFEDLLREDVVFINR
FT                   NPGSGTRVLIDMKLRELAEKLGLSFEEIKKRIKGYDVEAKTHTAVAVAVLMGKADVGVG
FT                   IRTVADRYGLDFIPLRPEEYDFVVRKDRLGKESVKRFLETLRSDKFKREVRKLKGIRVT
FT                   ERTGEIVEFS"
FT   gene            complement(253585..254514)
FT                   /locus_tag="Arcpr_0297"
FT   CDS_pept        complement(253585..254514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0297"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mmw:Mmwyl1_0852 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57367"
FT                   /db_xref="GOA:D2RGE2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE2"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADB57367.1"
FT                   /translation="MLRKLIFLAFLTIFTALIAPCIGSVVYSPVVAFEKNIDSWIFVNI
FT                   RIPRVLMGLVVGSSLAVAGVVMQCIFKNPLAEPYILGVSTGAGLGALLGFVLGLFYLTP
FT                   ALAFVSATLTVALVYNLARIRGFFTTESLLLAGIAVNFFLYALEWLILVKTNAHMILGW
FT                   LVGYLGNVEWCDVRVASLAIIPCFCSFMFSKHLNALLLGEEQAFYLGIDVKRVLKILIA
FT                   LATLATSTTVAFVGIIGFVGLMIPHIARGFVGEDNRFLIPASALIGATFLAWTDALARI
FT                   LNVPVGIITMLCGGPFFIYVMKRYAKRL"
FT   sig_peptide     complement(254416..254514)
FT                   /locus_tag="Arcpr_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.768 at
FT                   residue 33"
FT   gene            complement(254499..255473)
FT                   /locus_tag="Arcpr_0298"
FT   CDS_pept        complement(254499..255473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0298"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   dol:Dole_2060 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57368"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE3"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADB57368.1"
FT                   /translation="MNLRLLITLVLAVILLGCSSHSTNHSTEGFLIKENTTYVIVKDDF
FT                   GYVVAVKKYPKRIVSLAPSNTEILFALGLRDRVVGVTDYCDYPPEILKLKKEGKIVSVG
FT                   GYSTVDVEKVVRLKPDLVVASYGNGFGVIKALKDFGITVVALNPKNVTDVMRDAELLGK
FT                   VCGVEENATKLVEWMKDEIAKVKAKKHPWKPKILHIVWNDPIWVSGRGTFVDDVIKIAG
FT                   GVNVVNESGWVVVSLEDLIRMNPDIIIVNSGNGMDSKGENILYDWVMNNNYLKKLKAVR
FT                   CGNVYVIDANIICRPSYRIVYAIENLSKIVDVAYEKVRLCYAS"
FT   sig_peptide     complement(255399..255473)
FT                   /locus_tag="Arcpr_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.412 at
FT                   residue 25"
FT   gene            255544..256516
FT                   /locus_tag="Arcpr_0299"
FT   CDS_pept        join(255544..255912,255911..256516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Arcpr_0299"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   sfu:Sfum_0936 histone deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57369"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE4"
FT                   /inference="protein motif:PFAM:PF00850"
FT                   /protein_id="ADB57369.1"
FT                   /translation="MKIYYDDVFLQHKPNGYHPENPNRLKIIRKALEERGLWQNVVKPK
FT                   KAKVEDLLKVHDEEYIDFIRKSCQNEDFIDSDTYVCRESWDSALTAFGCAIHCVEDAVE
FT                   NKDLHLALVRPPGHHAGKKKGVAFNAPSLGFCLFNNVAGAVVKAKEFFDRVLVTDFDVH
FT                   HGNGTQEIFWGDLSIIHIDFHEYGIYPGSGYVDETDGSKVNIALPHYCNDDDYIYAWNE
FT                   VVEPILADVKPKLVLVSAGFDAFKDDGLATMELTEKFYAFVGSRLRDYSVVAVLEGGYS
FT                   IGLERGLPAFVEGYVEGYDVEGVRPSAKVVEIVKKLREIHDLR"
FT   gene            complement(256501..258780)
FT                   /locus_tag="Arcpr_0300"
FT   CDS_pept        complement(256501..258780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0300"
FT                   /product="Prenyltransferase/squalene oxidase"
FT                   /note="PFAM: Prenyltransferase/squalene oxidase; KEGG:
FT                   geo:Geob_0814 conserved repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57370"
FT                   /db_xref="GOA:D2RGE5"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR026453"
FT                   /db_xref="InterPro:IPR027954"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE5"
FT                   /inference="protein motif:PFAM:PF00432"
FT                   /protein_id="ADB57370.1"
FT                   /translation="MKKVILVLFVILTVQTAQALTINVQGDFIVGHKLTISTDKPALII
FT                   LRMNNGTPIYANTSTNFTPQVAGMLTIEAIAGCERASKVIEIRQPATSSMGSSGWIGRY
FT                   YLPSGTTTITLEDGGSATINWRTALGVLIKASQERGFSVKIKKWSYGLFVDCIGGICTR
FT                   ALGETSGWVYQVNGETPMVSSEQYNLNAGDTVVWYFSRSMSEAPESSPYRITIKTYDDW
FT                   SFDVSINPAMPWSLPSEETGSSSVSTTPTPTPTIPSKMSVARTNNSITCTVVGNVTVEV
FT                   NVTKIPLKVSVRSAKAVLLKISKYEPKGLEFNEIYATPLDCFDLELNRSTNVTISFVIP
FT                   KEKLTKLDAKPEDVCIAEYEGKWKFIPTNYTENETYYTFTANLTSFSIFAIVAKWESFP
FT                   LNSSDERIVKALNWLKSQQRPDGGWGSLSNTSWVVMAIASANENPCDWIKNGKSPLDYF
FT                   KANLNESVIERMGTSDFARTILALIALNQNPYNFNGINFVEKLKERVKEDGQIGDYIYT
FT                   TIWGILALKACGENVSKSVEWLKAHQNPDGGFAWAVNAESDFDDTASAIQALIASGVSR
FT                   DDPVIKKALNYLKKGQCEDGGMRYFGNSSSNADSDAWTIQALVSACVNPTNWKTSKSVV
FT                   EHLLSLQAEDGHFKYTKYVTSIPIKVTADSVMALLGKPHPVKILLNRTTQVTANRTVAV
FT                   TTEVTYVTYTTITPTPTTITKTVASTTTIATTNPPKVTATTKKVYGFEAILGILALLFV
FT                   MFYRRS"
FT   sig_peptide     complement(258721..258780)
FT                   /locus_tag="Arcpr_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            complement(258777..260666)
FT                   /locus_tag="Arcpr_0301"
FT   CDS_pept        complement(258777..260666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0301"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="SMART: Pyrrolo-quinoline quinone; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57371"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE6"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADB57371.1"
FT                   /translation="MRLLVCVAILMLIAVPVNAYTLQGDVQHTGNFTSNANIIPKLEWR
FT                   TYLSGLIGSSPVVANGKVFVTNWYGWGSWQPGFYVLDADTGQILWNNSTIYGASTPFVY
FT                   GDKVIVGGMVYSGSGWNYYGYLYIINLTTRSVKSVKLDDHPSYYGIASSPIVYNGYIYV
FT                   LTHSNGTLWKLDLDGNVVDCFTTGGLINPYTSPTAYDGKIFFAGNSSGDRIYCVYTNLT
FT                   EVWNRSVDSQIVDTPTVASINGETILIFATKNYLYAFYLNGTLKDRYPFNGTISSPAVA
FT                   YDRIYIGSRDGKLYCFAFDSRGNLSVLWTFEANGKIDSSPAVSNRVVYFATNTGEGTLY
FT                   AVDAMVGYEIWHYRLIPPQNTWWNIMSSPFISNNRLYIGADSGYVYCFNSSGEIDFDVN
FT                   LTPVNVSLNVNGREYEVRENTALGALLKASNYTMNSAEIYFNVTLDDSWYDKYGSFFIS
FT                   SIMGLGTQNVNGKWIYWSIWNETSLLSVGANLYTISDNETVYYCYGDGTSLSNCTVLLN
FT                   ITTHVKPVGISNLTVNSARLGGNATAWVNVSSAKSGWYVVVVSGLNDKGDYVAGISTVY
FT                   LSECQSLRVPVLIHVSQRNTIGTYKLFAGVYKLNEYPNNLIDWFGSVNCEVTS"
FT   sig_peptide     complement(260607..260666)
FT                   /locus_tag="Arcpr_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 20"
FT   gene            complement(260711..261577)
FT                   /locus_tag="Arcpr_0302"
FT   CDS_pept        complement(260711..261577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0302"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: scl:sce0211
FT                   adenosylcobinamide-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57372"
FT                   /db_xref="GOA:D2RGE7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE7"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ADB57372.1"
FT                   /translation="MIELVLAIAFDLLFGEPPNRVHPVVWFGKITAKIDRAYKRRNPLT
FT                   DFLAGIVCTTVVLFFALVLSFIPRFLPFPFNLIAEVYLLKSSFAIKSLYQHVKATICED
FT                   VEEMRRAVSLIVSRDVSKLDRHHLISASIESLAENIVDSVISPIFYYMLFGLSGALIYR
FT                   AINTLDAMIGYRNEKYEYFGKFSARLDDILNFIPARITVLLFLPLKPKRVWQYCRLAKF
FT                   KINSDKPIACMSAVLSVWIEKEGVYRFEGRNPRLEDVKKALKVYCLIVAIFLSLVFMLE
FT                   FILVNHA"
FT   gene            261618..262325
FT                   /locus_tag="Arcpr_0303"
FT   CDS_pept        261618..262325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0303"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; KEGG: bid:Bind_2697
FT                   cobalamin 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57373"
FT                   /db_xref="GOA:D2RGE8"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE8"
FT                   /inference="protein motif:TFAM:TIGR00317"
FT                   /protein_id="ADB57373.1"
FT                   /translation="MFMDLISFFTRIPAEGKLERVAKQLWALPLLALLTSALPMALLLL
FT                   KIPIREILALIALYATIGLIHLDGLADFSDGLMAKGDVKVKFRAMKDVNVGIAGIFAVI
FT                   VVILLQVGALRFAPFYAIFLAELNSKFSILLSLSVKKPLGEGLAKFFMDRLDRRQFFVG
FT                   FGIYIALIVAVAFYDRIALISALSLIVGLLTIKIALDNFKGLNGDCVGAVAEITRTSSL
FT                   VLCAILDNPSMII"
FT   gene            complement(262318..262563)
FT                   /locus_tag="Arcpr_0304"
FT   CDS_pept        complement(262318..262563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57374"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57374.1"
FT                   /translation="MLKLKGIYAEDYLYEFVNKHRGLSIYEIAKRLNWSTGKVHAIVKK
FT                   LENMGLVKTEITVENNRIKKKVYPVDWKDLLPKDVK"
FT   gene            262913..263524
FT                   /locus_tag="Arcpr_0305"
FT   CDS_pept        262913..263524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0305"
FT                   /product="GTP:adenosylcobinamide-phosphateguanylyl
FT                   transferase-like protein"
FT                   /note="KEGG: geo:Geob_0150 formate dehydrogenase family
FT                   accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57375"
FT                   /db_xref="GOA:D2RGF0"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF0"
FT                   /inference="protein motif:COG:COG2266"
FT                   /protein_id="ADB57375.1"
FT                   /translation="MENRYEVGRRAIKNIIGDMLIVVMAGGKSSRMGFEKPLALVRGKP
FT                   MLLWVYDRAVKAGDAVVAVSRNTPRTAEFCKERGIETIETSGKGYVEDIRFILKEFGEF
FT                   VSVACDIPFVRAEDIREIVENFEGMSLTGVLSPKIVPDFIDLKKLPIYEGWVIVGLNAV
FT                   GWEGEMFLELKNPLLALNVNTPEDLALANTIANKLDTSWA"
FT   gene            263515..263832
FT                   /locus_tag="Arcpr_0306"
FT   CDS_pept        263515..263832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57376"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57376.1"
FT                   /translation="MGLSCLSEKELEFVCEFCGKDIEDGLRFYNSNVVKILPNEVVKRL
FT                   EVVKKFDFEIDDTHKEVTDDIIHSLDRLDEEKIVRVHQKVFRLNHLLTPSSKAVLTALP
FT                   M"
FT   gene            complement(263760..264371)
FT                   /locus_tag="Arcpr_0307"
FT   CDS_pept        complement(263760..264371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0307"
FT                   /product="protein of unknown function DUF105"
FT                   /note="PFAM: protein of unknown function DUF105; KEGG:
FT                   rsq:Rsph17025_1386 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57377"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF2"
FT                   /inference="protein motif:PFAM:PF01955"
FT                   /protein_id="ADB57377.1"
FT                   /translation="MKSKLGEGYFTDDHFIFKLNEPMVCLSNAPHNSGLCKANGFFFMQ
FT                   VDENYSGDYKTDCRRFEDEYGLKDFVGFMTATLIKKTLTHTKIGDVEVFVTVGLKNKAI
FT                   VGESNENGWGTVNMVILIDRGVTIGCLVNAVMTAIEAKTYTLLKLVNATGTTSDCIAVF
FT                   GFEGEEEWAGTATKLGFYIGRAVRTALEEGVRRWFSLKTF"
FT   gene            complement(264361..265353)
FT                   /locus_tag="Arcpr_0308"
FT   CDS_pept        complement(264361..265353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0308"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; KEGG: abu:Abu_2184 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57378"
FT                   /db_xref="GOA:D2RGF3"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF3"
FT                   /inference="protein motif:PFAM:PF02277"
FT                   /protein_id="ADB57378.1"
FT                   /translation="MMLLVLGNTELSLIKGISIAGANPELTKFTPPADAEYIFYDRPKI
FT                   IDAIPVTPQGHPTPAIITKACYELAGFPITVVRAGTFLAPQIPHIHVSDDVGRDFRKTQ
FT                   ALPNVDEIVEKGKLIGCELSKVVNEVVIGESTPAGTTTAQAVLWALGYKAKTSSASPNN
FT                   PQELKKDVIEEGFKRANAKFGELADKPIQALKEFGDPMLACTLGISIGFRGKVVLAGGT
FT                   QMLAVSAILKALGEDLRRFKIATTRWVVEDRTATFERTAEEIGIDYYVANLDFSQSKFN
FT                   GLRDYERGFVKEGVGAGGAVYLAEKKGFSCKDVFKKVEELYAKLISNEI"
FT   gene            complement(265408..265650)
FT                   /locus_tag="Arcpr_0309"
FT   CDS_pept        complement(265408..265650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57379"
FT                   /db_xref="InterPro:IPR018716"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57379.1"
FT                   /translation="MDISFDLEYIGGSEENVLDRIISRITEKTGKNAKEVLAEINKKHE
FT                   ELNLLAVEVVALIVAREKGVDISDLIDDVEKKVLG"
FT   gene            complement(265652..266725)
FT                   /locus_tag="Arcpr_0310"
FT   CDS_pept        complement(265652..266725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0310"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypD; PFAM: hydrogenase formation HypD protein; KEGG:
FT                   sfu:Sfum_4014 hydrogenase expression/formation protein
FT                   HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57380"
FT                   /db_xref="GOA:D2RGF5"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF5"
FT                   /inference="protein motif:TFAM:TIGR00075"
FT                   /protein_id="ADB57380.1"
FT                   /translation="MLKLKDRKRAIKGLAEELKGLMEGEETITIMHLCGTHEDTVTRYN
FT                   LRSLLPENLKVVPGPGCPVCITPDTDLQRAFHLLEKENVILTTFGDMARVPFEGKSFFY
FT                   YKSKGYDVRIVYSVFDALEIAKTTDKPVVFFAIGFETTMPSTAVAVLDGVENFYVLSAH
FT                   RFFIPAMEHLLSFDDVRIDGFICPGHVSTIVGVKAYEHIKVPQVIAGFEPEDVLLALCM
FT                   LVKAIKNGENCLLNEYTRAVRYEGNVKAQKVMNEVFDRDDWEWRGLGVVRNSGAPLKKR
FT                   YEDFDALKVFEDAFKDFEPREDKKKRLCRCGDVLRGVATPLDCSLFMKACTPKNPIGAC
FT                   MVSFEGTCNIWARYWRG"
FT   gene            complement(266726..266944)
FT                   /locus_tag="Arcpr_0311"
FT   CDS_pept        complement(266726..266944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0311"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: hhe:HH0324 hydrogenase isoenzyme formation protein
FT                   HypC"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57381"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF6"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ADB57381.1"
FT                   /translation="MCIAIPGKVVEIDYPFAVVDFKGTKRKIRIDLIDDLKVGDWVLVH
FT                   VGIAIQKVDEEEARKTAELLEQVFGGL"
FT   gene            complement(266917..267579)
FT                   /locus_tag="Arcpr_0312"
FT   CDS_pept        complement(266917..267579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0312"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: gsu:GSU0305
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57382"
FT                   /db_xref="GOA:D2RGF7"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF7"
FT                   /inference="protein motif:TFAM:TIGR00073"
FT                   /protein_id="ADB57382.1"
FT                   /translation="MHKIEVDAEVDLLEENKKLAEANRRLLREKGVVTVNVMGAIGSGK
FT                   TLLIEKTIEALKDYKVGAILGDVIAKDDYERVARHGVKAMPLNTGKECHLDAHLVHHAL
FT                   EKFDLDGIDVLFIENVGNLICPVDFDLGEDYRVVMVSVTEGDDVVAKHPEIFRLADVII
FT                   INKVALADAVEANVDKMVEDAKRLNSKARIIKMDLKKGIGFEEWMEWLKCVLQSRER"
FT   gene            complement(267582..267908)
FT                   /locus_tag="Arcpr_0313"
FT   CDS_pept        complement(267582..267908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0313"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="TIGRFAM: hydrogenase nickel insertion protein HypA;
FT                   PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   rfr:Rfer_4095 hydrogenase nickel insertion protein HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57383"
FT                   /db_xref="GOA:D2RGF8"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF8"
FT                   /inference="protein motif:TFAM:TIGR00100"
FT                   /protein_id="ADB57383.1"
FT                   /translation="MSFAQAILDTVMKVAEQNNAKKINAVHIVIGNLLMLNPEQLKFCF
FT                   DVITKGTIAENAKLEVEVVKAKIKCTCCGKEFEEYIGICDECGGILSVDGGKEMILKKV
FT                   EMEV"
FT   gene            267987..268967
FT                   /locus_tag="Arcpr_0314"
FT   CDS_pept        267987..268967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: erythrocyte binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57384"
FT                   /db_xref="GOA:D2RGF9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGF9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57384.1"
FT                   /translation="MDRLTALIVAFVIGVLAVCGAIVYYFGWLFLIRLILGLAFLCATI
FT                   VFAVLFGILVYARSKYSLLSLLGFLSSAYALYQCYTWSKPMHIVYIIVAYAVALAFGLW
FT                   YISEPDLSIVERLRSAKALEKSGNYRAAARKYEKREDYVKAAECYLKAGLLESAAWCYE
FT                   RAEMYEKSAEIYERLAKEKRDSFYWKEAYEFYKKAGNLRKAGECLEKYAEEEPWYWEDV
FT                   AKLWEEVGDKDRAVKAWKKALDYYIKEAEEEGVFWEDVAKIYEKLGETEKAREAWMKFA
FT                   EYCEREAKNDPSWWKHVAEAYEKLGLKDKAEDAKRKYEEWKKQRD"
FT   sig_peptide     267987..268049
FT                   /locus_tag="Arcpr_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.748) with cleavage site probability 0.694 at
FT                   residue 21"
FT   gene            complement(268990..269610)
FT                   /locus_tag="Arcpr_0315"
FT   CDS_pept        complement(268990..269610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nis:NIS_1760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57385"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG0"
FT                   /inference="similar to AA sequence:KEGG:NIS_1760"
FT                   /protein_id="ADB57385.1"
FT                   /translation="MGFEVITKPKGGDIDKMAEKVFWEAIRMLGGLKKLVEYRNLTWLP
FT                   SLAEAAYVIVLKNEAMKTYGEIAKILGITEQTVRNIATADEEEVKKYIEGELEERPKEH
FT                   IAGGIAKLAYKKLKEEGRLDTEEIELKKEEMEVLDVDWAVHVLAKIRGLDFPVSKEQLM
FT                   ERLKGMVIKGKKIEEILEKLEYPIKTPAELLHRIKTHLAEQSS"
FT   gene            complement(269625..270491)
FT                   /locus_tag="Arcpr_0316"
FT   CDS_pept        complement(269625..270491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0316"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: Circadian clock protein KaiC central region;
FT                   KEGG: nis:NIS_1761 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57386"
FT                   /db_xref="GOA:D2RGG1"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022373"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG1"
FT                   /inference="protein motif:PFAM:PF06745"
FT                   /protein_id="ADB57386.1"
FT                   /translation="MAKYYYELKELEAKAPKLFGIPTGTKLDEMFYKVELEGDKYVKKP
FT                   LGGIPYLAVLNVTGIPDTGKSVLAEQFAVTQANLGYRVLYVTVESPAHFLYTALKNKAQ
FT                   ALGADFSKVEENIVVIDASESDELRENPKALIDTMAYAIKEKKVTNTIIDSITGLYEHK
FT                   EVMARQIVRQFFNFLKRFKQTAILVSQKRSAQASESAEAAGGLAVAHIVDGTIVLDKKL
FT                   IETRWDVNLYGLPIGSVLRTIRIDGCRLCGHDSRTWVFEITELGTINIICPLSEFIKRR
FT                   DRIEEEE"
FT   gene            complement(270529..270696)
FT                   /locus_tag="Arcpr_0317"
FT   CDS_pept        complement(270529..270696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57387"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57387.1"
FT                   /translation="MIELRNLHCARCGSEFDIIVKRTTGYSGVLHIPNLYCPFCGSRRL
FT                   MKKQGLIFKD"
FT   gene            complement(270701..271102)
FT                   /locus_tag="Arcpr_0318"
FT   CDS_pept        complement(270701..271102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0318"
FT                   /product="Protein of unknown function DUF61"
FT                   /note="PFAM: Protein of unknown function DUF61"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57388"
FT                   /db_xref="InterPro:IPR002746"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG3"
FT                   /inference="protein motif:PFAM:PF01886"
FT                   /protein_id="ADB57388.1"
FT                   /translation="MDNITEVVLAKMIEAVNSHLPRRSRTLDEMLKEKYPTIVARDGNE
FT                   YLIERKELEFIAKYLDEDEIKKFRIPIVLEMHTVGNTYLIYVRDKLHAEFIKRAFGYDR
FT                   FVEDSLVLHMHEMASIRRVLRTATQVAFR"
FT   gene            complement(271127..271885)
FT                   /locus_tag="Arcpr_0319"
FT   CDS_pept        complement(271127..271885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0319"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   dal:Dalk_3152 protein of unknown function DUF62"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57389"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG4"
FT                   /inference="protein motif:PFAM:PF01887"
FT                   /protein_id="ADB57389.1"
FT                   /translation="MIITLLTDFGDFYPGVMKGVILKINPKAIVVDISHSVEPQNVFQG
FT                   AFLLYNAYKFFPNAVHIAVVDPGVGSERKALAFECRNHIFIAPDNGIAYPSAREDGIER
FT                   IWVINENKTSEVTGVLSSTFHGRDVFAPAGAYASIGLLKEVAEPYEGDIAKLELFDYVV
FT                   EGNLIRCRIVFIDRFGNAVTNLKAEYVKGRYVVFEGVKIPIVRCYEDVKKGEPLALIGS
FT                   FGTLELSIREGSFAEEFGVKSNDFVELEQL"
FT   gene            271923..272663
FT                   /locus_tag="Arcpr_0320"
FT   CDS_pept        271923..272663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0320"
FT                   /product="Protein of unknown function UPF0278"
FT                   /note="PFAM: Protein of unknown function UPF0278; KEGG:
FT                   hha:Hhal_2243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57390"
FT                   /db_xref="InterPro:IPR014856"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG5"
FT                   /inference="protein motif:PFAM:PF08745"
FT                   /protein_id="ADB57390.1"
FT                   /translation="MRQRFVLDTTAITDASLRAKEKCESLCECAHKILGLIALARLKLN
FT                   ISCYILYPTVYAEIVSFLKRYKCDPDVFVKLDTWLVKKSPNRYEVMIPAIIFYEYVSTV
FT                   RGRINKGRKIAEEFIWESSAVTLKALMEEKSKEDIEKEVGALIGKFRDKYKTAMRQGIL
FT                   DSPPDLDVLLLAKELSAGVVSSDVGIRKWSERLGLRFIEASKFPRMIKEYLRMMGYDVE
FT                   VVDEGEVEIPEVEEFEEEEEEETI"
FT   gene            272688..274268
FT                   /locus_tag="Arcpr_0321"
FT   CDS_pept        272688..274268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0321"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; conserved
FT                   hypothetical protein; KEGG: gme:Gmet_0242 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57391"
FT                   /db_xref="GOA:D2RGG6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB57391.1"
FT                   /translation="MKVSIILPAYNEAERLENAVKTVKEYLERLGYDYEIIIAEDGSTD
FT                   GTDKIARKLAEKDERIVHLHSDERLGRGKALTNAIKQAKGEVVAYLDVDLSTDMEHFKE
FT                   LIEAILNGYDIATGSRLMKESRAERPFKRDIASRVYNFLVRFMLGSKLRDHQCGFKAFK
FT                   KSSILPLLEKVKDNHWFWDTELLVLAQREGLKIKEIPVRWRQGRDTKVRFKRDVVYMFS
FT                   QILRMWIESRRSKKFLAASVFVSVSIIVALAYFSGFSLKNLLSLNPFFLGVAGLIYLLT
FT                   FLVRGYRFEYILKKVGFEVPTLFSSEGVAISQMVNVVTPARIGDVVRAYVFKLKEVPIS
FT                   SCISALAVERIFDLFAVVILSLISAVLLGSFAYMREIVYASVIGITIVLAVLLFSKMEN
FT                   IIGKMSKEVKVALHSGFPVLMTLSILNWLMDVATCYVIGLPFNANLFSVMLAVAVANVV
FT                   KAIPITPGGIGTYEAVVTGILTAFGLSSSDAFTIALVDHTLKNLITVALGYVSIIHLNV
FT                   KIRKIREIA"
FT   gene            complement(274265..275005)
FT                   /locus_tag="Arcpr_0322"
FT   CDS_pept        complement(274265..275005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0322"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE domain protein;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG: similar
FT                   to CG6009-PA; K00286 pyrroline-5- carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57392"
FT                   /db_xref="GOA:D2RGG7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG7"
FT                   /inference="protein motif:PRIAM:1.5.1.2"
FT                   /protein_id="ADB57392.1"
FT                   /translation="MKIAVIGGGNLGSALAKALVKKYDVVVTRRNPEKIDFLRELGCEI
FT                   TSDNAKAVQDSDIALLTVKKDHVKEVLSEIPKDKITVSFVAGLTFKELEMVLKKPVKAM
FT                   TMLSAEFGKGFSIYYSKLVDEDNDLVERVLSCFGDVFRGEEKDVDNLTAFASSLAFIPK
FT                   IYEAFVYSGLRLGYDSEIAKRIALQVFEGGVELLKSYEPHEIVEKIVTPAGTTIEGLCK
FT                   LMERGVEFGIIDAIQACAKRFESL"
FT   gene            complement(275010..275705)
FT                   /locus_tag="Arcpr_0323"
FT   CDS_pept        complement(275010..275705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0323"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   lip:LI0117 siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57393"
FT                   /db_xref="GOA:D2RGG8"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG8"
FT                   /inference="protein motif:PFAM:PF02602"
FT                   /protein_id="ADB57393.1"
FT                   /translation="MKVAILRPEHVASETVDMFKKQGFDVISIPFIKIVPRNFEFDPRN
FT                   YDVLIVTSRTAARIVVEKGIKHENVIAIGKKTAEELRKAGIHAKIPTRFDSTTLYEEFK
FT                   DELKGKRVAILRSNRGDPILLNLPNVDEVILYDIEFEWGEKQKKFLNDLDFDVIVFSSR
FT                   MTVKSFFGLADHLGIDIVERLKDKIVIAIGPPTREELSKYGIEALMPEEWTFDSILKLL
FT                   KSIKTEQKS"
FT   gene            275740..276459
FT                   /locus_tag="Arcpr_0324"
FT   CDS_pept        275740..276459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0324"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dal:Dalk_3435 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57394"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGG9"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB57394.1"
FT                   /translation="MLVKFVGVGTAVKGIQSCIVLEGENTKIAVDIGAGSIARLDFDLD
FT                   AVLITHNHSDHNSDLIPLLKARWLLGYEKLDIYGVRGTKAFLESALESYAYLRRKLKFD
FT                   VHETRSFKVGEFDVKAIPTKHSIESQAYVVSDGNVTIVVSGDTYPIEDVLSVECDLLIH
FT                   EMSLPFGYETNDHTTPESFADLLDVCKAKKIVFVHMYPMALEVKDEILKYLRRRKDLSY
FT                   YIAREGEVINTAYQLKA"
FT   gene            276456..277604
FT                   /locus_tag="Arcpr_0325"
FT   CDS_pept        276456..277604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0325"
FT                   /product="arsenite-activated ATPase ArsA"
FT                   /EC_number="3.6.3.16"
FT                   /note="KEGG: dal:Dalk_3989 arsenite-activated ATPase ArsA;
FT                   TIGRFAM: arsenite-activated ATPase ArsA; PFAM:
FT                   Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57395"
FT                   /db_xref="GOA:D2RGH0"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH0"
FT                   /inference="protein motif:TFAM:TIGR00345"
FT                   /protein_id="ADB57395.1"
FT                   /translation="MRIILFTGKGGVGKTTIASATALKTAKLGYRTLIISTDPAHSLSD
FT                   AFQKELNPYPTEVTENLYAMEVNVEYELERHWNVIKEYLTIFFKSQGIEDVVAEELAIF
FT                   PGFDELASLLHLLEHYEKRDFDVIILDCAPTGETLRLLSVPEVARWYMNRFFGIEKKIL
FT                   KLVKPIAEPIINVPLPSEEVLNKIQELYVKIGKLKEILESDITTVRIVMNPEKMVIRES
FT                   ERAFTYLNLFGYRVDCVIVNKVFPESVGEYFSKWIEIQRSYLNEIAERFPIPIFKVQFK
FT                   DKEVVGKELESLAEEIYGERDPTEVFHYHKPMEIKKEGNYFVLSINVPFIEKKDLKLLK
FT                   RGEELIVIAKNWKRIVFLPQSLALKDVIKAEFKDQRLNVYFA"
FT   gene            277658..278776
FT                   /locus_tag="Arcpr_0326"
FT   CDS_pept        277658..278776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0326"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dol:Dole_1225 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57396"
FT                   /db_xref="GOA:D2RGH1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH1"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57396.1"
FT                   /translation="MVKGKATVSREITYDRSDEHIPRRLRELKESFRPVVVWNLTAKCN
FT                   LKCVHCYAHANQREELDTETAVRVVKELNELAVLVLFSGGEPLLRKDLFEIARYCKVIK
FT                   ALSTNGTLIDNNTAEMLKNAGFSYVGISLDGLKDVHDRFRGVDGAFERAVEGLKSVKSA
FT                   GILSGVRFTLTKFNSEEVEGVLDLCEDLGVERFCMYHLVPSGRADFSIDVPNDVRRNVI
FT                   DYLFERAFEFDGEILTVDNPCDGVYFCLKLREIDEDLAFKAYEFLKYRGGDRSGRNLVN
FT                   IDPFGEVHPNQFWWDYSCGNVKERNFKDIWFNDPLLNELRGKWILKGRCGRCAYKSVCG
FT                   GFRLRAMRAGDLWGEDPSCYLKDDEIAKNVFE"
FT   gene            278835..280061
FT                   /locus_tag="Arcpr_0327"
FT   CDS_pept        278835..280061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0327"
FT                   /product="protein synthesis factor GTP-binding protein"
FT                   /note="PFAM: protein synthesis factor GTP-binding;
FT                   Initiation factor eIF2 gamma domain protein; elongation
FT                   factor Tu domain 2 protein; KEGG: Dere_eIF2gamma;
FT                   eukaryotic translation Initiation Factor 2 gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57397"
FT                   /db_xref="GOA:D2RGH2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH2"
FT                   /inference="protein motif:PFAM:PF00009"
FT                   /protein_id="ADB57397.1"
FT                   /translation="MEEEVPLPEVNIGMVGHVDHGKTTLVYALTGVWADRHSEELKRGI
FT                   TIRLGYADATFRKCPMCNEPEAYTTERICPIHGVKTEILRTVSFVDAPGHEMLMATMLS
FT                   GAALMDGAVLVIAANEKCPRPQTKEHLMALEIIGVDKIVIAQNKIDTVSKERVLENYRE
FT                   IKEFVKGTIAENAPIIPISAQQRINIDALIQAIEETIPTPERDLDSPPLMHIARSFDVN
FT                   KPGTKPEDLVGGVVGGSLARGRLRVGDEIEIRPGIKDDRGNWQPLRTEVVSIMASGRYV
FT                   EEATPGGLIGVATKLDPFLTKSDKLVGNVLGYPEHLPDVLSELTMEVKLLERVVGLEED
FT                   VEVEKIKMNEVLMLVVGTAVTVATVTSARDDIVEVKLKRPVCAEKGDRVAISRRVGGRW
FT                   RLIGAGTIV"
FT   gene            280058..280447
FT                   /locus_tag="Arcpr_0328"
FT   CDS_pept        280058..280447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0328"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57398"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH3"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADB57398.1"
FT                   /translation="MRCAVIDTNVLMYSYLERVDIFSQLREMGFKKFYVPSKVVEELER
FT                   LKISLTGKERQASKFALSLIERYCEVVDIEASGTDLALIELARSKNCVLITNDKKLKKM
FT                   AKDLGIPIGYLRELKRIEIEDFYEE"
FT   gene            complement(280410..280943)
FT                   /locus_tag="Arcpr_0329"
FT   CDS_pept        complement(280410..280943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0329"
FT                   /product="Protein of unknown function DUF429"
FT                   /note="PFAM: Protein of unknown function DUF429"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57399"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH4"
FT                   /inference="protein motif:PFAM:PF04250"
FT                   /protein_id="ADB57399.1"
FT                   /translation="MIAGIDVGLKRCHMAVIRENKVVYLGELRLDFPIKFAGIDAPLTM
FT                   PERGFFRECERELHKIGVRIIPPIFLKRIHEIGVRIAEELRKKNVEVFEVYPYATRWIL
FT                   GMKWSKKRKEGRFKILEALKNYIDFPPTDDHNEIDAILSALTVKMFLEGKGEVICGRDG
FT                   CILIPHRSLLSQSS"
FT   gene            complement(280940..281467)
FT                   /locus_tag="Arcpr_0330"
FT   CDS_pept        complement(280940..281467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0330"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: dol:Dole_1766 metal dependent phophohydrolase;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57400"
FT                   /db_xref="GOA:D2RGH5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004454"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH5"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADB57400.1"
FT                   /translation="MDVPDIVLKIWDKYSLPENVRRHCLKVAEVALKIANKLKDKYDID
FT                   FEALKLGALLHDIGRAITHGIEHFVYTGEILRKEGFDEKVVRIAERHFLCGITKEEAKN
FT                   LGINVERDFMPETIEEKIVCMADNLVKGDREVTFDEFMKRLEELKKKYPETAWFTERTI
FT                   ERALKLKEELKL"
FT   gene            281545..281850
FT                   /locus_tag="Arcpr_0331"
FT   CDS_pept        281545..281850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0331"
FT                   /product="translation initiation factor SUI1"
FT                   /note="TIGRFAM: translation initiation factor SUI1; PFAM:
FT                   translation initiation factor SUI1; KEGG: hch:HCH_00188
FT                   translation initiation factor SUI1"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57401"
FT                   /db_xref="GOA:D2RGH6"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR022851"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH6"
FT                   /inference="protein motif:TFAM:TIGR01158"
FT                   /protein_id="ADB57401.1"
FT                   /translation="MSDICPICGLPKDLCVCEEVAKEQQQIVIKVVKRRYGKEVTVIEG
FT                   IDGSQINLEELAKFLKTKLACGGTVKNGVIELQGNHVARVKELLIKKGFNPDQIKA"
FT   gene            complement(281852..282640)
FT                   /locus_tag="Arcpr_0332"
FT   CDS_pept        complement(281852..282640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0332"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: rma:Rmag_0984 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57402"
FT                   /db_xref="GOA:D2RGH7"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH7"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADB57402.1"
FT                   /translation="MRIAYKLAYVGTNFHGFQYQPNVRTVAGELFKAFRALGIDPKKAK
FT                   FRCAGRTDAGVHAFGQVIAINVEKPIFPRMFNAHLPEDVTFWAWTEVDEKFNPRHAKSR
FT                   TYVYVMPAEGYDISAMRKASKLLLGTHDFSNFTKKFGERRRCIRTIYNVELRLDDGFVV
FT                   LEIVGNAFTWNMVRCIVSALREVGSGHRSVEWFEDMLNPERHRERIEPAPAYGLILKDV
FT                   EYEGIEFEVDEYAWKTLMYRVKEIVEFHGTIYKLFSQFQE"
FT   gene            complement(282637..283026)
FT                   /locus_tag="Arcpr_0333"
FT   CDS_pept        complement(282637..283026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0333"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: low molecular weight phosphotyrosine protein
FT                   phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57403"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH8"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ADB57403.1"
FT                   /translation="MIVLFVCRGNASRSQMAEAIFNYLAKGNFKAFSAGLKPAERVSSK
FT                   AKAVLKEIGIEWNGKPKALTREMIEEADIIVAMCEGDFPKEKTIYWNVEDPMGKDLEFY
FT                   RAVRDEIYRRVKELLNSLGSSVISP"
FT   gene            complement(283004..284893)
FT                   /locus_tag="Arcpr_0334"
FT   CDS_pept        complement(283004..284893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0334"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; GCN5-related N-
FT                   acetyltransferase; SMART: AAA ATPase; KEGG: sfu:Sfum_3762
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57404"
FT                   /db_xref="GOA:D2RGH9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGH9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB57404.1"
FT                   /translation="MICKVVDREIPKYKHRWFGTLTVECNGEQFVLYSAGISKWIKVGE
FT                   KIELIPKAKPKVIRGVNTFLFEDYELYKFYNGEKIKVWPYWVKDVELPRYNPFGEEIYR
FT                   YKIRAREAVFESDFEAIAELEQFHYASEKEKVAIWRCEKCGEIVEANTKPKCPKCGEDM
FT                   TIAEIKGSTPASRFLVLELLNREAYEPKFLAYVRVDPPIPLMHRRLPDGRIERNIREKV
FT                   FPRDWFHPVYSPELLMRKMFRELKKMYSKRVARHKLWEIATLKALDISNTACSRIARVV
FT                   VHPDYRSDGIGVTAVKLAIEWIAERRIPEMRKKKHLVETIAQMARFNPFFEKVGFKYVW
FT                   DSASGRPVLYYPLTDEAKSYLEKFLNTDEFARIHGGRLCVSKYGRVEGLRKPIIFKNVS
FT                   KVFESKLDIRNVSEEIRFLLSAFGVKSRVIQRCVIRNANFEIKPGEVVAVIGASGAGKT
FT                   TLLRLIYGAITGKDKPTSGEIEVEKCKVSALIPQEIEPEFGDESIIEHIYRKCGDLQLA
FT                   VEILNKSGLSDAVLYRAKFSELSTGQKERAKLASLLAEKPSLILIDEFASHLDTLTAMR
FT                   VAKKFGELVRSAGITAVIVTHRKEVIEAMGVDKVIYVGYGITKVESYDRSVRL"
FT   gene            284944..285291
FT                   /locus_tag="Arcpr_0335"
FT   CDS_pept        284944..285291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0335"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   xcb:XC_2789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57405"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI0"
FT                   /inference="protein motif:PFAM:PF04266"
FT                   /protein_id="ADB57405.1"
FT                   /translation="MKLGLIVKEPYASMIVKGLKIWEIRKRRTNVRGEIYIISKGFVVG
FT                   KVELVDVLGPFTVEELSKHEEKHRVEYEVLKRYAGDSKLYAWVLEKAEEFEKPLKVKVP
FT                   KGAQIWVRLNL"
FT   gene            285314..286270
FT                   /locus_tag="Arcpr_0336"
FT   CDS_pept        285314..286270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0336"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57406"
FT                   /db_xref="GOA:D2RGI1"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR022970"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI1"
FT                   /inference="protein motif:PFAM:PF01877"
FT                   /protein_id="ADB57406.1"
FT                   /translation="MRVIAFVGLPLSGKTTASKVAEEMGIPVVCMGDVVREEAKKRNLP
FT                   LTDEVLGKIANELREKEGMDAIAKRCIPLIREKGKDVGVVVVDGIRGIAEVEAFKKAFD
FT                   DFILIAVEAPLEVRFQRALKRKRSDDVKNIEELKERDRRELSWNLAKALEIADFTIENT
