(data stored in ACNUC7421 zone)

EMBL: CP001860

ID   CP001860; SV 1; circular; genomic DNA; STD; PRO; 3889038 BP.
XX
AC   CP001860;
XX
PR   Project:PRJNA30411;
XX
DT   21-JAN-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Haloterrigena turkmenica DSM 5511, complete genome.
XX
KW   .
XX
OS   Haloterrigena turkmenica DSM 5511
OC   Archaea; Euryarchaeota; Stenosarchaea group; Halobacteria; Natrialbales;
OC   Natrialbaceae; Haloterrigena.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-3889038
RX   DOI; 10.4056/sigs.681272.
RX   PUBMED; 21304683.
RA   Saunders E., Tindall B.J., Fahnrich R., Lapidus A., Copeland A.,
RA   Del Rio T.G., Lucas S., Chen F., Tice H., Cheng J.F., Han C., Detter J.C.,
RA   Bruce D., Goodwin L., Chain P., Pitluck S., Pati A., Ivanova N.,
RA   Mavromatis K., Chen A., Palaniappan K., Land M., Hauser L., Chang Y.J.,
RA   Jeffries C.D., Brettin T., Rohde M., Goker M., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Klenk H.P., Kyrpides N.C.;
RT   "Complete genome sequence of Haloterrigena turkmenica type strain (4k)";
RL   Stand Genomic Sci 2(1):107-116(2010).
XX
RN   [2]
RP   1-3889038
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Saunders E., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Tindal B., Fahnrich R., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (11-JAN-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1cde5d362544f54c3fc7bf2ce1c0cce1.
DR   BioSample; SAMN02598471.
DR   CABRI; DSM 5511.
DR   EnsemblGenomes-Gn; EBG00001446343.
DR   EnsemblGenomes-Gn; EBG00001446344.
DR   EnsemblGenomes-Gn; EBG00001446345.
DR   EnsemblGenomes-Gn; EBG00001446346.
DR   EnsemblGenomes-Gn; EBG00001446347.
DR   EnsemblGenomes-Gn; EBG00001446348.
DR   EnsemblGenomes-Gn; EBG00001446349.
DR   EnsemblGenomes-Gn; EBG00001446350.
DR   EnsemblGenomes-Gn; EBG00001446351.
DR   EnsemblGenomes-Gn; EBG00001446352.
DR   EnsemblGenomes-Gn; EBG00001446353.
DR   EnsemblGenomes-Gn; EBG00001446354.
DR   EnsemblGenomes-Gn; EBG00001446355.
DR   EnsemblGenomes-Gn; EBG00001446356.
DR   EnsemblGenomes-Gn; EBG00001446357.
DR   EnsemblGenomes-Gn; EBG00001446358.
DR   EnsemblGenomes-Gn; EBG00001446359.
DR   EnsemblGenomes-Gn; EBG00001446360.
DR   EnsemblGenomes-Gn; EBG00001446361.
DR   EnsemblGenomes-Gn; EBG00001446362.
DR   EnsemblGenomes-Gn; EBG00001446363.
DR   EnsemblGenomes-Gn; EBG00001446364.
DR   EnsemblGenomes-Gn; EBG00001446365.
DR   EnsemblGenomes-Gn; EBG00001446366.
DR   EnsemblGenomes-Gn; EBG00001446367.
DR   EnsemblGenomes-Gn; EBG00001446368.
DR   EnsemblGenomes-Gn; EBG00001446369.
DR   EnsemblGenomes-Gn; EBG00001446370.
DR   EnsemblGenomes-Gn; EBG00001446371.
DR   EnsemblGenomes-Gn; EBG00001446372.
DR   EnsemblGenomes-Gn; EBG00001446373.
DR   EnsemblGenomes-Gn; EBG00001446374.
DR   EnsemblGenomes-Gn; EBG00001446375.
DR   EnsemblGenomes-Gn; EBG00001446376.
DR   EnsemblGenomes-Gn; EBG00001446377.
DR   EnsemblGenomes-Gn; EBG00001446378.
DR   EnsemblGenomes-Gn; EBG00001446379.
DR   EnsemblGenomes-Gn; EBG00001446380.
DR   EnsemblGenomes-Gn; EBG00001446381.
DR   EnsemblGenomes-Gn; EBG00001446382.
DR   EnsemblGenomes-Gn; EBG00001446383.
DR   EnsemblGenomes-Gn; EBG00001446384.
DR   EnsemblGenomes-Gn; EBG00001446385.