FT                   SSLDEFREKVRDLLEQLAKKVEVEIETKVNPTEDVDKVVQAVKNLFPDADITIEGDTLR
FT                   AKAWDLRKFRDLLRRQRILDTARTELLKGKSNNETTVFLNKQTAYIGKVNFTDEDAILS
FT                   PIRVTFKLYGIPFGKFLDYLAPPTKAGKPIREVDRLI"
FT   gene            286315..286387
FT                   /locus_tag="Arcpr_R0010"
FT                   /note="tRNA-Arg2"
FT   tRNA            286315..286387
FT                   /locus_tag="Arcpr_R0010"
FT                   /product="tRNA-Arg"
FT   gene            286524..287042
FT                   /locus_tag="Arcpr_0337"
FT   CDS_pept        286524..287042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0337"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: dal:Dalk_5036 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57407"
FT                   /db_xref="GOA:D2RGI2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR039356"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI2"
FT                   /inference="protein motif:SMART:SM00471"
FT                   /protein_id="ADB57407.1"
FT                   /translation="MEEIVKLMFEAGTLKLIPRSGWFKVGIKNPESVAEHSFRTALIAS
FT                   LIAYMETKDFDKACKACLLGLIHDLNESRILDLHKLSRRYVRVDRDALEDQIQLMPFAE
FT                   ELKKAMNELMDYVKDADQLELLLQAKEYSESHPSAMLYTKNVKFKTETAKKLAEVIKKS
FT                   DWRWWLGLE"
FT   gene            287035..287511
FT                   /locus_tag="Arcpr_0338"
FT   CDS_pept        287035..287511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0338"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   tbd:Tbd_2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57408"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI3"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ADB57408.1"
FT                   /translation="MSKFICDRMLKRLAIWLRLFGYDTLYAGDIEVEGDEDSFLINEFR
FT                   DRILLTRDRELYNRAKGIRPVFLIRSNRLEEQLKELKVLGLRYELRMDRCSICNTPLRK
FT                   PSDKEALEVMKREGIREDLREKFELWYCERCKKLYWMGGHWRNMKKFLEEHGLA"
FT   gene            287564..288199
FT                   /locus_tag="Arcpr_0339"
FT   CDS_pept        287564..288199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0339"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: sat:SYN_00287 endonuclease III N; PFAM:
FT                   HhH-GPD family protein; helix-hairpin-helix motif; SMART:
FT                   HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57409"
FT                   /db_xref="GOA:D2RGI4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI4"
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /protein_id="ADB57409.1"
FT                   /translation="MNWYWIVETMEKIGRERKAPVYEMNLNDPFMVLVSAILSTRTKDE
FT                   QTHKAVRKLFSVVKKPEDLLKLSEDDIDELIKPVGFHRTKAKNLKKLAEVLVNNYGGKV
FT                   PDNLEELLKLPGVGRKVANIVLAHLGKPAIAVDTHVHRIANRLGVVRTKRPEETEKELK
FT                   KIVPKDLWSRLNKAFVGFGQTVCKPLKPLCEECPFKSFCEYFKNLKRS"
FT   gene            288204..288620
FT                   /locus_tag="Arcpr_0340"
FT   CDS_pept        288204..288620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0340"
FT                   /product="translation initiation factor aIF-2, beta
FT                   subunit"
FT                   /note="KEGG: eukaryotic translation initiation factor eIF-
FT                   2; K03238 translation initiation factor eIF-2 beta subunit;
FT                   TIGRFAM: translation initiation factor aIF-2, beta subunit;
FT                   PFAM: Translation initiation factor IF2/IF5; SMART:
FT                   Translation initiation factor IF2/IF5"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57410"
FT                   /db_xref="GOA:D2RGI5"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI5"
FT                   /inference="protein motif:TFAM:TIGR00311"
FT                   /protein_id="ADB57410.1"
FT                   /translation="MLSYEELLERAFRELPKKKVVKSERFEIPKVRAQREGNRTIIKNF
FT                   SQVAKALNRDEEHLFKYLVRSLGTAGFLEAGRLVLQGKFTQEEIQKEIDDYVRRYVICK
FT                   ECGAPDTELIREERVLMIRCQACGAKYPAKGLHV"
FT   gene            288691..288987
FT                   /locus_tag="Arcpr_0341"
FT   CDS_pept        288691..288987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0341"
FT                   /product="Protein of unknown function DUF424"
FT                   /note="PFAM: Protein of unknown function DUF424"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57411"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI6"
FT                   /inference="protein motif:PFAM:PF04242"
FT                   /protein_id="ADB57411.1"
FT                   /translation="MKFRLKVYRVKGEIVVAVCDSEIVGKTFREGDLKIEVKESFYGEK
FT                   DVDEDEVRRALRIATIANITGRRAVQLAIEMGIIDKENVLKIEDCWHAQMVVI"
FT   gene            complement(289000..290664)
FT                   /locus_tag="Arcpr_0342"
FT   CDS_pept        complement(289000..290664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0342"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; KEGG: similar to Fanconi anemia, complementation
FT                   group M; K10896 fanconi anemia group M protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57412"
FT                   /db_xref="GOA:D2RGI7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI7"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ADB57412.1"
FT                   /translation="MIELRDYQKEAIEHALKAKRSTLVLPTGTGKTVIGAFFLKKLFES
FT                   GKIKKAIVLVPTRILVEQTHNFYRSLGLNSEKIYGIFSKDVRAEVWKKARIAISTPETV
FT                   YNDLDVIGKVDAVVVDECHHAVGDDAYAKVLREIDCEYRLGLSAFIPRRRRKEIEELIG
FT                   EMREWSVESLRGYVAEWIGEVFETKFNKKEMEIYDEIDRRRCKAKSSDKLVYTSALKFF
FT                   AKDGALALKESLSRETKLSKLLEDLNDEIMKLRDLHKLNYLFRALELYEGFEKSIVFVE
FT                   RVIVAKKLFEILSKDFDTALIVGRKKRREEDLERAKEAKVVVSTSAGEEGVDLPTADLL
FT                   INWSNTSSPLRFIQRHGRIMRKVGRPVKFVVYLVTPDTIDVDDLLASAEQAKRIIDVNI
FT                   DKSTLEELWRASRRRKIIELLTEPMPIEWLVEISGRTLAEVRFALKKACEEGEVVYIYT
FT                   HLGKTYIRVDHIDKLERFSSYLNPVWEGKAKINGSVRGDYSKLKSRIERKLPLQKLEVV
FT                   VAKKVGDVIEYNHRVYNFRISSPKVLDIVLRNALSNF"
FT   gene            complement(290661..291539)
FT                   /locus_tag="Arcpr_0343"
FT   CDS_pept        complement(290661..291539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0343"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57413"
FT                   /db_xref="GOA:D2RGI8"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI8"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADB57413.1"
FT                   /translation="MALFDWGTYNGKSKLHVAELLGMRLTEIPPYDFVRRKYGEEYFRE
FT                   YAELSKAFVTVTAHAPYYSTVSEDDRVLEGARRGLISAAKKAEIANAEIFNLHLGGKLD
FT                   DLDRTIEIASETIREILKNTEKIKISLETTYSKYLLGSLDEIKAIMETLNSERVILSLQ
FT                   LENDWMREKEVYRTGLFSIADKETDEAFWYNILKRALNMCPDYLSLRFAQVTGVKLRGM
FT                   VVKKRVPLGMGHPNAEILTKALAKFIIKEIHEEDLSTEIHLIYTGLPENKYVDCVKLYS
FT                   MLANELVPYLQ"
FT   gene            291616..292947
FT                   /locus_tag="Arcpr_0344"
FT   CDS_pept        291616..292947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0344"
FT                   /product="Fmu (Sun) domain protein"
FT                   /note="PFAM: Fmu (Sun) domain protein; NusB/RsmB/TIM44;
FT                   KEGG: ppd:Ppro_3242 sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57414"
FT                   /db_xref="GOA:D2RGI9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGI9"
FT                   /inference="protein motif:PFAM:PF01189"
FT                   /protein_id="ADB57414.1"
FT                   /translation="MIYTQELVAEVLKVIEETKLSEKEAIKRCLSGKISDHAIWSSVHA
FT                   YVFEIEKRLNLIDFILRNCFREFDKQNTVFKNLLRVGVYEMHFKGVHPALATDSIVRIV
FT                   KQRFNLKMASLANAVLRRAEKFDYERRFRKLGKVKRLALEYWHPEWFVRYAIDMLGEDE
FT                   AIKLMKANNEKQSVYVRVNELKANIEEVRRYLENSGVEIEETPLPEVFKAVKYEKHPSV
FT                   LDWHSEGKYVVQDLASCFVSHVLDPQPDEIILDLASAPGLKASHIASMMENKGVIIAVD
FT                   NSAERLERMKAKMKQLGVKNVVCRLADGCKIKVGDVDKVLVDPPCSSTGSFRSYPCVKW
FT                   RFDRELYLKTIDVQRKMIKNAFRNLKSGGIMVYSTCSITFDENEENVMFASEFFKVEEV
FT                   KPVIGVRGIREFRGKVFPFWDKVVRTFPHLHDCTGFFISKLKKV"
FT   gene            complement(292934..293260)
FT                   /locus_tag="Arcpr_0345"
FT   CDS_pept        complement(292934..293260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0345"
FT                   /product="protein of unknown function UPF0132"
FT                   /note="PFAM: protein of unknown function UPF0132; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57415"
FT                   /db_xref="GOA:D2RGJ0"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ0"
FT                   /inference="protein motif:PFAM:PF03675"
FT                   /protein_id="ADB57415.1"
FT                   /translation="MRTTLGLPANVEGVLAYLFGPLGGIVLLLIERNHFVRFHAMQSTV
FT                   TFISLWILAGISRFVPFVGWILTGLVNIVAVAFWIGGIYKAYCREYYKFPFFGDLAESL
FT                   LRLF"
FT   gene            complement(293263..293862)
FT                   /locus_tag="Arcpr_0346"
FT   CDS_pept        complement(293263..293862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0346"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: dps:DP2809 thymidylate kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase;
FT                   deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57416"
FT                   /db_xref="GOA:D2RGJ1"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ1"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADB57416.1"
FT                   /translation="MLIAVEGIDGSGKTTIVRFLVEELKKRGYDVVAFKEPTDSEYGKK
FT                   IRQILKERKISPEEELKLFIKDREFNVRNNILPALKSGKVVIMDRYYYSTIAYQGALGL
FT                   DIGKIKTLNEQFPKPDLVIILDVSPETALKRIKAKRKPDRFEDLEYLRKVRNIFLSLKN
FT                   NIVVIDAERDIEEVKRDVLKVVLEHLEKSFKRSGGM"
FT   gene            complement(293912..293986)
FT                   /locus_tag="Arcpr_R0011"
FT                   /note="tRNA-Glu2"
FT   tRNA            complement(293912..293986)
FT                   /locus_tag="Arcpr_R0011"
FT                   /product="tRNA-Glu"
FT   gene            complement(294026..295015)
FT                   /locus_tag="Arcpr_0347"
FT   CDS_pept        complement(294026..295015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0347"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: dvm:DvMF_0155 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: Acetohydroxy
FT                   acid isomeroreductase catalytic domain protein;
FT                   acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57417"
FT                   /db_xref="GOA:D2RGJ2"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ2"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADB57417.1"
FT                   /translation="MAKIYYDDDADLSYLKGKVVAILGYGSQGRAHALNLRDSGVDVIV
FT                   GLYKGSKSWKVAEEDGMRVEEVERAVEEGDVIMFLIPDMVQPEVYKRLVRDKLEEGDML
FT                   MFAHGFNIHYNQIVPPEFVDVTMVAPKSPGHLVRRMFVEGKGVPALLAVHQNYTGKALE
FT                   IALAYAKAIGCTRAGVIETTFKEETETDLFGEQVDLCGGVTELIKATFETMVEAGYQPE
FT                   VAYFEALHELKLIVDLIYEGGLMKMWNAVSETAKYGGLTRGKRIINESVREEMKKILKE
FT                   IQTGEFAREWILENKAGRPVYNKLLEMEKEHLIEKVGAKLRKMMPWLE"
FT   gene            295062..295343
FT                   /locus_tag="Arcpr_0348"
FT   CDS_pept        295062..295343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0348"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: pca:Pcar_2311 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57418"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038767"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ3"
FT                   /inference="similar to AA sequence:KEGG:Pcar_2311"
FT                   /protein_id="ADB57418.1"
FT                   /translation="MEKTLLEEIIDLLEKEVLTTKEICYKLGLEPEREKDIYSILDRIA
FT                   KIVRRKGKRLMMIPPRCKNCGFEFSKPKATRCPKCKSERVEPARFTIR"
FT   gene            complement(295336..295815)
FT                   /locus_tag="Arcpr_0349"
FT   CDS_pept        complement(295336..295815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0349"
FT                   /product="arginine decarboxylase, pyruvoyl-dependent"
FT                   /EC_number="4.1.1.19"
FT                   /note="KEGG: sat:SYN_01577 pyruvoyl-dependent arginine
FT                   decarboxylase; TIGRFAM: arginine decarboxylase, pyruvoyl-
FT                   dependent; PFAM: Pyruvoyl-dependent arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57419"
FT                   /db_xref="GOA:D2RGJ4"
FT                   /db_xref="InterPro:IPR002724"
FT                   /db_xref="InterPro:IPR016104"
FT                   /db_xref="InterPro:IPR016105"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ4"
FT                   /inference="protein motif:TFAM:TIGR00286"
FT                   /protein_id="ADB57419.1"
FT                   /translation="MLLPKKVFFTKGVGRHEDALVSFELALRDAGIEKFNLVPVSSIYP
FT                   PNCVEVSREEGLKELKPGQIVFCVMAKFTSNEEGRTIYASVGVAIPEDRNLNGYLTEYM
FT                   GYCEEDEDVGKYAEENARYMLETAFGVKPARVFNVTAKAKVEKYTTVVAAAVFII"
FT   gene            complement(295842..297059)
FT                   /locus_tag="Arcpr_0350"
FT   CDS_pept        complement(295842..297059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0350"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: wbm:Wbm0684
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57420"
FT                   /db_xref="GOA:D2RGJ5"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ5"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADB57420.1"
FT                   /translation="MRLPTLDDVDYDGKSVLVRVDINAPIVNSTILDTTRFESHIPTLK
FT                   ELESAKVVLLAHQSRPGKKDFTTLKAHAEVLSNLLGRKVKYVDEIFSSRAIEEIKSLKI
FT                   GEVLLLENVRFYSEEQLKRSAEEHATCHMVQRLKDLFDLFVNDAFSACHRPHASLIGFV
FT                   PILPSVVGRLVEREVKALSRVFEEKGRKVFILGGAKIEDAVKVLKNVLTKGIADKVILT
FT                   GVVANYFLMLSGVDIGEVNKNVVKENKGDVSDEEMLEILKKYRDKIVLPKDVAVDKDGV
FT                   RVDVPLEKFDGKYMIKDIGIETISMLSEEIPKYDVAVINGPAGVFEDERFTLGTSEILK
FT                   AVAKAKYSVVGGGHIATATRMFGLDKLMDHISTAGGACIRFLSGEKLIALEVIREYWEK
FT                   EWSKKI"
FT   gene            complement(297133..298299)
FT                   /locus_tag="Arcpr_0351"
FT   CDS_pept        complement(297133..298299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0351"
FT                   /product="GTPase of unknown function domain protein"
FT                   /note="PFAM: GTPase of unknown function domain protein;
FT                   GTP-binding protein HSR1-related; TGS domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57421"
FT                   /db_xref="GOA:D2RGJ6"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ6"
FT                   /inference="protein motif:PFAM:PF08438"
FT                   /protein_id="ADB57421.1"
FT                   /translation="MIEIGLAGKPNAGKSTFFKSATLIDVAIANYPFTTIEPNVGIAYV
FT                   RTRCVCRELGIECGKCVDGWRFIPVKLIDVAGLVPGAHEGRGLGNEFLDNLRQAEGIIH
FT                   VVDASGSTDEEGNEVGVGEHDPVEDVKFLREELDMWLFGILKRNWNKIARRIHLERRDP
FT                   AKFITEQLAGLGFEEWMVKQALKVVGKGVHEFSDEDLKVFAQELRKVRMKMVIAANKAD
FT                   KAPDELIKRLLSLDEIVIPTSAYYELALRLASKNGYIKYLPGDEDFEILKPLNEKQKKL
FT                   LDEIRAFMKKYGGTGVQKAINTLVFDVLNYIVVYPVEDENKFTDSKGNVLPDAFLVKKG
FT                   TTVRELAYKIHTEIGESFIYAIDAKRKVRIGEDYELKHNDVVKIVSAK"
FT   gene            complement(298296..298547)
FT                   /locus_tag="Arcpr_0352"
FT   CDS_pept        complement(298296..298547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57422"
FT                   /db_xref="InterPro:IPR018662"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ7"
FT                   /inference="protein motif:COG:COG4003"
FT                   /protein_id="ADB57422.1"
FT                   /translation="MIEWDIDKFKRMFPNLYREIFSVPTIYDHFEICQNEKEALEIIDY
FT                   FERKGELSKEEADYLRRNLPKHLFGKRKRGDFARRGSR"
FT   gene            298612..299538
FT                   /locus_tag="Arcpr_0353"
FT   CDS_pept        298612..299538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0353"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   dvu:DVU0283 AhpF family protein/thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57423"
FT                   /db_xref="GOA:D2RGJ8"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ8"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ADB57423.1"
FT                   /translation="MPKLFMNYDVAIIGCGPAGLTCAIYATRYGLKTVVFEDPTNPSQL
FT                   ALAPQIENYPGFEGTGFELLNKMKEQAEKFGAEIKIEKVENVARDGELFTIKTDEGEYK
FT                   AKAIVFATGSKHRKLGVEGEKEFIGRGVSYCAVCDGFFFKGKKVLVVGGGNTALVEAIY
FT                   LHDLGCDVTIVHRRDEFRAEKALQDRVFEKGIKVIWNSVVERIEGKDRVERVVLRNVKM
FT                   GEVFTVEVDGVFVAIGVEPNVELAKELGVELENGYIKVDRYQRTNVEGVFACGDCCNNP
FT                   LKQVVTACGDGAIAGFSAYQFISRRKE"
FT   gene            complement(299516..300928)
FT                   /locus_tag="Arcpr_0354"
FT   CDS_pept        complement(299516..300928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0354"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: dde:Dde_2029 K+ transporter
FT                   trk"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57424"
FT                   /db_xref="GOA:D2RGJ9"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGJ9"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADB57424.1"
FT                   /translation="MNFGLVINTLGKISLAFFALMVGLTILAIYFNEDPVPFLTSSLFS
FT                   LGLGILLTAKKAESDVLRFKEGFAIVGLGWLLVSFLGSIPFMYYIHPINAFFESISGFT
FT                   TTGASVIDKPELLPRSILFWRSLTQWIGGIGIIMIFLLIIPNIATGAVFQAEYPGITLV
FT                   KIKPRIRDTALRLYLIYVSLTVAEIVILKFLGVPIFDAVTHAFTTLSTGGYSTHSQSIA
FT                   YFKDWRVEFSIAIFAILGGSNFSIFYFLCLRRFEVLRDREFIIYILLVTILTVTITLLN
FT                   LDRYDLINSFRYSFFQVASIITTTGYTTTDFDKWGSGAKMLLLIAMFIGGCSGSTAGGM
FT                   KVIRLYIMSKYAISQVVKSAEPKVVRIIKYGDRALRSDIVESVVAFFVLYIFIFTISSL
FT                   IIALHGYDIVTSLSATAACLGNVGPGMGLAGASETYSHFPWTIKILLCLDMWIGRLEIY
FT                   TVLALFIPSFWR"
FT   gene            301134..301307
FT                   /locus_tag="Arcpr_0355"
FT   CDS_pept        301134..301307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0355"
FT                   /product="putative transcriptional regulators,
FT                   CopG/Arc/MetJ family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57425"
FT                   /db_xref="GOA:D2RGK0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK0"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADB57425.1"
FT                   /translation="MKKISVRLTDQHYEMLETLVAIGEYASVSEAIRDAIRKLIAEKAE
FT                   LVEKHAKMKPFV"
FT   gene            301317..302399
FT                   /locus_tag="Arcpr_0356"
FT   CDS_pept        301317..302399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0356"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   plastid division protein FtsZ (AB032072); K03531 cell
FT                   division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57426"
FT                   /db_xref="GOA:D2RGK1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK1"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ADB57426.1"
FT                   /translation="MKSFIAKAQEFSRIEKVVGDDEFFVPKIIVVGVGGSGCNTVNRLM
FT                   NIGLNGVETIAINTDYQHLKMIKANKKILIGRSLTKGLGAGGYPEIGRKAAESARYKLE
FT                   ELLADANMVFVCAGMGGGTGTGAAPVVAEVAKKNDAIVIGVATMPFSTERARLIKAYEG
FT                   LEEFRKHCDTVILLDNNKLLEYYPNLPLEQAFSVMDQIIAETIKGITDTIMYPSLVNID
FT                   FADVRAIMKSGDVAALFVGESKSQQRAKDVVRNCLSHPLLEADIRGATGVLVHISGGRD
FT                   LTVKEVQEIVRELTFEIDEKANVIWGARVDPSLENLVRVVTIMTGVKSPNLLSNFEEGN
FT                   GRKIVREIDEKGKEKFIDYI"
FT   gene            complement(302415..303350)
FT                   /locus_tag="Arcpr_0357"
FT   CDS_pept        complement(302415..303350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0357"
FT                   /product="deoxyhypusine synthase"
FT                   /EC_number="2.5.1.46"
FT                   /note="KEGG: Deoxyhypusine synthase family protein; K00809
FT                   deoxyhypusine synthase; TIGRFAM: deoxyhypusine synthase;
FT                   PFAM: deoxyhypusine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57427"
FT                   /db_xref="GOA:D2RGK2"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR022899"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK2"
FT                   /inference="protein motif:TFAM:TIGR00321"
FT                   /protein_id="ADB57427.1"
FT                   /translation="MKVGDIQLKSGMTVNELIKELYKSGGFTAKDLAVAVDIFEEMIKD
FT                   EECTVFLSFPACIIATGTRGVIKELVKRRLVDVIVTTCGTLDHDLARIWKDYYHGSFML
FT                   DDVELYKKGIHRIGNVLTPKESYGLILEEKLQPIFEDIYNEGKRRISTRELIWEVGKRI
FT                   EGEENADSSIVYWCYKNKIPVFVPGITDGAFGSQLWLFYQTHKDFIVDVLKDEDELSEI
FT                   IFNAKRSGALIVGGGISKHHTIWWNQFKDGLDYVVYITTAVEWDGSLSGARVREAISWG
FT                   KVSESAKSVNVYGDATVLLPLIVASILERL"
FT   gene            303393..304016
FT                   /locus_tag="Arcpr_0358"
FT   CDS_pept        303393..304016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0358"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   cvi:CV_2425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57428"
FT                   /db_xref="GOA:D2RGK3"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK3"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ADB57428.1"
FT                   /translation="MKPLGVCKNCGDFEGMCKCGKGKILIDGEKRERISKFLSGLLRHY
FT                   PHSFGLKVDEFGWVDLKEVLKILKERYGVGRKVVELIVKFDPKGRFEIKDGKIRARYGH
FT                   SIDVKVDWSEAEEIPEKLYHGTSPKNLESILKEGLKPMRRKEVHLSATIEDAIEVGRRH
FT                   HPQPVVLEIYTECLIKHGLSVRKKGSVYTTDYVPPQCLKVLDMK"
FT   gene            304077..305486
FT                   /locus_tag="Arcpr_0359"
FT   CDS_pept        304077..305486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0359"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   dps:DP0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57429"
FT                   /db_xref="GOA:D2RGK4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028348"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK4"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADB57429.1"
FT                   /translation="MKKFDVIIVGAGPGGLFAGYKLAGKLSVAIFDMGRDIDKRKCPSD
FT                   LSQSFCQKCKPCNITYGVGGAGGLSDGKLNYPIPEFPSSFTVGGDLLGLVDTEYLLKKM
FT                   EEVDEIFLKHGAPDEVYGTDMEKVNEFLRKANSAGIEFVPLKQRHVGSDELPKVIKSIE
FT                   KYLKDNGVKIYTRKTVVDINPKEKVITLKNGEKYAYDYLIIGVGRGGSEWLEKWVKQYN
FT                   IAVSEKAKFIDVGVRVEVPASIMDEITSVIYDPKLRVLTKRHDDYVRTFCTCPRGWVIR
FT                   EDYGDFCLVNGHSKAKEKTNNTNFALLGHYEFTEPFEEPNEWGRDLARITTKLGGGNPI
FT                   VQRLRDLRLGRRSTERRIANNRLVQPTLKTAIPGDISLAYPGRVIDDIIDALEALDKVI
FT                   PGVADDSTLLYAPEIKFYSLRLKVNSEMETSIPNVYAIGDGAGVSRGIVGAAVTGLIAA
FT                   ESILRKAKKSS"
FT   gene            complement(305495..306946)
FT                   /locus_tag="Arcpr_0360"
FT   CDS_pept        complement(305495..306946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0360"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /note="TIGRFAM: dihydropteroate synthase-related protein;
FT                   PFAM: dihydropteroate synthase DHPS; KEGG: mno:Mnod_5321
FT                   dihydropteroate synthase DhpS"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57430"
FT                   /db_xref="GOA:D2RGK5"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR025595"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK5"
FT                   /inference="protein motif:TFAM:TIGR00284"
FT                   /protein_id="ADB57430.1"
FT                   /translation="MKILLVTGKIAEREVRKIAEKYDCDVYVADVDVASFITPKHLENL
FT                   DLSRYDIVIVPGLASGDWKRLEDEKGVKIRLGTIHYADLPLLLENIDKIELSHEIPACK
FT                   LLNINKAEENMRLVDSLDKCYFHIGDVRIGGRMKIVAEIVDATKLDNDSLIAKIEYYLK
FT                   SGADIIDLGIPLEFDSRDVERVVKVARDCCDALSIDTFNRKAVEIGVKYGVDMIMSVSN
FT                   ENLDCLELAKDKAVVVVDRNVNNLLKLVEKAKKYTEKIIADPLLDPLDVFSSLMRYYEF
FT                   RKRCSIPLLMGVGNVTELMDADSIGINALLAYIAEEIGCQILFTTEASDKTRGSIRELK
FT                   VATYMAKVSKLKRVPPKDLGFDLLVFKEKRIRRNKCEAGNIVEAKPSEFTRDPMGDFRI
FT                   WIDDRIYCQHEKATVVGDKAKDILDTIIRLGLVSRLDHAGYLGRELKKAEMALKLGKSY
FT                   VQDEELNFGIYSKEFSTDHTKRQKD"
FT   gene            complement(307042..310167)
FT                   /locus_tag="Arcpr_0361"
FT   CDS_pept        complement(307042..310167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0361"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   hypothetical protein; K01870 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57431"
FT                   /db_xref="GOA:D2RGK6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK6"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ADB57431.1"
FT                   /translation="MFPNAYSPHEVEREVREFWEKNKIYEKVKSKGDRLFFFVDGPPYT
FT                   TGRIHLGTAWNKVIKDTILRYKRMMGYKVTDTPGWDMHGLPIEVKVEQMLGFKTKRDIE
FT                   NYGIDKFIAKCMEYALQNKDAMTEQFKALGVWMDWENPYMTIKAEYINSAWWTIKRAYE
FT                   QGLLEKKLRVVNWCPRCETALADAEVEYADKEDPSIYVKFPIKGRENTYIVIWTTTPWT
FT                   LPANMAVAVHPDFEYGLFEAVKDGKKEYLILAKDLADNVLSKSYDEWKLVETYRGEDLY
FT                   GLEYEHPLAEEVPVQKEKQHRVVNADFVAHENTGCVHIAPGHGLEDFELGLEEGLEVFN
FT                   PVDDRGIFKEDAGKYAGMHVFEANKVIIKDLKAKGLLLAEETIVHRYGHCWRCKTPIIY
FT                   RATEQWFLAVSKLKDKMLEEIDKVWWIPEWAGKSRFKDWVSNAKDWCISRQRYWGIPIP
FT                   IWICEKCGKWKVVGSINEVPWKDDLDLHRPKIDEVVFECECGGKMYRVKDVFDVWFDSG
FT                   VASWGTLGYPLKISDEEFFKIWPADFITEGHDQTRGWFYSQLGASVISFGRAPYKTVLM
FT                   HGFTLDEQGRKMSKSLGNVVEPEEVINEVGVDTFRLYVLSSALWEDLRFSWNEVRNVLR
FT                   MLNIYWNAIRFAYTYMSLDREMITPDKIQQIFGCDFDSALKKIEDYENRWILSRLESLN
FT                   KVAWDAMENYQLHRVVRAFLDFVVEDFSRWYIQLIRPRVWVEGEDKLKIATYLTLLRVI
FT                   EKSIKIIAPFAPFLAEFIYQRFLKEFRDCEESIFMESYPKHDESFIDEELEKSMAVIRE
FT                   IFEAASSARQKARRKLRWPLRELVIESKDEIVKRAVDMLEGIIKSQCNVKSVRVVDEFE
FT                   KEIVIKPNYKVVGKILKDRVKEFAKFLESLSDDELKKIAETKAVEFDGEVIEDAVVVEY
FT                   KLPDGYEFEEFSRGNVYIYTVLDEELKREAYARELVRRIQEMRKEMDLNVEEFINVVVE
FT                   FPKELVEGWEEYIKGETRAKSLVFGKPEKGYIKEWDIEGIKAVIGIERIEGQ"
FT   gene            complement(310548..311327)
FT                   /locus_tag="Arcpr_0362"
FT   CDS_pept        complement(310548..311327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0362"
FT                   /product="protein of unknown function DUF75"
FT                   /note="PFAM: protein of unknown function DUF75"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57432"
FT                   /db_xref="InterPro:IPR004426"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK7"
FT                   /inference="protein motif:PFAM:PF01908"
FT                   /protein_id="ADB57432.1"
FT                   /translation="MLKRVDVRYLKEPEGVGLKDPVFIEGLPGIGHVGKLVADHLVKEL
FT                   DTVKVVEIYSHHFPPQVMVNEDGTIRLPKNEVYAYKSDGNSPDLLILVGDFQSMDGIGH
FT                   YELVNAYIEIAKKFGAKRIFTLGGYGVGRMVEEPYVIGAANTPELVEELKKFGVKFEKG
FT                   EPSGGIIGASGLLLGVSQLEGIEAACLMGVTSGYMVDPKSAKAVLDVLMKILNLKVSVE
FT                   DLEERAKEMEKFIEQIREMQEQVVQQYRSDEDLRYFR"
FT   gene            complement(311311..311511)
FT                   /locus_tag="Arcpr_0363"
FT   CDS_pept        complement(311311..311511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0363"
FT                   /product="RNA-binding protein Nop10p"
FT                   /note="PFAM: RNA-binding protein Nop10p; KEGG: Ribosome
FT                   biogenesis protein Nop10; K11130 H/ACA ribonucleoprotein
FT                   complex subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57433"
FT                   /db_xref="GOA:D2RGK8"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK8"
FT                   /inference="protein motif:PFAM:PF04135"
FT                   /protein_id="ADB57433.1"
FT                   /translation="MKVKMRKCPKCGRYTLKEVCPNCGEKTFMPIPPKFSPEDPYGKYR
FT                   RKLRKEVGFFNIGRWRHAEEG"
FT   gene            complement(311561..312592)
FT                   /locus_tag="Arcpr_0364"
FT   CDS_pept        complement(311561..312592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0364"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: gur:Gura_2451 SufBD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57434"
FT                   /db_xref="GOA:D2RGK9"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGK9"
FT                   /inference="protein motif:PFAM:PF01458"
FT                   /protein_id="ADB57434.1"
FT                   /translation="MPEDSLKKVGIERDPSKRSASFLMVDDKPTISFARNVEVMSTKQA
FT                   LEKYEWLKDYSWKLIEREEGEFDGYFIRVPKGVKVDFPVEACLYLKRVKSQKVHNIVIA
FT                   EEDSELNLITGCTSERLSGLHLGISEFYVKRNAKVTFTMIHNWKKKNEVLPKTAIKVEE
FT                   NGTFISNYVLLSPVKYLKAYPTAYLDKNAKVVFSSVIVGFEDSEIDLGSRVYLNGEGSS
FT                   AEIISRSISKGGKIVARGHIIGNAEGVKGHLECKGMILGGGIIHAIPELEARNPNVDLS
FT                   HEAAIGKIAEDEIFYLMTRGLSRDEAISLIIRGFMEIDIKGLPEVLKKEIDKAIELVEK
FT                   ALI"
FT   gene            complement(312574..313329)
FT                   /locus_tag="Arcpr_0365"
FT   CDS_pept        complement(312574..313329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0365"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_0164 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57435"
FT                   /db_xref="GOA:D2RGL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB57435.1"
FT                   /translation="MDRGILRIVNLGVEVDGRKILQNVNLYIQRGQTYALFGPNGSGKS
FT                   TLLMAIAGNPKYKIYDGRIIFKGKDITNMSPDERVKMGLGISYQNPPKIPGVKLRDLIK
FT                   HCAKLGGTEDKIEEYVKMLKMENLLDRDLNVGFSGGEVKRSELLQLLLMNPEFAMLDEP
FT                   DSGVDLENIAVIGKAISKLLERDKPEEERTKSGIIITHTGHILKYVDADYGVIMYKGRI
FT                   ACVGDPYDILKTVENYGYEECVKRCLRTL"
FT   gene            complement(313370..313840)
FT                   /locus_tag="Arcpr_0366"
FT   CDS_pept        complement(313370..313840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0366"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: dal:Dalk_3260
FT                   phosphodiesterase, MJ0936 family"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57436"
FT                   /db_xref="GOA:D2RGL1"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL1"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADB57436.1"
FT                   /translation="MKFVAISDTHDNMQAIRDLIDALKSERFDFIVHAGDIVAPFAMKA
FT                   LKNLGKKIYFAFGNNDGEKRLLTKIAEDNEWVIGEIVEFPEGVVYHGTDARIVEILKKT
FT                   NHRYLVLGHTHEVKVERVENKIIINPGEICGYLTGRRTFAIVEDGVVSVVEF"
FT   gene            complement(314202..314768)
FT                   /locus_tag="Arcpr_0367"
FT   CDS_pept        complement(314202..314768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0367"
FT                   /product="protein of unknown function DUF447"
FT                   /note="PFAM: protein of unknown function DUF447; KEGG:
FT                   msl:Msil_2393 protein of unknown function DUF447"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57437"
FT                   /db_xref="GOA:D2RGL2"
FT                   /db_xref="InterPro:IPR007386"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL2"
FT                   /inference="protein motif:PFAM:PF04289"
FT                   /protein_id="ADB57437.1"
FT                   /translation="MKLSDFGFTDGINEVIGITIGEWINTAPLGIIVENPESTFAKLRI
FT                   YPSHTRENLKKGTLYVNIVHDPLVFTISAFDDLSEDWFESSDPPIINGALAWCQFKANL
FT                   KNCWVDLELSRGEVLRKGLRAVNRGFNALIEALVHATRLKQNPKLIEKVRYYAEIVEKC
FT                   GGRREKEALEVMWSYLRKLYPHLSL"
FT   gene            complement(314765..315598)
FT                   /locus_tag="Arcpr_0368"
FT   CDS_pept        complement(314765..315598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0368"
FT                   /product="triphosphoribosyl-dephospho-CoA protein"
FT                   /note="PFAM: triphosphoribosyl-dephospho-CoA protein; KEGG:
FT                   bxe:Bxe_B2435 putative triphosphoribosyl- dephospho-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57438"
FT                   /db_xref="GOA:D2RGL3"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL3"
FT                   /inference="protein motif:PFAM:PF01874"
FT                   /protein_id="ADB57438.1"
FT                   /translation="MPFESMNDAQLGVLSLLLEVSANPKPGNVDREHEFSDLKFEHFIL
FT                   SAISAYPAFEDCMNRRGSIGTNFFNAVVRSYEICRTNVHFGAFFLLIPLIWCGGKVDDV
FT                   EDELKKTTHEDSLAILSAFRICKPRVMKVKELDLRGEKVKEEILEKKVNLYHWLEKSPK
FT                   ENVVARELVERYWRSLEGCTILRNRYEQCGNLNEAIVYTYIYLLSKHLDPLVIAKHGLD
FT                   TAYYVKERAEEFLDEFSLEGVRKFDEELVKRGINPGSIADLTCSSIYLALKEGLI"
FT   gene            315625..315845
FT                   /pseudo
FT                   /locus_tag="Arcpr_0369"
FT   gene            315855..316883
FT                   /locus_tag="Arcpr_0370"
FT   CDS_pept        315855..316883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0370"
FT                   /product="protein of unknown function DUF43"
FT                   /note="PFAM: protein of unknown function DUF43; KEGG:
FT                   rpb:RPB_2044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57439"
FT                   /db_xref="GOA:D2RGL4"
FT                   /db_xref="InterPro:IPR002723"
FT                   /db_xref="InterPro:IPR014435"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL4"
FT                   /inference="protein motif:PFAM:PF01861"
FT                   /protein_id="ADB57439.1"
FT                   /translation="MMRRIKNQVLQALYRREMSVYELIDEQDASLPEFFELIQSMEREG
FT                   LIKVENGMISLTDKGLKLCEELGVKKVEKLTCDCCEGTGYAIKGIFESTLKEYSEIAKD
FT                   RPEAIEVYDQGFISLDGVIRRVEFLFERGDLLKTEIFVVGDDDLFSLASALTGLPKRVF
FT                   VVDIDERLIDFINKKADEYGLPVEAQVYDVQQAFPEELKGKFDVFVTDPVETIPGLKLF
FT                   LSRGVSTLKGVGCSGYFGLTTLEASRRKWYEIQKMIHDMGFVITDIRRKFNVYPQDEKN
FT                   FFRFQEKLPIVKKLGAKVDYNWYKSSLYRIEAVKEPKPLVEGEMRIDEKVYKDEESWAT
FT                   PY"
FT   gene            316885..317358
FT                   /locus_tag="Arcpr_0371"
FT   CDS_pept        316885..317358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0371"
FT                   /product="PUA domain containing protein"
FT                   /note="PFAM: PUA domain containing protein; SMART: PUA
FT                   domain containing protein; KEGG: hypothetical protein;
FT                   K07575 PUA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57440"
FT                   /db_xref="GOA:D2RGL5"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR015266"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016437"
FT                   /db_xref="InterPro:IPR022430"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR039757"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL5"
FT                   /inference="protein motif:PFAM:PF01472"
FT                   /protein_id="ADB57440.1"
FT                   /translation="MKRYRLRKKDSKAISKFFEENYKISIKGDMEKFEFDDISIITVDN
FT                   EPIILEYEGRYYFTVYGVIKFKPEKGKVVVDEGAMPYIMKGADVMKPGIVEADESIKAG
FT                   DFVYVAVEKKMTPIAVGIALVDGIEMKGGKGKAVKNIHHLKDKIWNYFFVSKK"
FT   gene            complement(317360..317857)
FT                   /locus_tag="Arcpr_0372"
FT   CDS_pept        complement(317360..317857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0372"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57441"
FT                   /db_xref="InterPro:IPR014424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL6"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADB57441.1"
FT                   /translation="MWRKIAEKFEKYPSQIVVAKEFLRLGISVRNGKAYCDKIELVPTK
FT                   IAEALDVDRKVVVSAIQNIESDEELRKVFSSLKPVANITEVARILGFGVLEVYAESHKV
FT                   GIVAGITSILAKEGIPIRFILAEDPELSVESKLTIVTDGKIPGRLVDEFLKVDGVQKIV
FT                   IS"
FT   gene            complement(317871..319010)
FT                   /locus_tag="Arcpr_0373"
FT   CDS_pept        complement(317871..319010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0373"
FT                   /product="TraB family protein"
FT                   /note="TIGRFAM: TraB family protein; PFAM: TraB determinant
FT                   protein; KEGG: dal:Dalk_0214 TraB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57442"
FT                   /db_xref="GOA:D2RGL7"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL7"
FT                   /inference="protein motif:TFAM:TIGR00261"
FT                   /protein_id="ADB57442.1"
FT                   /translation="MAEVYIVGTAHVLRESVEKVHKVIEEVNPDAVAVELCPRRYNALI
FT                   NNVQSISLSDVLKSGNISLALLQIVLAYFQRKIGEETGVRPGEEMLTAIKKARELGADV
FT                   LLIDRDIGITFQRLWQKMSFFEKLKFGWNILKGLFSKEDVEDVASNVDSLIEEFRKISP
FT                   KAGEVLIDERDAYMAYNIIRVSERYNKIVVVVGAGHKKGIEGYLKNPEKLPPIEKLLEV
FT                   KKGKFSLSKAFGWILSALIVGTFAYILTKLGSEMALKAFMYWFLINGTLSALGATLALA
FT                   HPLSILAAFLCAWLTSINPLVAAGWVSGYVELKMRKPSVDDLISLSNASSLKDLWRNKA
FT                   FRVLLVAALTNIGSIIGTIYGAYVVLQMTGIDIRKLLIP"
FT   gene            319113..320363
FT                   /locus_tag="Arcpr_0374"
FT   CDS_pept        319113..320363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0374"
FT                   /product="Phenylacetate--CoA ligase"