DR   EnsemblGenomes-Gn; EBG00001446386.
DR   EnsemblGenomes-Gn; EBG00001446387.
DR   EnsemblGenomes-Gn; EBG00001446388.
DR   EnsemblGenomes-Gn; EBG00001446389.
DR   EnsemblGenomes-Gn; EBG00001446390.
DR   EnsemblGenomes-Gn; EBG00001446391.
DR   EnsemblGenomes-Gn; EBG00001446393.
DR   EnsemblGenomes-Gn; EBG00001446394.
DR   EnsemblGenomes-Gn; EBG00001446395.
DR   EnsemblGenomes-Gn; EBG00001446396.
DR   EnsemblGenomes-Gn; EBG00001446397.
DR   EnsemblGenomes-Gn; EBG00001446398.
DR   EnsemblGenomes-Gn; EBG00001446399.
DR   EnsemblGenomes-Gn; EBG00001446402.
DR   EnsemblGenomes-Gn; EBG00001446403.
DR   EnsemblGenomes-Gn; EBG00001446404.
DR   EnsemblGenomes-Gn; EBG00001446405.
DR   EnsemblGenomes-Gn; EBG00001446406.
DR   EnsemblGenomes-Gn; EBG00001446407.
DR   EnsemblGenomes-Gn; EBG00001446408.
DR   EnsemblGenomes-Gn; EBG00001446409.
DR   EnsemblGenomes-Gn; Htur_R0001.
DR   EnsemblGenomes-Gn; Htur_R0002.
DR   EnsemblGenomes-Gn; Htur_R0003.
DR   EnsemblGenomes-Gn; Htur_R0004.
DR   EnsemblGenomes-Gn; Htur_R0005.
DR   EnsemblGenomes-Gn; Htur_R0006.
DR   EnsemblGenomes-Gn; Htur_R0007.
DR   EnsemblGenomes-Gn; Htur_R0008.
DR   EnsemblGenomes-Gn; Htur_R0009.
DR   EnsemblGenomes-Gn; Htur_R0010.
DR   EnsemblGenomes-Gn; Htur_R0011.
DR   EnsemblGenomes-Gn; Htur_R0012.
DR   EnsemblGenomes-Gn; Htur_R0013.
DR   EnsemblGenomes-Gn; Htur_R0014.
DR   EnsemblGenomes-Gn; Htur_R0015.
DR   EnsemblGenomes-Gn; Htur_R0016.
DR   EnsemblGenomes-Gn; Htur_R0017.
DR   EnsemblGenomes-Gn; Htur_R0018.
DR   EnsemblGenomes-Gn; Htur_R0019.
DR   EnsemblGenomes-Gn; Htur_R0020.
DR   EnsemblGenomes-Gn; Htur_R0021.
DR   EnsemblGenomes-Gn; Htur_R0022.
DR   EnsemblGenomes-Gn; Htur_R0023.
DR   EnsemblGenomes-Gn; Htur_R0024.
DR   EnsemblGenomes-Gn; Htur_R0025.
DR   EnsemblGenomes-Gn; Htur_R0026.
DR   EnsemblGenomes-Gn; Htur_R0027.
DR   EnsemblGenomes-Gn; Htur_R0028.
DR   EnsemblGenomes-Gn; Htur_R0029.
DR   EnsemblGenomes-Gn; Htur_R0030.
DR   EnsemblGenomes-Gn; Htur_R0031.
DR   EnsemblGenomes-Gn; Htur_R0032.
DR   EnsemblGenomes-Gn; Htur_R0033.
DR   EnsemblGenomes-Gn; Htur_R0034.
DR   EnsemblGenomes-Gn; Htur_R0035.
DR   EnsemblGenomes-Gn; Htur_R0036.
DR   EnsemblGenomes-Gn; Htur_R0037.
DR   EnsemblGenomes-Gn; Htur_R0038.
DR   EnsemblGenomes-Gn; Htur_R0039.
DR   EnsemblGenomes-Gn; Htur_R0040.
DR   EnsemblGenomes-Gn; Htur_R0041.
DR   EnsemblGenomes-Gn; Htur_R0042.
DR   EnsemblGenomes-Gn; Htur_R0043.
DR   EnsemblGenomes-Gn; Htur_R0044.
DR   EnsemblGenomes-Gn; Htur_R0045.
DR   EnsemblGenomes-Gn; Htur_R0046.
DR   EnsemblGenomes-Gn; Htur_R0047.
DR   EnsemblGenomes-Gn; Htur_R0048.
DR   EnsemblGenomes-Gn; Htur_R0049.
DR   EnsemblGenomes-Gn; Htur_R0050.
DR   EnsemblGenomes-Gn; Htur_R0051.
DR   EnsemblGenomes-Gn; Htur_R0052.
DR   EnsemblGenomes-Gn; Htur_R0053.
DR   EnsemblGenomes-Gn; Htur_R0054.
DR   EnsemblGenomes-Gn; Htur_R0055.
DR   EnsemblGenomes-Gn; Htur_R0056.
DR   EnsemblGenomes-Gn; Htur_R0057.
DR   EnsemblGenomes-Gn; Htur_R0058.
DR   EnsemblGenomes-Gn; Htur_R0059.
DR   EnsemblGenomes-Gn; Htur_R0060.
DR   EnsemblGenomes-Gn; Htur_R0061.
DR   EnsemblGenomes-Gn; Htur_R0062.
DR   EnsemblGenomes-Gn; Htur_R0063.
DR   EnsemblGenomes-Gn; Htur_R0064.
DR   EnsemblGenomes-Tr; EBT00001600052.
DR   EnsemblGenomes-Tr; EBT00001600054.
DR   EnsemblGenomes-Tr; EBT00001600055.
DR   EnsemblGenomes-Tr; EBT00001600057.
DR   EnsemblGenomes-Tr; EBT00001600058.
DR   EnsemblGenomes-Tr; EBT00001600060.
DR   EnsemblGenomes-Tr; EBT00001600063.
DR   EnsemblGenomes-Tr; EBT00001600065.
DR   EnsemblGenomes-Tr; EBT00001600066.
DR   EnsemblGenomes-Tr; EBT00001600069.
DR   EnsemblGenomes-Tr; EBT00001600071.
DR   EnsemblGenomes-Tr; EBT00001600072.
DR   EnsemblGenomes-Tr; EBT00001600074.
DR   EnsemblGenomes-Tr; EBT00001600075.
DR   EnsemblGenomes-Tr; EBT00001600076.
DR   EnsemblGenomes-Tr; EBT00001600077.
DR   EnsemblGenomes-Tr; EBT00001600078.
DR   EnsemblGenomes-Tr; EBT00001600079.
DR   EnsemblGenomes-Tr; EBT00001600080.
DR   EnsemblGenomes-Tr; EBT00001600081.
DR   EnsemblGenomes-Tr; EBT00001600082.
DR   EnsemblGenomes-Tr; EBT00001600083.
DR   EnsemblGenomes-Tr; EBT00001600084.
DR   EnsemblGenomes-Tr; EBT00001600085.
DR   EnsemblGenomes-Tr; EBT00001600086.
DR   EnsemblGenomes-Tr; EBT00001600087.
DR   EnsemblGenomes-Tr; EBT00001600088.
DR   EnsemblGenomes-Tr; EBT00001600089.
DR   EnsemblGenomes-Tr; EBT00001600090.
DR   EnsemblGenomes-Tr; EBT00001600091.
DR   EnsemblGenomes-Tr; EBT00001600093.
DR   EnsemblGenomes-Tr; EBT00001600094.
DR   EnsemblGenomes-Tr; EBT00001600095.
DR   EnsemblGenomes-Tr; EBT00001600096.
DR   EnsemblGenomes-Tr; EBT00001600097.
DR   EnsemblGenomes-Tr; EBT00001600098.
DR   EnsemblGenomes-Tr; EBT00001600100.
DR   EnsemblGenomes-Tr; EBT00001600101.
DR   EnsemblGenomes-Tr; EBT00001600102.
DR   EnsemblGenomes-Tr; EBT00001600103.
DR   EnsemblGenomes-Tr; EBT00001600104.
DR   EnsemblGenomes-Tr; EBT00001600105.
DR   EnsemblGenomes-Tr; EBT00001600106.
DR   EnsemblGenomes-Tr; EBT00001600107.
DR   EnsemblGenomes-Tr; EBT00001600108.
DR   EnsemblGenomes-Tr; EBT00001600109.
DR   EnsemblGenomes-Tr; EBT00001600110.
DR   EnsemblGenomes-Tr; EBT00001600111.
DR   EnsemblGenomes-Tr; EBT00001600112.
DR   EnsemblGenomes-Tr; EBT00001600113.
DR   EnsemblGenomes-Tr; EBT00001600114.
DR   EnsemblGenomes-Tr; EBT00001600115.
DR   EnsemblGenomes-Tr; EBT00001600116.