FT                   /EC_number="6.2.1.30"
FT                   /note="KEGG: gbm:Gbem_2192 phenylacetate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57443"
FT                   /db_xref="GOA:D2RGL8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL8"
FT                   /inference="protein motif:PRIAM:6.2.1.30"
FT                   /protein_id="ADB57443.1"
FT                   /translation="MRLLLKAEKGVKMSRKKIEEIKNRRFRRIVRYVYQNCPFYRRKFK
FT                   SAGIDVDKIRSVEDISKLPFTTKQELREAYPLKILCVPKEKVVRIQMSGGTTGQPVIIP
FT                   YTRKDVEQWKEMMLRAFYIANITSKDVIQITPAFGLWNGGFGFHFAADAINAFVVPIGP
FT                   GNTRNQLRFMRDFGTTVLCSTASYPLRLLEVAKEMGIDLNELELEKMLLGAEPWTEEMR
FT                   KIIEREFDVIAYDIPGLTEMGGVGTVGFECPERMGLHMWEDNYIVEVVDPETGEVLDEG
FT                   EEGEVVYTALNREAMPLIRYRSGEVSAVVSREPCECGIEHMTIRRIRGRTDDMIIYRGV
FT                   KFYPADVEEILASYGITQYRIVLDSKVIVEFEGDESLVLKLARDFKEFLGFKPKLVALP
FT                   FGTLERFEGKAKRLVKS"
FT   gene            320403..320487
FT                   /locus_tag="Arcpr_R0012"
FT                   /note="tRNA-Leu1"
FT   tRNA            320403..320487
FT                   /locus_tag="Arcpr_R0012"
FT                   /product="tRNA-Leu"
FT   gene            complement(320733..321464)
FT                   /locus_tag="Arcpr_0375"
FT   CDS_pept        complement(320733..321464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57444"
FT                   /db_xref="GOA:D2RGL9"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57444.1"
FT                   /translation="MNLIIADTLPALMGLIVVALSAVAYSSLSAKIDARAINPRDIAVC
FT                   ILLLVVTAIYKGVTGILTMFYGIDPTYHTLHGLILLMIVEAVILVRLLHIFKSVGALRI
FT                   NRDTFEFLIYLAVLHLVAREVDEYIRIYLSNFETIVQVVIMSFVASITLIGLVLGAYLL
FT                   KIHKELASLVDAVDVVPPVKTSCIAFSFVGLYGIHRVSHTIPHSCFLLALAALSLLVAG
FT                   VQLLLELEMKYLKPLRRHNRI"
FT   sig_peptide     complement(321390..321464)
FT                   /locus_tag="Arcpr_0375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.696 at
FT                   residue 25"
FT   gene            322449..323012
FT                   /locus_tag="Arcpr_0376"
FT   CDS_pept        322449..323012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0376"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: sfu:Sfum_1697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57445"
FT                   /db_xref="GOA:D2RGM0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM0"
FT                   /inference="protein motif:COG:COG2220"
FT                   /protein_id="ADB57445.1"
FT                   /translation="MKLRWLGNSCVEIIDDLHTVIDPNYVIEPEPEIDYVLVTHEHNDH
FT                   IDVEKLKSLKYKHLVAPEYTLKLYNLEGIKAEVGKELDGIRILPSWCWKAEESVSYYYK
FT                   GVLHSGDSAKFPDVKDVKVAFTACFPDFYDDYVREMKRLKPELVIPIHYDPERKLKNAE
FT                   GLVERLRNEGINARIVKIGEVVEI"
FT   gene            323009..324121
FT                   /locus_tag="Arcpr_0377"
FT   CDS_pept        323009..324121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0377"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   Alcohol dehydrogenase 3 lateral transfer candidate"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57446"
FT                   /db_xref="GOA:D2RGM1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM1"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADB57446.1"
FT                   /translation="MKSFELRYAYTHLYFGLNAVEKIRNHLNSVERVTIATGKQSARVS
FT                   GALKDVETILRDLEIEYEVFDKIKANPTVEIADDLAKVVWENGSDCIIAIGGGSVIDTA
FT                   KVSSCIALSGGKAEEYLKGRKAKRYLPLLAINLTHGTGSEIDKFAVLTHEREKIGISIR
FT                   YPDFSFDDPKYTLTLPKEQSIYTTIDAFFHAYEAVTAKTTNPFVETLVFECARIIGENL
FT                   PKEQKLEEKYNLLYASMIAGIALDMSPAHIVHAIEHALSGINPKLAHGCGLALIGPRAI
FT                   YWIHKHSENSAKILRCLVGRDVSSAEEAEKIFREFLNSIGFNERLSDYIGRDDFKDVEK
FT                   IVFGPLKYLLNRIDFEFTREMLYDILERSL"
FT   gene            324155..325087
FT                   /locus_tag="Arcpr_0378"
FT   CDS_pept        324155..325087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0378"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: ngo:NGO1894 putative
FT                   5-methylcytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57447"
FT                   /db_xref="GOA:D2RGM2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM2"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ADB57447.1"
FT                   /translation="MNVVDVFAGCGGFSRGFKEEGFELVAAIENFKPVAETYKTNFPEV
FT                   EVIVKDVKEVRGFDVERICGDVDVLIGSPPCEPFTSVNLRRMKKPEDRLYKDKRGQLVL
FT                   HFIRLVRELKPKVFVMENVPQILEIRNAIEREFRKIGVYRVYFNVLKAQNYGNPSKRTR
FT                   VFISNVPIDEKPAKRYVKVADALRDLPPLNTIPNHEEIRISKSKLEKIAMLRWGESLVK
FT                   FGGRFENWLRLHPYKLAPTVMGHSRFIHPFEDRLLTVREQARLMGFPDDHVFLGGKNVQ
FT                   FDMVGEAVPVPLAKAVAKEIKLKISEMEI"
FT   gene            325246..326229
FT                   /locus_tag="Arcpr_0379"
FT   CDS_pept        325246..326229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0379"
FT                   /product="isopropylmalate/isohomocitrate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: aha:AHA_1152 isocitrate dehydrogenase;
FT                   TIGRFAM: isopropylmalate/isohomocitrate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57448"
FT                   /db_xref="GOA:D2RGM3"
FT                   /db_xref="InterPro:IPR011828"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM3"
FT                   /inference="protein motif:TFAM:TIGR02088"
FT                   /protein_id="ADB57448.1"
FT                   /translation="MKKIVVIPGDGIGKEVIPATLHILQGLDLPFEYVYAEAGDECFEK
FT                   YGTPLPEETLELCKESDAILFGAVGETAADVIVKLRQELDLFANVRPAKSMRGVKCLYD
FT                   NVDLVVVRENTECLYKGYEFDVGDSAVAMRVITRKGCERIVKFAFEFAKREGRKKVTAL
FT                   HKANVLKKTCGLFKRTFYEIARNYDIEANDYYIDAGCLYLVTKPWIFDVIVTTNLFGDI
FT                   VSDLTAGLVGGLGLAPSANIGERYALFEPVHGSAPDIAGKGIANPTATILSACMMLRHL
FT                   GFSEVAEKIEKALKKVIAEGKTTPDLGGNLKTMEFAEEVLKACREV"
FT   gene            326257..326889
FT                   /locus_tag="Arcpr_0380"
FT   CDS_pept        326257..326889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0380"
FT                   /product="NADPH-dependent F420 reductase"
FT                   /note="TIGRFAM: NADPH-dependent F420 reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; KEGG: eba:p2A348
FT                   oxidoreductase, F420-dependent NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57449"
FT                   /db_xref="GOA:D2RGM4"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM4"
FT                   /inference="protein motif:TFAM:TIGR01915"
FT                   /protein_id="ADB57449.1"
FT                   /translation="MIISIVGGTGNLGKGLAVRLALAGYKVVVGSRMVEKAEEKAKEYS
FT                   KLCGCKIEGLSNDKAIDICDVAILTIPWKSALDFVKNYRDSLSKKIVISPIVPMVKEGE
FT                   FVYKPLNGSMAESIAKILGNKVVSAFQNIPAKRFSNLNETPEFDVIVCGDNEEAKAVVM
FT                   EIVNSIERLRALDGGPLSNSRIVESLTPFLINLASRNGLKELGVKFV"
FT   gene            326954..328573
FT                   /locus_tag="Arcpr_0381"
FT   CDS_pept        326954..328573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0381"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   sfu:Sfum_4067 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57450"
FT                   /db_xref="GOA:D2RGM5"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM5"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADB57450.1"
FT                   /translation="MERVLRNSSYLNAMSTTSTRTRVRDVNPQSGMCPLCIRECPFLCE
FT                   IGLSAFRGREALYPDPQYFGDSTASGLKDYGLDWSHIQILPRLRGAEGIEPDPDKMLFP
FT                   KASVETEIGGIKLKMPVAIGAYGSTDVARKYWDGIAIGSALAGVILIIGENVCGVDPES
FT                   TFSNGKVVRSPEMERRIKLFREFWDGKYGNIAVQTNVEDQRIGVDEYVISKLEVDIIER
FT                   KWGQGAKAIGGEIRVYSLERAIELKKRGYLIIPDPEDPEVQQAFKDGLFKSFERHSRVG
FT                   SPRAADVIEDVERLREMGAKVVTIKTGAYRPVDVAWTLRVASEAKVDYVTFDGAGGGTG
FT                   MSPVPMMNEMGVPTVYLESLILKALLALKKKGKYVPDISMAGCFINETQIFKAIAMSNF
FT                   DGKPFVKTVTMGRSPLTAVMKASYFCELASQGKLPREFARRFGETPDKFFILADELKAK
FT                   YGDKVGKEIPWTAVGLYTYLDRIKEGLKQLLAGVRKFRIDLIDRNDLASLKPLAAEVTG
FT                   IPMVHEVDKELFEQILDASTIE"
FT   gene            328780..330237
FT                   /locus_tag="Arcpr_0382"
FT   CDS_pept        328780..330237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0382"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: mno:Mnod_3383 glutamine synthetase, type
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57451"
FT                   /db_xref="GOA:D2RGM6"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM6"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADB57451.1"
FT                   /translation="MTAKHMDVREVLKRNNIKQVLCAFSDIRGYLMTFSVPAREFIEGN
FT                   ALEDGIGFDGASIRGFKTIEQSDMVWKPDPETLRIVPWINDPIHKTAIIFGDVYEAGGE
FT                   NLADCDPRGFVAKSLQKKLAEEGKSVILGPEIEFFVFENLDPMCLAWDLWTSPNGGAGD
FT                   SWGPPRVMPKSPELTPGKNFIIRPKEGYFRPPPEDTTVEYRNELVHYLEQMGVIVEYHH
FT                   HEVATAGQVELDFKPMGLVPAGDAFYIYKFAAKNLAAMRGWIATFMPRPLYLDNASGMH
FT                   VHQSLWEGEPFKGKNLFADPDDEFGLSQKARYYIGGLLEHAKALTALCCPTVNSYKRLV
FT                   PGFEAPIYICWSPGNRSALVRVPMYLKKPSAIRIEYRGADPSCNPYLAFTAMIAAGLDG
FT                   IKKKIDPGDPIMKDVYELSPEEKKELGIGELPTTLRDALDHLASDEVIQKVLGSHIFDS
FT                   FMSIKIDEWNQYCLYITPWEYMKYMDI"
FT   gene            330369..330692
FT                   /locus_tag="Arcpr_0383"
FT   CDS_pept        330369..330692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57452"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57452.1"
FT                   /translation="MGVHRITSEAAKYYAKREKILGIGVSLLGLASEKLDELTKEQFEK
FT                   LGDLASMLLPHAPGYAGKLIPIIARLFWKLAGVKEKEFKYVELDEIEKYMEELKNELGL
FT                   QVE"
FT   gene            330725..331117
FT                   /locus_tag="Arcpr_0384"
FT   CDS_pept        330725..331117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0384"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   mxa:MXAN_2547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57453"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM8"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADB57453.1"
FT                   /translation="MIEIKTSRRVEIVDITDKVREIVDKHSVRDGIAVVYTKHTTTAII
FT                   INENESGLKEDVISVLEKLIPTNAGYMHDRIDNNADSHLRAILLGNSVVIPITDGKLDL
FT                   GTWQRIMFVELDGPRTRKVIVKVIPC"
FT   gene            331111..331767
FT                   /locus_tag="Arcpr_0385"
FT   CDS_pept        331111..331767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0385"
FT                   /product="Suppressor Mra1 family protein"
FT                   /note="PFAM: Suppressor Mra1 family protein; KEGG: similar
FT                   to CG3527-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57454"
FT                   /db_xref="GOA:D2RGM9"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGM9"
FT                   /inference="protein motif:PFAM:PF03587"
FT                   /protein_id="ADB57454.1"
FT                   /translation="MLRIVFVESSLETVPKSIAKHPAILSDARRRKKKPTEMILDDSRH
FT                   HTAMKDLENREKRGRPDIIHQCLLLALDSPINDLEVYVHTINDVMIWINRKTRLPRNYN
FT                   RFIGLMEDLFKKREIKADGEVLLKIVDLSLEDVLRDFRVVVMSEKGERREVKLEGCAVC
FT                   IGAFPHGDFDEKTVEVFRKVDAEFVSVADKPVTALYTTCWVVGHVGVKALNPLRD"
FT   gene            331775..332767
FT                   /locus_tag="Arcpr_0386"
FT   CDS_pept        331775..332767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0386"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine cyclo-
FT                   ligase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: Os03g0831500;
FT                   hypothetical protein; K01933
FT                   phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57455"
FT                   /db_xref="GOA:D2RGN0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN0"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADB57455.1"
FT                   /translation="MEKFSYAKAGVDIRQEEKAVKSLVSKIKYVRQGFGKPILMGHYAS
FT                   VLDFGEVGVAITTDGVGTKIIVAEKLGKFDTIGIDCVAMNVNDLLAIGAEPIAMVDYIA
FT                   TFNPDERVMEQIAIGLEKGCEIANITLVGGETATLPDLIKGWDLVGTAIGVVDKDKIIT
FT                   GKDIQAGDVIFGVPSSGIHSNGLTLARKVIENAGLSYHDKFNGKTIGEELLTPTRIYIE
FT                   ILDVVRNCEVHGLAHITGGGLLNLKRLKNVKYVIDDPLKPQKIFRFIQELGKIDDDEMY
FT                   RTFNMGMGFAIILPEEEVDCVKKYVDGKVVGFVEEGEGVYVKDMRIDKF"
FT   gene            332792..333178
FT                   /locus_tag="Arcpr_0387"
FT   CDS_pept        332792..333178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0387"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: bvi:Bcep1808_5674
FT                   diguanylate cyclase/phosphodiesterase with PAS/PAC
FT                   sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57456"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN1"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADB57456.1"
FT                   /translation="MVKVGDAMVREIVSVDYRTPVKEVVRIMGQRKIGSVLVSRNGEIY
FT                   GIFTERDLVSKVLLEGSLDDDVGKYTSTPLITVSLDYDLKEATRIMSDMKIKRLVVVED
FT                   GKIVGILTASDVVRAIAKAPLEVL"
FT   gene            333179..333406
FT                   /locus_tag="Arcpr_0388"
FT   CDS_pept        333179..333406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57457"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57457.1"
FT                   /translation="MKCVSCGRELREEDEGVTWRRCSICKSPVCFDCVRYVGTWVRGLY
FT                   KNFVNVIPVCPNCLPKSMLKRLAEKKLKEE"
FT   gene            333438..334391
FT                   /locus_tag="Arcpr_0389"
FT   CDS_pept        333438..334391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0389"
FT                   /product="Dehydrogenase (flavoprotein)-like protein"
FT                   /note="KEGG: abu:Abu_0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57458"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN3"
FT                   /inference="protein motif:COG:COG0644"
FT                   /protein_id="ADB57458.1"
FT                   /translation="MKVQIYGAGISGSYLYHLLDQDGFEVSIYDVRSKPDCRCAWGFSY
FT                   SETKELYKKIGINVDEFLLSKPKYVIVNNRLWLKNKEIVILDKKRLMEELWSFELKDEG
FT                   GDVVVDATGHSRAILPKIENDAIYTTVQNVEKHDLDENIYIYMVKTGYAWAFPLGDGRW
FT                   HIGAGDMSRERALELVKKLREVYEIEEVEGECNCIGKIRLLPPSKCKPIVWNNVYGVGE
FT                   AIGCVSGAGEGNAPSLKCAKIFYDCLVENKLEEYEKRVLEEFWWIEVEHEFVSAVQTGK
FT                   KLKALRLLPKIIPIESRRSVEQSFETIKSLLGLLKQ"
FT   gene            334506..335423
FT                   /locus_tag="Arcpr_0390"
FT   CDS_pept        334506..335423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0390"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: gbm:Gbem_3637 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57459"
FT                   /db_xref="GOA:D2RGN4"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN4"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADB57459.1"
FT                   /translation="MKHLISMADLTPEELEEILKLAEKLKEERYKGRVTDYLKNKSLAM
FT                   IFELPSTRTRISFEVAMTDLGGHALYLNWNDLQLGRGEPIKDTARVLSRYVHAVMMRVR
FT                   KHETILEFAKYSTVPVINGLSDLEHPCQVIADLLTIKEYKGDLKSVRLTWIGDGNNVCN
FT                   SLILASALTGMEMVVCTPKGYEPNKEIVEKALKMGAKLTFESDPLKAVENADVIYTDVW
FT                   VSMGQERERRKRLKAFTGYQVTQKLVDSAKTNVVVMHCLPAHRGEEITEEVLEGEHSIV
FT                   FDQAENRLHAQKAILLKLIGKEKE"
FT   gene            complement(335426..335704)
FT                   /locus_tag="Arcpr_0391"
FT   CDS_pept        complement(335426..335704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0391"
FT                   /product="DNA-binding protein Alba"
FT                   /note="TIGRFAM: DNA-binding protein Alba; PFAM: Alba,
FT                   DNA/RNA-binding protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57460"
FT                   /db_xref="GOA:D2RGN5"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR013795"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN5"
FT                   /inference="protein motif:TFAM:TIGR00285"
FT                   /protein_id="ADB57460.1"
FT                   /translation="MTEGVVYVGQKPVMNYVLATLTQFNEGAERVVLKARGKAISRAVD
FT                   VAEIVRNRFLPNVEVESIKIDTEELESEQGRKVNVSTIEIVLAKKSE"
FT   gene            335784..335867
FT                   /locus_tag="Arcpr_R0013"
FT                   /note="tRNA-Ser2"
FT   tRNA            335784..335867
FT                   /locus_tag="Arcpr_R0013"
FT                   /product="tRNA-Ser"
FT   gene            complement(336158..336325)
FT                   /locus_tag="Arcpr_0392"
FT   CDS_pept        complement(336158..336325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57461"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57461.1"
FT                   /translation="MIVTTGRHSRNKGVRYRVRRSGNGHSRDTYAVIDLDNSTLLDELE
FT                   FRTWLREVMM"
FT   gene            336361..336582
FT                   /locus_tag="Arcpr_0393"
FT   CDS_pept        336361..336582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0393"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57462"
FT                   /db_xref="GOA:D2RGN7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN7"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADB57462.1"
FT                   /translation="MLRLCIVTVTLNKEVAEKLEKLRREGKTLSDVIKRIVETYEELED
FT                   YIDEKWGKLQRDKEKFIDLEDYASSRGL"
FT   gene            336760..338019
FT                   /locus_tag="Arcpr_0394"
FT   CDS_pept        336760..338019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_1393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57463"
FT                   /db_xref="InterPro:IPR014127"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57463.1"
FT                   /translation="MLNATAIREYLDKRYNISAKYYLNSSLLSCVRRFNDISRDEKDTA
FT                   NFAFISAMYDYQMKVSHLISRFNFIVDFLERNNLELPDLADSSHFEKLRDLMLKNYGYF
FT                   HRFDPRMRDFRKLVDVLTKLDLENIAKDYYDPNQSEPVEKVIDGILNEIRRFAEFSSRG
FT                   FIPNPKNKSSKKRLTLFLRWVVRPEYPDLGVWKFISPAHLYVSMDLGVLRVFQRMTGIA
FT                   LRNNWDGVIRVTDYFRSVNPQDPAKYDYVLSRPAILDICKKSLEYSGCDACLLNEICLT
FT                   GRENIRNIRLVVEEEVDKTRHDYIRDLFKSRNPWKASCVREEYLNGRADIVCYLPDMKS
FT                   PERIVVVEVKVVLTFNGVKQLLNYIRTAIEKWKETVKECRGAMVCECISKDQEQKILEI
FT                   SEYHSIEIYKFESNKFVRIA"
FT   gene            complement(338033..338371)
FT                   /pseudo
FT                   /locus_tag="Arcpr_0395"
FT   gene            complement(338626..338698)
FT                   /locus_tag="Arcpr_R0014"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(338626..338698)
FT                   /locus_tag="Arcpr_R0014"
FT                   /product="tRNA-Val"
FT   gene            338799..340490
FT                   /locus_tag="Arcpr_0396"
FT   CDS_pept        338799..340490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0396"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; SMART:
FT                   Hedgehog/intein hint domain protein; KEGG: gur:Gura_2185
FT                   dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57464"
FT                   /db_xref="GOA:D2RGN9"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR028992"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGN9"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADB57464.1"
FT                   /translation="MELALVVAKRSTCLRQKVGAIIIKDKRILATGYNGAPSGMAHCLD
FT                   IGCLREKLSVPSGERQELCLTPDVEILTDRGFVRISDIKVGDKVLTHRNRYQKVVKVIS
FT                   RDYKGEICVVKPMGLLPIRLTPEHEVLAVKTVKCIDGKTICKESCQSILRERCKRFFES
FT                   YEEDWIPAILLNKGDLVVFGFDTTVENLKSLDLSKYIENPPKVYYDVVRAKNSGKTYSY
FT                   IEKVYGISRSVAWNWVNGGSPRGYVIVRNGMLHSGDSPSKDIPAEIEINKDTMWLFGIY
FT                   LAEGCTSGNQIAFGLNVEESEIVERIENVMRETFNLKPNIYTRKQSTLVRYSSKILATI
FT                   FERLFGGNAYTKRIPAELMRVKPKLQSYMLRGWLEGDGYDNSVDVRGVTASKTLALQMY
FT                   QICLRLNMLPTLDSSPPRKGVKSVMYRLRINKNPKLKTRYIKNGKLYTPVSYVKMDFYE
FT                   GKVYNLEVEEDKSFVTESFIVHNCRGLHAEQNAIIQAAKFGICIDGATMYTTHCPCITC
FT                   AKMIINAGIKKVVYGKEYADKRGLELLKEAGVEVVYLPIEKLLAKS"
FT   gene            complement(340473..341912)
FT                   /locus_tag="Arcpr_0397"
FT   CDS_pept        complement(340473..341912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0397"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: metallophosphoesterase; DNA polymerase epsilon
FT                   subunit B; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57465"
FT                   /db_xref="GOA:D2RGP0"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP0"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADB57465.1"
FT                   /translation="MDKKTIIKKFAVYGRNIHPLAVEVLIKNVDHHNLDSLIAHICKTT
FT                   SSFVISREEVERAIKSFKTAPTTNDVKNVDDKPKQVVRSQENVSVKDVTGRSTCEGGIE
FT                   DFLAYFNSRFEKLSALVRRRIGGVRISSLPKFKNEQVEVVGMVKDVRDYGEFAVFDLED
FT                   KTGVVSVFAGEKLKELALELLGDEVVGVIGVYRNGRIYADRIIFPDIPMRERAKKDFGI
FT                   VFISDTHFGSKEFLEKEWEVFTKWLSGEVGNEKVVDLASKIKYVVIAGDIVDGVGVYPG
FT                   LENDLTITDIYGQYQYAAEQLDKIPKDVKVILSVGNHDAIRQAEPQPALPKEIRDLFSN
FT                   NVIHVGNPAHVDLDGLKVLIYHGRSLDDVITKIPRLSYEKPHEAMIELLKRRHLCPIYG
FT                   GKTPIAPEREDWLVIDEVPDVLHCGHVHTYGVGFYRGVLVVNSSTWQAQTEFQKKMNLN
FT                   PMPCNVAVYYNGEVGRLRFCK"
FT   gene            341995..342903
FT                   /locus_tag="Arcpr_0398"
FT   CDS_pept        341995..342903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0398"
FT                   /product="Cell division GTPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57466"
FT                   /db_xref="GOA:D2RGP1"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP1"
FT                   /inference="protein motif:COG:COG0206"
FT                   /protein_id="ADB57466.1"
FT                   /translation="MRLLTIGVGTKGAEISSLLYKRGVKVNRIPLFRCYAVLNNLNDVS
FT                   KIKLDEKNKFYLPKNSDVTGIINEIMSRYEIHEGAMLITSIKEEDFNVTIELSRKLREV
FT                   LDDPVMVLGVLSLKNVDSGELRRRIKSLKEFSDYLLLTREESVNETVEALNILARVGEI
FT                   DLKRRVAGEVVVDTSDLFNALARDGFTVLGQSKRSIPIFKFFMKRSQLLALRTQRMVEM
FT                   VKDAVRNLSFNGDIESAKSSLIVFAGNPDEITMDGLFASISFVESLNDGMVVRYGDYPI
FT                   PRARFLSTVVLFSGLRKIKFD"
FT   gene            complement(342890..343444)
FT                   /locus_tag="Arcpr_0399"
FT   CDS_pept        complement(342890..343444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0399"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: sde:Sde_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57467"
FT                   /db_xref="GOA:D2RGP2"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP2"
FT                   /inference="protein motif:PFAM:PF01944"
FT                   /protein_id="ADB57467.1"
FT                   /translation="MPYSMKEFIVLLAVFLLSTYIGYQWAASHPDQAETFIKQIFESLS
FT                   FVKDLPQAMIFAVIFVNNTVKSFVNMLLGLAFGVIPVLFIAINGFTIGVVSAVVSKNVG
FT                   LLKVLLMLIPHGILEIPAVLIACSYGLKLGIATLNRARGVSVDIKFEIKRAVRAYLKYV
FT                   MPMLLVAAFIETYVTPIISQI"
FT   sig_peptide     complement(343364..343444)
FT                   /locus_tag="Arcpr_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.905 at
FT                   residue 27"
FT   gene            343493..343765
FT                   /locus_tag="Arcpr_0400"
FT   CDS_pept        343493..343765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0400"
FT                   /product="DNA-binding protein Alba"
FT                   /note="TIGRFAM: DNA-binding protein Alba; PFAM: Alba,
FT                   DNA/RNA-binding protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57468"
FT                   /db_xref="GOA:D2RGP3"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR013795"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP3"
FT                   /inference="protein motif:TFAM:TIGR00285"
FT                   /protein_id="ADB57468.1"
FT                   /translation="MAENAVFVGNKPVMNYVLAVLTQFNNGAKEVAIKARGKAISRAVD
FT                   VAEIVRKRFLPDVDVKDIKISTEQIESEQGTANVSAIEIILAKKE"
FT   gene            343789..344430
FT                   /locus_tag="Arcpr_0401"
FT   CDS_pept        343789..344430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0401"
FT                   /product="Translin"
FT                   /note="PFAM: Translin; KEGG: TRAX (PMID 16043634)"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57469"
FT                   /db_xref="GOA:D2RGP4"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP4"
FT                   /inference="protein motif:PFAM:PF01997"
FT                   /protein_id="ADB57469.1"
FT                   /translation="MIEEFLDFVRSKLEEKELAREELLKLVREMRINSTKAIASIHAGD
FT                   FKKADEYLRNAMEILQKVKEYKVYPDVYYPVTFDAMQELVEAYVFRHIVENYDIDVDLS
FT                   QLDVEFAPILTGLADAVGEIRRHILDLLRKNEFDKAEKLIGIMERIYNNLITFSFPDKI
FT                   TPNLRPKVDYVRNAIERTKSDFISAKASALSEDVKSLEELIKKLQQSLRA"
FT   gene            complement(344399..345691)
FT                   /locus_tag="Arcpr_0402"
FT   CDS_pept        complement(344399..345691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0402"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   cla:Cla_0032 conserved hypothetical protein, putative VWA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57470"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP5"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ADB57470.1"
FT                   /translation="MKNNLVNVTNDDFIYQLIAQRIEGYLPKDLQQVYRTCEQIQLIAT
FT                   DCYFLHYSLYPFLRSKNEDDVLEEARKFLQDYISSDRYQKIKMLTTLDDEMSLAYSIAL
FT                   AKAVIGKVLGLIRLEHENPFDNLKAYVVWAMRAMVEGGEIPAILDYATEYAEEMVRNAN
FT                   DVRELIGGKRAGKEEGTFKKVLDLAEHMLYVKFMRDIVSFSKKLFSHIPKATYILKKRG
FT                   RFGEELSGYSLTKRIDRALVRELALPEELFLKKFSGEGFLTKEKLSIAEGAYYILVDKS
FT                   GSMVGEKTVWARSVALAIYRMASLKRRRYFLRFFDKKTHHLLSDPHEVVDAILKVKSNG
FT                   GTDITNALRTAVKDLVERGLSDLTNTIVIITDGEDVVEDLSKDLKKANANLISVMIQGE
FT                   NETLKSISDCYMRAELSEAGGIKLLKIVEAS"
FT   gene            complement(345688..346827)
FT                   /locus_tag="Arcpr_0403"
FT   CDS_pept        complement(345688..346827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0403"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; KEGG: scl:sce3841 AAA ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57471"
FT                   /db_xref="GOA:D2RGP6"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP6"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADB57471.1"
FT                   /translation="MLKDKLTELKYRLAERFVQREAEITAVLAGLLSGEPTILVGEVGT
FT                   AKTALIENLASMIDARYFYYLLTRFTEPDEILGVLDINALREGKYVRRTEGKLPQAEIV
FT                   FLDEIFKASSAIRNILLDIILNKRIFSDGSYIRLPMLALYTASNEISGDVEDAPFYDRL
FT                   TIRCFVKGVSEDSWEELIEKGVELDLGVESDIVMSVNDVKSLQNAVMEKFRQITSNRDL
FT                   IRRYIEALVRLKQRGVKISDRRKIKVLKVASAISFVYGENDVSLDSLAEALKLTAVHDE
FT                   EDLKKVEQIILELGLSSFYQHVQKIQVVTAELQNALNASLNGGMEELKMLSTIYKKAST
FT                   LMDEIPKNPRLLPYIRQFKQVYSRAEDVLERKKAELFGI"
FT   gene            complement(346853..347437)
FT                   /locus_tag="Arcpr_0404"
FT   CDS_pept        complement(346853..347437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0404"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_2073 amino acid permease-
FT                   associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57472"
FT                   /db_xref="GOA:D2RGP7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57472.1"
FT                   /translation="MNLQEAVIMALKDVEALIPKMIVSVILICLFFVLGYAINRALSKI
FT                   FEVFKVGELFKPLARHINISFSSLMLAILNVGIALTALYTISSVAFPEGMDYLNMALEY
FT                   FGRVLSVIFLIAIVFVAVSRISEKIAVEGKMRGFMTLMTLFIVLVLLIDVTNLTPEIKS
FT                   ALAWGLSIGIGISMGVFSAWFFFHDILSKKG"
FT   gene            complement(347434..348738)
FT                   /locus_tag="Arcpr_0405"
FT   CDS_pept        complement(347434..348738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57473"
FT                   /db_xref="GOA:D2RGP8"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57473.1"
FT                   /translation="MLYFLYACTKMRGKSLVMEALTAGFYVNITRSLAPIYLAVVGYDV
FT                   LEIVKLNAKAYLFATLLAYVVYKCRHIFLKNPKKYLIIFHALERIFWGLIPLSYYLNIL
FT                   PAFYTLAICFTVPTSALINVAIFSLDERDAKKTLALRNSLGAFSNILGSITSLIVLYTL
FT                   SGYEKYTYLYALASAVGFTSTVVLLFADIGHVRLREIEEELKVKSVNVLLFLLLVTSSS
FT                   AIIGSTWTPHLVSDLKVEDYFAMLISFLQTTTSIFAPLFWSGRSYRTYRFAVVLASAVP
FT                   FMIYTVNIPILHLFIAIIYTFAFNGTNMLASFICAEIKGREVPFLLTAVTTLSQFFGMI
FT                   VAIIVGTFHFMMISASLLLLSALILSLLAIPEISIDVERARLYSRIVYNLTISGYSFST
FT                   TLARETTLLAIRLTVVSLSVILIIFIYRVAYYLSL"
FT   gene            348755..349501
FT                   /locus_tag="Arcpr_0406"
FT   CDS_pept        348755..349501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0406"
FT                   /product="F420-dependent oxidoreductase"
FT                   /note="TIGRFAM: F420-dependent oxidoreductase; PFAM:
FT                   protein of unknown function DUF129; KEGG: rpb:RPB_4408
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57474"
FT                   /db_xref="GOA:D2RGP9"
FT                   /db_xref="InterPro:IPR002847"
FT                   /db_xref="InterPro:IPR008225"
FT                   /db_xref="InterPro:IPR023659"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGP9"
FT                   /inference="protein motif:TFAM:TIGR01916"
FT                   /protein_id="ADB57474.1"
FT                   /translation="MEIVGLKLPLIKEGDDIAKLIVERFDVEDGDVIAICSTVVSKAEG
FT                   RIARLDEYKPSAKAIEIANRIGEDARFVQAVLDESDEILIDYPFLLVKAKFGNICVNAG
FT                   IDRSNVESGVILLPPKDPDESARRIRERIRELTGKDVGIIITDTNGRCFRKGVVGVAIG
FT                   ASGVQVLRDWIGKVDLYGNPLSKTVECVADEIAGFANLIMGEGDWGIPVVIFRGLNLRG
FT                   EGCARDIYRSEREDVIRMHLKKSRIS"
FT   gene            complement(349488..351341)
FT                   /locus_tag="Arcpr_0407"
FT   CDS_pept        complement(349488..351341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0407"
FT                   /product="indolepyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /note="TIGRFAM: indolepyruvate ferredoxin oxidoreductase,
FT                   alpha subunit; PFAM: thiamine pyrophosphate protein domain
FT                   protein TPP-binding; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; KEGG: dol:Dole_0440 thiamine
FT                   pyrophosphate binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57475"
FT                   /db_xref="GOA:D2RGQ0"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR017721"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ0"
FT                   /inference="protein motif:TFAM:TIGR03336"
FT                   /protein_id="ADB57475.1"
FT                   /translation="MHVLGSEGEKAFLLGNEAIARGALEAGVDVFACYPGTPSSEIGDT
FT                   LAKVSKLLKDFMHVEYSTNEKVAFEVAMGASLAGKRGMCAMKHVGVNVASDALFSFAYI
FT                   GAVGGFVLVTADDPFMHSSQNEQDNRWYGLSAKVPVFEAHSVQELKDLTKECFEISEKF
FT                   GLPVILRTYTRLSHARGIVRLGKIPEKKLEKVEWVAKPEKFVVLPSNARKLKLELEKKL
FT                   KNLQDFLERWERNWVEDGDSRLGIIACGLSYSYVKDALKRLNLNLPILKLSSMHPLPMK
FT                   KIEDFVTSVERVLVVEEVDPIVEIFVKTLTKNVYGKLTGHLPMHYEYSIPIVEKAIAKL
FT                   LNIPTRLDYDRIVERAREISKIAPPRPPVLCPGCPHSPVFYVLRKIANEVKCALPSDIG
FT                   CYTLGYNPPYRAVEVCVCMGASVGVSNGLSWVIKDKIIATIGDSTFFHAGIPALINAVY
FT                   NGAKFVLVVLDNMTTGMTGHQPHPGIGLKADGSVGKAIKIEEVAKACGVEFVEVVNSYS
FT                   VRNVEDAVRRALDHDSVAVVVAKQLCSIVRMRELRRKGVKLLPFEILQNKCNNCGECYR
FT                   VFSCPAIYLDGEKPQIDPALCTSCGVCARICPERAIKVKKS"
FT   gene            351345..352085
FT                   /locus_tag="Arcpr_0408"
FT   CDS_pept        351345..352085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0408"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K03100 signal peptidase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57476"
FT                   /db_xref="GOA:D2RGQ1"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57476.1"
FT                   /translation="MAIRGWILTFCDRFNFKLLTSFMDWKGIAREIISTIIIVGAIIGI
FT                   GIAITGTWPFMVAVQSGSMEPHIHKGDVIILFGLNRVGKVVTWIDGSKSDYKMFGDYGD
FT                   VIVYYPNGDNGKTPIIHRVIAYVHKGEYIPTLIKINGRVYLGYVKVKAKVSGFITQGDA
FT                   NYEPCKIQDLKNLLIYNYVLLYNETEKRFDKVNLSDLTKFKMCKLGIPDQLAPDWNIEP
FT                   VKEEWIVGVAKFRIPYVGWVRLLI"
FT   gene            352064..353146
FT                   /locus_tag="Arcpr_0409"
FT   CDS_pept        352064..353146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0409"
FT                   /product="L-fucose isomerase-like protein"
FT                   /note="PFAM: L-fucose isomerase-like-like; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57477"
FT                   /db_xref="GOA:D2RGQ2"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ2"
FT                   /inference="protein motif:PFAM:PF02952"
FT                   /protein_id="ADB57477.1"
FT                   /translation="MGKVADMKCYILTSDLQRDRAKKIAEKLESLGLEIASEIEPYSCV
FT                   VVASGGTERKILEAVNEPVVVWALPYYNSLPAVLEAYAVKEFRFFYSDIDEKALEKIKI
FT                   YERVFNAIKRLRGIRLGIVGGVSDWIVTDGNWVRNLLEVVEIGLEDVRVEGEGVERAYS
FT                   VYNSLREIIERYELDALTIKCFDLLEKDTTACLALHLLNDEIPAGCEGDLEAVFTMIVL
FT                   RLLTNQPCWMANINRIGRTAVLSHCTVPKSMCEYVKLTTHMESGKGVGIEGVLRKGIVT
FT                   IARFRGKRALIARGRILRGNLGDETLCRTQVEVETGDLIGFGNHVVLSYGDHVELLKEF
FT                   CFYTGFEPQIRGPHHRSVAD"
FT   gene            complement(353194..353742)
FT                   /locus_tag="Arcpr_0410"
FT   CDS_pept        complement(353194..353742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0410"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   xfm:Xfasm12_1417 histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57478"
FT                   /db_xref="GOA:D2RGQ3"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ3"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADB57478.1"
FT                   /translation="MRVLRKAVVRRKTGEVDIYIELDLDSKGYTIEMDIPFFRHMLETL
FT                   AKHSNVSLTLRAFGDDEHHTIEDTAIALGTAVAKALGDKRGIRRFGQAIVPMDDALAIC
FT                   GLDLSGRGYFVIEGDINENYVHFFDTFCRNSGMNVHLIVKGQNMHHKIEACFKALALAF
FT                   RQAKEVIGEDVLSTKGVLD"
FT   gene            complement(353739..354437)
FT                   /locus_tag="Arcpr_0411"
FT   CDS_pept        complement(353739..354437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0411"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: gur:Gura_4054
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino] imidazole-4-
FT                   carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57479"
FT                   /db_xref="GOA:D2RGQ4"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ4"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADB57479.1"
FT                   /translation="MIPAVDLKGGKVVRLVQGRKDKVTIELEDPIEVAKMWIKKGARVL
FT                   HVIDLDGAFEGRLFHEDVILEIARIAETQAGGGIRDLKIAERLLNSGVERVIFGTLAVR
FT                   DVRSVKTFAKKYPNRVMIAVDSKKGKVVVEGWVRKTELTPIEVAKLYEDCEVSLLYTNV
FT                   DVEGLVSGVELEKIREVVESTSLPVYVAGGISSPDDVRAIKKCGAVGVIIGSALYTGKV
FT                   RLEDLLGEEE"
FT   gene            complement(354421..355509)
FT                   /locus_tag="Arcpr_0412"
FT   CDS_pept        complement(354421..355509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0412"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; peptidase M50;
FT                   SMART: CBS domain containing protein; KEGG:
FT                   afw:Anae109_3134 peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57480"
FT                   /db_xref="GOA:D2RGQ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ5"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADB57480.1"
FT                   /translation="MAYSIRICRIFGIDVKAHISLALILLILSYVFYVNKPPFGFSDLQ
FT                   NPMRLIYSVVMAVSIFVAVLIHELSHSLVAKRFGARVREIILFIFGGVASIENLPKEPK
FT                   KEFAIAIAGPLASLVLSLFILTPHRFLHLFGYFNLILAIFNLIPAFPMDGGRVLRSLLA
FT                   KKFGYVRATRISANVGKAFAIFMGVFGLFYNIWLTFIALFIYIGAVEEERAVTLEGLLS
FT                   NYKVGDVMTPNPICVTPDMTVRDVISLMLRQKHLGYPVVKDGRLVGIVTLKDITDADEN
FT                   DVVENVMSRKVIAVTPETKVFEALRIMSENRIGRLPVVEGDRVVGIISRSDIIKLAEIL
FT                   EIFEGVKSSREKFGSVQSDTSG"
FT   gene            355555..356073
FT                   /locus_tag="Arcpr_0413"
FT   CDS_pept        355555..356073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0413"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57481"
FT                   /db_xref="GOA:D2RGQ6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ6"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB57481.1"
FT                   /translation="MLSDILESDWRRKVLPVKPLLEKIEKLESRNVAFDIGAGTGYFTV
FT                   HLAKFFRKVYAVEKDIEAVKKLANKGLRNVGIIVSDKPPEIDFEVDFVLFADSLHEIEN
FT                   REEYADWVKKHAKSFAVIDWKKESCLDIGPPSDRRLDIDYVLKLFKGFNIEVLNVYKCH
FT                   YFIFGYVLR"
FT   gene            356060..356890
FT                   /locus_tag="Arcpr_0414"
FT   CDS_pept        356060..356890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0414"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: atc:AGR_C_1309 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57482"