DR   EnsemblGenomes-Tr; EBT00001600117.
DR   EnsemblGenomes-Tr; EBT00001600118.
DR   EnsemblGenomes-Tr; EBT00001600119.
DR   EnsemblGenomes-Tr; EBT00001600120.
DR   EnsemblGenomes-Tr; EBT00001600121.
DR   EnsemblGenomes-Tr; EBT00001600123.
DR   EnsemblGenomes-Tr; EBT00001600124.
DR   EnsemblGenomes-Tr; EBT00001600125.
DR   EnsemblGenomes-Tr; EBT00001600126.
DR   EnsemblGenomes-Tr; EBT00001600127.
DR   EnsemblGenomes-Tr; EBT00001600128.
DR   EnsemblGenomes-Tr; Htur_R0001-1.
DR   EnsemblGenomes-Tr; Htur_R0002-1.
DR   EnsemblGenomes-Tr; Htur_R0003-1.
DR   EnsemblGenomes-Tr; Htur_R0004-1.
DR   EnsemblGenomes-Tr; Htur_R0005-1.
DR   EnsemblGenomes-Tr; Htur_R0006-1.
DR   EnsemblGenomes-Tr; Htur_R0007-1.
DR   EnsemblGenomes-Tr; Htur_R0008-1.
DR   EnsemblGenomes-Tr; Htur_R0009-1.
DR   EnsemblGenomes-Tr; Htur_R0010-1.
DR   EnsemblGenomes-Tr; Htur_R0011-1.
DR   EnsemblGenomes-Tr; Htur_R0012-1.
DR   EnsemblGenomes-Tr; Htur_R0013-1.
DR   EnsemblGenomes-Tr; Htur_R0014-1.
DR   EnsemblGenomes-Tr; Htur_R0015-1.
DR   EnsemblGenomes-Tr; Htur_R0016-1.
DR   EnsemblGenomes-Tr; Htur_R0017-1.
DR   EnsemblGenomes-Tr; Htur_R0018-1.
DR   EnsemblGenomes-Tr; Htur_R0019-1.
DR   EnsemblGenomes-Tr; Htur_R0020-1.
DR   EnsemblGenomes-Tr; Htur_R0021-1.
DR   EnsemblGenomes-Tr; Htur_R0022-1.
DR   EnsemblGenomes-Tr; Htur_R0023-1.
DR   EnsemblGenomes-Tr; Htur_R0024-1.
DR   EnsemblGenomes-Tr; Htur_R0025-1.
DR   EnsemblGenomes-Tr; Htur_R0026-1.
DR   EnsemblGenomes-Tr; Htur_R0027-1.
DR   EnsemblGenomes-Tr; Htur_R0028-1.
DR   EnsemblGenomes-Tr; Htur_R0029-1.
DR   EnsemblGenomes-Tr; Htur_R0030-1.
DR   EnsemblGenomes-Tr; Htur_R0031-1.
DR   EnsemblGenomes-Tr; Htur_R0032-1.
DR   EnsemblGenomes-Tr; Htur_R0033-1.
DR   EnsemblGenomes-Tr; Htur_R0034-1.
DR   EnsemblGenomes-Tr; Htur_R0035-1.
DR   EnsemblGenomes-Tr; Htur_R0036-1.
DR   EnsemblGenomes-Tr; Htur_R0037-1.
DR   EnsemblGenomes-Tr; Htur_R0038-1.
DR   EnsemblGenomes-Tr; Htur_R0039-1.
DR   EnsemblGenomes-Tr; Htur_R0040-1.
DR   EnsemblGenomes-Tr; Htur_R0041-1.
DR   EnsemblGenomes-Tr; Htur_R0042-1.
DR   EnsemblGenomes-Tr; Htur_R0043-1.
DR   EnsemblGenomes-Tr; Htur_R0044-1.
DR   EnsemblGenomes-Tr; Htur_R0045-1.
DR   EnsemblGenomes-Tr; Htur_R0046-1.
DR   EnsemblGenomes-Tr; Htur_R0047-1.
DR   EnsemblGenomes-Tr; Htur_R0048-1.
DR   EnsemblGenomes-Tr; Htur_R0049-1.
DR   EnsemblGenomes-Tr; Htur_R0050-1.
DR   EnsemblGenomes-Tr; Htur_R0051-1.
DR   EnsemblGenomes-Tr; Htur_R0052-1.
DR   EnsemblGenomes-Tr; Htur_R0053-1.
DR   EnsemblGenomes-Tr; Htur_R0054-1.
DR   EnsemblGenomes-Tr; Htur_R0055-1.
DR   EnsemblGenomes-Tr; Htur_R0056-1.
DR   EnsemblGenomes-Tr; Htur_R0057-1.
DR   EnsemblGenomes-Tr; Htur_R0058-1.
DR   EnsemblGenomes-Tr; Htur_R0059-1.
DR   EnsemblGenomes-Tr; Htur_R0060-1.
DR   EnsemblGenomes-Tr; Htur_R0061-1.
DR   EnsemblGenomes-Tr; Htur_R0062-1.
DR   EnsemblGenomes-Tr; Htur_R0063-1.
DR   EnsemblGenomes-Tr; Htur_R0064-1.
DR   EuropePMC; PMC3404096; 22848480.
DR   EuropePMC; PMC3570448; 23374508.
DR   EuropePMC; PMC3783009; 24003073.
DR   EuropePMC; PMC5333441; 28265340.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02163; sR-tMet.
DR   SILVA-LSU; CP001860.
DR   SILVA-SSU; CP001860.
DR   StrainInfo; 159228; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082988
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC     David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Haloterrigena turkmenica VKM, DSM 5511
CC   Culture Collection ID :: DSM 5511, VKM B-1734
CC   GOLD Stamp ID         :: Gi02245
CC   Greengenes ID         :: 665
CC   Funding Program       :: DOE-GEBA 2007
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3889038
FT                   /organism="Haloterrigena turkmenica DSM 5511"
FT                   /strain="DSM 5511"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Haloterrigena turkmenica"
FT                   /db_xref="taxon:543526"
FT   gene            155..2011
FT                   /locus_tag="Htur_0001"
FT   CDS_pept        155..2011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0001"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="KEGG: Cdc6; cell division cycle 6 homolog (S.
FT                   cerevisiae); K02213 cell division control protein 6;
FT                   TIGRFAM: orc1/cdc6 family replication initiation protein;
FT                   PFAM: CDC6 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58902"
FT                   /db_xref="GOA:D2RSS8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSS8"
FT                   /inference="protein motif:TFAM:TIGR02928"
FT                   /protein_id="ADB58902.1"
FT                   /translation="MSDDDSERTRADEVEQVDTDETGGFSSFDGSELADEEPSQGLFDD
FT                   LLSGEPIFENKEVLRPSYTPHELPHRSDQINKMATILVAALRGETPSNILIYGKTGTGK
FT                   TASAKFVSKELESTSQKYSVPCDVEYINCEVTDTQYRVLAQLANKFIEKNEARIDDRID
FT                   DLESLLEAVDEYEATSADADAAVRSEIEGDRVDEDDPFESVLPDDDESASTGTETGPAS
FT                   DESPLETEGSSNEAGGPSNAAIDDSDPTRRNDPNRLPADGDAQRPDDDFNREATDLDRS
FT                   DTGSSDGRSDDGSPNHPLASTPFDSREGVEAEIESLEADKESFEEVPMTGWPTDRVYSV
FT                   FFDAVDYDERVVVIMLDEIDKLVEKSGDDTLYNLSRMNSELENSRVSIIGISNDLKFTD
FT                   FLDPRVKSSLGEEEIVFPPYDANQLRDILEHRSEVAFKGGALSEDVIPLCAAFAAQEHG
FT                   DARRALDLLRTAGELAERSQAETIVEEHVREAQDKIELDRVVEVVRTLPTQSKLVLFAI
FT                   ILLEKNGVHSINTGEVFNIYKRLCEEIDADVLTQRRVTDLISELDMLGIVNAVVVSKGR
FT                   YGRTKEISLSVPLEETEAVLLSDSRLSDIDDVQPFVQARFEN"
FT   gene            2110..2637
FT                   /locus_tag="Htur_0002"
FT   CDS_pept        2110..2637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0002"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58903"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58903.1"
FT                   /translation="MFETAPGSNDASIYLESLPLHMNRRAVIAGAGSATLLALAGCVFV
FT                   DGKVEADRGDIAVVIDGEPIDLSADRFQSEHVENDSIEFHLHEDTDDWFMEGEEPVTFA
FT                   EGIDLLPHFAYAQRDGAHVVTIDGTTYDGSESGTELVFLVDDDPIDPTDYVVSDGDDLR
FT                   LEITTDADVGDE"
FT   gene            complement(2975..3934)
FT                   /locus_tag="Htur_0003"
FT   CDS_pept        complement(2975..3934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0003"