FT                   /db_xref="GOA:D2RGQ7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ7"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57482.1"
FT                   /translation="MYYVKPFDPWKSKLCTCPPKFSFNPYTGCYHNCIYCYSTYIPRFH
FT                   ELRLKKDLFRKLVKDLEKIPKNSLISMSNSSDPYPPIERELKITRKCLEIMSDFDIKLL
FT                   IVTKSDIVARDLDVFPKKSAVGITITSLKTAKVIEPNAPDPEKRIEALKIIKECGVPVI
FT                   LRLDPIIPFLTEDEAMKVLEKCDFVDHVVTSTLKLRKDILARFSKVLPDLAEVYKRIYT
FT                   ERVGSYMYLPKDFRIRLLKAIEEKCNELGVSCAFCREGILFKAKSCDGSHLIPS"
FT   gene            complement(356853..357665)
FT                   /locus_tag="Arcpr_0415"
FT   CDS_pept        complement(356853..357665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0415"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: geo:Geob_3337 cobalt ABC transporter, ATPase
FT                   subunit; TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57483"
FT                   /db_xref="GOA:D2RGQ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ8"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /protein_id="ADB57483.1"
FT                   /translation="MDALEVSNLSYAYEDRKVLDNVTFSVEEGEIITILGPNGAGKTTL
FT                   FLNLVGILKGEGEIKLFGKKIEDYSRKELVKTIGMVFQNPDDQIFMPTVFDEIAFGLIN
FT                   LGFEKNEIVRRVNVVLEKFGLEGYKDRYPHHLSFGEKKKVAIASAICTEPRILLLDEPT
FT                   ANLDPVSREELIEIIRDLNDDGMTILIATHDTELALQSDKTIILNREIVKIGKPKDVFL
FT                   DLDLLRQNGLDAPQIVKLFMKLGLKIPQSLDEAVEIIKRELDANRHNS"
FT   gene            complement(357653..358360)
FT                   /locus_tag="Arcpr_0416"
FT   CDS_pept        complement(357653..358360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0416"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   dde:Dde_1192 cobalt ABC transporter, permease protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57484"
FT                   /db_xref="GOA:D2RGQ9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGQ9"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADB57484.1"
FT                   /translation="MKHHLVDRYYHLDSLIHRLDPRAKLLGIFILVFSIVLVKDLLACI
FT                   LALTISLIFLYLSKLPLKFAFEQLKYGLIFLLILSITMLIFGHRPFEIFTRATSALILI
FT                   FVAFATSRFDISIKALNQIGFPSKLTQILMFAYRYIFVFAEEYEKLSIALKMKGFEKRT
FT                   NIHTFETIAKLIATLFIRSYERAESVYRAMILRGYTGNIETITDFKITARDILFVTLSL
FT                   YLAITLHIVAWML"
FT   gene            complement(358357..358767)
FT                   /locus_tag="Arcpr_0417"
FT   CDS_pept        complement(358357..358767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57485"
FT                   /db_xref="GOA:D2RGR0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57485.1"
FT                   /translation="MRKYVVALIVILILAVPVNAHRMHVNYKVSEVEVYAWYGGGAKVV
FT                   DGVVKVYRSDGTLYVEGKTDENGTFRFKPEIGESYRVVVESMGHRAECDVNLTSAQVVV
FT                   KEEPIHLKVISGLGYLAGLAGIASLYIARRKR"
FT   sig_peptide     complement(358705..358767)
FT                   /locus_tag="Arcpr_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            complement(358764..359342)
FT                   /locus_tag="Arcpr_0418"
FT   CDS_pept        complement(358764..359342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0418"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: dvm:DvMF_3139 cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57486"
FT                   /db_xref="GOA:D2RGR1"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR1"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ADB57486.1"
FT                   /translation="MVHISDGVLAPEIWITGYIVTAVILFFTLRRVRAEDIPKISIVTS
FT                   AFFIASLIHIPIGPTSAHLILNGLMGILLGLYSYPAIFIGLLLQALLFQHGGITTLGIN
FT                   TINMGIPALIAYYIFRLKKNPITAGVACGLAVFLAVLLTSIVLMLSGEEFYEVAVLLFI
FT                   AHVPIAMVEAFVSAFVVAMLLKVKREVIA"
FT   gene            complement(359344..360300)
FT                   /locus_tag="Arcpr_0419"
FT   CDS_pept        complement(359344..360300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0419"
FT                   /product="ABC-type Co2+ transport system periplasmic
FT                   component-like protein"
FT                   /note="KEGG: rpe:RPE_1971 ABC-type Co2+ transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57487"
FT                   /db_xref="GOA:D2RGR2"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR2"
FT                   /inference="protein motif:COG:COG5266"
FT                   /protein_id="ADB57487.1"
FT                   /translation="MRKAIVVSLVLAFFVVCGVASAHFTMVLPKLDAKAEDYLAELGET
FT                   KTLYILWGHPFEHILFDCPDVEVTLKDPKGNVRTLTPEEVTLEGLKAWKVSFKVEEPGD
FT                   YIVAVKLVEEEHGLIDYTKAIIHCGEEAWEGWDAVVGQEVEVIPYTRPYGIEEGFVFSG
FT                   KAIFKGEPLANAIVEVEKYNTKDEAEPIVKLAEEKFKQDPPMMFTRVVKTNDYGYFAYT
FT                   LDEPGIWFVGVYAEEGGMEKRGVIIVPVLEKFPPEAKATADLSELESKIDELSGKIDTL
FT                   ESKISALKGASDQSMSYGAIGLAVIAIILAIVAIARK"
FT   sig_peptide     complement(360232..360300)
FT                   /locus_tag="Arcpr_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 23"
FT   gene            360411..361295
FT                   /locus_tag="Arcpr_0420"
FT   CDS_pept        360411..361295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0420"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate dehydrogenase; KEGG:
FT                   gsu:GSU1755 dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57488"
FT                   /db_xref="GOA:D2RGR3"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023359"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR3"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADB57488.1"
FT                   /translation="MLEVELSNLRLRNPIMLASGILGSHAGSLNRIAEHAGAVVTKSVG
FT                   LEGREGYKNPCVISWECGILNAVGLASPPAKEFARELKMFNGACPLIVSFFGSNPEEFA
FT                   ELVKIFDFANAFELNLSCPHAKGLGLEIGRDFDLVYEIIRAVKRNTDKPVFAKVSANLD
FT                   YVELAKVCESAKADGIVAINTVRGMAIDIVSKRPILSNVSGGVSGKAIKPIALKCVWDI
FT                   YEEVSIPVIGCGGISNWKDVVEFALAGARAVQIGSAFYYSYDVIKNILEGLESYLRING
FT                   VSFDELVGLAHKR"
FT   gene            361308..361457
FT                   /locus_tag="Arcpr_0421"
FT   CDS_pept        361308..361457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57489"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57489.1"
FT                   /translation="MRKWMKGFLGFLGFLGFNAFKTGNYLWLLWFVWFTWFYYFKYLKE
FT                   GDEK"
FT   sig_peptide     361308..361373
FT                   /locus_tag="Arcpr_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.775 at
FT                   residue 22"
FT   gene            361454..361735
FT                   /locus_tag="Arcpr_0422"
FT   CDS_pept        361454..361735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57490"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57490.1"
FT                   /translation="MNLKVVALAVMLILALLAAYQFSTDHNSNVVSYKVEKCEAGFGKP
FT                   FARYDEQNKTLNAVVWVNCCGVEVKVEREGKNLQNVAKKAPLFRAGMN"
FT   sig_peptide     361454..361525
FT                   /locus_tag="Arcpr_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.413 at
FT                   residue 24"
FT   gene            361809..362225
FT                   /locus_tag="Arcpr_0423"
FT   CDS_pept        361809..362225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0423"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   rpc:RPC_4507 transposase IS200-like"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57491"
FT                   /db_xref="GOA:D2RGR6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR6"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ADB57491.1"
FT                   /translation="MQLKSTRHAKYLCNYHFVFIPKYRRSILDKYKEDLKDIFHQIAEK
FT                   WGFEILALEIMPDHVHLFVSAPPKYAPAQIIKIFKGASSRELGKRYPESKIKGSELWAR
FT                   SYFVATAGNVSSDVIMEYVKEQYFKEAKKNEKSE"
FT   gene            362209..363453
FT                   /locus_tag="Arcpr_0424"
FT   CDS_pept        362209..363453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0424"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   Protein of unknown function DUF1225; transposase IS605
FT                   OrfB; KEGG: noc:Noc_2902 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57492"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR7"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADB57492.1"
FT                   /translation="MKRVNKFRLRPTKEQEKVLFSLCEMSAVLWNKLNYVRRQLFFEGK
FT                   FDWKEGVEELYDEFKPILGSATAQQIIRKNNEAWRSFFSLLRLKNQRKLPSHIRKVSPP
FT                   RYWKDRLLNKRKLMTVIRNDCYRIEEVEGKKYLVLPKGLRIRITGEIKWRGKQGRLEIF
FT                   YDDLTGRWYAHQSVEVDQPRRTISPEKRAFIDLGVINIITAWIEGEKQPIAFSGKSLLA
FT                   DWWYWTHKIAHYQSIAKKVNGMDTTRRIRKYYRKRQLRFRHAVNTIIYRFVKLCYERGV
FT                   TEIIVGDVKGIRQNNDKNTKANAIIHNFWSFRYIIDRLITTAENFGIKVKFVREDYTSS
FT                   VCPRCGSTNAYKHKRLFKCLNCGLEAHRDVVGVLNIARVSLNGRDGFNGVLAHPVLLRV
FT                   SPVEAQTSPQGILAL"
FT   gene            363453..363818
FT                   /locus_tag="Arcpr_0425"
FT   CDS_pept        363453..363818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce6465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57493"
FT                   /db_xref="InterPro:IPR027553"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57493.1"
FT                   /translation="MRGGCQRILEIQYGELCRCICRSEVTIFNVPENAAVVFVNKDGDY
FT                   FILSPHVEFCGWSTYGRCNSDEDCIVAGCSGQVCQSKFEELTVTICEWLDCYGAEKFNV
FT                   SCRCVDGRCQWTSTSIE"
FT   gene            363852..364241
FT                   /locus_tag="Arcpr_0426"
FT   CDS_pept        363852..364241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0426"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57494"
FT                   /db_xref="GOA:D2RGR9"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGR9"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADB57494.1"
FT                   /translation="MCIFCKIAKKEEKAYVVYESDNVIAFLDINPLSKGHTLVIPKEHY
FT                   ENLLEVPSDLAKDLHEAIKAVCEKLKVFNPAGFNIVSNIGKQAGQVIMHAHIHVIPRYE
FT                   DEETRPITFGKPVKVDLEEVYRELC"
FT   gene            364235..365383
FT                   /locus_tag="Arcpr_0427"
FT   CDS_pept        364235..365383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0427"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: ilo:IL0239 phosphopantothenoylcysteine
FT                   synthetase/decarboxylase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57495"
FT                   /db_xref="GOA:D2RGS0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS0"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ADB57495.1"
FT                   /translation="MLKTIVLGITGSVSAVNSFNIARELKRRGFKVVAVLSDDAKKFVT
FT                   PELMKFACDEVLEEFDESYHVRFLGYGGEADLLLIAPATANTISKIAHGIADTNVTLVA
FT                   LTALGSGKPVLVAPAMHLAMYEAIKDNLEILRSKGVEEIKPKFEGLKAKLAEVERIVLH
FT                   VERALSSDEFKGKRVVVTSGPTFEFIDPIRFISNKSSGRMGNELALEFWRRKAEVVLIS
FT                   SKPIEIDPPNFKVVKVVSVKDMLDAVLKEIENCDLFVCASAPSDFVVDRVDSKIKTTEE
FT                   LVLKLKQAPKIIKEVRKVYDGPIIGFKAETGLSDEELIEVAKRKMEEDKLEMVVANDVK
FT                   ERGMGTVDTRVVIVTPKRVEWVKGLKRDVAKRIVNAYVEDYL"
FT   gene            complement(365374..366471)
FT                   /locus_tag="Arcpr_0428"
FT   CDS_pept        complement(365374..366471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0428"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pca:Pcar_0178
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57496"
FT                   /db_xref="GOA:D2RGS1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS1"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADB57496.1"
FT                   /translation="MSEDLITITLISLIAFLSPLLAERLNIPAVVVELVLGMFLGVSFL
FT                   NAIKHSEWLSFLALLGLIFLMFLSGLEIDITAILREKRTLPLSVAFLILSLIVSFAITQ
FT                   ALGLSLLYAILLANVAVGIVVSTLRELKIEKTKFGQMSIITAFITDVTTMFLLSIYFLS
FT                   GFIQIIFAFLIIVAFFISYHLGRLVIWHFPEFVARWFVRDPMEIGVRGSLAIMTVFVGL
FT                   SYILGVEAILGAFLAGLLLSTLFRGGKKLYDKLYGIGYGFLIPIFFIKTGAEFYFRIDL
FT                   NMIKFALILLAVSYIVKVLPALILRFERALTFGVLQSTKLSLTVAGVTIGVSAGILSDF
FT                   EATSLITFTIISCLISPTIFRLLYR"
FT   sig_peptide     complement(366403..366471)
FT                   /locus_tag="Arcpr_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.774 at
FT                   residue 23"
FT   gene            complement(366468..367553)
FT                   /locus_tag="Arcpr_0429"
FT   CDS_pept        complement(366468..367553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0429"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57497"
FT                   /db_xref="GOA:D2RGS2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS2"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ADB57497.1"
FT                   /translation="MYIVVGDKEIARKIARIYSNCVFVGKDTDDLKDINVIEGDPLEII
FT                   PKLDLSSAKVVLASDESTNSKIAEFLKSKGVDVVEVNVERVCDLYRKLRIDRASNGTGV
FT                   RRKYLETVVGKSLSGVPLRRMDMGDECAVVSVFRGGKLLRPHPELILKEGDTLGILCGE
FT                   EIRQARNPFDNILRILRGYRDEDIITESRMLSERFESNIITLKLVSGNAGIVKDLTKLD
FT                   EADLVVTSAIKKKDNLIEELSKVHPTVVARGKREYKKILAVVNSSDPFKIISLSKVFAR
FT                   AFDYVKLLLLEKEQLVYASKVIETSVDVSVTEGNPFVEFVREFKRRYDLLIISLKNDVG
FT                   NIDEDIIWKVIVDMDTSVLLV"
FT   gene            367602..368144
FT                   /locus_tag="Arcpr_0430"
FT   CDS_pept        367602..368144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57498"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57498.1"
FT                   /translation="MIGDKALKVVSDFVLRKVPEGLFEVRTFCACSDYRRLDVKTPEEI
FT                   VKVLNEVFERFGSLIEDWEVEAIKPWLRPYGIIIEKEDRYRAKLLKTGYEDKLDELLDY
FT                   YSCGMKRESLVLAKALLDSIAKERGFESFKDMVKGKLADLLELFYDSLDRDLNDEEILF
FT                   LLKTMRNVLELCSSQRV"
FT   gene            368123..368923
FT                   /locus_tag="Arcpr_0431"
FT   CDS_pept        368123..368923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0431"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57499"
FT                   /db_xref="GOA:D2RGS4"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR012043"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS4"
FT                   /inference="protein motif:PFAM:PF00288"
FT                   /protein_id="ADB57499.1"
FT                   /translation="MFVSASVTCFFAPVIDDPKNSGSIGVGFTIDRGVEVRLAEKTTFN
FT                   GKKIRLPTLEYVLSKLGYEGGAEIKSDLPLGCGFGLSGATALASALEVNEKLGLNLSLF
FT                   QIADLAHEAEVLNRTGLGDVTTQCHGGFVVRKNASAPSICSVDRFLWDVEMDFLVMGEL
FT                   KTSEILEGNLKEVYKIGVECLKKFLKRPSISYLFEVSKEFTLRCGFADDDILDAIEAVE
FT                   SCGGLASMIMLGKGVFALNGDVLRELKGFYTKSRVVWYGIKKSL"
FT   gene            368948..369514
FT                   /locus_tag="Arcpr_0432"
FT   CDS_pept        368948..369514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0432"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: psb:Psyr_0251
FT                   regulatory proteins, AsnC/Lrp"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57500"
FT                   /db_xref="GOA:D2RGS5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS5"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADB57500.1"
FT                   /translation="MKVLELDEKDRLIIKILQENPKISQTEVAKLVGLSQPSVGGRIKK
FT                   LKELGIIDHTYGVNLKNSRMYILKVDVKCKNPDEILDTLRDCPFFLNGFVVAGNRNLIL
FT                   MFVGEDLPTLEAIVDKHVRPNPDVYDVDVGIIVRTEKSTIIPLNVGFKRDKVAPCKSYC
FT                   SECDYWGKICLGCPITGHYRGRVLR"
FT   gene            369514..370077
FT                   /locus_tag="Arcpr_0433"
FT   CDS_pept        369514..370077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0433"
FT                   /product="CDP-alcohol phosphatidyltransferase"
FT                   /note="PFAM: CDP-alcohol phosphatidyltransferase; KEGG:
FT                   noc:Noc_2982 CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57501"
FT                   /db_xref="GOA:D2RGS6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS6"
FT                   /inference="protein motif:PFAM:PF01066"
FT                   /protein_id="ADB57501.1"
FT                   /translation="MLSAIKGRTTELLKPITNILAKIGIKPNHLTILGLLLGFLCAYEI
FT                   YLGNYTVSVILLILSSLMDALDGALARDKGMITEFGGFLDSVLDRYVDIAIFFALGFQV
FT                   GWVLAVFALSGALMVSYTRARAEKIIPKCDVGIAERGERLILIMIGLAFPSILESIVLI
FT                   VGILSHLTALHRIIYTYKECKRKT"
FT   gene            complement(370087..370908)
FT                   /locus_tag="Arcpr_0434"
FT   CDS_pept        complement(370087..370908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0434"
FT                   /product="iron-sulfur cluster assembly/repair protein"
FT                   /note="KEGG: sat:SYN_01185 iron-sulfur cluster
FT                   assembly/repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57502"
FT                   /db_xref="GOA:D2RGS7"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS7"
FT                   /inference="similar to AA sequence:KEGG:SYN_01185"
FT                   /protein_id="ADB57502.1"
FT                   /translation="MQEYEEVKEKMKFNHEEVKKKFMEGIDQLAKRMKKVKTKLAVMSG
FT                   KGGVGKSTVAGLLAVHYGKKGYKTGIMDCDFWGSSIPKIFGVENKRPVVREDGIEPVHT
FT                   DKWGIAVMSIQFFLPSPESPLAWRGPLVSGVIRDMLAKTEWGELDYLIFDLPPGTGDVP
FT                   LTVLQEVRPNGVILVATPQELTATIVEKSLKLAQELNTAIVGLVENMSYYECPQCGHKE
FT                   YLFGKGRAAEMASKYRIDFFLELPIDPALTRLCDSGKIELYEIDPFEFFLI"
FT   gene            complement(370913..371746)
FT                   /locus_tag="Arcpr_0435"
FT   CDS_pept        complement(370913..371746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0435"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   dal:Dalk_2264 cobyrinic acid ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57503"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS8"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADB57503.1"
FT                   /translation="MQIAVVSGKGGTGKTTVTSVFATLCKGVIADCDVDAPNLHILLKP
FT                   RILEEIPFKGMKKARIIQDKCERCGLCMDLCRFDAIYVENDSYKVDIVRCEGCAFCFRA
FT                   CPNKAIEMVSEERGKIFVSETEYGPFVHALLEPGEENSGLLVHEVKAKAEKVAEEKGLD
FT                   LILVDGAPGIGCPVIASLSKVDKAVVVTEPTLSGLNDMERVLKLIRHFRIEPYIIINKF
FT                   NLNLDVSNKIERFCKSEKIPIVAKVPFYEDIPKAIANLQIPIKDEIVEAWENIWR"
FT   gene            complement(371731..372528)
FT                   /locus_tag="Arcpr_0436"
FT   CDS_pept        complement(371731..372528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0436"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   ppd:Ppro_1954 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57504"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGS9"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADB57504.1"
FT                   /translation="MVKIAIASGKGGTGKTTLAVNLAYFNGVDLFDLDVEEPNCHLFIK
FT                   GEKREEIVCRKVPSIDESRCDYCGICRDVCEFHAIVVLKDKIYVMPELCHSCGACSYFC
FT                   SKRAIEEVEIPIGKIVEVNSKIKLTYGILNVGETTPVPIIKQVKKKIKGDAIIDCPPGT
FT                   SCPMVESVRDADYCILVCEPTPFSLHDLKLAMSVLDKLEVSYGVVINKHGLPFNIEDKI
FT                   DADIIGRIPFSKRIAESYSRGELLHDYADLFREIYEVIKCRLQ"
FT   gene            complement(372522..372920)
FT                   /locus_tag="Arcpr_0437"
FT   CDS_pept        complement(372522..372920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0437"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: dol:Dole_0581 dinitrogenase
FT                   iron-molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57505"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT0"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ADB57505.1"
FT                   /translation="MRVAVSTISGGLDDKVSEVFGRAVSFTIVDVEDGEIKSVEVVRND
FT                   FAVRGGGAGVAVSQFLVDKGVNAVITGNVGPNALGVLSSAGIKVYRGSGLTVKEAIEKL
FT                   IRGELEEITSPSQPKMGRWRRGGGRGQW"
FT   gene            373044..373703
FT                   /locus_tag="Arcpr_0438"
FT   CDS_pept        373044..373703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0438"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57506"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR015832"
FT                   /db_xref="InterPro:IPR040537"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT1"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADB57506.1"
FT                   /translation="MLRAIQIIAKNEIGVLRDVTTVIANYNGNITYSQTFILEDGEYKG
FT                   KAMIYFEVEGGDFESMLKEIKEIPTVLSVEEVKPFKDIFGKRVIIFGGGALVSQVALGA
FT                   ISEADRHNLRGERISVDTMPIVGEIELAEAVNAVSRLHRAKALVLAGGLMGGKIADEVK
FT                   MLRRCGIPVISLNMLGSVPKVSDLVVSDPVMAGTLAVMHVSEKAKFDIRRVRGRRI"
FT   gene            complement(373675..374154)
FT                   /locus_tag="Arcpr_0439"
FT   CDS_pept        complement(373675..374154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0439"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: pca:Pcar_2746
FT                   molybdopterin-guanine dinucleotide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57507"
FT                   /db_xref="GOA:D2RGT2"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT2"
FT                   /inference="protein motif:TFAM:TIGR00176"
FT                   /protein_id="ADB57507.1"
FT                   /translation="MKVLCVVGKSNSGKTALIEGVVPILKKKGLVVLVIKHAKEFDIDR
FT                   EGKDSWRIFRSGADVVITSKEKTAFIGRIPDDLDTLIEIFKDKYDLILTEGFSSSNYPK
FT                   IVVLKDGEDLRSYTNVIAVVADFNVDFQPKFRRDDYENIANFMISWIKSACPSPF"
FT   gene            complement(374193..376088)
FT                   /locus_tag="Arcpr_0440"
FT   CDS_pept        complement(374193..376088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0440"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="PFAM: RNA-metabolising metallo-beta-lactamase; beta-
FT                   lactamase domain protein; KH type 1 domain protein; SMART:
FT                   KH domain protein; KEGG: scl:sce4166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57508"
FT                   /db_xref="GOA:D2RGT3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019975"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR033769"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT3"
FT                   /inference="protein motif:PFAM:PF07521"
FT                   /protein_id="ADB57508.1"
FT                   /translation="MMDKIKEIKQKVIESLPKKVKVKDVEFEGPFLVVYVKNPQELANA
FT                   DIVKKLAKDLRKRIIIRADPKSLKPKEEAEKIIRQIVPEDAKITSIFFDEEYCEVIIEA
FT                   EKPGVVIGKGGSTFRKILKETGWSPRVVRTPPLKSKTIESIRSYLLSVREERKEILKRI
FT                   GESINRPILHADKWVRVTFLGGAREVGRSCYLLQTPNSKILVECGINVSGNQPPYLYIP
FT                   EIQPLDSIDAVVITHAHLDHCGLVPVLFKYGYRGPVYLTPPTRDLMVLLQLDFIEVASR
FT                   EGTTIPYESHWIRTALKHCITLDYGVVTDIAPDVRLTFYNAGHILGSAIAHFHIGEGLY
FT                   NIAFTGDFKFERTRLFDKAETNFPRLEALIMEATYGGSQDFQPSRKEAEENLIRIVNET
FT                   ISKGGKVLIPAFAVGRSQEVMIVLEEAIRTKKIDEVPVYIDGMIYEATAIHTAYPEYLN
FT                   AHLRDLIFHQGINPFISESFVRVDSPSKRQEVIDSSEPCVIISTSGMLNGGPVMEYFRA
FT                   LAGDEKNTIVFVGYQAEGTLGRRIQKGWKEVPFTVDGRREVVKVNMRVETVDGFSGHSD
FT                   RRQLMNYVKALSDKPEKIITVHGEESKCIDLASSIYKTYKIETRAPMNLETIRFI"
FT   gene            complement(376085..376732)
FT                   /locus_tag="Arcpr_0441"
FT   CDS_pept        complement(376085..376732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0441"
FT                   /product="Proteasome endopeptidase complex"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   hypothetical protein; K02737 20S proteasome subunit beta 5"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57509"
FT                   /db_xref="GOA:D2RGT4"
FT                   /db_xref="InterPro:IPR000243"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016050"
FT                   /db_xref="InterPro:IPR019983"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:D2RGT4"
FT                   /inference="protein motif:PRIAM:3.4.25.1"
FT                   /protein_id="ADB57509.1"
FT                   /translation="MLGEIQDKVYKGTTTVGLVCKDGVVLATEKRATMGNFIASRRAKK
FT                   IYRIADRVAMTTAGAVGDAQFLARLISVEIKLYEIRKEEKPTVKAIATLLSNILNSVRW
FT                   FPYFVQLLVGGVDKRGPSIYSIDLLGGAIEEIDIVATGSGSPTAYGVLEDRYTPEITVD
FT                   DGVELAVRAIYSAMRRDSASGDGIDVVKITKDGYFELSKEEVDKILSSLRRA"
FT   gene            complement(376820..378004)
FT                   /locus_tag="Arcpr_0442"
FT   CDS_pept        complement(376820..378004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0442"
FT                   /product="Myo-inositol-1-phosphate synthase"
FT                   /note="PFAM: Myo-inositol-1-phosphate synthase; Myo-
FT                   inositol-1-phosphate synthase GAPDH domain protein; KEGG:
FT                   sfu:Sfum_1982 inositol-3-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57510"
FT                   /db_xref="GOA:D2RGT5"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT5"
FT                   /inference="protein motif:PFAM:PF07994"
FT                   /protein_id="ADB57510.1"
FT                   /translation="MKVWLIGAYGIVSTTAMVGAKALERGIVDKTGLVSELPPFKKISE
FT                   YVPLKFEFGGHDIRPLPTAYDAIMEHWESNRHFDREILDAVGDELKKIKACKGTALNCG
FT                   EGIRELGRVETLEDEGLTLREIVDRIEKDIKGFADDETVVINVASTEPLPKFSEKYHTT
FT                   IEGFEEMLDNDVKEYATASMLYAYVALKLGLPYGNFTPSVGSSLPALKQLAEEKGVPHA
FT                   GNDGKTGETLVKTTLAPMFAYRNLKILGWMSYNILGDYDGKVLSHRENKESKVISKDKV
FT                   LEKIMGYSPYTITEIEYFPSLVDNKTAFDFIHFQGFLGTKMKFYFIWDGIDAIVAAPLI
FT                   LDIARFLLFAKKKGISGVVKEMAFFFKSPMETDVINTHEQFVMLKDWFEKLAEV"
FT   sig_peptide     complement(377942..378004)
FT                   /locus_tag="Arcpr_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.644) with cleavage site probability 0.311 at
FT                   residue 21"
FT   gene            complement(378073..379497)
FT                   /locus_tag="Arcpr_0443"
FT   CDS_pept        complement(378073..379497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0443"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: gsu:GSU3365 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia; tRNA synthetase class I (M);
FT                   Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57511"
FT                   /db_xref="GOA:D2RGT6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT6"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADB57511.1"
FT                   /translation="MRGDPVRLYNTLTKEMEELKLDKTVRMYVCGITAYDYSHIGHART
FT                   FVFFDVLRRYLEYEGHEVIYVQNFTDVDDKIVRRAVNEGKTQKEIAEKFISEFLKDMSA
FT                   LNVKMPDYMPKVTDHIQDIVQAVQKLIELGYAYEVENEHGKDVYFHVPAFESYGKLSGM
FT                   SLEELNRHRIEPNPKKRDVKDFALWKSAKEDDFKAKAVFDSPWGYGRPGWHIECSVMSA
FT                   KYLGVPFDIHGGGKDLIFPHHENERAQSYALFGVEPVRYWIHCDFVMIKGEKMSKSLGN
FT                   IVKIRDVLNVYGGEVLRYFLLTAFYRSPLDYSEKSLERAKNSYNYLKNTLINLDMEISA
FT                   LKSYGEDRKDMGFDPSSFLKEFESAMDIMNTPKALAVFHSFAKAINKNLYDMSLKELES
FT                   CFETFMTFSKVLGLFENYERIPTLPKELIELVKEREVARKEKDFERADKIREKLREKGI
FT                   MLIDTPKGTRWLTKHF"
FT   gene            complement(379499..380509)
FT                   /locus_tag="Arcpr_0444"
FT   CDS_pept        complement(379499..380509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0444"
FT                   /product="tRNA (guanine-N1-)-methyltransferase"
FT                   /note="PFAM: tRNA (guanine-N1-)-methyltransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57512"
FT                   /db_xref="GOA:D2RGT7"
FT                   /db_xref="InterPro:IPR016742"
FT                   /db_xref="InterPro:IPR028564"
FT                   /db_xref="InterPro:IPR038459"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT7"
FT                   /inference="protein motif:PFAM:PF01746"
FT                   /protein_id="ADB57512.1"
FT                   /translation="MRLRDVFVKALKELGIDCISTEIKRITESDDPLQSMAYHVIMGKA
FT                   QVCRGLKGKVFNLNQECENPAYVGKCDDPILTRNDLLEKAKDFPFIVIDCSFYDFHTEK
FT                   EKKKLKLQIQQCLGVIRKFMWDERLVITHKDFGVGVFYPSTAKFIKEMGLKDIILLDPN
FT                   GDEVFEGQRAECYIIGGIVDKTGNKRGWTSKIGENLRREGISFRSMRIELRGDVIGVPD
FT                   RLNTIVEIVLRVVLDGEDVEKAVRSVQSHLVAKWRLRRELPKRTIRIDVNGKPFRVVRK
FT                   SEIKSFDWLNIRPKDFYEACSELGYLVIDDEWLERILRNSTFDESKNRYIFKGFN"
FT   gene            complement(380601..381161)
FT                   /pseudo
FT                   /locus_tag="Arcpr_0445"
FT   gene            complement(381145..381528)
FT                   /locus_tag="Arcpr_0446"
FT   CDS_pept        complement(381145..381528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0446"
FT                   /product="Protein of unknown function UPF0146"
FT                   /note="PFAM: Protein of unknown function UPF0146"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57513"
FT                   /db_xref="InterPro:IPR005353"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT8"
FT                   /inference="protein motif:PFAM:PF03686"
FT                   /protein_id="ADB57513.1"
FT                   /translation="MLQIADYISKRYSGKLVEVGIGYNWIVALKLKENGFRVVATDIRH
FT                   IPIKDIEFYIDDITTPRLEIYSNSSLIYSIRPPPEIVPHILRVAKEVKADVLIRPFGNE
FT                   FYSGKLINYRGERFYVWRDGIET"
FT   gene            381572..382033
FT                   /locus_tag="Arcpr_0447"
FT   CDS_pept        381572..382033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0447"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: tdn:Suden_1201 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57514"
FT                   /db_xref="GOA:D2RGT9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGT9"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADB57514.1"
FT                   /translation="MVIREYSVKDFRDIMEIDGEAFSPRNPVYDVYIYVTYGSDLLVAD
FT                   IGGKVVGYIAVMDIDRETSKIVSLAVKKEFRRKGIGTKLLSTAIERCKERGKKKIILEV
FT                   RVSNYPAQNLYKKMGFKIVDVIPNYYQDGEDAYLMVLDLTQSTQEAPLS"
FT   gene            complement(381984..382262)
FT                   /locus_tag="Arcpr_0448"
FT   CDS_pept        complement(381984..382262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0448"
FT                   /product="Protein of unknown function UPF0058"
FT                   /note="PFAM: Protein of unknown function UPF0058"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57515"
FT                   /db_xref="InterPro:IPR002753"
FT                   /db_xref="InterPro:IPR036519"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU0"
FT                   /inference="protein motif:PFAM:PF01893"
FT                   /protein_id="ADB57515.1"
FT                   /translation="MHKEEMVLLHLALFNVKRFFENAGVANGHFKLYDELGVHPVHIHK
FT                   SKADHKRAILLLCKGIYEIFKDKHASELLNNPKIRELLESIESDLKP"
FT   gene            382428..382498
FT                   /locus_tag="Arcpr_R0015"
FT                   /note="tRNA-Cys1"
FT   tRNA            382428..382498
FT                   /locus_tag="Arcpr_R0015"
FT                   /product="tRNA-Cys"
FT   gene            complement(382798..383814)
FT                   /pseudo
FT                   /locus_tag="Arcpr_0449"
FT   gene            383903..384127
FT                   /locus_tag="Arcpr_0450"
FT   CDS_pept        383903..384127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57516"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57516.1"
FT                   /translation="MAVRTREIEEIRKNVREFAKKQTQPFSVNDVAREFGISWTTARAI
FT                   LLELALEGEVEVMKTSKSYIFIPKRGDKR"
FT   gene            384124..384798
FT                   /locus_tag="Arcpr_0451"
FT   CDS_pept        384124..384798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0451"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   sat:SYN_02191 selenocysteine-specific protein translation
FT                   elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57517"
FT                   /db_xref="InterPro:IPR004977"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB57517.1"
FT                   /translation="MKKIKIENVMIELEEPLRFFKFEADKIYEVEIDLQRFPIIKKFRS
FT                   RNGGEYPACIYNLRILRENGKEINSEWMQRRVSVGDYREDENGIRVKPRMFSEFWQLAQ
FT                   IYDKFRAGIHKCIVKTKGGNKGQVLTRIIHSKDCDCLKSREGEKRREERDSDIQVYHPQ
FT                   EIAERLKEDIKEEKAITVKEVMDRYNTNEETARKALDVLTEEGLAVKIREDKYFISPKS
FT                   EL"
FT   gene            384855..385826
FT                   /locus_tag="Arcpr_0452"
FT   CDS_pept        384855..385826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57518"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57518.1"
FT                   /translation="MAIGLKPLEDIVELAIISAWIKPKPVSLGIFAPPEYGKTEALLQF
FT                   AGCKGVKIISDVTSFGLSRFILPEISSKRVKCLIFPDLLKILNRSWKVTNEILSLLNVI
FT                   IEEGVSAVYTFNIQFDAEIIGDRVRCGVILACPEEVIKERENRLKKFGFWSRILPFYFE
FT                   YTKEDLLRIHEEIKEERSPFMKKNLNIPDDEIEIKLPKEEADKLDPIVFAFKDSIGSTT
FT                   GFRLRWNLQQLAKANAWINDRDIVIEEDIRKIISFTPFFFNPIKGDECIYRILRLLPAK
FT                   SEEIVEELSDLYSRRTIYDRLKRLKESGIIIESERGWNLRLK"
FT   gene            complement(386191..386622)
FT                   /locus_tag="Arcpr_0453"
FT   CDS_pept        complement(386191..386622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57519"
FT                   /db_xref="GOA:D2RGU4"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57519.1"
FT                   /translation="MKVHKEKYEKCVEMLRQGYSYRQIAKKLKLSISQINQIAKDLEIM
FT                   VDLEVNKRKLKELENKINELEEYKAKLEKEIKEKEKLIDEIVEVAKLKKEAIGTLKLFD
FT                   KAFQSILSNPYIHYLALSDDNFRDLIVKANKIHEAVKKL"
FT   gene            complement(386763..387287)
FT                   /locus_tag="Arcpr_0454"
FT   CDS_pept        complement(386763..387287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57520"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57520.1"
FT                   /translation="MMEWTEEKIIEYINQGWTLSYDKTNQKYKLQKRINGRVKSYTLPK
FT                   RFNEFCKRLKEEFKYLPIFEDIEKEYSITKVMERHNLDEIEIYDVLWKYVEWKLNKREG
FT                   LKELLYDILCKFKAIEEIEDRLNKASRMVRTGFGFAELSFQCPNCLENSKLRYDKSMGK
FT                   WVCSNCGEIPF"
FT   gene            387456..387848
FT                   /locus_tag="Arcpr_0455"
FT   CDS_pept        387456..387848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57521"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57521.1"
FT                   /translation="MTVPYWFNEKLIDTDAKAFGVYLALLRSRFTHGWWDKEVRPSPPI
FT                   VDDVRLEIQKFLTGRDILEASEAVRDFMKLLNEYEYEKLFLDKSFLDEIEIKYYEKFRR
FT                   ACYRYFKREAINEEIRDYILGYFLKM"
FT   gene            387875..388384
FT                   /locus_tag="Arcpr_0456"
FT   CDS_pept        387875..388384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Low complexity protein with large Glu repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57522"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57522.1"
FT                   /translation="MTKIGSVHIYSIASKASKYLAISKDFERYCTNLQCKKDKIDEIAK
FT                   ALIESGIVVFGISGADIIQAPFLKDEFIERLAPPEETEEVEGEEKIEREEKEKLGKEYE
FT                   GKALTREILESIVRDVLEDLGFKVETNKKLDARGGGKIEVDVWGMKLIKNAGFYVYASC
FT                   KNWDRK"
FT   gene            388369..388704
FT                   /locus_tag="Arcpr_0457"
FT   CDS_pept        388369..388704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57523"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57523.1"
FT                   /translation="MGQKIDRSTIDEEFGRTQHLIQIPHLKIFVAKRLTDPARQTALAD
FT                   GFIVIELGEKASTNNAREIYEIIYKHLRELFIGIAPPELQKFAKETREISERLKTLAEE
FT                   IERISSL"
FT   gene            complement(388729..388986)
FT                   /locus_tag="Arcpr_0458"
FT   CDS_pept        complement(388729..388986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57524"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57524.1"
FT                   /translation="MDWSKYSFVIRAKNRKAVLLCLSNPKTPAQIAKELNLSLPHVSRA
FT                   LKELEKEGLIECLTPNEKVGRVYKRTMIGEEIANFIKKIC"
FT   gene            389059..390531
FT                   /locus_tag="Arcpr_0459"
FT   CDS_pept        389059..390531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57525"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57525.1"
FT                   /translation="MANMHSEVQDYLKALLEYYDFTVEKERYISPSDRIDLYGYSKSHN
FT                   KTIGIEITFTSDVRRDAEKLAKSGFDLIYIVVDNPAYEGKIEYRGRVIPIVHYNSFENE
FT                   LRRSLNISLTFPMFGSFEEWIKGRRIEQIPVAEGKLDKFIQTLRYSGLDEFIEDVINLL
FT                   AMLYITREIPSMYRDAITYDLICSGVKTKRPQYRTIIEPKILNILKNFDLVLEEARGSG
FT                   ELRKYFIHLTNKGDEIGREIIANRISTNSRELDSIIKEFGKMAPIIAVGTVERYVRERI
FT                   MRFELSEKDIFDRLLLHVESRVTDYVIHSKLVTMGKEVELRYGRKRKLHPLLSLICYFI
FT                   TYYNYSKSRDFFNRLEELGLAYEVPIYDSRGRFIHDEIRSSIEVSEYILSRIPLPESEL
FT                   IFEFGSLTTILAISRIRDPKIARERLEEYIKFYEIPLDSIKRVLDEFNRFGLASKFIEV
FT                   SDSGPFLIFDEKKFEEIIKRKLIDTALRFLKL"
FT   gene            complement(390573..391214)
FT                   /locus_tag="Arcpr_0460"
FT   CDS_pept        complement(390573..391214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57526"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57526.1"
FT                   /translation="MIKLNVVKRLYLRIEESEKDRIDENYREIRENYNPMKQNIKIKVL
FT                   FIGESPAGATFFYCANSNLYFATKEAFEKAYSKSITNFLDCFKYLGCYLIDVYNKPDTK
FT                   AKSPCGWVGRQEKGKLIPNLANQISQLNPYFIIVIHERVCCWAILSAKEALKKLKKSKT
FT                   QPNFNLNDIRCLPFPRCDCREVYIDQLAEIIKKELIPRGIFPKKLPQPPC"
FT   gene            complement(391272..392249)
FT                   /locus_tag="Arcpr_0461"
FT   CDS_pept        complement(391272..392249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57527"
FT                   /db_xref="GOA:D2RGV2"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR031857"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV2"
FT                   /inference="protein motif:COG:COG4342"
FT                   /protein_id="ADB57527.1"
FT                   /translation="MKEVRDANVNVGTMLRRIGGWDVHHILSQGPDLNRGQGICSGLRE
FT                   EKIKNRVISIGCSSKESNIDEIRYDEVRKDFINWLYEKCSKEHADKQIYYLDKYLPDRI
FT                   RNPKELFEIIRKVEKGKRHFCVGLRNLLNFYEAFDLMNEESLMKYRKIVKIPKTNQDEY
FT                   VPEDSKVIEVFRKFKDERYKILFKLLAFSGIRLREALHLLRTFDSNKLITNDKIAKYPL
FT                   GLDRGSKKSYYAYLPLEFSNELRRMELDEDAVSQYFAKKGLPAKYLRKWNYNFLILNGV
FT                   PESVADFIQGRASITVGSMHYLAKVKQADEWYSRIISKLLNLFK"
FT   gene            complement(392332..394575)
FT                   /locus_tag="Arcpr_0462"
FT   CDS_pept        complement(392332..394575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0462"
FT                   /product="efflux transporter, , hydrophobe/amphiphile
FT                   efflux-3 (HAE3) family"
FT                   /note="TIGRFAM: efflux transporter, , hydrophobe/amphiphile
FT                   efflux-3 (HAE3) family; KEGG: dal:Dalk_0513 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57528"
FT                   /db_xref="GOA:D2RGV3"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004767"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV3"
FT                   /inference="protein motif:TFAM:TIGR00921"
FT                   /protein_id="ADB57528.1"
FT                   /translation="MSFEDFLEKVSRFVAKRPGFIVSVTALVVIIFLISASQTEFTSLE
FT                   YKNMFPIGDPVYKDLELYQKDFGIRAEGVYIMIKGDDVVNREVYEYMLKLGENLKNIDG
FT                   VGGVTSPASIIAELNGGVLPSDNSQLKRLTELYAYHLVPKKTLALISITITVTDPDKTM
FT                   ELAEQIERVVKFTDRPTGITAEVTGSPVLSYQITQTTQKETGMTTMASIIAMIILLIVT
FT                   FSGAVRKKYTAFMPLVISVFSVIVVVGLLPLTGIKLDTMISASLPILIGLAIEYAAQIQ
FT                   NRYEHERMRGVDRDNSIVISVTKTGLAVILAMITTVIGFMSMATTLIPEFAIFGGSISL
FT                   GLVIAYIFSITSLPAILKILDKEETTKVKEKKEVGILEKVLTSIASLTASKPKAILALA
FT                   LIIVIVGAYANTQIELETDTKKYFPENLPAMVKFNELEEVMGKQYIYTVVLSVDEVGVD
FT                   ELKRLDELGNYIVNKEDMVYRCDSLSSLIKEYLGKLPESDAELSTVLSMIPKDVLKRYI
FT                   SGHTLALYLYTSADTHDKRVELTEYLKRDVRFFEWHEGYYITGQPAIMAHLGEIMLNSQ
FT                   TQMTLVSYGLIVLLLFATYRSITRAVVPLVAITTVIGVLNTTMFAMGMKQTFMSIAINS
FT                   ITLGLGIDFSIHMAERYAEERQKYSPEKAVTVAIEETGKAIVTSALTMAGGFGALMLSS
FT                   FPMLWNFGFLSVIAIIFSLIGALTVVPAFLMIVERFRRTDVMDSVANALSRAT"
FT   gene            complement(394572..396386)
FT                   /locus_tag="Arcpr_0463"
FT   CDS_pept        complement(394572..396386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0463"
FT                   /product="S-layer domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57529"
FT                   /db_xref="GOA:D2RGV4"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV4"
FT                   /inference="protein motif:COG:COG1361"
FT                   /protein_id="ADB57529.1"
FT                   /translation="MKVRIVLLALIVSFLIVATMPVQALEYEEKPNVTAYIVGSNYLDR
FT                   GEQKTVYIAIYNPAERKKVDYFDQEEAAFFAGKEDMLFTAYNVEVRLEGNEYIEVKTPT
FT                   QKIPALPPLQPVNLAFIVKVKDEAKAGKYELKLKVSFDIIDDLVYVDTFNPTWMPTQKQ
FT                   VKDEDEANATYTYEYEMLTEHYKLRYEHLSFEIPIEVYVEEKDVRLDIVNVNAENMVGK
FT                   SKGKLVVEVKNVGEKTAKNAYLVLETPSGFKASALSLSQAQTMSAMPAMAVPGTQMANA
FT                   PSMPMGMPAQVASMPSTTSQPAYYVGELRPNDVAKAIFYIRIDTKDEGNYTFKVKAVYL
FT                   DEYGNIAESDPVPFGVYVSKAPDFEVKSVESKVFVNAKGDVVVTLVPEMDLKDVSVYLT
FT                   TKPPLSVLSAEYYLGDVQAGKEYTAVFKVQASDEAKPVIYPAEIKLKYRSMDEYFYTDS
FT                   KSIGIKINPKMKFEVYGTPKIAAGSEGIVTFTIKNVGNFTIREATARLTITDPFSSDDD
FT                   TAYIGTLKPGESAEIKFKLSVDADATPKKYGLNLEVKYKDLEDEWAISEPTKAVIEVVP
FT                   PKPPYGAIALIAILAIVAVGYYLRRRRK"
FT   sig_peptide     complement(396312..396386)
FT                   /locus_tag="Arcpr_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 25"
FT   gene            396455..397150
FT                   /locus_tag="Arcpr_0464"
FT   CDS_pept        396455..397150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0464"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   bbr:BB3556 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57530"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV5"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADB57530.1"
FT                   /translation="MKITEVLKYFGLSEYEAKALYVLLLHGELTAKDIAELSGIPRTSV
FT                   YDVMNLLESKGLVVSYGKPLRFRAIEADEIVKIFSGIVLDRLDLLKKELSRLRGGASEE
FT                   VRVYKGEATLSILRTLVSEARERIVALLSYITDDMAEILNSAKCRVTVVSSNASRVKGE
FT                   CYEFQRKEKLLEKVKGLCHGILIFDDRAAMIVFMNGIALSIVSYDERLVLFLKMLVNSL
FT                   IEFFRDVRT"
FT   gene            397225..397926
FT                   /locus_tag="Arcpr_0465"
FT   CDS_pept        397225..397926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0465"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: hch:HCH_06642 PP-loop superfamily ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57531"
FT                   /db_xref="GOA:D2RGV6"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV6"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ADB57531.1"
FT                   /translation="MSGGIDSSTLLWYLMKRYDEIYVITYIYGQRHAREVEHAKMIVEK
FT                   AREKAKIHHEIADISCIQRLIAKGALTGNEEVPEGFYTDESQKKTIVPNRNMILLAIAV
FT                   GYAVKVGEREVYYAAHKSDYATYPDCRKEFVKALDTAVYLATIFDPVVIKAPFVDMTKA
FT                   DIVKLGLKLGVPYELTWSCYRGEERPCLRCGTCLERTEAFLINGVKDPALSDEEWKRAV
FT                   EIYERFKGGSR"
FT   gene            complement(397966..398790)
FT                   /locus_tag="Arcpr_0466"
FT   CDS_pept        complement(397966..398790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0466"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57532"
FT                   /db_xref="GOA:D2RGV7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV7"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADB57532.1"
FT                   /translation="MIITDDHMHLYNHLKFKALEQFKSAGGTHVFLVNLLSKHYGLKPT
FT                   KPEDYLEMFKKHISMVEKANKIVRAFAVIGVHPAEITLLGGRMKVQKAAEIMKSAFDLA
FT                   GKLIEEGKAVALKSGRPHYKVSKEIWDLSNEVMKHAFEVAKDVGCAVQLHTESYTYEGI
FT                   KEIAEMADKVGLKRYKVVKHFSPPKIKEFEEIGIFPSVICLNDYALEAAKQGSRFMLET
FT                   DYIDDKDRPGAVLGPKTVPRKVKELLKHGFDEDFIYKICVENVEKVYGVEIE"
FT   gene            complement(398852..399952)
FT                   /locus_tag="Arcpr_0467"
FT   CDS_pept        complement(398852..399952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0467"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="KEGG: sfu:Sfum_0041 chorismate synthase; TIGRFAM:
FT                   chorismate synthase; PFAM: chorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57533"
FT                   /db_xref="GOA:D2RGV8"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV8"
FT                   /inference="protein motif:TFAM:TIGR00033"
FT                   /protein_id="ADB57533.1"
FT                   /translation="MVGNTFGYLFRVTTWGESHGKAVGCVVDGCPAGLELREEDIQREL
FT                   DRRRPKSAISTARREKDEVVILSGVFEGKTLGTPISMLVYNRDVNSKPYEEIKHLFRPG
FT                   HADYTYQAKFGLRDWRGGGRSSGRETVARVMAGAIAKKILQRFGIRLVGFTREIAGIRC
FT                   DINPEEYDLDEIFRLAESNAVRCPDEDVARRMEETILKAKAEGDSVGGIAEVIARGVPA
FT                   GLGEPVFFKLDAYLAFALMSVPAVKGVEIGAGFKVAKMRGSECNDPIVLKEGKIGFATN
FT                   NAGGILGGISNGEDIVVRVAIKPTPSISKPQKTVNWVKMVEDKIVVKGRHDPCIVPRAI
FT                   PVLEAMVALVLVDCMMMQGLIPRFLG"
FT   gene            400006..401289
FT                   /locus_tag="Arcpr_0468"
FT   CDS_pept        400006..401289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0468"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   GF24327 gene product from transcript GF24327- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57534"
FT                   /db_xref="GOA:D2RGV9"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGV9"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADB57534.1"
FT                   /translation="MITPTYSVEEVVGIRGYITSHEGINGIFKENPEDFYVEEVADLKI
FT                   GEGDWVIIKVKKVNWDTLNFVRVLSNKLRISQKRISYAGTKDKRAVSVQYFAVRIKSED
FT                   ELERLKGLSIKDAEIEVVGRTNRSIQLGDLKGNIFKVVIKNAKNVSNIPLIEGELRARG
FT                   TPNFFGLQRFGSIRFITHEVGKYILKRDYETAFWVYVAKPFEGESEDARKVREILWNTR
FT                   DVKFGLREMPKYLRYERTLLQKLREGKSEKEALLSLPENLKMMFIHAYQSYVFNNVLSD
FT                   RIAEFGNLKVVEKGDWVDFVNLNDYYTFREDFVKVHDHNYKRVKFLIERGLCALAIPLP
FT                   GYETPLGDDWTSERIRFYLERDGIDLKDFKHEYKEFSSKGSVRVADMLIEQTNLKYEVE
FT                   ENVTFSFYLPKGCYATVLLREFVKKPLA"
FT   gene            complement(401281..401589)
FT                   /locus_tag="Arcpr_0469"
FT   CDS_pept        complement(401281..401589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57535"
FT                   /db_xref="InterPro:IPR016800"
FT                   /db_xref="InterPro:IPR040713"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW0"
FT                   /inference="protein motif:COG:COG4004"
FT                   /protein_id="ADB57535.1"
FT                   /translation="MREYRFKRGYKPDEGRLEELIRKYFGEFEKDGNVYVVRYGAMEEL
FT                   RLWIENKRLYAETRTNPKVTEDVAVQTIKTYNKFLEELTGYTAKERAKMMKKEVESG"
FT   gene            401648..402364
FT                   /locus_tag="Arcpr_0470"
FT   CDS_pept        401648..402364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0470"
FT                   /product="protein of unknown function DUF75"
FT                   /note="PFAM: protein of unknown function DUF75"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57536"
FT                   /db_xref="InterPro:IPR004425"
FT                   /db_xref="InterPro:IPR019151"
FT                   /db_xref="InterPro:IPR038389"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW1"
FT                   /inference="protein motif:PFAM:PF01908"
FT                   /protein_id="ADB57536.1"
FT                   /translation="MDTKVVVDRVDIENPIVFTSFPGIGLVGTIASSHLIMELNLEWIG
FT                   VVESKDLPPVASLMDGIILPPIRVYQSSELGFVLIHSDVPIFPHIAYEMSEKILDWVME
FT                   IKAKRIYSLAGVATFEDKKRVFGAATSKELLEEIKDYVEIFKSGTISGIAGSILNECVA
FT                   RKFPGLALLGETLGFNPDPRAAAEVINVLNRMFGWSISVEKLIKEAELIEAQMQKLAEQ
FT                   TRMQEMGRKEELPMYG"
FT   gene            402370..402759
FT                   /locus_tag="Arcpr_0471"
FT   CDS_pept        402370..402759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0471"
FT                   /product="Protein of unknown function DUF473"
FT                   /note="PFAM: Protein of unknown function DUF473"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57537"
FT                   /db_xref="InterPro:IPR007417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW2"
FT                   /inference="protein motif:PFAM:PF04322"
FT                   /protein_id="ADB57537.1"
FT                   /translation="MKCLVLTGISKDVLDDLMRRHIKTIELRSAHNIATAMRAEVGDCV
FT                   FLTSAKTFDVDRGTLGIIAQVTGKEIYSHSLMFSTPTLIQESEMTVVRLKLEVRGVGRV
FT                   VRVYNTGILDTTEAEVVEVSYFDAR"
FT   gene            complement(402913..403074)
FT                   /locus_tag="Arcpr_0472"
FT   CDS_pept        complement(402913..403074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57538"
FT                   /db_xref="GOA:D2RGW3"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57538.1"
FT                   /translation="MNVMRFNVTVREDIGKLFRMKVVEIKGNKKGALSEAVEEALILWL
FT                   EKYGVKIH"
FT   gene            403125..404237
FT                   /locus_tag="Arcpr_0473"
FT   CDS_pept        403125..404237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0473"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; KEGG: noc:Noc_2211 transposase
FT                   IS605"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57539"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW4"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADB57539.1"
FT                   /translation="MELIKAYSIPIKAPKDLMEEFFKLRKTVLDEVFKHIKYSKSGKAH
FT                   LKFNKNDRKELRDKLLRNWRFAKHYVDSAINSVIGLVKGWIQLYNRGKAKSKPEITKKT
FT                   VYVKTTLFTVRNGKIKITIEPKKRYLEVDLAKFNYLPKDYDSIGGLILQKDKLIITFKK
FT                   RVELVEPKDYASFDVNLTNVTGLINYRIVRFDLRELYHIHRVYEEKRKRIQKLAKTKPK
FT                   TAKKLMQKYSKRERNRVRDIMHKITTTIARELVSIKHGAILEDLKNIKDGILNGSKNLN
FT                   RKLSKWNCRMFQSMLEYKLMWFGLPVKYVNPANSSKTCPVCSGRLSAYRDRLMKCDRCG
FT                   LVQDRDVIAVLNLRMWGLGGYPEGGRALQG"
FT   gene            complement(404261..404545)
FT                   /locus_tag="Arcpr_0474"
FT   CDS_pept        complement(404261..404545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57540"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57540.1"
FT                   /translation="MKFAIVSFGLRDIVDVVLPLYPQADVFNSLDDVNIEEYDFIVLTS
FT                   ELGGEEGERLISAMESVACEDLIVFCTTATSLNGILRSRNQGFSGRSHR"
FT   gene            complement(404576..405037)
FT                   /locus_tag="Arcpr_0475"
FT   CDS_pept        complement(404576..405037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0475"
FT                   /product="riboflavin synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase; PFAM:
FT                   67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57541"
FT                   /db_xref="GOA:D2RGW6"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR006399"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW6"
FT                   /inference="protein motif:TFAM:TIGR01506"
FT                   /protein_id="ADB57541.1"
FT                   /translation="MKVGIVDTTFARINMGKIAIDELRKICSLPYERYTVPGIKDLPVA
FT                   AKKLIEERGCDIVIALGMPGPKPIDKQCAHEASLGLIMAQLMTNKHIIEVFVHEDEAKD
FT                   EKELWMITENRVREHVRNAVDLLLNPKKLQKLAGTGQRQGFPDVGPLLR"
FT   gene            complement(405034..406134)
FT                   /locus_tag="Arcpr_0476"
FT   CDS_pept        complement(405034..406134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0476"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aminotransferase
FT                   class-III; KEGG: dde:Dde_3452 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57542"
FT                   /db_xref="GOA:D2RGW7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW7"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADB57542.1"
FT                   /translation="MLLMIPGPVHLHERIQLAMAKPMIGHRTKDFSEILEYCTEMLKKL
FT                   FGTKHDVFIISGSGTAGMEAAIACFSKVKRITCIDNGKFGDRLGKIAERYTEVDVVRFE
FT                   WGKSIELDEVEKSLAEGSEALAFVHNETSTGILNPARELAKIAKKYDALVIMDGITSVG
FT                   GDYVAMDEWGVDVAIVGSQKCIGAPPGLCAVAVNDRAWEFYNEKCPFYLDLKAYKKKLE
FT                   DWQTPYTPAVSLFFALQEALKIIEEEGLENRIRRHRELSAFVRKWVEEAGLELFPELNE
FT                   YSQYSNTVTAIKMPEGITDKELRGELKEKYGILISGGQEHLKGKIFRIGTMGNVTIRDV
FT                   VTTLACIERILVKRGIIKPVLGEIEA"
FT   gene            406181..406453
FT                   /locus_tag="Arcpr_0477"
FT   CDS_pept        406181..406453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57543"
FT                   /db_xref="GOA:D2RGW8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57543.1"
FT                   /translation="MKEIELTLDEFEKWLRERGYDKRMGKENFELFLKIGLAGLFFMNS
FT                   SLLMGYIFSSLGLPSERISEKTRFEIGRRIKEIKATRDYLKIVIE"
FT   gene            complement(406443..407276)
FT                   /locus_tag="Arcpr_0478"
FT   CDS_pept        complement(406443..407276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0478"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   dps:DP0629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57544"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGW9"
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /protein_id="ADB57544.1"
FT                   /translation="MSLKEYLKGKVSDDELKKVVRSFEIIGDVVIINLPDEISHLKDLI
FT                   VEAILKKHKHVKTILRKVGEVSGEFRVARYEVLYGGETETIAKEFGCRFLVDPTKVYYS
FT                   SRLSSERERIARMVKEGERVLVMFAGVGPYAIVIAKLAKPSEVIGVELNPKAVEYFRKN
FT                   VKLNKVEGIVKVYEGDVRDVVPKLEGKFDRILMPAPYSAENFVYLVRDKIKKGGYVHYY
FT                   TFAGEEEEEKLPEKVKELFRKHGMVVEVLNVRECGSFAPRVYRYVVDLRVVDFIQ"
FT   gene            407323..408321
FT                   /locus_tag="Arcpr_0479"
FT   CDS_pept        407323..408321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0479"
FT                   /product="RNA 3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="KEGG: geo:Geob_0963 RNA 3'-phosphate cyclase;
FT                   TIGRFAM: RNA 3'-phosphate cyclase; PFAM: RNA 3'-terminal
FT                   phosphate cyclase; RNA 3'- terminal phosphate cyclase
FT                   insert region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57545"
FT                   /db_xref="GOA:D2RGX0"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR020719"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX0"
FT                   /inference="protein motif:TFAM:TIGR03399"
FT                   /protein_id="ADB57545.1"
FT                   /translation="MIKIDGSYGEGGGQILRTAIALSCVTQKPVEVYNIRANRPKPGLA
FT                   MQHLKGIEAAKMITNAEVEGLKLGSTRVVFKPRSLRGGNFKIDIGTAGSVTLILQTILL
FT                   PSLYAERPSTFEIRGGTDVKWSPSVDYVRFVTFKALEELGAKVELDLIARGYYPEGGGK
FT                   IIVRVEPSKLRGKSFEVLPCDVVKGISHCQNLPSHVAERQKNSAVSFLKERGYDAEVEI
FT                   EVRKGISTGSGITLWCGYKGSVELGEKGKRAEIVGKECAEKLVKELESDGAFDKHLADQ
FT                   IMPFSAVASGETVYTTTEVTKHQISNAYVMNKFFDNVKIDGNRIEIDGIGL"
FT   gene            complement(408322..408606)
FT                   /locus_tag="Arcpr_0480"
FT   CDS_pept        complement(408322..408606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0480"
FT                   /product="Zn-ribbon containing protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57546"
FT                   /db_xref="InterPro:IPR018645"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX1"
FT                   /inference="protein motif:COG:COG3364"
FT                   /protein_id="ADB57546.1"
FT                   /translation="MPHRCTKCGKVYEDGDMRILNGCECGNNKFEYIPKERKERKEGEK
FT                   IEIVRILSPGCYEINLENAFKKEGIIIALGEEGKYAIHLPSLLKRRKKT"
FT   gene            complement(408609..408953)
FT                   /locus_tag="Arcpr_0481"
FT   CDS_pept        complement(408609..408953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57547"
FT                   /db_xref="InterPro:IPR012017"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX2"
FT                   /inference="protein motif:COG:COG3365"
FT                   /protein_id="ADB57547.1"
FT                   /translation="MEVKLNLISKEKLEKMGTMEKLRLILDEVKAGKIVVLESGLTPEE
FT                   EAKLIEMTMLEIDHENFVGIEVESYPQKSSGFLGKLFGKKGGRLMVIGPANRLKTLEKR
FT                   EDIIEALIRG"
FT   gene            complement(408959..409594)
FT                   /locus_tag="Arcpr_0482"
FT   CDS_pept        complement(408959..409594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0482"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: pmy:Pmen_1476
FT                   GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57548"
FT                   /db_xref="GOA:D2RGX3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX3"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADB57548.1"
FT                   /translation="MGLILRIKRRFGAIFKLFRKRNKLKIGIYGPPNAGKTTLANRILL
FT                   DWVGDVMGSVSEVPHETRRARLREGVKIEVDGRTITIDIVDTPGLATKIDFHDFLKYGL
FT                   SEEEAKRRAKEATEGVIEAIKWLDDLDGVILVMDSTEDPFTQVNITIVGNIEARKLPLI
FT                   IAANKIDLPNASPARIKSAFPQHTVVPISALKGLNMDTFYRVLAEKFG"
FT   gene            complement(409635..409805)
FT                   /locus_tag="Arcpr_0483"
FT   CDS_pept        complement(409635..409805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0483"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dal:Dalk_4905 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57549"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX4"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADB57549.1"
FT                   /translation="MPAVVDEDRCDGCGECVDECPTGAIELNDVAHVDPDICDDCGLCV
FT                   DVCPNEAIRIE"
FT   gene            409873..410898
FT                   /locus_tag="Arcpr_0484"
FT   CDS_pept        409873..410898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0484"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: mpt:Mpe_A1985 adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57550"
FT                   /db_xref="GOA:D2RGX5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX5"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADB57550.1"
FT                   /translation="MPATIVVGGFWGDEGKGKIISYLAYSDKPKIIARGGVGPNAGHTV
FT                   EVEGKKFGVRMLPSGFVYKDARLLIGAGVLVDPRVFLNELEVLDKDYNVRSRVGVDYRC
FT                   AIIEEKHIQEDRGDEHLRKKIGTTGTGCGPANVDRVRRKAKQAKDIPELKDYLADVPLE
FT                   INESLDEGHFVLIEGTQGFGLSLYYGTYPYVTSKDTTASSVAADVGIGPTRVDDVVIVF
FT                   KTFPTRVGEGPFPTEIPLEEAEKMGIVEYGTVTGRRRRIGLWDGKMARYAAMVNGATQV
FT                   AITGIDKLDKECYGVTEWSKLTPKAKEFIERVEDEVKVPVTLISTGPELHQIIDLRKEK
FT                   L"
FT   gene            complement(411075..411719)
FT                   /locus_tag="Arcpr_0485"
FT   CDS_pept        complement(411075..411719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: LL5 beta protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57551"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57551.1"
FT                   /translation="MLFRKKKKAEDLGERVSPTEDVDVLREKYGVDIEDDILRRLEELS
FT                   FAVAVGAKDRDVREKALNIYGKVKLVRSIRGTEKEEIIKLYAGLDVPDEFIEKLKEEGL
FT                   AEVTYKVSGVEIKAKNKEELAKKLEDFLQEEIELKDDVKIALSGKPLKVDESNAEVAGK
FT                   LYELGAFEIYLVPKGWFDLPYINGVSVERNLKELNELKEALPEYVSKFLES"
FT   gene            complement(411916..412881)
FT                   /locus_tag="Arcpr_0486"
FT   CDS_pept        complement(411916..412881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0486"
FT                   /product="RNA methylase, NOL1/NOP2/sun family"
FT                   /note="TIGRFAM: RNA methylase, NOL1/NOP2/sun family; PFAM:
FT                   Fmu (Sun) domain protein; KEGG: nuclear protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57552"
FT                   /db_xref="GOA:D2RGX7"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX7"
FT                   /inference="protein motif:TFAM:TIGR00446"
FT                   /protein_id="ADB57552.1"
FT                   /translation="MILDYPSTKKSRELAKRYGYNEFIVRRWINFFGFEETVKLIEAME
FT                   RGIPKHIRVNTIKIDENDLIERLRERGFKLEKTEVPFCYKVVEEPYSIGATPEYLMGYY
FT                   YVMEKSSCIPPLVLNPKSNELVADFASAPGGKTTFLAQLMNNRGVLIAIEANKERIQAL
FT                   IDNIHRMGVLNTAVIHMNAVRFCNLGLKVDKILLDAPCSGEGVIHKDKDRKRVSGRKDI
FT                   EFCSKLQKELVESALKSLKPGGVLVYSTCTLAPEENELVIQYVLDRFEVEIGEIEWGEP
FT                   ALTEIPNFGKLDKDIAKCRRFYPHKHESSGFFVAKIVKVS"
FT   gene            412929..414374
FT                   /locus_tag="Arcpr_0487"
FT   CDS_pept        412929..414374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0487"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dal:Dalk_3125 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57553"
FT                   /db_xref="GOA:D2RGX8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57553.1"
FT                   /translation="MENNPFIKKWRKGLRKIALVYPNAYASGVANIGLQYIYAYLNSLE
FT                   NCICERFYLDIHNCLRSFESGTPLSDFDIALFSLQFEEDYFNVVKILKESGFKGLKIAG
FT                   GPCAMINPKPIAKYFDAFVIGEVENSRVLDVIAEARSVEDLECEGVWLKEGKVKRIYPK
FT                   RLDFYLRRQIIADNVFGRCLILEIGRGCIRRCRFCVVRQIYSPPRWRDLKLLIDTAEDY
FT                   KGVVDKICLVAPSTLDHPRAKELIARLIEMGFLVSPSSTRADKLDEETVELLVKGGLRS
FT                   LTIAPEVGSDKLRDILNKGLSEEHILNAVEIGKEKGINSFKLYFMIGLPNESFEDVKEI
FT                   VRLVEKIKSLKVEVSVSINPFVPKPHTPLQWCSYTGIERVEDGLKEIKRRREYLIKELS
FT                   KICEVNVESVERFAIQTILSRGDEDVSKLLEAKPSLRLAKKMNLTRYLEKIPLDSELPW
FT                   DFIDHGYKKERLIKEFIQAVWSE"
FT   gene            complement(414349..415230)
FT                   /locus_tag="Arcpr_0488"
FT   CDS_pept        complement(414349..415230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0488"
FT                   /product="Protein of unknown function DUF1511"
FT                   /note="PFAM: Protein of unknown function DUF1511; SMART:
FT                   Water Stress and Hypersensitive response domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57554"
FT                   /db_xref="GOA:D2RGX9"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGX9"
FT                   /inference="protein motif:PFAM:PF07427"
FT                   /protein_id="ADB57554.1"
FT                   /translation="MKRLVVILVLALIFLGCSQSLGKPKIEKIVNRWGNVTEDYTEIVT
FT                   EITVYNPNPIPIPIKDVLTEVYLNGIKVGEGKSLQSEIKPSSESKIVISTKIDNDYIPK
FT                   WWVSHIKNRETSVLDVKGYLVFDLKITTFKFELPGIHSEFKTDFLGELSSSSQSFRLGI
FT                   YSVEIESVKAHWGKVDDNVTEIIAVAKVRNDNLIPLLFTRMHYVIKANGIVIGEGYSNV
FT                   STVISPKSTAEVPMVLTIETPKLKDWWVNHIRNGERTKLEVLIDPFVEIGGKKFEFSLA
FT                   KMETTIQTKLLG"
FT   sig_peptide     complement(415162..415230)
FT                   /locus_tag="Arcpr_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 23"
FT   gene            complement(415227..415601)
FT                   /locus_tag="Arcpr_0489"
FT   CDS_pept        complement(415227..415601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0489"
FT                   /product="protein of unknown function DUF123"
FT                   /note="PFAM: protein of unknown function DUF123; SMART:
FT                   Excinuclease ABC C subunit domain protein; KEGG:
FT                   hha:Hhal_1123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57555"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY0"
FT                   /inference="protein motif:PFAM:PF01986"
FT                   /protein_id="ADB57555.1"
FT                   /translation="MKGTYLLFLKLGDDKRINVGRLGRVEFRQGWYVYVGSGMNSLIKR
FT                   VARHFKRVKKLKWHIDYLSVQADEIVAFLIPNQRLECDLAKHLVTKFEYIEGFGCSDCG
FT                   CISHLFYLGNILKSDEDTKS"
FT   gene            complement(415598..416800)
FT                   /locus_tag="Arcpr_0490"
FT   CDS_pept        complement(415598..416800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0490"
FT                   /product="peptide chain release factor eRF/aRF, subunit 1"
FT                   /note="TIGRFAM: peptide chain release factor eRF/aRF,
FT                   subunit 1; PFAM: eRF1 domain 2 protein; eRF1 domain 3
FT                   protein; eRF1 domain 1 protein; KEGG: eukaryotic petide
FT                   chain release factor eRF subunit 1; K03265 peptide chain
FT                   release factor eRF subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57556"
FT                   /db_xref="GOA:D2RGY1"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY1"
FT                   /inference="protein motif:TFAM:TIGR00108"
FT                   /protein_id="ADB57556.1"
FT                   /translation="MYEFKRKLEELERYKGRGTELITLYIPPDKNIADVMSQLRNELSQ
FT                   AENIKSKQTRVNVIGGLEAILQRLKMFKKPPEHGMVIVSGVVEEDGKQKRITEIIIPPE
FT                   PVPLYKYHCDSKFYLEPLKDMLKDKKVYGLIVLDRREATIGLLRGKRIEVLDYKTSNVP
FT                   GKHRQGGQSSVRFERLREIAINEFYKRVGEAASEAFLPYKDQLEGILIGGPSPTKEEFY
FT                   KGEYLHHELQKKVIGLFDVGYTDESGLYELVEKAQDKLHELDLVREKRLMSRFLKEVVS
FT                   DGLAAYGEEEVRKYLTMGAVDTLLLSEDLRLERVKYRCPKCGKEVEITVRDETKKKMVC
FT                   ECGVEMEEVERKDVVLELSELAEQSGAKVEILSTESEEGAMLLNAFGGIAAILRFKPKH
FT                   G"
FT   gene            complement(416893..417651)
FT                   /locus_tag="Arcpr_0491"
FT   CDS_pept        complement(416893..417651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0491"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: similar to dehydrodolichyl diphosphate
FT                   synthase; K11778 dehydrodolichyl diphosphate synthase;
FT                   TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57557"
FT                   /db_xref="GOA:D2RGY2"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY2"
FT                   /inference="protein motif:TFAM:TIGR00055"
FT                   /protein_id="ADB57557.1"
FT                   /translation="MKAIYKLYEIKLLKEVKKFPPPKHVAFIMDGNRRYAKKKGLPSYM
FT                   GHFFGSRKAEEVLKWCLELKIKTVTAYAFSTENFRRSEEEKINLFKLMERELRRLMEDR
FT                   RIHKNKVRVRIVGKRELLPENVQKVVDDLERATRDYDRYNLNIALAYGGRQELVDAIRC
FT                   VLRLVEGGKIRPEEIDRHLIERFLYSDNGYESVDILIRTGGEQRLSNFLPWQTTNCLAY
FT                   FSDVFWPEFRKIDFLRAIRMWQRRVFAKSF"
FT   gene            complement(417648..417941)
FT                   /locus_tag="Arcpr_0492"
FT   CDS_pept        complement(417648..417941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57558"
FT                   /db_xref="InterPro:IPR020501"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57558.1"
FT                   /translation="MIDRIQDRLVNYLKRDKKGIRREVLSIMIDGRKYTTSEIYEILKA
FT                   KGYDVNLRGVSAMLGLMNTRLGIVRTETGEKNRYYIKPEYIELVKSVLREFS"
FT   gene            complement(417938..418951)
FT                   /locus_tag="Arcpr_0493"
FT   CDS_pept        complement(417938..418951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0493"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   dat:HRM2_06230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57559"
FT                   /db_xref="GOA:D2RGY4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040087"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY4"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57559.1"
FT                   /translation="MPVRKFKRIEAGSFYSYLSEGCKLCRRGAKMVLFVTGICNNSCFY
FT                   CPISEERRGKDVVFANEREVKRIEDAIEEANAMSAEGIAITGGEPLLKLDRVVEFLKTF
FT                   KDLHSHLYTAIPAKESVLSKLKHLDEIRFHPPELRNVKAYEEPIKTAKKLEMDVGFEIP
FT                   SIAYSDELVEITNKLDIFLNLNELEFSSTNYENLIAKGFRPNDHYGCSNCDEIIKAYAE
FT                   NVNKFHYCSARFKDKAQLRRRLIRMAKNLPDFYIITREGTVICGYIEGDVRVIEEFLQS
FT                   KGLKRSEDYVVVEGGVETSVEFVEEYSSLLKKLGTNVFIIERYPTSKRVVVEVNPV"
FT   gene            419218..419580
FT                   /locus_tag="Arcpr_0494"
FT   CDS_pept        419218..419580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0494"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57560"
FT                   /db_xref="GOA:D2RGY5"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY5"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ADB57560.1"
FT                   /translation="MAYVRFEVPEEIQQEALALLEKARETGKIKKGTNETTKAVERGLA
FT                   KLVYIAMDVDPPEIVAHLPLLCEEKNIPYVYVKSKADLGKAAGIEVPAASACIIDEGEA
FT                   KKELKDLIEKLRGLRK"
FT   gene            419613..419822
FT                   /locus_tag="Arcpr_0495"
FT   CDS_pept        419613..419822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0495"
FT                   /product="Ribosomal protein S28e"
FT                   /note="PFAM: Ribosomal protein S28e; KEGG: hypothetical
FT                   protein; K02979 small subunit ribosomal protein S28e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57561"
FT                   /db_xref="GOA:D2RGY6"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY6"
FT                   /inference="protein motif:PFAM:PF01200"
FT                   /protein_id="ADB57561.1"
FT                   /translation="MEEDVAPAEVIEIIGRTGMHGEATQVKVKILDGPNKGRIITRNVF
FT                   GPVRVGDVLMIKETAREARKLIVR"
FT   gene            419828..420013
FT                   /locus_tag="Arcpr_0496"
FT   CDS_pept        419828..420013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0496"
FT                   /product="Ribosomal protein L24E"
FT                   /note="PFAM: Ribosomal protein L24E; SMART: TRASH domain
FT                   protein; KEGG: 60S ribosomal protein L24; K02896 large
FT                   subunit ribosomal protein L24e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57562"
FT                   /db_xref="GOA:D2RGY7"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY7"
FT                   /inference="protein motif:PFAM:PF01246"
FT                   /protein_id="ADB57562.1"
FT                   /translation="MEKRVCSFCGYEIEPGTGKMVVRKDGKILYFCSRKCEKNMLELKR
FT                   NPRKLKWTKFYVKGGQ"
FT   gene            complement(420016..420306)
FT                   /locus_tag="Arcpr_0497"
FT   CDS_pept        complement(420016..420306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0497"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   nam:NAMH_0933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57563"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY8"
FT                   /inference="protein motif:PFAM:PF01910"
FT                   /protein_id="ADB57563.1"
FT                   /translation="MIVEISVVSIGVSESQSEYVSEVVRLLKERGIKFSVNPMGTVFEI
FT                   KNFRELADLMDEAVNRLESKGVPRVYIVIKADWRKKRKGMEEKVRSVLEKI"
FT   gene            420356..420805
FT                   /locus_tag="Arcpr_0498"
FT   CDS_pept        420356..420805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0498"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="KEGG: similar to NME1-NME2 protein; K00940
FT                   nucleoside-diphosphate kinase; PFAM: nucleoside diphosphate
FT                   kinase; SMART: nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57564"
FT                   /db_xref="GOA:D2RGY9"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGY9"
FT                   /inference="protein motif:PRIAM:2.7.4.6"
FT                   /protein_id="ADB57564.1"
FT                   /translation="MERTFVMIKPDGVQRCLIGEIISRLEKKGLKIVAMKMMKIERDLA
FT                   ERHYAEHKGKPFFESLVSYVTSGPVVAMVVEGKNAIKIVRTLVGATNPAEAAPGTIRGD
FT                   FGMEVGRNVIHASDSPESAEREIALFFKPDEIVEYRRIDEDWLYE"
FT   gene            420851..424285
FT                   /locus_tag="Arcpr_0499"
FT   CDS_pept        420851..424285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0499"
FT                   /product="translation initiation factor aIF-2"
FT                   /note="KEGG: hypothetical protein; K03243 translation
FT                   initiation factor IF-2 unclassified subunit; TIGRFAM:
FT                   translation initiation factor aIF-2; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; SMART:
FT                   Hedgehog/intein hint domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57565"
FT                   /db_xref="GOA:D2RGZ0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ0"
FT                   /inference="protein motif:TFAM:TIGR00491"
FT                   /protein_id="ADB57565.1"
FT                   /translation="MSKEEKKLRTPIVAVLGHVDHGKCLTPESLVATPEGLVKIKDFFD
FT                   SAQPYFRENGCEVRKISTVVQGLSADAKNSVFNSTHVWKLRHRGKVVKIKLKNWHTVTT
FT                   TPEHPFLTNTGWKKACELRVGDFVAIPKKIVGNERFERFLSYVYSKFGGDAIFRVEEDK
FT                   LKDVTLPSQKAYKVKRNVFRIEEIRELGLFDSIESFAFCSRKRRCGKPRYYLRFPRSVE
FT                   DWKAVFYLAGVLFGDGSVSKIANNDGEVFERIKRIESLGVEVVRIRRHSSYEIEFRKGR
FT                   NTLFKFIKMLFDYPEKRKSHTIEVPQILFLAPKELVAEFIKGYFDADATVNKRSVRIEV
FT                   SSASHEFILKLSLVLLRFGILSKIYRISKCYNGKMCKYSLLIISGKRNLENYAKYIGFS
FT                   VKHKIESLKKIVRKSKKSEAYPLQKELKRLRILFGFTKSEISKIIPFYTKYESCQMPSY
FT                   EIVKRFLKVLERGCKNLNKKIGVLEGKIRDSNYVKAFVSDGLLDENGNLTDLGREALNI
FT                   WKNMEFDLKDIKYLENLIENVAFVEVEDVEEIDYDGYVYDLTTPTHNFVANGVIVHNTT
FT                   LLDKIRKTRVAQKEVGGITQHIGATEIPIDVIKKICKDFLKNVKITIPGLLFIDTPGHQ
FT                   AFTNLRKRGGALADLAVLVVDINEGFKPQTEEAISILKTFRTPFVVCANKIDKIPGWKS
FT                   VPDAPFLKSYAQQDEYAKRNLENKIYELIGELYKHGFNADRFDRIRDFTRTVAIVPTSA
FT                   VTGEGIPELLMVLVGLAQKYLEKSLRLHVEGKAKGTILEVKEEKGLGVTCDAILYDGTL
FT                   KVGDTIAIAGIDDVIVTKVRAILKPRPVQDIRMERKFVGVKQVTAAAGIKIVAPNLENV
FT                   LAGSEFEVIESEEDVKKFRERVRKEYEEIAIRTDEEGIVLKTDTLGSLEALINELKRAG
FT                   IPIKKAEVGDVDKRDVVEASANKDEVNKVVLAFNVKLLPGVAEEAEKYGVKIFQDSIIY
FT                   SLVDNYVKWREETKALKEKQRIEALIKPGKIKLLPEFIFRRSKPAIVGVRVLAGELRKD
FT                   VTLIKPDGTKVGTVRSMQKEGKNVNIAKEGEELAIAIDGVTIGRQLEGNEVLYVDVPEN
FT                   HARIIEREFMDILSEKAKEAFKEFLEIKRKQNPLWAK"
FT   gene            complement(424278..424568)
FT                   /locus_tag="Arcpr_0500"
FT   CDS_pept        complement(424278..424568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57566"
FT                   /db_xref="GOA:D2RGZ1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57566.1"
FT                   /translation="MDKWAVIGVAVGFLFGFNGIATIFNMLGQAVNEVQAHLTQASTLI
FT                   LLIIAIVLIVKVRILASLLVGAIIGAILNFVLKANGIDVVGIVWSEILKAI"
FT   gene            complement(424583..425740)
FT                   /locus_tag="Arcpr_0501"
FT   CDS_pept        complement(424583..425740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0501"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   pub:SAR11_0080 aspartate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57567"
FT                   /db_xref="GOA:D2RGZ2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADB57567.1"
FT                   /translation="MPLSRKISERVQAIRPSGIRRFFELVIGRKDVISLGVGEPDFPVP
FT                   WSIRESMIYSLEKGWTSYTSNLGLKELRDGIAEYYKKFGVETSGENVLVTTGVSEGLDL
FT                   ALRATINPGDVVLIPEPCYVAYKPLAFLAYGEPVSIPTNPDFRLNYDVLKPYSKFEPKV
FT                   LVLNYPNNPTGITYTKKELEEIADFVIDNDMIVISDEIYAELTYKGKHVSIASLNGMEE
FT                   KTVILNGFSKAYAMTGFRIGYAIAPDEIVQAMTKIHQYCMLCAPITSQIGALEALKLKD
FT                   EEMDKIRAEYMRRRNFFVKRLSKFLDVKMPEGAFYAFPSIKETGLSSEEFAERLLIEKG
FT                   VAVVPGNAFGECGEGFVRCAYAVSMEKLKEAVERMEEFVENLKSD"
FT   gene            complement(425724..426212)
FT                   /locus_tag="Arcpr_0502"
FT   CDS_pept        complement(425724..426212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0502"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; regulatory
FT                   protein Crp; SMART: regulatory protein AsnC/Lrp family;
FT                   KEGG: atc:AGR_L_1389 proline dehydrogenase transcriptional
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57568"
FT                   /db_xref="GOA:D2RGZ3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ3"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADB57568.1"
FT                   /translation="MSKELEILRILEDNARLTPKEIAEMVGLSEDEVARIIKKFEEEGV
FT                   ILKYKTLIDWEKIGEDVVYAIIDVRVTLTREKSYDDIAKRIAKFPEVHAVRLISGDYDF
FT                   QVVVKGKSLKDVAFFVAEKISTLPEVRDTFTHFVLRSYKEEGVLLFKDEEDRRLAFVP"
FT   gene            426284..427702
FT                   /locus_tag="Arcpr_0503"
FT   CDS_pept        426284..427702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0503"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; GatB/Yqey domain protein; GatB
FT                   central domain protein; KEGG: dal:Dalk_0676
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57569"
FT                   /db_xref="GOA:D2RGZ4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ4"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADB57569.1"
FT                   /translation="MDDVIIGLEVHVQLNKLKTKLFCSCPLNYHDSEPNTHVCPVCLGL
FT                   PGAMPVVNKEAVKAAIKVALALNAEVQPVAIFDRKNYFYPDLPKGFQISQYDKPLALGG
FT                   YVTIETEEGEKKITLKRIHMEEDPGKLVYKGSITTAKYCLIDYNRSGAPLLEIVTEPVM
FT                   NSPKEARLFLNKLRMILEYLDVFDGNLEGAMRVDANVSIRGGGRVEIKNISSFKGVERA
FT                   LTYEIARQRNLIRMGRRVERETRHYDEVNNITVSLRSKEEEQDYRYFPEPDLVPIYTAE
FT                   LLEEVKGTLPEMPEEKRERLKREYGIGDNFAKVLILDKVMADYFEEVAKEIDPKLSASW
FT                   IVDVLRGELNYRGRDFRFAYEVFKPKEFAKLLSYLKKGMITEKGAVEVIRTKLDHGGDV
FT                   DEIIRSRGLFAISREEVEKICREVVEECRKAVEDYRSGKKQALDYLVGQVMKRTRGKAD
FT                   PAETAKIIRSLIEG"
FT   gene            427846..428763
FT                   /locus_tag="Arcpr_0504"
FT   CDS_pept        427846..428763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0504"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: hdu:HD1487
FT                   putative transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57570"
FT                   /db_xref="GOA:D2RGZ5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADB57570.1"
FT                   /translation="MHLHDRYLSFNRKVKVAFAVYTIIAILKLVCYFLTGFLVMFAEFL
FT                   HNLVDITIFSTIVYTRKLSEKPPDSTHPFGHGLAQNVGSVVISVVFVTVIALELVREGI
FT                   ERILHPYTGHFPELAITVLIFSLVASSILYVIFGSEIVAERATRAELYNDILSNVGALA
FT                   GILLTSVGYPRADGFLTIFIAFLICRNGYRLFKENVTYLLGKSPDEEVYVKIKEITESF
FT                   PEVLDVHDIIAIYTGENSLHVDMHVTVRGDMKVKEADELTKRIAKKLMENIPEISYVLI
FT                   HVCAERGEIVKSTSNNVMRKVYDM"
FT   gene            428891..431158
FT                   /locus_tag="Arcpr_0505"
FT   CDS_pept        428891..431158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0505"
FT                   /product="Replication factor C"
FT                   /note="PFAM: Replication factor C; SMART: Hedgehog/intein
FT                   hint domain protein; AAA ATPase; KEGG: RFC4; replication
FT                   factor C (activator 1) 4, 37kDa; K10755 replication factor
FT                   C subunit 2/4"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57571"
FT                   /db_xref="GOA:D2RGZ6"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ6"
FT                   /inference="protein motif:PFAM:PF08542"
FT                   /protein_id="ADB57571.1"
FT                   /translation="MEAEIWVEKYRPKTLDEVVDQEEVVKRLKNYVKQKNIPHLLFAGP
FT                   PGTGKTATAIALTRDLFGENWRDNFIELNASVSKDTPILVRIDGQIRRVTFEELDKIYF
FT                   KDSNEEYVKVDNLEVLTVDRNYKVAWAKVSTLIRHWVPKILRIHLEGGGVIELTGNHSV
FT                   MILSEEGLKAIKASEIKEGEYLLSFTAELEGNLNVIDLSDYGSKVVTSRTVVLNDLELN
FT                   ENSSWVFGLYTAGGAVGFKGNTSGQIVYTVNAEEQNLANRIGNFADYYNIGVYENYTTS
FT                   GFNRERLSAKQIRILSTQLAKFFRDNFYDGNGFKAKNKRVPSFMFSAKLENRLSYLKGL
FT                   YEGDGYGEWGNVIRIFSVSKDLLIDVAWLARISGIESSIFDREVRLIWRGKMNWKKSDL
FT                   LPAKPIISLIEKIEKKIKGNWRYEFRHQLYDGRDRISKDTLKRIVKMIDEYELSENEKK
FT                   IFELLKKLACTDLHALKVKKIEIVDYDDYVYDVSVPNNEMFFAGNIPILLHNSDERGID
FT                   VVRHKIKEFARTAPIGGAPFKIIFLDEADALTPDAQAALRRTMEMYSKTCRFILSCNYI
FT                   SRIIEPIQSRCAVFKFKPVPPEAMKKRLKEIAEKEGVKITDDALDALVYIANGDFRKAI
FT                   NALQGAAALGEVVTAEAIYQITATARPEEMRKLIETALSGKFLEARQILDRMMVEYGMS
FT                   GEDIVSQLFREIISSNLDERVKVMLIDKLGEIDFRLTEGAHDRIQLDAYLAYLATIGKK
FT                   LS"
FT   gene            431155..431538
FT                   /locus_tag="Arcpr_0506"
FT   CDS_pept        431155..431538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57572"
FT                   /db_xref="GOA:D2RGZ7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57572.1"
FT                   /translation="MKVRIAGLHASDKKPVVGDEVVIRGYVQRYDDKRKMWIPIRTRVW
FT                   VDVDGINYGVVYSNPDGSFEFRYSSGVKGKKRVEFKAEGCKREIEIEFVGEEEKRRVNR
FT                   IGTIVVAILILLLILLYLIMVLV"
FT   gene            431535..432803
FT                   /locus_tag="Arcpr_0507"
FT   CDS_pept        431535..432803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0507"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; KEGG: noc:Noc_2902 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57573"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ8"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADB57573.1"
FT                   /translation="MINNFNEIVIECNYLIINEIYKLTENFINYVCKQTHMGDEVSLTG
FT                   VVEMTVRAEPLVQLIRNYTNALRFVVHEILRDPSKYGRWRYVKRSKRIKWEHDLRRIHH
FT                   SFYEVLKYRFSLPPKFAIACQKEAVAIVKSVLNNENNGGKCVIKNYRARVDYQAYKIEV
FT                   RNGKCYLKLRNFDEIEVTGFSRKWFTKFKDWRLGDLIMKLENGLVKLFVTFKKTVKVAE
FT                   PSENAVAVDLNFEEVVLGNHEFEVRFKTPLRKIIHLKKNHIEKTQKKYNRKWRYVKGIR
FT                   NAISRWWSRINGITNDFVKQVSRRIVVFVKERGYDTIVLEDLNGLKDEQAKLRKSWRER
FT                   FTFFAYRKLQNWIEWQAKKEGLAVVYVNPANTSKTCPKCKSLNTEFRERILICKDCGFT
FT                   MNRDSVAVINLVDRWLSIMGCAV"
FT   gene            432848..433225
FT                   /locus_tag="Arcpr_0508"
FT   CDS_pept        432848..433225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0508"
FT                   /product="Ribonuclease P-related protein"
FT                   /note="PFAM: Ribonuclease P-related; KEGG: POP5; RNase P
FT                   and RNase MRP subunit involved in RNA processing; K03537
FT                   ribonuclease P subunit P14"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57574"
FT                   /db_xref="GOA:D2RGZ9"
FT                   /db_xref="InterPro:IPR002759"
FT                   /db_xref="InterPro:IPR038085"
FT                   /db_xref="UniProtKB/TrEMBL:D2RGZ9"
FT                   /inference="protein motif:PFAM:PF01900"
FT                   /protein_id="ADB57574.1"
FT                   /translation="MRLKNEGCITIDGIQTHLKGLPPALRRKKRYIAFEVYSDGDIDGN
FT                   RLFRAISETMLSLFGELKFLGLELKHFDGKRGILKCYREALKDVKFGLNLVDRVDERRI
FT                   AIRILGVSGTIKSCMRKFLRR"
FT   gene            433230..433970
FT                   /locus_tag="Arcpr_0509"
FT   CDS_pept        433230..433970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0509"
FT                   /product="Proteasome endopeptidase complex"
FT                   /EC_number="3.4.25.1"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   proteasome alpha subunit; K02729 20S proteasome subunit
FT                   alpha 5"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57575"
FT                   /db_xref="GOA:D2RH00"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR019982"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH00"
FT                   /inference="protein motif:PRIAM:3.4.25.1"
FT                   /protein_id="ADB57575.1"
FT                   /translation="MHLPQMGYDRAITVFSPDGRLFQVEYAREAVKRGATVIGVKTKEG
FT                   VILVADRRVTSRLLEPDTIEKIYIIDDHIGAATSGLVADARILIDRARLEAQINRLTYD
FT                   EPISVKDLAKRICDFKQQFTQFGGVRPFGVSLLIAGVDEKPRLYETDPSGALLEYKATA
FT                   IGAGRNVAMEFFEKEYNDNMSLDDAMVKAMIAMGKAIESELTYDGIEVGMIKVDDKVFR
FT                   ILSVDEVKDYVDKANEVIREELRK"
FT   gene            433977..434684
FT                   /locus_tag="Arcpr_0510"
FT   CDS_pept        433977..434684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0510"
FT                   /product="Shwachman-Bodian-Diamond syndrome protein"
FT                   /note="PFAM: Shwachman-Bodian-Diamond syndrome protein;
FT                   KEGG: hypothetical protein, conserved"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57576"
FT                   /db_xref="GOA:D2RH01"
FT                   /db_xref="InterPro:IPR002140"
FT                   /db_xref="InterPro:IPR018978"
FT                   /db_xref="InterPro:IPR019783"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036786"
FT                   /db_xref="InterPro:IPR037188"
FT                   /db_xref="InterPro:IPR039100"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH01"
FT                   /inference="protein motif:PFAM:PF01172"
FT                   /protein_id="ADB57576.1"
FT                   /translation="MVSLEKAVIARLRKGGEVFEVLVDPYLARDLKEGKEVDFEQLLAV
FT                   EEVFKDAKKGERVSKEELTKAFGTADVRVIARKIIMEGEVQITAEQRKEMLEQKRRQIV
FT                   EYLRRNAVDPRTGAPHPPQRIEMALEQAKVHIDIFKPVEAQIKDIVKALKPILPMRFEE
FT                   IEIAIKIPPEYTGKAISALYSFGNVIKEEWQRDGSWICVMRIPAGLHGDLLDLLGKVAK
FT                   GEALTKILKRIQL"
FT   gene            434694..435539
FT                   /locus_tag="Arcpr_0511"
FT   CDS_pept        434694..435539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0511"
FT                   /product="KH type 1 domain protein"
FT                   /note="PFAM: KH type 1 domain protein; RNA binding S1
FT                   domain protein; SMART: RNA binding S1 domain protein; KH
FT                   domain protein; KEGG: hypothetical protein; K03679
FT                   RNA-binding protein Rrp4 and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57577"
FT                   /db_xref="GOA:D2RH02"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023474"
FT                   /db_xref="InterPro:IPR026699"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH02"
FT                   /inference="protein motif:PFAM:PF00013"
FT                   /protein_id="ADB57577.1"
FT                   /translation="MAEVSRKIVLPGDLLSTNPKTAGPNTYVEGNKVYARVLGLLDKTE
FT                   TMVKVIPLKGRYVPSLGDTVIGIVKEVTANGWIVDILSPYVAFLPVQENPAMRPNKKPN
FT                   EVLDIGDAIIAKVMNIDPKMRVTLTMKDKLCRPIRVGRIVVINPTRVPRVIGKKGSMIK
FT                   LLKSELDVQIIVGQNGLIWINGDRRKVSIAEEAIYIIEQEAHTEGLTDRIAEFIKKRKV
FT                   EMGLAKPEEVEKEEVEEKAEELGKTEVEEERTEEVKMEEKPEESLEIPPEIPEERLKGE
FT                   "
FT   gene            435541..436275
FT                   /locus_tag="Arcpr_0512"
FT   CDS_pept        435541..436275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0512"
FT                   /product="exosome complex exonuclease 1"
FT                   /note="TIGRFAM: exosome complex exonuclease 1; PFAM: 3'
FT                   exoribonuclease; Exoribonuclease, phosphorolytic domain 2;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57578"
FT                   /db_xref="GOA:D2RH03"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR011807"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH03"
FT                   /inference="protein motif:TFAM:TIGR02065"
FT                   /protein_id="ADB57578.1"
FT                   /translation="MEEIKLIVNGKRLDGRDFEELRPIKIEAGVLNRADGSCYLEMGGN
FT                   KVVAAVYGPREVHPKHLEDPSKAIIRYRYSMAPFSVEERKRPGPDRRSIEISKVSREAL
FT                   EPVIMKELFPRSAIDIFVEVLQADAGSRTACLNAASVALIDAGIPMKGMVTSVAVAKVD
FT                   GILVLDPMKEEDNYGEADIPFAFLIRNGKIESITLLQMDGRVSKEELKKALEMAKKGAM
FT                   QIYQLQREAILKKYIKEEEVME"
FT   gene            436272..437051
FT                   /locus_tag="Arcpr_0513"
FT   CDS_pept        436272..437051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0513"
FT                   /product="3' exoribonuclease"
FT                   /note="PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2; KEGG: hypothetical protein;
FT                   K01149"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57579"
FT                   /db_xref="GOA:D2RH04"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020869"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH04"
FT                   /inference="protein motif:PFAM:PF01138"
FT                   /protein_id="ADB57579.1"
FT                   /translation="MSDEILMEVRKDYVLSKLRDGERIDGRAFDEIRPIEIKTGLIKKA
FT                   EGSAYVKLGNTQVVAGVKMQIGEPFPDTPDQGIIITNAELVPLASPTFEPGPPDENAIE
FT                   LARVVDRGIRHSEAVDLKKLCIEEGEKVWIIFIDIWALDDDGNLMDASALAAIAALLNT
FT                   TVPAERFEVGDDFPLPVRDLPVAITSLVYDDKILVDPCRDELSVGKNTITITTDQNDNI
FT                   VSIQKSGPFLLSEKAFEEVLEVSIRKAREVRKLLADV"
FT   gene            complement(437055..438194)
FT                   /locus_tag="Arcpr_0514"
FT   CDS_pept        complement(437055..438194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0514"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: dps:DPPB77
FT                   related to glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57580"
FT                   /db_xref="GOA:D2RH05"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH05"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB57580.1"
FT                   /translation="MKIRKVAILGPSKRFLSGVSYYTIRLSNALSAYVHVRTILFRNML
FT                   PKRLFPGWKRVGENLTYLEFDKRVEVHEILDWNNPSTWLKAFNLMKDCDAVILEWWTSS
FT                   VAHMYLSVELLNGIFAEIPTVIEFHEVIDPLESSILPIRIYSRVVGKVIRKLADHYVVH
FT                   SEMGKKLIGRVYGISLDKISVIPHGLYDHYKRVEGAKEKLGIKENFVILFFGLLRPYKG
FT                   VKYLVKAFESLPKEVLEDSRLLIVGETWEDRETTKLIANSKYRNKITVVNRYVPDNEVS
FT                   LYFSASDVVVLPYTRASQSGVAHIAMAFGLPVISTYVGGLRESLSKYKGTIFVKPMNAD
FT                   ELAEAIVKAYRNGRKRFSPPKDLSWNEIAKRWIKLLNQL"
FT   gene            438247..439320
FT                   /locus_tag="Arcpr_0515"
FT   CDS_pept        438247..439320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0515"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rle:pRL110391 putative phosphatidylinositol
FT                   alpha-mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57581"
FT                   /db_xref="GOA:D2RH06"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH06"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB57581.1"
FT                   /translation="MKIAQVCPRFYPDIGGVETHVYEISKRLTKNFEVEVLTTDPMGKY
FT                   PEVEEIDGITVRRFKSIAPSEAYYFSLEMYRFLKERSSDYDIIHAHNYHAFPALFVALT
FT                   KSNNKLVFTPHYHGRGHSFIRDLLHKPYKIFGRWIFEKSDAVICVSNFEKELILKNFNV
FT                   NSSKLFVIPNGINLEEFKDVEKIKKRKDRTVRTILYVGRIEKYKGLDYVVKALKYLPEN
FT                   YVLEIVGKGSYKSKIVKLAKNLGVINRIRFYQDLSREELIERYAKADVFVLLSKYEAYG
FT                   LVVAEALACKTPCIVANTSALSEWIDNRNVFGIDYPIHIEKLVNLIKEMSGVSVEGVNI
FT                   PTWDVAVEKLKRVYRGV"
FT   gene            439322..439672
FT                   /locus_tag="Arcpr_0516"
FT   CDS_pept        439322..439672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0516"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; SMART: HEPN domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57582"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH07"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ADB57582.1"
FT                   /translation="MEFLKKNALKFLSEAKEAFDKKDYNLTMFFVEQFFQLALKYILYK
FT                   KYGDFPKTHSLKMLFELTKDENLIKYYRENLDLFRDIELSYIAARYFDVEYSENVAKKS
FT                   LKLAEDFVRWLK"
FT   gene            439669..439998
FT                   /locus_tag="Arcpr_0517"
FT   CDS_pept        439669..439998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0517"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: atc:AGR_C_4229 conserved hypothetical protein
FT                   NMB1265"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57583"
FT                   /db_xref="GOA:D2RH08"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH08"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADB57583.1"
FT                   /translation="MREYYEILEKNREFFKEAFEIAKDIAEKAKKMFKDCEVFIIGSFA
FT                   RGDHKLSSDLDILIVSDEIPDKIDFEFYSRIVKALTDDPRVNIHLLNRRRLKEVDKIYS
FT                   PRIKV"
FT   gene            440209..441216
FT                   /locus_tag="Arcpr_0518"
FT   CDS_pept        440209..441216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0518"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   nis:NIS_1384 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57584"
FT                   /db_xref="GOA:D2RH09"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH09"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB57584.1"
FT                   /translation="MSGIKKYEDELYKNMVKIICEEGLNVEIQRIQRDKNKILGSTVAS
FT                   WFLKYRCDKADLVHATSQVVAPVVFIRRPKRFIVTVHDLTPMLYPSTIRDSSTRLQWIL
FT                   TPKALKKVDKIIAISNFTKREVVRLLGINEKVITVVYQGVDHNLYKPMNKEKCKEYFGL
FT                   NPEEKHILYVASNDEHKRVDLAKAIFEEIRKCRDDVKLIKAGYSERLEGEGIISMGWIR
FT                   EEDMPKLYNSADVYLHTSEYEGFGLPVLEAMACGVPVVVSNRASLPEIVGNAGVLIDLD
FT                   ENCVQEFAENILRILDKNIKIDRKALERSMMFSWEKTARETLKVYESLRNHNGG"
FT   gene            441206..442537
FT                   /locus_tag="Arcpr_0519"
FT   CDS_pept        441206..442537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0519"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   pcr:Pcryo_0635 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57585"
FT                   /db_xref="GOA:D2RH10"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH10"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB57585.1"
FT                   /translation="MEDKLLIVSCPFPIIGGGEERSFQVLKLIKKYTYFDIEVIFPPDR
FT                   IVDLLQIYCINDYDWKNIIKTLEKNRVPINQYSIMFLENGFGKQTKIGSFNISAFFDGL
FT                   LPQRKINFYKEYIRKCIEHCDSETFKGIYSHHEYLDAVYVSKYLSSKLNLDFVILLQLE
FT                   PFRSFVDATKSYFRFNRFDFRTLINFLPFMNLNTTISKEYRDLLKSKHFKGFLSVSITP
FT                   ILISGLTNTNYRVLRPANAFESKLLKYRRNIRKKENYAVFFARFTPGKGIFELPIIWRI
FT                   VTKEIPDIRLIVCGRQDQRFLGKFKNLTKKYDVEDKIILKGYVPRDELFEIVSKAKVFV
FT                   YPTHSDSFSLVTLESLAVGTPVIAYDIPAIKYTYRDINAVKIVREWNTREMAKRVIDIL
FT                   KISEDEYIEMLNERKLINFLKLHSSWENVAKNEAKELENLLNFE"
FT   gene            442553..443578
FT                   /locus_tag="Arcpr_0520"
FT   CDS_pept        442553..443578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0520"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   mlo:mll5661 nodulation protein NoeI"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57586"
FT                   /db_xref="GOA:D2RH11"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH11"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADB57586.1"
FT                   /translation="MALIQDLKTTISLVRNVENWTNILIQTIRKKKIENITIKFRKHPI
FT                   SLYIYKSYTSIRPHHLNSISADLGRHNNIIKKECYVEIRRNEIKLKLGRYSLTLPNDEY
FT                   SLTFSLPRWIIFLSAGGKVLESEDNPLIEISGYKFYLPDYKNGIYEIVEMYIDEVYDRF
FT                   DFKNKTILDVGASIGDSSIWFIHKGAKKVFAYEPNPKLYEILKKNIKINNLSGKIIPEN
FT                   YAVGISKKKAKMKIPWYGAGSIYGIFKCENLEEVDVTVVPINEILENKNIDIIKLDCEG
FT                   CEYEILDYLIKSGKLDNLEGVVFECHYINNSLNPERMIHALTKYGYNCQRDGNIISLTA
FT                   K"
FT   gene            443801..444613
FT                   /locus_tag="Arcpr_0521"
FT   CDS_pept        443801..444613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57587"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57587.1"
FT                   /translation="MNLHGFNPFMDYHKLDLSYYKKIYSEIYQRFRTYRDVVPTSLNEV
FT                   VELFDYLNDIQEEIIIQPNRCHFILSQLSKRYDCPFIHIIRNPIDVWFGQTIEMFALAD
FT                   NIRRARIILRLSKIKYKKLSALLIAPILRYILVIILPNKKTLNCCQVSENFNLIKDKFN
FT                   LGYPNFLDPLDKMLVVWTYCNYHAFKQAEECDRGMVVYYEQVTKEPEKWFKIMSDFSGV
FT                   NFDLKYAKILKPRITKDEKLRKHFVERLERLGLIDMVNEFYPPERWFG"
FT   gene            444645..444884
FT                   /locus_tag="Arcpr_0522"
FT   CDS_pept        444645..444884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57588"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57588.1"
FT                   /translation="MAKAIIGVPINAKTGYILNRFLKNQEEIQKAFNGEIETVFATEDV
FT                   LFAQKLKKVLKNYKINSNVITFKPNRPKDAKDRI"
FT   gene            444954..445400
FT                   /locus_tag="Arcpr_0523"
FT   CDS_pept        444954..445400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57589"
FT                   /db_xref="GOA:D2RH14"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57589.1"
FT                   /translation="MDADMIFDPEIVNKLIKIAEKGYDVVYNGYLDRGNPNGINLTGFG
FT                   GTLIKRWIMEKVKFRCKERRGRVIDEGVFFEFDLVRIGAKIFRGFISYSEHHDPKRPPS
FT                   VCYPRELKLSERIRNNPYFRFLFHLISIPLCYDILWHLSMKLKT"
FT   gene            complement(445397..446851)
FT                   /locus_tag="Arcpr_0524"
FT   CDS_pept        complement(445397..446851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0524"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: hch:HCH_06176 O-antigen
FT                   and teichoic acid export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57590"
FT                   /db_xref="GOA:D2RH15"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH15"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADB57590.1"
FT                   /translation="MLAKRVFRNVVYNSSSVLIANVVGVVVTIYVARALKPELFGIYSL
FT                   ALSIAFLLLTFTDLGINATLVRYVAHAHGLKDYELVRGYIRGLSKLKVLLVFLVSTTLF
FT                   ASSDVLSTYVFHKPLLSDPLKVTSLFILFFSLSGFLNAIFNAFNDFKANLIKSAVYEFS
FT                   RLFFIILFVSAGLSVIGALLGFAIASSLALIVLLVSLLKKYGNLVFGRAKPIDWRRIVR
FT                   FTSYLTIGSITWVVFAYVDSVMIGMFLPAEDVGYYRASYNIVGAISGLVSIPTVMFPVF
FT                   VQLEGRDLRNAFNRAFKYSAILSFPVVFGLISLGEQLIKFVYGADYLPAVPVLYVLSFL
FT                   ILRSALGFWGVIFNAKEKPEYPVYVSFFAMILNIVLNYFMILRWGIVGAGIATVVSNLF
FT                   SWITLAYLSKVMFNVFPKVEHLVKPIVSSLIMFYIISQFKLSNLIEGVSVVLLGAMVYF
FT                   GVLFLIKGMTIDDLRYLRTILGLERD"
FT   gene            446935..447189
FT                   /locus_tag="Arcpr_0525"
FT   CDS_pept        446935..447189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0525"
FT                   /product="ribosomal protein L37a"
FT                   /note="TIGRFAM: ribosomal protein L37a; PFAM: Ribosomal
FT                   L37ae protein; KEGG: hypothetical protein; K02921 large
FT                   subunit ribosomal protein L37Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57591"
FT                   /db_xref="GOA:D2RH16"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH16"
FT                   /inference="protein motif:TFAM:TIGR00280"
FT                   /protein_id="ADB57591.1"
FT                   /translation="MARTKKVKMAGRFGPRYGLRVRRMIIKIEELQRQKYVCKRCGKKA
FT                   VKRVGSGIWECKACGYKFAGGCYVPSTTIAQSFEKSLER"
FT   gene            447195..447332
FT                   /locus_tag="Arcpr_0526"
FT   CDS_pept        447195..447332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0526"
FT                   /product="RNA polymerase Rbp10"
FT                   /note="SMART: RNA polymerase Rbp10"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57592"
FT                   /db_xref="GOA:D2RH17"
FT                   /db_xref="InterPro:IPR006591"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH17"
FT                   /inference="protein motif:SMART:SM00659"
FT                   /protein_id="ADB57592.1"
FT                   /translation="MYICLVCGEEVDVDLVRNIIQCPRCGNRILMKPRPPALRKVVKAI
FT                   "
FT   gene            447342..447770
FT                   /locus_tag="Arcpr_0527"
FT   CDS_pept        447342..447770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0527"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="KEGG: predicted protein; K00794 riboflavin synthase
FT                   beta chain; TIGRFAM: 6,7-dimethyl-8-ribityllumazine
FT                   synthase; PFAM: 67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57593"
FT                   /db_xref="GOA:D2RH18"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH18"
FT                   /inference="protein motif:TFAM:TIGR00114"
FT                   /protein_id="ADB57593.1"
FT                   /translation="MEKIKLGMVVSEFNRDITYMMEILAKEHAEFLGAEITEVIRVPGA
FT                   FDIPLAVKKMLERGKVDAVVAIGCVIEGETEHDEVVAQHAARKIMDLSLEYGKPVTLGI
FT                   SGPGMGRIAAQERVDYAKRAVEAAVKLVRRLREYEEKA"
FT   gene            447754..448881
FT                   /locus_tag="Arcpr_0528"
FT   CDS_pept        447754..448881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0528"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   nis:NIS_0815 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57594"
FT                   /db_xref="GOA:D2RH19"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH19"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADB57594.1"
FT                   /translation="MRKRLSLIKPSATLKISALAKELAKQGKPVVNMSAGEPDFRTPQH
FT                   IVESAIKALNEGKHFYTPTRGIPELLEAIAEKVNKENEIPAKPENVIVTAGAKYAIFLA
FT                   MQALLDEGDEVILLDPAWVSYEANVIMANAKPIWVKHDDSFEDAPIEEYVTSKTKMVVI
FT                   NTPNNPTGVVYPKGFLKKVADLAQDHDFYVLSDEIYEKIIYEGRHYSIASFDGMFERTV
FT                   TVNGFSKAYSMTGWRLGYAVASEEIIKAMNKIQSHSISHPTSFVQYAGVTALKGDQRCV
FT                   DEMVKAFRRRRDRIMEGLNELGIDYVYPKGAFYIFMRVGDGTTFAERFLKEEYVAVTPG
FT                   EAFGSYKDYVRISYATSDENIEEFLKRLERFIEKF"
FT   gene            448969..449595
FT                   /locus_tag="Arcpr_0529"
FT   CDS_pept        448969..449595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57595"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57595.1"
FT                   /translation="MGEVLISGVPGAGKTMLLMKIIKEFDNVIWVTTTRSAKTLRSILK
FT                   SDDVWIIDTHTWAHVKFHPRDIVISNPLNLNEVNLGISRILDSINGKCLVVLDSLSGLL
FT                   LYHNLQRVAHFLRSALVKMEEKNASGLFTLVKNAHDIHTETSMYALFPVVIELLREDNE
FT                   ETKRFIRVIKATKYIEPSFGEVKIVKDDIIVPEHIMEYILKVLKS"
FT   gene            complement(449585..450238)
FT                   /locus_tag="Arcpr_0530"
FT   CDS_pept        complement(449585..450238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0530"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: mes:Meso_1399 multiple antibiotic resistance
FT                   (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57596"
FT                   /db_xref="GOA:D2RH21"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH21"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ADB57596.1"
FT                   /translation="MTCVDYISYFVTAFTTIFVIVDPPGNIPFFIALTERFSEKERDRV
FT                   SKKSTLIACALLIIIALSGDILLKFFHISIESLKVAGGILLFVIAIDILLGGARKEFYA
FT                   KRGLKHIDVDSLAVFPIALPLYTGPGAITATIVLSAEASDIPSKILLIASIALVYIIVR
FT                   LTHVYSEVVIKVLGKSGSDIVARVMAIFLAAIGVEYVFSGLESEIAKIVEIIRT"
FT   gene            450298..451116
FT                   /locus_tag="Arcpr_0531"
FT   CDS_pept        450298..451116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0531"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region; KEGG: sat:SYN_00159
FT                   fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57597"
FT                   /db_xref="GOA:D2RH22"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH22"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ADB57597.1"
FT                   /translation="MEYEDVVDTVVELFRKAETELSEDVLKAIKYAYENEDSEIARMNL
FT                   KNILENVEYAKAKKIPMCQDTGLPIVFVELGRELHLDFDLKSAIIEGVKRATAEVPLRP
FT                   NAVHPITRKNPGNNVGEHMPIIDIDIVEGDELKIAVMPKGAGSENCSALKMMLPHDVDK
FT                   IKRFVVDVVRSAMGKPCPPIFIGLGIGSTFDGSAKLAKKALLRDVTKMNDFELEILEAV
FT                   NELGIGAMGMGGKFTALAVLSEIGYCHTASLPVAVNIQCWANRRAFAVLR"
FT   gene            451121..451687
FT                   /locus_tag="Arcpr_0532"
FT   CDS_pept        451121..451687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0532"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="KEGG: bph:Bphy_5632 tartrate/fumarate subfamily Fe-
FT                   S type hydro-lyase beta subunit; TIGRFAM: hydro-lyase, Fe-S
FT                   type, tartrate/fumarate subfamily, beta subunit; PFAM: Fe-S
FT                   type hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57598"
FT                   /db_xref="GOA:D2RH23"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH23"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ADB57598.1"
FT                   /translation="MELKTPVSREDLEKLNVGELVYVSGEIITARDSAHIRILEYLREG
FT                   KDLPFKIDGAVIYHCGPLLKKRNDGWEVISAGPTTSARMNETTKELLKYVECIAVIGKG
FT                   GMDVDFRGKGVYLAYTGGCGALASKAIKRVKDVHWLDLGMPEAVWVFEVEKLPCIVAID
FT                   FKGNNLYDVVKRKVEENYKRLIEKI"
FT   gene            complement(451911..452492)
FT                   /locus_tag="Arcpr_0533"
FT   CDS_pept        complement(451911..452492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0533"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57599"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH24"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADB57599.1"
FT                   /translation="MVVKKFGSVEVVLEKGDITKYPAEAIVNAANKYLEHGGGVALAIA
FT                   KACAGDPQKYTEISKKALKEQLGKDYMDHGEVVVTPALNLEKIGIKYVIHTVGPICGGR
FT                   WNNEFEEKLYKAFIAPLEKAEELKLKSIAFPAVSAGIYGCPLENVVETFLKAVKDFSEK
FT                   ANVVKKVALVIFGDEDFEVAKRVFEMFPER"
FT   gene            452617..453114
FT                   /locus_tag="Arcpr_0534"
FT   CDS_pept        452617..453114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0534"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: scl:sce3089 PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57600"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH25"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADB57600.1"
FT                   /translation="MSKDRQLKGILKLLILKELEKEEATGYDIIKRIGERAKRPSPGSV
FT                   YPILKELKENGFLNVRIDGRKKIYSLSDKGRKVLREAMEKEKEAIIRKVEVLRESGILS
FT                   EREAEDFYHFVSSKKEIIMKLHELRNWSAFLDALVKVLEKSKPKAEEILDEFIKRLEDL
FT                   SK"
FT   gene            453163..455115
FT                   /locus_tag="Arcpr_0535"
FT   CDS_pept        453163..455115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0535"
FT                   /product="S-layer domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57601"
FT                   /db_xref="GOA:D2RH26"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH26"
FT                   /inference="protein motif:COG:COG1361"
FT                   /protein_id="ADB57601.1"
FT                   /translation="MKRLLIILVLLTVIGVANAHDIDFHVSVEGDGKLHPGEDTYITLL
FT                   IENEGKADGFVLNENTSNLLSLITTAKDLRVEIEDMWIPITVETVNPQLIGDLPSGKVA
FT                   KAVFRVRVDENAKLGKYRVPIRLKYTKVSYSTTSSGALLDYSEETDVEYLKIEITRKDY
FT                   DFTVTSIESNLRVGGEGLVEATVKNVGRFKMYNATLTISVTPPLKPNPSATSSHLGDLD
FT                   VGDEAKAIFKVYVMDDALDQVYPAELVLNFERADGKTVTISHRIGLKVECAEVFSIEDV
FT                   KTFVTSAKIVENTTIPSRGFIKVAIRDLGEDVRDAVAVLSFETPLLQAENSPYLGNLRK
FT                   GDEKIVTFYVRCLAPEGSYRGKLIISYKNELGDEEVEDYYIGVNVDSAPIKVERVETKN
FT                   VGVGAKGDVIVHIKNELDCDVRNLELAIVPPKSITPLSPACYVELLKPNEIGEAKFRIA
FT                   VSSELVSGYYNLYLIEKYDMGDVEDVVSVAEIPLLVEPKRAYFEVISVESVLYPDETGD
FT                   VIVKIRNIGNTTIHNGVVELTVSTPLTIAGGTALSGLIGQAQPGLYFIGTLKPNEVAVA
FT                   KFRVDVDKDAGAGYYPAIVKIRYDDDEGYTHESSPITISIEVREKPLLNPVTVTAVVLI
FT                   AVAVIAGVRFARKRR"
FT   sig_peptide     453163..453222
FT                   /locus_tag="Arcpr_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            455112..456629
FT                   /locus_tag="Arcpr_0536"
FT   CDS_pept        455112..456629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0536"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gur:Gura_2706 EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57602"
FT                   /db_xref="GOA:D2RH27"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH27"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB57602.1"
FT                   /translation="MRSLIRSWLAFLPVSLGLFMVLLDVSVLNVALPRIAEDFHARMSD
FT                   LQWVLNAYTLTMVVLLVLAGRIGDIVRRDRYFVLGMGIFVLGSFLCAQSWSIEVLIFSR
FT                   IIQAVGGAILSSNTLAIVTELFPPGQRGAVMGLNAILMASSFALGPIVGGWLTTNLSWH
FT                   WVFYINVPIGIISIALAFMLLPPLEPKEKVPIDLAGTILLAIGLGSLTLGIIEGQNWGW
FT                   DNQKTLACFAVAFPYLAAFAIRELNYDYPILDLSLFKIRNFTVCVAATSIIFFGTSSSF
FT                   FVIPYFLQGLKGLTAEEAGYWMISIPIANTFVAPIAGRLSDKMNPKYMMCLGPILFAMG
FT                   MYNMTDVDVDIKYWEFFFRLIPMGIGMGLLTSPAFNVLMSSVPPAKAGMANGTLRSVNT
FT                   LAQAMGVAIGGVLITHNMKNYLPGYENIVPDPGTMAILTLLAKFNPLPLIGMVEGFIDS
FT                   MHFVFSTMMWLPLASSLIIAIFLRGEEHLRRMRHEILENSKTYIKRS"
FT   sig_peptide     455112..455183
FT                   /locus_tag="Arcpr_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.738) with cleavage site probability 0.303 at
FT                   residue 24"
FT   gene            456692..457060
FT                   /locus_tag="Arcpr_0537"
FT   CDS_pept        456692..457060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0537"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: sit:TM1040_3612 periplasmic
FT                   sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57603"
FT                   /db_xref="GOA:D2RH28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH28"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB57603.1"
FT                   /translation="MMSKPKVMVVEDDLAVLEAVQVMLGDRYEVIVATNGKEAIEKYQE
FT                   YKPDIVLMDMLMPVMDGIEATKKIKEIDPQAKIIGLTAYAINKGKELLEAGALEIIGKP
FT                   FTRSQLIETIEKCLKKTP"
FT   gene            457072..458055
FT                   /locus_tag="Arcpr_0538"
FT   CDS_pept        457072..458055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0538"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: ppd:Ppro_0904 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold domain protein; PAS
FT                   fold-3 domain protein; PAS fold-4 domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57604"
FT                   /db_xref="GOA:D2RH29"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH29"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB57604.1"
FT                   /translation="MLDQLKKYGHTLPVPFLVYNEKGEIVYANSAFLELVGMTSEEVLG
FT                   KNILDLVHPEDKERARDAMKKRLAGERVEPYFLRLIGTQGKCRTYMVVGGTIKIMGKNF
FT                   GIITFTDVTKLEEQKLMLLILTRALRHDVLNAVTVAMAHLEVAKDLCRDCEKSDFLQKI
FT                   EKAINRVVEIMRSLKAFEEAVLEGKLERICVREVAESVAKHFDVPIVVEGDCEAIADRG
FT                   LEIVFENLFQNAIQHGRTDRIDVKISRVGDFCEIRVIDYGKGIPDEIKDRIFEESFSYG
FT                   ETASSGQGLYLVKKLVERYGGEIWVEDNEPKGAVFVIMLKAWSEES"
FT   gene            458115..459530
FT                   /locus_tag="Arcpr_0539"
FT   CDS_pept        458115..459530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0539"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: noc:Noc_1328 KaiC; PFAM: KaiA binding;
FT                   Circadian clock protein KaiC central region; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57605"
FT                   /db_xref="GOA:D2RH30"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH30"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ADB57605.1"
FT                   /translation="MVMRISSGIESLDIILNGGFLPKRSYLIRGGPGSGKTTFCLHFLI
FT                   EGVKNNENVLFITFGEPSEKIKENAKAIGLSPEGIVFLDLAPSEEFFVKDQTYDIFSPA
FT                   DVERGPTVKTIVETVEKVKPSRVVIDSVTYLRFLAPDVYQYRKQVLSLIDFLTDRGATV
FT                   LFTSESGVIPDDDLQFIADGVIDLIMEMIGVDIYRRLSVKKFRGSSFLPGYHLIRIGHG
FT                   GIRIYPRILPQKIERKHIGEKISTGIKELDEMTNGGINRQTITVISGAAGTGKTTLAMR
FT                   IAYEAALRGENVTYYAFEEDPAIILSRAKKVGMERIRELVEKSLIKIVFAESLKFAPEE
FT                   ALHITLKDLRERNTKLVIIDSLNGAELALVGAEDKRRPIQAILRNLVANGATVILIDEF
FT                   EANSRGFTRLGVSYLADNIIVLGHYVKDGVTRKYIRVVKMRLSKFSPEIRDFEITSEGI
FT                   KIGERVKEVQKLC"
FT   gene            459493..459873
FT                   /locus_tag="Arcpr_0540"
FT   CDS_pept        459493..459873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0540"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: cps:CPS_2473 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57606"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57606.1"
FT                   /translation="MERGLKRCRSYADRNRGKNETNTKILKDFFEKHGYEVVVAKDYDE
FT                   FENLYSADLIFIDLAGFDSRIWDLCEDLRMKMILFILFYPSKVDIALTKGAEVAAFKPL
FT                   NSKKILELVENLIRGRFYEDKD"
FT   gene            459857..460729
FT                   /locus_tag="Arcpr_0541"
FT   CDS_pept        459857..460729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0541"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: wsu:WS0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57607"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57607.1"
FT                   /translation="MRIKIDLRSKTNEELLKKMLSKYEITEGDDFDLLITDTKKLKENI
FT                   EKILEIRKGEVITPVLVIDSINSKKLVEEGYADDYIQAPVDVRELLAKIDNLLRIRKRS
FT                   IEIKELKDFILTASKILAEMINQPLVVFDENLNVVYKNSKAEKIDISKLKKLAKKVIES
FT                   RKPITEELAIGDKFYFVSASPFVKDGKIVRIISVAFDITERVEAENQLKKVAAQLTENV
FT                   EKFAVLVDRIKNPLTAAIAYLEVYEKNKDVKEKVIAQLERIAKVMEDIDEAWRKSEEVI
FT                   KFIKRSRER"
FT   gene            461050..461163
FT                   /locus_tag="Arcpr_0542"
FT   CDS_pept        461050..461163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57608"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57608.1"
FT                   /translation="MVMFLDSIVKEKNLKMRDWVVLSNDCKGRLVCHSVAR"
FT   gene            461173..461778
FT                   /locus_tag="Arcpr_0543"
FT   CDS_pept        461173..461778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0543"
FT                   /product="MobA"
FT                   /note="KEGG: dat:HRM2_09220 MobA"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57609"
FT                   /db_xref="GOA:D2RH34"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH34"
FT                   /inference="similar to AA sequence:KEGG:HRM2_09220"
FT                   /protein_id="ADB57609.1"
FT                   /translation="MRLNVAILAGGKGSRIGLDKGFLELNGRMFAEILLERFDGCNVVF
FT                   VCRDKKQAETYRTKFNCNTIIDTVKEFSPLAGIHSALEHFRDYVLIVAVDMPLVRRELA
FT                   EFLYRKARGYDALIPRWSDGKLEPLLACYSYTAVKEIEQCITRGVRKVSKPFENLKTLY
FT                   YPIERLRVFDEKLISFVNVNTPKDLEMVRCLSTGTEDL"
FT   gene            461748..462641
FT                   /locus_tag="Arcpr_0544"
FT   CDS_pept        461748..462641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0544"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: tgr:Tgr7_0336 GTP cyclohydrolase subunit MoaA;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   Radical SAM domain protein; molybdenum cofactor synthesis
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57610"
FT                   /db_xref="GOA:D2RH35"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH35"
FT                   /inference="protein motif:TFAM:TIGR02668"
FT                   /protein_id="ADB57610.1"
FT                   /translation="MLVDRYGRPIKHLRISVTSLCNMNCIYCHNEGMKDAGKDMSLEEI
FT                   IEICKVFYDFGVEKVKITGGEPLIRGDIMDIIAEMPEFKEISMVTNGYYLSKYAYELKE
FT                   VGLNRVNVSLDTLNPETYRFITGVRGLEKVLDGIESAYNAELTPIKLNMVVMKGVNEHE
FT                   IEDILEYTARFNKNRINVVLQLIELVGHDEYYYSLDEIEEKFKSRAKTVITRSLHARRQ
FT                   YILGNKAVEFVRPFHAKFCMHCTRMRVTSDGKLKPCLMRDVTVDVRGLKGEELLEAIKR
FT                   AVELREPYVKDLNQSR"
FT   gene            complement(462629..463147)
FT                   /locus_tag="Arcpr_0545"
FT   CDS_pept        complement(462629..463147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shl:Shal_0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57611"
FT                   /db_xref="GOA:D2RH36"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57611.1"
FT                   /translation="MANEVFQVIPPRSFVVFSTALILGLIALTAYVWLITVDNVRYITL
FT                   SITLIILAICAYFFIVAPYQTSIVLNDQIEVIAPPYAHESISKDVVLKSYVADIGRDEN
FT                   LRPVLRVGGTSFGSYKVGWFKLKNGKTALIVATQSRVVCFELKDKIVMISPNDFERFVN
FT                   APKVRSYLD"
FT   gene            463201..464868
FT                   /locus_tag="Arcpr_0546"
FT   CDS_pept        463201..464868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0546"
FT                   /product="DNA ligase I, ATP-dependent Dnl1"
FT                   /EC_number="6.5.1.1"
FT                   /note="KEGG: afw:Anae109_4301 ATP-dependent DNA ligase;
FT                   TIGRFAM: DNA ligase I, ATP-dependent Dnl1; PFAM: ATP
FT                   dependent DNA ligase; DNA ligase domain protein; ATP
FT                   dependent DNA ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57612"
FT                   /db_xref="GOA:D2RH37"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH37"
FT                   /inference="protein motif:TFAM:TIGR00574"
FT                   /protein_id="ADB57612.1"
FT                   /translation="MKFREFAEFCAILERVSSTLEMTGRIASFLRRIEDDDDLYNVVHF
FT                   LMGRVFPPWDERELGVGIGLVCKALENVSGVSKEKIESMIKDYGDLGLVAERLLKGRGI
FT                   KSLFAEELTIKRVREIFDEIASLEGEGSQKRKILLLTGLYGSASPIEARYLTRLILGEM
FT                   RLGVGEGIMRDAIARAWGVDAELVERAYMIVNDLGRVAIIAKNEGKEGLKNVKIQLHIP
FT                   VKMMLAQVAESIEQALREMKTIAVEWKYDGSRVQVHYGNGKVTIYSRRLENVTKALPEI
FT                   VEEIKKCVKEGVILDGEVIAVKDGKPMPFQEVLRRFRRKHEITKAMEKIPLEAYFFDIL
FT                   YNDGEVIDLPLKERRKILESVIKESKIIKIAKQVVTNKKEEIERVFKEALDAGHEGAML
FT                   KNPNSPYTPGKRGRHWLKLKEVMETLDLVVVGGEWGEGRRSHLISSFELACLDPRTGKL
FT                   LRIGQVGTGFTDEDLEELTELFKPLIVKEEGKKVYFKPKIVFEVAYQEIQKSPKYESGF
FT                   ALRFPRFVRLRDDKGVEDADTIDRVRELYEKQFARAKS"
FT   gene            complement(464875..465342)
FT                   /locus_tag="Arcpr_0547"
FT   CDS_pept        complement(464875..465342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0547"
FT                   /product="Protein of unknown function DUF509"
FT                   /note="PFAM: Protein of unknown function DUF509; KEGG:
FT                   similar to MGC80189 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57613"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR016799"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH38"
FT                   /inference="protein motif:PFAM:PF04416"
FT                   /protein_id="ADB57613.1"
FT                   /translation="MKIKQGILKVNSLEEFLKDLGECAAVIDAKYVIDLDVVKFAAEKA
FT                   LKSWKEKRNIAKTLPLEILLYFSATRQIRDAIKVGVKEGTNEAVVVILNNCEDKLKKYF
FT                   EEKEVVKVDKARIENVKRLYGITDEEIKIVRLEKLPLLIMERIALFDVFKE"
FT   gene            complement(465379..466029)
FT                   /locus_tag="Arcpr_0548"
FT   CDS_pept        complement(465379..466029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0548"
FT                   /product="RecA-superfamily ATPase implicated in signal
FT                   transduction-like protein"
FT                   /note="KEGG: atc:AGR_pAT_757 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57614"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH39"
FT                   /inference="protein motif:COG:COG0467"
FT                   /protein_id="ADB57614.1"
FT                   /translation="MKKYTTGITVLDSSLGGGIPAGSLVLLVEKPGAGAEIISFQFAVE
FT                   GVKKGESVLYVTTDETSENLLNYIKLYFPDFNVNENFQLISFISNVTSDAKNFIKSSMH
FT                   DPLGFTRKVLATSKYDRIVINNLNNLIRNYGENEVISLFEELSRKVKNDESVALAILVE
FT                   GATESRIENTLKAIADGILELDVQERKRDSEKTQNNKAEEMHGSKERVQVRHN"
FT   gene            466079..466396
FT                   /pseudo
FT                   /locus_tag="Arcpr_0549"
FT   gene            466429..467286
FT                   /locus_tag="Arcpr_0550"
FT   CDS_pept        466429..467286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0550"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114; KEGG:
FT                   afw:Anae109_3319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57615"
FT                   /db_xref="GOA:D2RH40"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH40"
FT                   /inference="protein motif:PFAM:PF01972"
FT                   /protein_id="ADB57615.1"
FT                   /translation="MDYYYDPFGFFASMIWWLLLFWLLVGPQLQYRRLTLMRQAIMKKL
FT                   GEKRGSNVITLIHRQESIGLFGIPFYRFISIEDSEQVLRAIRMTPKDQPIDLIIHTPGG
FT                   LVLAATQIAKALKNHPAKTTVIVPHYAMSGGTLIALAADEIIMDPNAVLGPVDPQLMNY
FT                   PAPSIINAVKKKDPKDVDDQTLILADIAEKAINQVRQFVYELLKDKMEDEKAREVARIL
FT                   TEGRWTHDYPITVEVAKELGLKVSTDVPPEVYELMELYPQPIMQRPSVEFVPRREIKTT
FT                   SILK"
FT   gene            467348..467650
FT                   /locus_tag="Arcpr_0551"
FT   CDS_pept        467348..467650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57616"
FT                   /db_xref="GOA:D2RH41"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57616.1"
FT                   /translation="MLIEVIVFLLGVIYGFLNPGKEDRWKLFKRALVIGSVIGLILGLT
FT                   FVFLLLPFGFHPLFPLVAIAGVFWMVILFVILTVYFAVIFIVGTFVGDLLESLRS"
FT   gene            complement(467645..468214)
FT                   /locus_tag="Arcpr_0552"
FT   CDS_pept        complement(467645..468214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0552"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: bja:bll3178
FT                   transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57617"
FT                   /db_xref="GOA:D2RH42"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH42"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADB57617.1"
FT                   /translation="MIDKKNKIIIEELQRDGRATITEIAKKIGLTSMGAKKRVDKLIKE
FT                   GLIKVKALVNVEKFEIKLALIAMELESGEVLRDMLNKFENCPRIIKFFVTTGAYNLFAL
FT                   VWAENYYTLESISLESCSLRAQKGVRRFEFYPIADIYYDTFMDIKVIAEKTEKIAPCGV
FT                   YCGGCERYKRERCQGCPSTIFYKGRL"
FT   gene            468380..469165
FT                   /locus_tag="Arcpr_0553"
FT   CDS_pept        468380..469165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0553"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pla:Plav_0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57618"
FT                   /db_xref="GOA:D2RH43"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH43"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADB57618.1"
FT                   /translation="MNSITAILVFVAGLIAGTLGGLLGIGGCVIMLPALVFIFKYPLPL
FT                   AIGTTITAVILTATSGAIAHIKLRNVDYSTAKIVAISGAVGAAVGSITFFYIANQLWLL
FT                   NFILGFAFLYVSIRMIYEGIFKRKMPAKTGNKVPGSRFAKSLIGFFIGIVTGIVGLGGG
FT                   YALVPSFIYLLGSPVKIAVGTSLASFISMAVVSGAFKLYQGVVDAIAAICLGIGTIIGA
FT                   QIGARLTKIFPSWAIKAVFGFVFLYVSLKFIYQGVSVLE"
FT   sig_peptide     468380..468442
FT                   /locus_tag="Arcpr_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.672) with cleavage site probability 0.242 at
FT                   residue 21"
FT   gene            complement(469239..470369)
FT                   /locus_tag="Arcpr_0554"
FT   CDS_pept        complement(469239..470369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57619"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57619.1"
FT                   /translation="MNRPVTVDIPFTVTGEKARLVWWTAWFSKFCAHRLLNDAKENEIL
FT                   VDLSQTSFLKYARKRCYDVLPNRRYVDGIAVLIHSTLKSARKLGLKVNEIKLRQWLLFQ
FT                   CEADKKKKGNLNVRLTSTREAEALVFNQEREPRKIKINLRTPKKYEKLLKILVERAIKS
FT                   EVGYPARIVIKEYNTHLNDLRLYCSLQVMVPYDLYLEVMRKYDAPLGNHVAGIDVNVDR
FT                   LNIAIVDRYGRLRDVKTFWFREITSRGYRRKRAWTKIYQAIHDMLNYAYHHGVSHVVLE
FT                   NPEIVGYLKYYWIKNGNRKTKNYNYRTSIFRNRIIETIAYKTPLYGLKTIYVNPKGTTR
FT                   SKEHEKIMKKYGLDRHTASAYLIALKSLKKIHYATK"
FT   gene            complement(470587..471216)
FT                   /locus_tag="Arcpr_0555"
FT   CDS_pept        complement(470587..471216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0555"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   bam:Bamb_1702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57620"
FT                   /db_xref="GOA:D2RH45"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016771"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH45"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57620.1"
FT                   /translation="MSFDPIERARKVEDIVMQNDKRKYYRFRYTRYYGGIVTADTVGCN
FT                   LLCAYCWNYFKNLRPEKYGEFYSPEEVAEKLRKIARAKNCYLFRISGAEPILGERSAKH
FT                   VAKVISLVDGEFILETNGLMLGYNSDIVNLLVGLNVVVRVTIKGWDEDSFEKITGAKGE
FT                   YFRYQLKAVENLAKKGVPFWVAIMYDVFGEEGVKALKEKLPVPLQN"
FT   gene            complement(471221..472201)
FT                   /locus_tag="Arcpr_0556"
FT   CDS_pept        complement(471221..472201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pae:PA4313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57621"
FT                   /db_xref="GOA:D2RH46"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH46"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ADB57621.1"
FT                   /translation="MKDWIKATIALIISIVTIAIIFHISNFEVSLSIIRTLDYKFLVIA
FT                   FLLQVSFWLLWALRLKIIAKTLGSDVSYSYSLITTLSSMFFAAITPSSAGGEPVRVKMV
FT                   ADVCKSYGTASAVVLIERLLDAIFFAISLPILVILTGFYVGLGFRVAGIFSLFLVLFIA
FT                   LLYTLLKNPKKIERFVEKLFKFTRRFLKGRTDEIKAKVITEALRFRVALIDILKSKHYA
FT                   CIVFLLTIAMWLLGFLIPSFILLAMHLPPYFLFSITAQVIIVVVSLIPLTPGSSGIAEG
FT                   TMAYLYSAFVPQGALGVLVAIWRTITYYTNLFFGFLVSLKILKSG"
FT   gene            complement(472185..473108)
FT                   /locus_tag="Arcpr_0557"
FT   CDS_pept        complement(472185..473108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0557"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ank:AnaeK_3149 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57622"
FT                   /db_xref="GOA:D2RH47"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH47"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB57622.1"
FT                   /translation="MKVLVVILNKDNAEGLERCLKSLKDQTYKNFDVLVLDGKSKDNSK
FT                   EIAEKYGVMFKVQNRLGGTGFARVEGCEFALKRGYDAVIWGDSENVYDKRYIEEMVKAL
FT                   KNYDIVGGVPILEGSFLDHAFAWYHAIHLIVPKLYRRHAPGNNKAEKTWIYREIMYPTS
FT                   VRAEDYGFSLLLLKNGLNVKCGLANAKVVVSLPRNLKDVLAWQSARAKGVAQALKMVGF
FT                   KPYDVLAWSLLIFMIPLLAFNLEALIIYALILLASSIAIHFKSKRFIRRFRWFYFIAPL
FT                   IGFAIHSIYSIKALIHYMRWSNERLD"
FT   gene            complement(473105..474304)
FT                   /locus_tag="Arcpr_0558"
FT   CDS_pept        complement(473105..474304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0558"
FT                   /product="Protoporphyrinogen oxidase-like protein"
FT                   /note="KEGG: mxa:MXAN_1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57623"
FT                   /db_xref="GOA:D2RH48"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH48"
FT                   /inference="protein motif:COG:COG1232"
FT                   /protein_id="ADB57623.1"
FT                   /translation="MIGIIGGGLAGLSLAYHVKDSIVLEAKDRVGGLLRSEYVDGYTFD
FT                   TGGSHIIFSKDANALRELVNIIGRVVEHRRRTFIHYKGRFVKYPFENGIYMLPKEERFE
FT                   ILYDFFMNYVREKEKPKNLLEWFYYVFGRAITDKYLRPYNEKLWKTDLRKITLEWVGNR
FT                   VPNPPVEDILKSCVGIPTEGYTHQLRFYYPLEGGIETLARNLAKHCNIVTNERIKKIER
FT                   EGERFILKGKKEYVCDKVVSTAPIDVTARMLGMKVKLSYNPLTVVGIGGKGDLPDFHWV
FT                   YVPDGDVIFHRVAFLHNYSPNMAPENRVNLIAEISGKAEIDEVLEGLERIGFKVEPEIC
FT                   LKWEWDYAYIVYDESYSQIEEIRGFLIENGVIPFGRFGNWEYLNMDAVWIKAKNLAKEL
FT                   "
FT   gene            complement(474301..474897)
FT                   /locus_tag="Arcpr_0559"
FT   CDS_pept        complement(474301..474897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0559"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57624"
FT                   /db_xref="GOA:D2RH49"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH49"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ADB57624.1"
FT                   /translation="MHLEFWLKEVYPRIAKDLKLDVEKDRTATKIMAELGKGKFLPADV
FT                   LKFIEGKDVVVLGPLAKSLDFKWDVLITAGKSILNYDIIPHIHVTDGEEGWKILKKLEE
FT                   KDCIIILHAHGDNIELLREIVPKLDRFVATTQVEPVNGVYNFCGFTDGDRAAIIAKHFK
FT                   ARSIRLVGFDFERADGLKLRKLKWAEYILRMEGII"
FT   gene            complement(474887..475390)
FT                   /locus_tag="Arcpr_0560"
FT   CDS_pept        complement(474887..475390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0560"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein); KEGG: dol:Dole_2932
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57625"
FT                   /db_xref="GOA:D2RH50"
FT                   /db_xref="InterPro:IPR002071"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH50"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADB57625.1"
FT                   /translation="MRLLHLTVILALVFLGCLEYERVEKGVVVDVVDGDTIIVKIDGKI
FT                   EKVRLIGVDTPEIKAEQNKPYEYDNITNLTLLAEWGLKAKEFAESYLDNKNVTLEFDPM
FT                   TGYRDRYGRLLAYVYVNGTDFNALLLKEGYARVYVTKFKKLEYYLKLQEIAMKERRGLW
FT                   KYAS"
FT   gene            complement(475387..477051)
FT                   /locus_tag="Arcpr_0561"
FT   CDS_pept        complement(475387..477051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0561"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="KEGG: YALI0E28468p; K01885 glutamyl-tRNA synthetase;
FT                   TIGRFAM: glutamyl-tRNA synthetase; PFAM: glutamyl-tRNA
FT                   synthetase class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57626"
FT                   /db_xref="GOA:D2RH51"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH51"
FT                   /inference="protein motif:TFAM:TIGR00463"
FT                   /protein_id="ADB57626.1"
FT                   /translation="MKEIVMKYVVLNALKYGKPNEKAVMGKIMAEMPELRSKAKEVLEI
FT                   VKECIAEFNSLSEEKRRALFERYSVIDVKKKDERETKLPPLENAEEGKVVMRFAPNPNG
FT                   PPTLGSARGIIVNDEYCKMYKGKFILRFDDTDPRTKRPLLEAYGWYLEDCEWLDAKPKE
FT                   VVYASKRIPIYYEYCEKLLKMEKAYPCFCSREEFKKYRDAGVECPHRNVSKEKALEVWE
FT                   KMLNGEYEEGEVVIRIKTDMRHKDPAIRDWVAFRIIYEDHPLVGDKYCVWPTLDFESAI
FT                   EDHILGITHIIRGKDLRDSELRQRYIYKYFGWEYPITKHWGKVSIHEFGRLSTSEIRKA
FT                   IEEGKYEGWDDPRLPTIRAFRRRGFQPEAIRNFILSLGVGENDVAVSVKNLYAENRKLV
FT                   DPVANRYFFVWNPVEIKIEGVEEREVRIPLHPNKDGFRVLRGKSTVYITSDDFEKLKEG
FT                   DIIRLKDFCNIKLIDKNERIFEFVSYELGDVKKGRIIHWLSEDDSIDCKVIGEVTKEGF
FT                   AEKNALNDMGNVVQFERFAFCRLESFNGFLRAIYTHP"
FT   gene            complement(477146..477682)
FT                   /locus_tag="Arcpr_0562"
FT   CDS_pept        complement(477146..477682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0562"
FT                   /product="Protein of unknown function UPF0113"
FT                   /note="PFAM: Protein of unknown function UPF0113; PUA
FT                   domain containing protein; SMART: PUA domain containing
FT                   protein; KEGG: hypothetical protein; K07565 60S ribosome
FT                   subunit biogenesis protein NIP7"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57627"
FT                   /db_xref="GOA:D2RH52"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR040598"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH52"
FT                   /inference="protein motif:PFAM:PF03657"
FT                   /protein_id="ADB57627.1"
FT                   /translation="MLRKPKRREEKVVKSALRAFGSENFLEENELLIKDSEGAKELYAL
FT                   SKDLANFINRVKLNYVCVGIKVGEVGSRRLRFTLEGSFYLIRREKKKVYVDEKGEMLFL
FT                   YGRDIFARSVVKVTDDVEENDVVFVCNSKGDILGLGKSRFDASRYKDVEEDRVVVENLV
FT                   DRGEYLRKEKLYKAF"
FT   gene            complement(477643..478056)
FT                   /locus_tag="Arcpr_0563"
FT   CDS_pept        complement(477643..478056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57628"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57628.1"
FT                   /translation="MFAYPIEVATDLYVSKVGGFSPELEKNEIGINIDAIYSNTSIIAN
FT                   ETYAKIRFLGERAKPFFFRESYRVIGLEPNMEGFEYSQNGEVVFSESLANSLGTYIGKD
FT                   VIINTVETFRLNIDIITLVKKCLESQRGEKRRL"
FT   gene            478549..479286
FT                   /locus_tag="Arcpr_0564"
FT   CDS_pept        478549..479286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57629"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57629.1"
FT                   /translation="MDEIKPLRELDFKTIREEWMNIQLEDGTVIRFKSVLVRVFETGRH
FT                   DPITGEPIYHVEGQNIVVARAPDELKGAPSDFIPPIPELVKKKKPIEVKIKGITGDEWN
FT                   EYELETGKRIKTKTVITKVLRIDGYYDRYGNPIYIVQSQMIATSSPTRHKVVPKQHESI
FT                   TYISPDKLIVCVFSRSEGITRVDSTNEYSFSGYGYNINDPISESNPHRGWKISPEKLDL
FT                   LLLVQKTLEKDWYSKEDEFWDDY"
FT   gene            479276..479632
FT                   /locus_tag="Arcpr_0565"
FT   CDS_pept        479276..479632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0565"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="KEGG: dvu:DVU1509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57630"
FT                   /db_xref="GOA:D2RH55"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH55"
FT                   /inference="similar to AA sequence:KEGG:DVU1509"
FT                   /protein_id="ADB57630.1"
FT                   /translation="MIIEQRDIVLIHFPFTDLSRTKKRPVLVVSSDEFNRLSEDVIVVQ
FT                   ITSNLRSGFEEYNVRISNDDLEICYGKPIIPSIVKPYIIFSLDKGLIIKKIGKLNEDKF
FT                   REVLEKLKEVIFPQ"
FT   gene            complement(479616..479732)
FT                   /locus_tag="Arcpr_0566"
FT   CDS_pept        complement(479616..479732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57631"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH56"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57631.1"
FT                   /translation="MKADFEKKHREFLSYERFVRGVKRLREKGVIKEVIEEK"
FT   gene            complement(479926..481077)
FT                   /locus_tag="Arcpr_0567"
FT   CDS_pept        complement(479926..481077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0567"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   vvy:VV2235 transposase and inactivated derivative"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57632"
FT                   /db_xref="GOA:D2RH57"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH57"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADB57632.1"
FT                   /translation="MPRPRGYQTSSKVKVSRNIDKIFERICVREVCRNVKRLVYTHIDL
FT                   KLNYNCIYTTEDFLDFLTYIAITKDFATNGSRTYRLLRNKAPSADTLLYHLRKLSIEEI
FT                   ITQFDLVFDKLLEDAKRKGKFRNPVDVAIDIHDWLYYGKWGDYVIGTQPKQGTHKAYKF
FT                   MTICIVENGKRFHLKALPLKEFKDRYKVFEELLKHAMSRIKIKRVYLDRHFYDMEYIRI
FT                   LKKLGLKFIIQALRSSTIRKILDENKDKDVIVVRNYQMWRKRKPPGKETVNLFIVPSRV
FT                   NNDKVCFVTNLPVNEKNAIGYAELFRRRWGIETAYRVSKDFRAKTTSKNISVRLFYFLF
FT                   SLCLYNLWILVNITLCLIFNEMKPVVTAKIIGTLIFQFQVDYG"
FT   gene            481268..481975
FT                   /locus_tag="Arcpr_0568"
FT   CDS_pept        481268..481975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein similar to merozoite
FT                   antigen erythrocyte-binding ligand"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57633"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57633.1"
FT                   /translation="MARVGVYRYPDISLKEAVSDLDKIKRFLGKKVDGEITREAIAKAL
FT                   GLTPRGGRFTNKIASLIHYGFLESAGDGKVKLTELAKEILYPIGNSDIEAMKKAFFSIQ
FT                   LFKDLYEQYGDSVTVEQIEWFLRAKANADPREAKEKARKIHKIYIEGLTQIFSVEKQEE
FT                   QISEEILDRGEEIMMEREVLKQPEGIEEIKFGDVRIWLPPTEEGVKIAEQLIKLFKETR
FT                   LKVKEVKEEEKEE"
FT   gene            482042..484825
FT                   /locus_tag="Arcpr_0569"
FT   CDS_pept        482042..484825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57634"
FT                   /db_xref="GOA:D2RH59"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57634.1"
FT                   /translation="MRYVFENRLNVLLSELLNELGVISYSEQLGRRVRRDIVVYHQGLR
FT                   IILEGSYNREDAERDAKRRIEQLLADLAIAIHYPRIPDATDKELKERLKSIRFYAKVIV
FT                   PVDISGTLYEFLWQKRVIAKPVEDWIEVNLNLLANLIRESAQFIISEEHVKQVENKVDS
FT                   FINDWVQLLVNHPHSNTIARNLYDVLLKLYGFSIGDPQRIKEVIFAQSGLALLLSAVYY
FT                   ESVRYAHDLKSLFELSEKTDAQSALRRAIVEILKINYQPIFNTALAILDCLPPMHRKFE
FT                   HLIDLATEIASKRSLLRRDIAGKIYHKIVGDWSLRKGLATFYTQIPAAYLLLHLAKPTL
FT                   SRICDFACGSGTLLTAAYSAARTQYGLSLLEQGVDKDPREIDEEFHKAFIKSCYGIDVL
FT                   KYATQVTAINLALHSPETPLDEFNIYTLPLGLREKNGMVSLGSLEFARTAVRLDQILYG
FT                   EKATKIGLTKEEEKLIKLEPFKFIVMNPPFTRATGRGGREGGGLFGFIADETARERVRS
FT                   DYDRLRDDIRNQLLKIGTRCLYGTDLRFLLEEREYRSIGQAGEGLLFLYLAYKMLEDNG
FT                   KICFVLPKSLLSGVSWFLARTLLASEFHTEYIIVSYDSEGGYNFSESTSLSELLLVAKK
FT                   TKEHSDDEKTKFVLLLKKPRTSIEAIALANQIDRGEEYVEAGNAQAFVISVDRKTLLKY
FT                   IDNWGRFVFLPNTYLIKEILDILRGVIRVGNIKIEIPITKLNNLISSIGIDRHQFHDHF
FT                   QRVLRQIPGSMPAVYGGGEEVRGKMVISPNAYVKPKTQRARTIFREKAGRLLLPDRIRV
FT                   NTAHVISMLSDTPVLSNIFYAVRLRDEDENKLKALCLWFNTTWGILTVLANREETEGAF
FT                   ISLKMSHWKTIPALDVDNLPEDRLKELANVYDQFGEANFKRLHEQSYSPIHCLIDV"
FT   gene            complement(485094..485453)
FT                   /locus_tag="Arcpr_0570"
FT   CDS_pept        complement(485094..485453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0570"
FT                   /product="metal-dependent protease of the PAD1/JAB1
FT                   superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57635"
FT                   /db_xref="GOA:D2RH60"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH60"
FT                   /inference="protein motif:COG:COG1310"
FT                   /protein_id="ADB57635.1"
FT                   /translation="MKIRKEVLRLALEIARESYPNEFVALLTGKKGVIEELLFLPFDSG
FT                   ESSAIIHLEMLPLGYRIYGTVHSHPSPSCKPSRADLDMFAKHGIVHIIVCYPFEWGCWG
FT                   FYDKNGNEIRLEIVD"
FT   gene            complement(485450..486088)
FT                   /locus_tag="Arcpr_0571"
FT   CDS_pept        complement(485450..486088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0571"
FT                   /product="RNA-binding protein-like protein containing a
FT                   C-terminal EMAP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57636"
FT                   /db_xref="InterPro:IPR041169"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH61"
FT                   /inference="protein motif:COG:COG2517"
FT                   /protein_id="ADB57636.1"
FT                   /translation="MDTSRDFRLILAEKGIKELERVINAVKVQRRKEILKKVREMENDI
FT                   QVVKWSYLDIDELLNFENFVKLVETAKELREALKQAEKDFNWKLADYWLEYISYLPELM
FT                   KRGEISRVYEAIRFFSGVITNRKKIGGLWFCNVDCGFKINVVTNSEKFKPNEYVVIAYL
FT                   PPREFGEYMSEGMFVDAKIEKKGELSLDEIRSIADKLGEVEAILIEMLR"
FT   gene            486128..487219
FT                   /locus_tag="Arcpr_0572"
FT   CDS_pept        486128..487219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0572"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase;
FT                   aminotransferase class V; aminotransferase class I and II;
FT                   KEGG: swd:Swoo_2007 pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57637"
FT                   /db_xref="GOA:D2RH62"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020931"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH62"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ADB57637.1"
FT                   /translation="MLEEFKSKDIPYSRVLSSMCTIPHPIAVKAHVEFINANLGDPAVF
FT                   RGSAELEKEVVRMIGELLHHPNAKGYIASGGTEANIQAIRAFRNLKRVKKPNVVVPESA
FT                   HFSFDKAGEILRVEIRKAKLDGEFRVDVGDVERLIDDNTVGIVGIAGTTALGQIDPIEE
FT                   LSELALERDVFLHVDSAFGGFVIPFLDLNVKFDFELEGVSSMTIDPHKMGLATIPAGCI
FT                   LFRDESFLKALAVKTPYLITEKQYSLTGTRPATGVASTYAVMKYLGFEGFRKVVRRCME
FT                   VTRYLVERMGELGFEPVIEPIMNIVCFKCEKAFEIRNELYKRGWVVSAIRNPRALRFVV
FT                   MPHVDFEVIDKFVEEMKNVLRKV"
FT   gene            487244..487531
FT                   /locus_tag="Arcpr_0573"
FT   CDS_pept        487244..487531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0573"
FT                   /product="protein of unknown function DUF211"
FT                   /note="PFAM: protein of unknown function DUF211; KEGG:
FT                   dps:DP2436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57638"
FT                   /db_xref="InterPro:IPR003831"
FT                   /db_xref="InterPro:IPR023129"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH63"
FT                   /inference="protein motif:PFAM:PF02680"
FT                   /protein_id="ADB57638.1"
FT                   /translation="MAGLRRLVLDVLKPHEPSNVLLAVKLSEMENVEGVNLLLREMDQN
FT                   TETLKITIVGDNLNFDKIRKILEEFGAVIHSVDEIVAGRKIVESVKTEQD"
FT   gene            487613..488323
FT                   /locus_tag="Arcpr_0574"
FT   CDS_pept        487613..488323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0574"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: KaiA binding; Circadian clock protein KaiC
FT                   central region; KEGG: smt:Smal_1030 non-specific
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57639"
FT                   /db_xref="GOA:D2RH64"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH64"
FT                   /inference="protein motif:PFAM:PF09054"
FT                   /protein_id="ADB57639.1"
FT                   /translation="MNGGVDLFEKIPTGVEGLDVMLKGGLIKGRTYLIKGGPGTGKTIL
FT                   SMHFLVEGAKRGENVVYITLEEPENEVRENMETLGFDLSNVTIVDLSPTSGHPIFSSLM
FT                   GFESGIDVKTFENILQDIIGDNIDRVVIDSITMLKVATPTETEYRASLLRLMRTLKVKF
FT                   NATTVLISELGNGVEDYLVNGMIELRTIEVKGRAVRGIKIVKMRGSDFDETIRPYRITN
FT                   RGIEVYPDLSVFEV"
FT   gene            488320..488934
FT                   /locus_tag="Arcpr_0575"
FT   CDS_pept        488320..488934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57640"
FT                   /db_xref="InterPro:IPR008553"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57640.1"
FT                   /translation="MKLVEPLDKLIEDFLRGEFVLVEYDSICHFPLLPLRLAIENDGIL
FT                   VEMGDKLSVKIPALIKFIRNYEGLYKVKIVNISNYKLELEGIYIYNIALAELLSVTSKL
FT                   YEFFKDYSSELIVFDGVEYLFLHYDLKNVIKDLAGLKVMFPDTTMILFVNYGVVKRRYI
FT                   TLLESLATTTIRFKGVLGDKIVRQGYVLKSLTKPRAETVVL"
FT   gene            488931..489530
FT                   /locus_tag="Arcpr_0576"
FT   CDS_pept        488931..489530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57641"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57641.1"
FT                   /translation="MNFGIKKLDELIGDIEKGTVILIEGVGDVPILIAKEFLKNALNEG
FT                   FNAFAIVSERVKRVLSDLNGLNVLTPDDAFSFQELFTISLVVRDLKEKVGLIDVFQQLL
FT                   IMPESEKVYHLLREICQHIRKKKGIVVITLDKRLADDRTIAMFENEADYVIEIDEISEG
FT                   LKIRRGIRVKKSLKNPPSPYYSLLIEGGIRVGDKIG"
FT   gene            complement(489556..490452)
FT                   /locus_tag="Arcpr_0577"
FT   CDS_pept        complement(489556..490452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0577"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: hha:Hhal_0895 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57642"
FT                   /db_xref="GOA:D2RH67"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH67"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ADB57642.1"
FT                   /translation="MREFELIGKAKELFRVERDDVIVGIDDDCALVDVGTRLALTTDCL
FT                   HEKTDFPKGIKPEEIGHLALAINLSDLASCGAKPLFFLYTITLSDYWIEYFERILKGMK
FT                   NLADKYGVAVVGGDTDFGDELHISGFAIGKAERFVGRDGAKVGDKICVTGLLGKAQLSL
FT                   EQLMNGFSRYEIAYPDSLFKPEPRVEEGLRIAKHANSMTDISDSLAISLHQIAKRSGVG
FT                   IKIYEEKIPLDHLTKFVDYEKALELFLYSGGDYELVFTSKKSEYIEIGEVIEDEGVWIV
FT                   RRDGRVKEVEFRGYAHL"
FT   gene            490627..491886
FT                   /locus_tag="Arcpr_0578"
FT   CDS_pept        490627..491886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0578"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: cytoplasmic tryptophanyl-tRNA synthetase;
FT                   K01867 tryptophanyl-tRNA synthetase; TIGRFAM:
FT                   tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57643"
FT                   /db_xref="GOA:D2RH68"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH68"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ADB57643.1"
FT                   /translation="MITPWEVEGVVDYERLMREFGIRPFSEILDKIPNPHPLMRRGVIF
FT                   GHRDYERIVDAMKKGEEWAVMSGFMPSGLPHLGHKMTMDEIVWHQNMGGKAFMCIADME
FT                   ARFVRGLSVEKTRELGELYIRSIIALGLKSDNCLIYYQSANRYVKDLAIELSSETNFSE
FT                   LRAVYGFNPETSLIKMFIPMIQAGDILHPQLKDFGGFKPVVVPVGADQDPHLRLTRDLA
FT                   NRICIFSFERIEGGVRVRSRKGENYLEKLKDLNFDLKAYEGHVDIFGDPEEIEKAVRNL
FT                   EMELGGYAFIPPSSTYHKFTTGLRGGKMSSSKPESYISLFDKPEEGAKKVMRALTGGRA
FT                   TVEEQRRLGGEPDRCVVFELYTYHFADDKMLEEIRRDCEDGNLLCGQCKKQLAEIVKEF
FT                   LKEFQEKAKSVDLSEFEILK"
FT   gene            complement(491878..492612)
FT                   /locus_tag="Arcpr_0579"
FT   CDS_pept        complement(491878..492612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0579"
FT                   /product="protein of unknown function DUF178"
FT                   /note="PFAM: protein of unknown function DUF178; KEGG:
FT                   dde:Dde_0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57644"
FT                   /db_xref="GOA:D2RH69"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030868"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH69"
FT                   /inference="protein motif:PFAM:PF02621"
FT                   /protein_id="ADB57644.1"
FT                   /translation="MKIGKFDYINNYLPYYYVEKEKLAEIVTATPKEMIALLENRKIDY
FT                   APIPSFYYLKNKSKFKRYRFCVASNGKVYSVIVVSRDGKLGDRVGITSETTTSVNLLKV
FT                   ILAERGIKCKLVPMNAFKADDILKSCDSALVIGDSALEARKHFKVVMDLGEEWKDLTGY
FT                   PMVFGISASIDDAEICDELIIRSLRWGLKNFNEVVKSAVKRFGIDEEFLRKYFKALKHE
FT                   MDSKCEKGLKAFEEFCRDYKLL"
FT   gene            492664..493593
FT                   /locus_tag="Arcpr_0580"
FT   CDS_pept        492664..493593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0580"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: MGC84142
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57645"
FT                   /db_xref="GOA:D2RH70"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH70"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADB57645.1"
FT                   /translation="MIGVYSNLYYPTRWVPLRRRGLGWQRCNEMYEEHGCIASCGLAYD
FT                   KILELVLDIKGCNLHCKYCWCWKMRYHSEDIKKSPKDVLRDLECRFDEVVKDKFVSKKG
FT                   YRIGVIRITGNEPSLQWDHVKEVLKLIDRSERLRSFKVIIETNGVAFAKMDVNGLDNLE
FT                   INIDIDVSFKGVNYDQFEWLSSVKREYFRYQIEGFVKLFDYYEGTNVSVNPVLGINHAE
FT                   NYCVWKRGKKYVMDVEIIDKYGNKLNFYDYSKDFEEEVLSRKELRYDEAPFREYFGINR
FT                   ETTRLVVAVVYKGRRYLHILPSELPDLI"
FT   gene            493590..494690
FT                   /locus_tag="Arcpr_0581"
FT   CDS_pept        493590..494690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0581"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dps:DP2838 quinolone resistance protein (NorA)"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57646"
FT                   /db_xref="GOA:D2RH71"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH71"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB57646.1"
FT                   /translation="MRALLLAVFSAMLGLGIVSPLMPIYAKDLGATTLILGIIYSSFST
FT                   ARTIFTPIVGFLSDRLGRKFFILTGLALYSILSIFYMVARTPEDLVVIRFFHGLSSAMV
FT                   VPSAMAYVSQLAPKGEEGRTISSFNIAFLTGMGFGPFLGGVVKDIFGLRFAFAIMAFLT
FT                   ALAFILALPLPNLKDRTNFRVKAILNRCITSLMIFRFSTAVRMSLMIAFFPVLISYLKG
FT                   YEIGAIVSAVILSNAISQKLFSGLVDRFDRVLIATISGLASTIIFIVLPFSDDFYRILA
FT                   LALVMGIFNGLATCSACAIAIELGRTYGHGAVMGLYNTAMSLAMMTTPVIAGFIADKTD
FT                   IPTSFVALGFLSMTCLFIFHATISKR"
FT   sig_peptide     493590..493670
FT                   /locus_tag="Arcpr_0581"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            494687..495604
FT                   /locus_tag="Arcpr_0582"
FT   CDS_pept        494687..495604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0582"
FT                   /product="RNA methylase, NOL1/NOP2/sun family"
FT                   /note="KEGG: sdn:Sden_2046 rRNA (cytosine-C(5)-)-
FT                   methyltransferase RsmF; TIGRFAM: RNA methylase,
FT                   NOL1/NOP2/sun family; PFAM: Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57647"
FT                   /db_xref="GOA:D2RH72"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR011023"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH72"
FT                   /inference="protein motif:TFAM:TIGR00446"
FT                   /protein_id="ADB57647.1"
FT                   /translation="MKSDFAQINRRFVERYERIDDSEEFWMYMAKPLRPSFRVNTLKAS
FT                   VEDVVSSLSDRFKLEPIPWCKEGFFSDKEVGRTIEHQIGVIFSQEASSMIPAIVLDPKP
FT                   NMLVLDMCASPGGKTTQIAQYMKNEGCIVANDVKYDRINILISNLQRCGVTIARVTMKD
FT                   GRFFKRFKDTFDRVLIDAPCSNVGMIRKNYRYLKMWSLKEVYSLSRLQKELVMAGYRAL
FT                   KPNGIMVYSTCTLDPLENEEVVDYLLSNTDAKLLEIDLPVNRTEPITEFEGKVYDEEVK
FT                   KCLRIHPQDNDTEGFFIAKITKPE"
FT   gene            complement(495576..496160)
FT                   /locus_tag="Arcpr_0583"
FT   CDS_pept        complement(495576..496160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0583"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57648"
FT                   /db_xref="GOA:D2RH73"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57648.1"
FT                   /translation="MSSRFEARTALISMLLLSLSILVDQRMSLPILILTIAFNFNVLKA
FT                   LAKLTPLIAFYIVSSFFLGGVDKILTMVALLSLFLFLYGLNPEEVGFALMYFRFPPRFA
FT                   YSICISLRLLQNISNDLNNLFQLRKIERFSYLELLKRLTNIAIIRAISMAESLESRNFD
FT                   LDMRIPHINKPNLKDYALLLSSIILALLSLL"
FT   sig_peptide     complement(496089..496160)
FT                   /locus_tag="Arcpr_0583"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.557 at
FT                   residue 24"
FT   gene            complement(496144..497166)
FT                   /locus_tag="Arcpr_0584"
FT   CDS_pept        complement(496144..497166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0584"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ppd:Ppro_1540 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57649"
FT                   /db_xref="GOA:D2RH74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH74"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB57649.1"
FT                   /translation="MVSLRDIWFSYSKPVLRGVSLDVDRTFICGYNGSGKTTLLKIASG
FT                   LLKPDKGIVEGRAVYVHQNADDYILFSKVKNELLIQAVQCGRDLDEVLRIARKLGIVHI
FT                   LERETSKLSDGEKRLLTIALALLKGDCLALDEPFANLHPKVAEKVLKVLKEPFIIAEHR
FT                   ISLCEDFIWLENGKIRDVPDFHFELPKGEIGEVVLRVEDLCFGYKDSLLKDVTFEARRG
FT                   EILAVVGMNGCGKTTLIKLLAGILKPWSGEISVKGKIGHCLSNPYYHVQEPISFGEAKI
FT                   KALERTFKADILLWDEPTAGLDITKKFQILKRARELKKTIIMATHDEDILEFCDHVVEI
FT                   "
FT   gene            complement(497153..497761)
FT                   /locus_tag="Arcpr_0585"
FT   CDS_pept        complement(497153..497761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0585"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: rsh:Rsph17029_0845 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57650"
FT                   /db_xref="GOA:D2RH75"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH75"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADB57650.1"
FT                   /translation="MVNNYLRFTLACALAVLTALTSQIKFYIGMIPYTFQNFAVILSGL
FT                   VLGKYGFVPQLIYIGMIALGFPASARGGGLGILLGYTAGYIWSFPLSATIMGLVRERVW
FT                   RKGDSREVVMLWIGSILAVIPLYILGFYVFWLWTSGSSGLLNYCLEVTRAFGLNLSPFW
FT                   AAFFATVVIFFPQDIFMDHVIAITVFKHIQKFLKSYGIS"
FT   sig_peptide     complement(497696..497761)
FT                   /locus_tag="Arcpr_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.634 at
FT                   residue 22"
FT   gene            497940..499505
FT                   /locus_tag="Arcpr_0586"
FT   CDS_pept        497940..499505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0586"
FT                   /product="protein synthesis factor GTP-binding protein"
FT                   /note="PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor Tu
FT                   domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57651"
FT                   /db_xref="GOA:D2RH76"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039263"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH76"
FT                   /inference="protein motif:PFAM:PF00009"
FT                   /protein_id="ADB57651.1"
FT                   /translation="MRCLEDIVQNGERENIEFKEYLTSYHLKENRFQELACQMNHRIIM
FT                   GRGKAIYVIGVSDNGELKGIDEDKFKETVEVLKKIAEEISAKIKSVEMFKVDSGYVGIV
FT                   EIVKSKAKEHIIVGTAGHVDHGKSTLVGCLITGRPDDGDGLTRMYLDTLKHEIERGLSA
FT                   DLHFAVFGFKDGKPMRMKNPLNKNERAFVTEKADKLISFVDTVGHEPWLRTTIRGLLGQ
FT                   KIDYGLLVVASNDGVMRTTKEHLGILLAMELPVIIAITKIDMVDEKRVNEVVDQVSRLL
FT                   RTVGRIPYVVKDAEDVKKVVRLMRKSLVVPIVKTSAVTLEGYDLLEELLLRLPKRTYKG
FT                   KGFLMYIDRIYKVTGVGTVVSGSVKRGEVEEGEEVYIGPFRDGSFKLVKVQSIEMHYYR
FT                   VDRAEAGDIVGIAVKGVKYDELRRGMVLTKEEPKAVKEFDADVYIFTHPTRIKRGYEPV
FT                   IHIETISETVIFKEMDREYMKAGDRGKVRIAFKYNPQFVYEGQKFIFREGRSKGMGEIT
FT                   KVYT"
FT   gene            499502..500659
FT                   /locus_tag="Arcpr_0587"
FT   CDS_pept        499502..500659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0587"
FT                   /product="protein of unknown function DUF401"
FT                   /note="PFAM: protein of unknown function DUF401; KEGG:
FT                   gsu:GSU1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57652"
FT                   /db_xref="GOA:D2RH77"
FT                   /db_xref="InterPro:IPR007294"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH77"
FT                   /inference="protein motif:PFAM:PF04165"
FT                   /protein_id="ADB57652.1"
FT                   /translation="MKTSLCLLISIATILILIRRFHVSVAVLVGAFVLGILTLGLDCFN
FT                   VMFSTLTSFQTLKFLVIITLAFTLAYSMKESGALDMITQSSLSLFGKASMFVIPAMIGL
FT                   LPMPGGAIVSAVMLRDIVKKFKIPPEKATFLNYWFRHVWACLDPIYPSVIITLAILEIS
FT                   FSTLLKSTYFITLAMIAFGLPFASLEKSNNPKDLKGFLYLAPILIVMVLTVSGIDLTLS
FT                   LILAILLLYIFKRPDLRKVTKKAVDIKIYILIVALLYYKDLIMKTGSSHELLKDLTSLG
FT                   VPQPVTATILSFILGFATGIESGYAAMAIPLLAPFTGIGEKIVAKNLMLVVGAGILGVM
FT                   FSPLHLCLILTREYYSADLEKVYTRYLIPAGLLTLLSLFLAYLIL"
FT   gene            500693..501862
FT                   /locus_tag="Arcpr_0588"
FT   CDS_pept        500693..501862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0588"
FT                   /product="mannosyl-3-phosphoglycerate synthase"
FT                   /EC_number="2.4.1.217"
FT                   /note="TIGRFAM: mannosyl-3-phosphoglycerate synthase; KEGG:
FT                   hypothetical protein; K05947 mannosyl-3- phosphoglycerate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57653"
FT                   /db_xref="GOA:D2RH78"
FT                   /db_xref="InterPro:IPR012812"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH78"
FT                   /inference="protein motif:TFAM:TIGR02460"
FT                   /protein_id="ADB57653.1"
FT                   /translation="MLIELPKHSEVFGSIKIHELQKVLKLESSKVIAPLIRGFSRDELR
FT                   EIFSRMAVVIPVKDERLHLLDGVLRSIPDDCTIVVVSNSRRVEQDVFKLECDLVSNFYK
FT                   ISNQRIAIVHQKDPGLSLAFQEVGYNAILDKTGVVRDGKGEGMVIGILLAKMFGCDYVG
FT                   FVDADNYIPCSVNEYVSIYAGVLSLAETPYAMVRLHWRYKPKVMEDRLYFRKWGRVSEI
FT                   TNKYINMLLSMKTGFETLIMKTGNAGEHAMTMKLAEIMEFSTGYSIEPYQIIYLLEEFW
FT                   EGETRFKDALSSGVSIYQVETINPHVHEEKGEEHIKDMLLASLAVIYHSKLAKDELKDK
FT                   IFEELKNNEVVKSRRDIKKCVKMPPICDIDLKKFIEVFERYTETFLCYD"
FT   gene            501868..502617
FT                   /locus_tag="Arcpr_0589"
FT   CDS_pept        501868..502617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0589"
FT                   /product="mannosyl-3-phosphoglycerate phosphatase family"
FT                   /note="TIGRFAM: mannosyl-3-phosphoglycerate phosphatase
FT                   family; HAD-superfamily hydrolase, subfamily IIB; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase type 3;
FT                   KEGG: hch:HCH_00271 mannosyl-3-phosphoglycerate
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57654"
FT                   /db_xref="GOA:D2RH79"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006381"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH79"
FT                   /inference="protein motif:TFAM:TIGR01486"
FT                   /protein_id="ADB57654.1"
FT                   /translation="MIKIIFTDLDGTLLDKNYRCDKALELIKKLEVPIVFVSAKTIFEQ
FT                   EVFRKMLGISDPFVVEDGSAIYAPLNYFGRRIGYRRHGYDALILGVEREVILQHIKSLN
FT                   VKSYANMSVEEISKLTGLSLEMSELAKRREFSEVIVEADEKALKYLKKFFNVQIGGRFI
FT                   HVYGKGADKGKAVRILTELYEDLYGEVVTIGIGNSYTDIPMLREVDIPALVRNEDGWIE
FT                   VDFEVYRANGVATEGWVEVVKKFVGGD"
FT   gene            502618..505188
FT                   /locus_tag="Arcpr_0590"
FT   CDS_pept        502618..505188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0590"
FT                   /product="glycoside hydrolase family 38"
FT                   /note="PFAM: glycoside hydrolase family 38; Glycoside
FT                   hydrolase family 38 central region; glycosyl hydrolase 38
FT                   domain protein; KEGG: ecr:ECIAI1_1941 putative
FT                   alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57655"
FT                   /db_xref="GOA:D2RH80"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH80"
FT                   /inference="protein motif:PFAM:PF01074"
FT                   /protein_id="ADB57655.1"
FT                   /translation="MEERDVIYLVPHSHYDAMWIFTKEDYFYINIDIILKKVIEIMEES
FT                   KDYKFLIEQTHLLEEVERRYPDLFKKIGEYIREGRIEIADGEYVMADTMLPQEETLIRE
FT                   ILFGKRYVREKFGADVVVMWVADSFGLNAQLPQIYRKCGYKYVAFRRGCPEIKPSEFLW
FT                   EGLDGTRIIAHFFPLGYRAGLYLDRLEEAYAKLKRVAFSNHILMPSGSGSIPPQEETPK
FT                   VVEEWNKKHRALMKIATPSEFFKAIEKFKDKLPVRKGEMYSGKYSQVFPDTASSRIWVK
FT                   KNLRKFENWILFFERFSTINYLLGGEYRVEELKNCWKKVLFMAFHDVVPGTSMDTGYQD
FT                   IRHDIDFLKTKLSYLTPRVLKEIIERDSDGEDFGDVIVFNPLSWDVTNWVEVDLNFDEG
FT                   QVYRIEGLKCGDEEIDVEVIRFRRYDDESLSYARIGFVASVPALGYKVYKIVEERKRKR
FT                   REKNFIRIVGNTIETKHFNVTFSPEDGLITVTKNGKTIFRDGNELVIESEIGDLYYHRE
FT                   DIDIPIRTEGGEGLQFGSFRVKNFWIEKSPLRRVINVHTDYYSVRWPYRYIERFKPLMW
FT                   RHRFISFRKKIIVYRDIPRIDFVTYVDNKHPRVRLRVRFKTDMNLPEYTCECQFGAVNR
FT                   KTNTYYFKPKDWKEKPSGVYPSLRWIDYSDGEKGLAILNRGNPENEVRDGNVYITLLRS
FT                   VGILSNGSAGPVIPVPDARELKRYSFKYAVYPHEGDWKQAKVYKMGYEFNYNLVALQVP
FT                   RNRRYRLKRSFLRIDPDNVILTAFKLAEDGDGIIVRFYEAEGSEVKAKLTFFKEIKEAK
FT                   VVNMLEETDEEFEREFGKDVKVDGNVVEVEMKPFEVVTLKVKFD"
FT   gene            505189..506499
FT                   /locus_tag="Arcpr_0591"
FT   CDS_pept        505189..506499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0591"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: gur:Gura_4245
FT                   glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57656"
FT                   /db_xref="GOA:D2RH81"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH81"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADB57656.1"
FT                   /translation="MEKILIQLPKRLVMKLEKSKALYEEAVKLLPGGVSSPVRAIKPFP
FT                   FYTAKAEGSKIYDVDGNCYIDYCLAYGPLILGHANPVVKSALMEQLEKGWLYGTPIELE
FT                   VKYAKLITKLYKSIEMLRFVNTGSEATMSAIRLARGFTGRNKILKIEGSFHGSHDAVLV
FT                   KAGSGATTHGIPNSAGVPPDFVKHTLQVPFNDVEALAEVVEKNRDDLACVIMEPVMGNS
FT                   SLIIPEEGYLKEVRKITAENDVLLIFDEVITGFRLALGGAQEFYGIEADLTTLGKIAGG
FT                   GLPIGIFGGRREIMEHVAPSGNVYQAGTFSGNPLSLTAGYTTVKFMIENKVIDVVNRTT
FT                   EELVKGLKDQIEDSNANLEIDSIASMFCVYFGRKPKNYADALKLDKDRYMKFFWKMLEN
FT                   DVFFPPSQFETCFVSYAHTKEDVEKTIEAFGLCLREL"
FT   gene            506481..507359
FT                   /locus_tag="Arcpr_0592"
FT   CDS_pept        506481..507359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0592"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: nis:NIS_1020 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57657"
FT                   /db_xref="GOA:D2RH82"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH82"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADB57657.1"
FT                   /translation="MSERVVVGTRGSKLALAQTSKVVERLKEEGYSVEIRIIKSTGDIM
FT                   KDKPLYEFKGSGAFVRALEHALVRGEIDVAVHSYKDIPSNMLEGVTVSAVLERDSPYDA
FT                   FIARNGESLEEIKPNAVIGTSSLRRRAQLKLYRSDLRFENLRGNVDTRLRKLREGLYDA
FT                   IVLAEAGIQRLGLNVKYQRLPIERFVPPANQGIIAVQTRVGEEDLVKFMNHEETWIEAE
FT                   VERIVMKTLGVGCAIPAGIYAECRGKVRLIVQVIRDGREFKVIEELSRESAIEEAREIA
FT                   ENFREEVGLRA"
FT   gene            507356..508126
FT                   /locus_tag="Arcpr_0593"
FT   CDS_pept        507356..508126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0593"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: dol:Dole_3062 uroporphyrin-III C-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57658"
FT                   /db_xref="GOA:D2RH83"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH83"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADB57658.1"
FT                   /translation="MTGKVYIVGAGPGDPDLLTVKALKVLREADVILYDELIGDEIREL
FT                   LRSLKAELVDVGKRAGKHKMKQNEINELMVKLAREGKIVVRLKGGDPFVFGRGGEEAEY
FT                   LAKHGIPFEIVPGITSAIAVPAYAGIPITHREFDPAVVFITGREWKERLNWKALAELNA
FT                   TIVVLMGVSNLEKIVKKLLENGKNPKTPVAIIERGCTLRQRVVISNLENVVDVARREGV
FT                   KAPAVIVIGDVVRLREKLAKFLQNLGNFDHAEGN"
FT   gene            508110..508655
FT                   /locus_tag="Arcpr_0594"
FT   CDS_pept        508110..508655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0594"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: tgr:Tgr7_1228 putative L-fuculose phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57659"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH84"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADB57659.1"
FT                   /translation="MQKVINEMIKIGRKLGQFRLVDGASGNMSCRIGDFMLITRSGSIL
FT                   DDLTPQDFVYVKIGEFCKGISSDWKVHKAIYEKTDYKAVLHCHGVYNVVLSLIHDEIVP
FT                   RDLEGGIFLKKVRVVEGEFGSDEVAEAIADEIARNGIAIHKGHGIYSAGKDMIEAFNKA
FT                   CYLEHSCEILYRLKVLKR"
FT   gene            508697..509887
FT                   /locus_tag="Arcpr_0595"
FT   CDS_pept        508697..509887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0595"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: dvl:Dvul_1567 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57660"
FT                   /db_xref="GOA:D2RH85"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH85"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADB57660.1"
FT                   /translation="MIVAIARAKKDAKALKHALNCEVLSLGGIRSLESVDFSIFRDKIP
FT                   IFFFGKDEVDLALEAERMIKEVTPIYQIVVLSKKAVRNTRMEEIREKFEMAKAKIRLGV
FT                   KFDKVFVFSPKNEFGIEIHPDYDSYFIIGKGFIENMRKIGVDVEEGNLILRKLYNEENV
FT                   YVPELKAIVSKRIGEKVRVNYLSDVEPKKMPIDKTIEKNRMFLEVMERISIKFIREHAN
FT                   NVAVPFSGGKDSLACLILAKKALGDVKAIYIKTNYEMPYTEEYIERVCKRLGVDLIVES
FT                   VKFDVEKYGMPTHQNRWCTKLKMEALERVVKSEEVKTLIVGDRDAESRVRRERPVVFER
FT                   IAKEIFPIKYWSGAMVQLYILMNGLDLHPLYYKGFYRLGCTICPSLSEWEKNLLES"
FT   gene            complement(509909..510502)
FT                   /locus_tag="Arcpr_0596"
FT   CDS_pept        complement(509909..510502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0596"
FT                   /product="GTP-binding protein HSR1-related protein"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   mrd:Mrad2831_3502 GTP-binding protein HSR1- related"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57661"
FT                   /db_xref="GOA:D2RH86"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH86"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ADB57661.1"
FT                   /translation="MIEIVFAGRSNVGKSTLFSQLFGVKVRRGKRPGTTIKPNQIKFKD
FT                   LLVTDLPGFGYISGVDKEFNERVKDFIVEYIEKNAERIILAVQVVDGKSFLEIAERWER
FT                   RGYIPVEVEMFEFLNEVCSKVFLAVNKMDKVDNPNEVLDAIALKLGMTPPWKDWTHVIY
FT                   PISAKEGKINNLREAIKRRLIEIGRSDLIPVLKK"
FT   gene            complement(510499..510678)
FT                   /locus_tag="Arcpr_0597"
FT   CDS_pept        complement(510499..510678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0597"
FT                   /product="Sec61beta family protein"
FT                   /note="PFAM: Sec61beta family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57662"
FT                   /db_xref="GOA:D2RH87"
FT                   /db_xref="InterPro:IPR016482"
FT                   /db_xref="InterPro:IPR023531"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH87"
FT                   /inference="protein motif:PFAM:PF03911"
FT                   /protein_id="ADB57662.1"
FT                   /translation="MAKREKVKTPPLMSSAGIMRYFEEEKTQIRISPKSVLAFGLTVGV
FT                   LVIILNAYYGLWPK"
FT   gene            complement(510709..511251)
FT                   /locus_tag="Arcpr_0598"
FT   CDS_pept        complement(510709..511251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0598"
FT                   /product="protein of unknown function DUF99"
FT                   /note="PFAM: protein of unknown function DUF99; KEGG:
FT                   hch:HCH_04342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57663"
FT                   /db_xref="InterPro:IPR002802"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH88"
FT                   /inference="protein motif:PFAM:PF01949"
FT                   /protein_id="ADB57663.1"
FT                   /translation="MKLWRVVGFDDSFKDNLAYIVGCVTCKDYVEGFLIDRIEVDGWDV
FT                   SEKIVELISNSKFYKQIKCVLLSGITFAGFNVADLEFIYENLGIPVIVILERYPDFERI
FT                   ERALRNLEGFERRIELVKKAGEIRKVRKVLVQLKGCDLEFAEKILKLTIRKGKIPEPLR
FT                   IAHLVASALIHKESRRR"
FT   gene            complement(511276..511578)
FT                   /locus_tag="Arcpr_0599"
FT   CDS_pept        complement(511276..511578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0599"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   mmw:Mmwyl1_1522 branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57664"
FT                   /db_xref="GOA:D2RH89"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH89"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ADB57664.1"
FT                   /translation="MIEIIVTVAIGTYLTRLLPLLFRDKLNLEKWSEWLSYSSTALISA
FT                   LFVTSFVSFPINPRDLTIGLISLTIVYASYAKSKNLGVSIIFGVLAYYIFSISIS"
FT   gene            complement(511575..512210)
FT                   /locus_tag="Arcpr_0600"
FT   CDS_pept        complement(511575..512210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0600"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: mmw:Mmwyl1_1521
FT                   AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57665"
FT                   /db_xref="GOA:D2RH90"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH90"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ADB57665.1"
FT                   /translation="MIKKGIVAGIPIALGYFPVAVTFGLTAMAMGLKDYEAVLASLLIF
FT                   AGSAQFALATLIDSPINATIVPILLNLRHLIYGCILSKRIKISKPFITAFGLTDEVFAM
FT                   SFKGDNERFIWGLALIAYSAWVSGTVVGVLGGTFIVSNEALHRSLVFAFPALFFILLIP
FT                   NRSWNLISAIFGGLIALILHILGYTSFGILLAGIVSPFVTSTLRRCLE"
FT   sig_peptide     complement(512121..512210)
FT                   /locus_tag="Arcpr_0600"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.863 at
FT                   residue 30"
FT   gene            512307..512870
FT                   /locus_tag="Arcpr_0601"
FT   CDS_pept        512307..512870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0601"
FT                   /product="DNA-directed RNA polymerase"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: hypothetical protein; K03015 DNA-directed RNA
FT                   polymerase II subunit G; TIGRFAM: DNA-directed RNA
FT                   polymerase; PFAM: RNA polymerase Rpb7 domain protein; RNA
FT                   binding S1 domain protein; SMART: RNA binding S1 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57666"
FT                   /db_xref="GOA:D2RH91"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH91"
FT                   /inference="protein motif:TFAM:TIGR00448"
FT                   /protein_id="ADB57666.1"
FT                   /translation="MYARVKVRDVVRVPPNRLNEDLEEVIHDLLWEQFEGKLDTEYGMV
FT                   IGIESVDSIGEGKIVEGDGGVYFDVEFTALTFKPLLQEVVEGEVVEVVEFGAFVSIGPL
FT                   DALLHRSQIMDDYIVYDEKNERLIGKETKRTIEKGDLVRARIVALSLKEKDPSKSKIGL
FT                   TMRQPWLGKLEWIEEEIKKRGEHG"
FT   gene            512863..513051
FT                   /locus_tag="Arcpr_0602"
FT   CDS_pept        512863..513051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0602"
FT                   /product="DNA-directed RNA polymerase subunit E, RpoE2"
FT                   /note="PFAM: DNA-directed RNA polymerase subunit E, RpoE2"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57667"
FT                   /db_xref="GOA:D2RH92"
FT                   /db_xref="InterPro:IPR007178"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="InterPro:IPR038589"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH92"
FT                   /inference="protein motif:PFAM:PF04035"
FT                   /protein_id="ADB57667.1"
FT                   /translation="MAELACKRCKFINVDTEVCVNCGSTELTKEWYGYLIIIDPEKSEI
FT                   AKKLGITKPGKYALQVE"
FT   gene            513051..513623
FT                   /locus_tag="Arcpr_0603"
FT   CDS_pept        513051..513623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0603"
FT                   /product="Protein of unknown function DUF359"
FT                   /note="PFAM: Protein of unknown function DUF359"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57668"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH93"
FT                   /inference="protein motif:PFAM:PF04019"
FT                   /protein_id="ADB57668.1"
FT                   /translation="MLKLTEEVRAFAKKPFGLLYRGEGVDVVKRVLKGDEFLVCVGDIV
FT                   SLTTLKAGFKPKIIVFDGKSIRRELNSVVNRIRDLSRGYKEIVAENPAGCITEDLAEKV
FT                   FEAVNSALEGLNVRIYVRGEEDLAVMPLVALLPNGAVILYGQPNEGVVRVDVNDERKII
FT                   ILSMLERMEKHGKTLEKIRRWSNGGSR"
FT   gene            513607..513936
FT                   /locus_tag="Arcpr_0604"
FT   CDS_pept        513607..513936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0604"
FT                   /product="Ribosomal protein S24e"
FT                   /note="PFAM: Ribosomal protein S24e; KEGG: 40S RIBOSOMAL
FT                   PROTEIN S24; K02974 small subunit ribosomal protein S24e"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57669"
FT                   /db_xref="GOA:D2RH94"
FT                   /db_xref="InterPro:IPR001976"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR018098"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH94"
FT                   /inference="protein motif:PFAM:PF01282"
FT                   /protein_id="ADB57669.1"
FT                   /translation="MEVVVEKDRYNPLLKRREIHARIVYWGEGPTPTRQAVREKFAGLF
FT                   NAELDRIVVDYIKPEFGKQEARCYVKIYDTPEDLRAIEDEHIIRRNFGEETGEQGEGGQ
FT                   VEQAE"
FT   gene            513947..514111
FT                   /locus_tag="Arcpr_0605"
FT   CDS_pept        513947..514111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0605"
FT                   /product="Ribosomal protein S27a"
FT                   /note="PFAM: Ribosomal protein S27a; KEGG: hypothetical
FT                   protein; K02977 small subunit ribosomal protein S27Ae"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57670"
FT                   /db_xref="GOA:D2RH95"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR022845"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH95"
FT                   /inference="protein motif:PFAM:PF01599"
FT                   /protein_id="ADB57670.1"
FT                   /translation="MAKGAECVSKYYEIKGDKVIRKRKFCPRCGEGVFLAEHKDRRTCG
FT                   KCGYTEFKK"
FT   gene            514130..515101
FT                   /locus_tag="Arcpr_0606"
FT   CDS_pept        514130..515101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0606"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: similar to predicted protein; K01409 O-
FT                   sialoglycoprotein endopeptidase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57671"
FT                   /db_xref="GOA:D2RH96"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH96"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADB57671.1"
FT                   /translation="MKALGIEGTAWNLSVAVVDENDVIAMFSDPYIPKEGGIHPREASQ
FT                   HHSEKIGELIKKIFSIVPIEDIDVIAFSQGPGLGPCLRVVATVARFLALKFNKPLVGVN
FT                   HCLAHVEVGRWKTKAKNPVTLYVSGGNSQVIARRGNRYRVFGETLDIGIGNALDKLARH
FT                   MGLSHPGGPKIEELARKGKNYYELPYVVKGMDFSFSGLVTAAQRLYDSGVSKEDVAFSF
FT                   QETAFAMLVEVTERALAYLDLNEVLLVGGVGANRRLQEMLKIMCEDRGARFYAPPKELM
FT                   GDNGAMIAYTGLLMYKHGYVTPLEDSYAKPDFRIESVEILWD"
FT   gene            515516..516064
FT                   /locus_tag="Arcpr_0607"
FT   CDS_pept        515516..516064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57672"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57672.1"
FT                   /translation="MITYKIRRFNIEGFEIRGKKYLSPEEEFLLSKKVFVQEKVDGKFT
FT                   CRDFGDFLILCEDLRDTHTIYYKNLPSRFLGFDVYQKDEGFLEVKEAYKIMLEYGIIPV
FT                   PIIYVGKVDKEMIKNFVLEKNSEFLTEINPKMRDIAKEVAPDIVGKKNFIEGVVVKYYE
FT                   NNRLYAGKAVNPAFEKIGR"
FT   gene            complement(516168..516968)
FT                   /locus_tag="Arcpr_0608"
FT   CDS_pept        complement(516168..516968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0608"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   similar to ubiquitin-activating enzyme E1- domain
FT                   containing 1; K12164 ubiquitin-like modifier- activating
FT                   enzyme 5"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57673"
FT                   /db_xref="GOA:D2RH98"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH98"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADB57673.1"
FT                   /translation="MALPNFSSSSDSTPREFSRLIGLKGWSYEKAREMKVIIVGCGGLG
FT                   NPIARLITRLGIGNLVLIDNDIVEIENLNRDGFEVCDIGKNKAEILKRKLEKIFENHSV
FT                   RIEAIPKNVLEIDLQEIVEEANLVVTATDNTSSRIYVNDICVETNTTMIDTGFTTDGLR
FT                   GHVRLIIPGKTACLRCSYFELPVLDKTNLSDKVDLSMKTGYAVSPAPTLSFLASLAAMI
FT                   AFNVLFEISKPPNYISVNLAEMKFSTANLKRNPRCEICSALDES"
FT   gene            complement(516940..517233)
FT                   /locus_tag="Arcpr_0609"
FT   CDS_pept        complement(516940..517233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57674"
FT                   /db_xref="UniProtKB/TrEMBL:D2RH99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57674.1"
FT                   /translation="MIADSESQLFGVYDLNEEESIIYYRKPRVVSLKYKNKVPLYFFVK
FT                   NAITYSEWFKSVVVNGFLDFEFTNFTVTRNGMKVRLNMEEVVKDGVTEFFLF"
FT   gene            complement(517220..517768)
FT                   /locus_tag="Arcpr_0610"
FT   CDS_pept        complement(517220..517768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0610"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Mov34/MPN/PAD-1 family protein; K09613 COP9
FT                   signalosome complex subunit 5"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57675"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57675.1"
FT                   /translation="MFLLNFCRANCEYVLVSETELLDFYEAAVKAGENEIVGALVGVVT
FT                   DEGYLVLSIFKYKGTSSPVSVTYNQLENSFLPAGLENLGTIHTHVGFGAYLSSTDLANL
FT                   RKSKLNRIALVMDPKKFEIKAFNKNGKQIRLKVVEDHEIFSKVKVKIFYKYGIPFRVYT
FT                   LASADYLEKATVKYHIDSR"
FT   gene            complement(517769..518533)
FT                   /locus_tag="Arcpr_0611"
FT   CDS_pept        complement(517769..518533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57676"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57676.1"
FT                   /translation="MGAIPLILEVDGEEIYVEANPNERLFEVGMRAVPPEKWRESIIAT
FT                   TSGLPVDPGKTVRDIVRETGETRFRVLSEGDQGIIPDFPNFLRNVKVNSPKWNERAREE
FT                   IVRIKMLNNLIGRNNPGFAYVNPAFYTYEGLKTVKGCIRVGSYGSVELLVFLPPAYPLV
FT                   HPEATLRGRFFDKYMASNIHKHVYPFYINGKKIIVVCGDKKYLQNWTGRLGIAHYISDV
FT                   VFPWIRIGYEALGEKSTTLREMSDILRILRGE"
FT   gene            complement(518546..518728)
FT                   /locus_tag="Arcpr_0612"
FT   CDS_pept        complement(518546..518728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57677"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57677.1"
FT                   /translation="MQEDSDFHYFLAIAIPIIEGKVDVPTNLTIPELISFAKQVWTFWV
FT                   VRIKSVIPSIVSLIR"
FT   gene            complement(518746..518886)
FT                   /locus_tag="Arcpr_0613"
FT   CDS_pept        complement(518746..518886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57678"
FT                   /db_xref="GOA:D2RHA3"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57678.1"
FT                   /translation="MNSNLIFAATVAGLLLTVLIVWVLRKIRNRRTARPCEDDIEWWRG
FT                   L"
FT   gene            complement(518892..520079)
FT                   /locus_tag="Arcpr_0614"
FT   CDS_pept        complement(518892..520079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57679"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57679.1"
FT                   /translation="MFVRTVFNIKPESFGKEIYEPPEWRNMWSNGYFLTSVGDESANLV
FT                   TTKLPAILRKYTHLICILADDNVASAVFEKVKHCFRSALVIGLGIDGCGKNAMVGYETI
FT                   RPMSAEISFKINKYLNELKSKYGVVPSTFIELIFAGGTSSGYALAVSNEVKKLVRSIES
FT                   KAQIIDYVSLSRGDYAPQIANSILVTLKLMNEVGDRRSLILSYFDREPTLKKLSDLNIL
FT                   NTIMTLLLSKYKAGINRIDLTDIIGRGGFFTTNTEYRSITHLPRVKSIGGEDIFKLAKR
FT                   AIDFDSTSLYARAVFHARDSELVRISIISPVKIVDLEIFGKEFEFAENIIADGFHLPIK
FT                   YIPISVTAFLKGNEMAIRHFLHNHRKIVDEAIPELENYLGTGLVDDEVLENFVRG"
FT   gene            complement(520085..520867)
FT                   /locus_tag="Arcpr_0615"
FT   CDS_pept        complement(520085..520867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57680"
FT                   /db_xref="GOA:D2RHA5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57680.1"
FT                   /translation="MYWAKFLAVVMAIVILPIACAAEPLVVSAKVRPENPTVGDVVGIY
FT                   VTILGQQDESVQVYTKLKNPTFKVVDVLTKESVPYNTIKSDTIDFKISKGQTVEITIIG
FT                   DMPDAETLAVIFPNAYRIDSPSIQKELTLTPQKTTRDKSTTQSERLQLLKRYGELYAKY
FT                   EKVKSAIPERLQLIIEEKFRIAKSTLEDGQLEEANAILNEIEGLLTVSEPDNSSPILAV
FT                   VILALIAGTAVFVWRYYLANKLPKEEEEFAQTNFRLLR"
FT   sig_peptide     complement(520802..520867)
FT                   /locus_tag="Arcpr_0615"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.892 at
FT                   residue 22"
FT   gene            complement(521014..521319)
FT                   /locus_tag="Arcpr_0616"
FT   CDS_pept        complement(521014..521319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57681"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57681.1"
FT                   /translation="MSDMVDYEEFIEEVFRKIEEDPTRFIVFKALLFAREAIQRDLGSV
FT                   KLEDVEFVLEKFALSCIDYYEFLLKLVLFPRYNKLERFSVQWTYQTEVGRSLKDLS"
FT   gene            complement(521359..521553)
FT                   /locus_tag="Arcpr_0617"
FT   CDS_pept        complement(521359..521553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57682"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57682.1"
FT                   /translation="MWTTDYLRSVDNVVVVRYIADRDISLVKFRYLGKDGYIHRATVVF
FT                   KGKLDKRKALEELSKIFFI"
FT   gene            521807..522223
FT                   /locus_tag="Arcpr_0618"
FT   CDS_pept        521807..522223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57683"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57683.1"
FT                   /translation="MEFGRIIVHNKVHGTEQIKLAPPGGARVRHYIFRIYYDDGSVEKS
FT                   PTFSVGPVGPGGEMKYVHGLIDVEGVILPADIKDDPIHLEYYDEKLKRAKYIIRVNKIN
FT                   RFEIGGWTPSKLSTRQKGIKIIELIEYDTALVEV"
FT   gene            522227..523279
FT                   /locus_tag="Arcpr_0619"
FT   CDS_pept        522227..523279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0619"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57684"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57684.1"
FT                   /translation="MVEEDVFKREYWDNESVNRYLEKLGVSPEQKALYFATTFFGVRDD
FT                   GRYNPQEAIIKEANRIYEMFEGRRGRIDSRTFNKLWETGLLAPVDYFYVDPIILAEGRG
FT                   SKKTWIGIHPWVLELLEEVDKRKQSLDSIFMNIPLKPRPYSPDYNYWFRAKGKYTFITK
FT                   TFYRFMYGYMISNILCSINDDKVANIKIRTLTRTTRIEKDINKIIQYLESNLENINFDV
FT                   RYYHEEKFEILTTLIQSLKDKIEEFITPDSKINRLLNLITSILIKQNNILNNISKIEKI
FT                   WLVEIRRKGEPKEVTFGGNIASYTPGFLETKKYGSTIYVNREDFIKYVQELFNLLDMID
FT                   DEKDELQVLF"
FT   gene            complement(523401..523601)
FT                   /locus_tag="Arcpr_0620"
FT   CDS_pept        complement(523401..523601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57685"
FT                   /db_xref="InterPro:IPR024550"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB57685.1"
FT                   /translation="MQVQMKFMDFEEAVLLAIANGLRTPKDIAKKLNVKLEDVRSVLAN
FT                   LEAQGLVDSKFKMSSAQNQVR"
FT   gene            523650..525317
FT                   /locus_tag="Arcpr_0621"
FT   CDS_pept        523650..525317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0621"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; SMART: Rhodanese domain protein;
FT                   KEGG: gme:Gmet_3484 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57686"
FT                   /db_xref="GOA:D2RHB1"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHB1"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ADB57686.1"
FT                   /translation="MDIVVIGGGACGLKAACRARRRNEEANITVVDASPYPSLGRCGLP
FT                   YYIGGIVHTVDDLRKTLSGTVRDEDYFKKVKNIDVLTRTRAVKIDREKRIVKIVKPDGS
FT                   EDELNYDYLVLATGARPIRLDIPNADADGVTTLFNPEDAEKILDMWDEGILEKAVIIGG
FT                   GLIGMETAEALSNLDVEVTIVEIMDYILPALLDREMAMLVESYLREKGINVMTKSTVTE
FT                   ILTKDGRVSGVKINGTKEVPCDLVLMAVGVRPNVDLAVDCSLEVSKFGIKVDEYLRTSD
FT                   ERIFAGGDCVENKFLVTGDPIYTPMGSVANKHGRVIGDNITGGSSRFPGVLGTTIFKIF
FT                   DLNVARTGLTEKRARELGYDVVTCLVPGPDRAHYYPHQKPIRIKLIADRKTGRILGAQI
FT                   VGWGVVDKRIDVVVSAMHMNATVHDLANFDLAYAPPYAPAIDTLIHAANTVRNKMDGLL
FT                   ETISSFELKEKLDKGEDFVILDIRYEDEVRKFKRIEDSRVVHIPYNELRERYKELPMDK
FT                   EIVIICQIGNRAYDVYRFLKSKGFNCKVLDGGLAFWFW"
FT   gene            525501..526385
FT                   /locus_tag="Arcpr_0622"
FT   CDS_pept        525501..526385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0622"
FT                   /product="Lactate/malate dehydrogenase"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   afw:Anae109_2185 malate dehydrogenase, NAD- dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57687"
FT                   /db_xref="GOA:D2RHB2"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHB2"
FT                   /inference="protein motif:PFAM:PF00056"
FT                   /protein_id="ADB57687.1"
FT                   /translation="MKLGFVGAGRIGSTTAFTCIQHLDLDEVVLVDIVEDLAVGEAMDL
FT                   SHAIVGLDKYAKIVGGSDYSLLKGCDLIVVSAGLARKPGMTRLDLAKKNAEIMRSVAKN
FT                   IVKHASDSKILVVTNPLDVMTYVMWKETGKDRREVFGMGSLLDTVRLKERIIALGGKPR
FT                   RIFMMGEHGDSMFCPKSLAEVEGEVDLDRAIEETRGVAMEVIKRKGATFYAPAVCIYRM
FT                   VKAVLEDTKEEIPTSVVLQGEYGISDVALGVPAILGRDGVERIVEYDLTDEEKAMLMKS
FT                   AEILKERLKELGY"
FT   gene            526603..526675
FT                   /locus_tag="Arcpr_R0016"
FT                   /note="tRNA-Arg3"
FT   tRNA            526603..526675
FT                   /locus_tag="Arcpr_R0016"
FT                   /product="tRNA-Arg"
FT   gene            526780..527775
FT                   /locus_tag="Arcpr_0623"
FT   CDS_pept        526780..527775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0623"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745; KEGG:
FT                   sde:Sde_3362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57688"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHB3"
FT                   /inference="protein motif:PFAM:PF08495"
FT                   /protein_id="ADB57688.1"
FT                   /translation="MWAELVKVDEIGDLDAVSLIIFASDSCYEELREQFGNIKAKNVFG
FT                   AVFPGVIFDGKKYEDRAIALRFDFEISGFRGCVPADVKAETLLTLADGFHENVESTLEN
FT                   VYFKLGNTVKYLGGGAGSLNRRIDCLFDKDGFFSNDVLFVSLPFDCNIAVRHGWQETGY
FT                   SFVSTRTSGRKILELDWTPAFEAYKDILAQFDIEISRKNFFDVAMAYPFGISKICGEDI
FT                   IRDPLYLDKSSIICAGKVPRNHILKLMRGEKDRLVEAARECAEAVEGNVSFDCISRVLY
FT                   LGDEFKREARHLKGTFGALTIGEIACSRGIVEFFNKTLVVGGIHEKVYLA"
FT   gene            527753..529321
FT                   /locus_tag="Arcpr_0624"
FT   CDS_pept        527753..529321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0624"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bph:Bphy_1143 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; PAS fold-3 domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57689"
FT                   /db_xref="GOA:D2RHB4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHB4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB57689.1"
FT                   /translation="MKKYTLHEKGKLITTLLDLSTFIRPGKPESIVINFGKELMRRFGL
FT                   TYFEAEVPIINFKVRIPEVAECNQPVEYVGSTIRLRFEGDIRDIHIKALRPLFEELDDI
FT                   LAHTIFHDVLTKMLEFSQDIIFVVDENGRVVEMNKKARETFGSVEKLPEALDKDICDCG
FT                   GKTYSIAAYDLGNLKVVVGRDITEIKRLEESAREGEERFRRLAEAVPVAVFAYQKDGLI
FT                   FVNKAAEYLTGYSRDELIREAFWNIFPEEEVEKVKRAMKSRLRGEVVEPYKLKIRRKDG
FT                   SERIVRVHGTTISWNRERTGIATLLDITDLEEERRKLEELSKMLSLINRILRHDVLNAI
FT                   TSAVGYLELYKETRDESLLEKVAISLERCANVVRTMKSFEEMVSEGKLRIVNVGKIAED
FT                   VAKSFVIPVNIEGDCEVVADEGLRAVIENIVQNAIQHGKTDRVDIRISRVHDYCEIRIA
FT                   DYGKGIPDEIKSRIFEEGFTYGESAGTGMGLYIAERIVERYGGKIWVEDNEPQGTTFVI
FT                   RLKSP"
FT   gene            529351..529524
FT                   /locus_tag="Arcpr_0625"
FT   CDS_pept        529351..529524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Arcpr_0625"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dds:Ddes_0889 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Arcpr_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADB57690"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D2RHB5"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADB57690.1"
FT                   /translation="MIWIDYEKCTNCKKCLHCPQGVFEDVGYIIVANPEYCNGCCYCVQ
FT                   VCEVEAVHVDEC"
FT   gene            529558..530139
FT                   /locus_tag="Arcpr_0626"
FT