FT                   /product="Signal peptidase I-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58904"
FT                   /db_xref="GOA:D2RST0"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST0"
FT                   /inference="protein motif:COG:COG0681"
FT                   /protein_id="ADB58904.1"
FT                   /translation="MSGSSPGDVSDDPDDTPDSNRPDDRERYRGDRDAAADPNSRRDGS
FT                   AAATTASDDGVTIEDDGVVRWFLRSDDENVLFVRDVLSSVAIVAVIGLILFGVSGVWPP
FT                   LVAVESPSMTPNMKTGDLIFVAEDERFVGDGAVAGTGVVTLESGQESGYEKFNNPGDVI
FT                   VFQPNGNERRTPIIHRAHFRVEEGENWVETKANEDIAGDITCEDITTCPAPHDGFVTKG
FT                   DANSNYDQIAGGATTTVVKSEWVTGKAMFRVPWLGNIRLTFDKLLGGILAPSPGPAIDG
FT                   ASSPATPDAPVSPAALAGATGLAACGGGAVTAIGRRRN"
FT   gene            4164..5717
FT                   /locus_tag="Htur_0004"
FT   CDS_pept        4164..5717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0004"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: metallophosphoesterase; DNA polymerase epsilon
FT                   subunit B; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58905"
FT                   /db_xref="GOA:D2RST1"
FT                   /db_xref="InterPro:IPR007185"
FT                   /db_xref="InterPro:IPR011149"
FT                   /db_xref="InterPro:IPR024826"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST1"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADB58905.1"
FT                   /translation="MPLEASARIVSELTSRGYNAEREAVTKLASAENPQAALERVVEDL
FT                   PEDALVVRTDHVDSTLLRGNSTGPNADAASDSPADPAVSTGDATTDPPATGGDVPVETK
FT                   GGGGADRSVDPALRSLEIAGDMTGQSTGTGEYEDFVAVFRDRLERLGSKLRGRVNHRPA
FT                   SAIQNMPGGSDVAMVGLVNDIRSTASGHWLIELEDATGTFPWLVMKDREYVDLVDELLC
FT                   DEVLAMEGTLADDSGIAFVDSMYFPDIPRTHEPSTADRHVQAALISDVHVGSDEFMAEA
FT                   WNRFADWLHTEQAQHVEYLLLAGDMVEGVGVYPDQDEELEIVDIYEQYEAFSEHLKKIP
FT                   GDIEIVMIPGNHDAVRLAEPQPGFDEELREIMSAHDPQIVSNPSTVTLEGVSVLMYHGV
FT                   SLDEVIAELPEEKASYDDPHKAMYQLLKKRHVAPQFGGHTRLAPEERDYLVMEEVPDIF
FT                   HTGHVHKLGFGKYHNVLAINSGCWQAQTDFQKSVNIDPDAGYAPIVDLDTLDVTVQKFS
FT                   "
FT   gene            complement(6133..6519)
FT                   /locus_tag="Htur_0005"
FT   CDS_pept        complement(6133..6519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0005"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   avn:Avin_46430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58906"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST2"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADB58906.1"
FT                   /translation="MSRPVEGETHTFERTFTTDDVERFAELSRDRQAIHTEPDDDGRLM
FT                   VHGLLTATLPTKIGGDLEVLARSMDLEFRRPVYTGQRIACTWTFESVEEREDRYAIGVN
FT                   VVCERAGDEPVLTGTVEGLIWKDG"
FT   gene            6681..7583
FT                   /locus_tag="Htur_0006"
FT   CDS_pept        6681..7583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0006"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mxa:MXAN_1379
FT                   amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58907"
FT                   /db_xref="GOA:D2RST3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST3"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADB58907.1"
FT                   /translation="MPVSDRSTDADDRATAFRPAIDAHTHLFPDRLAAAIQRTLSAETD
FT                   WEFSTPTARADIEDVLRSAGVEAYVTLPYAHEPGLASDLNDWLLEQAADSDFLIPFATV
FT                   HPDDEEPAAVVREAFEAGARGLKIHCPVQECRPADSRLEPALEVAAAYDRPITYHGGTA
FT                   PMYEGSPYVGADVFEELLESYPGLRVCCAHMGTYETDRFLAFAREYDGVYLDTTFAMST
FT                   SAPETMGFDPSSISDATLVECSGSIMYGSDFPNIPYPYRNERAGLLERDLPQETARDIF
FT                   YRTACEYLGLEGDAMLNPD"
FT   gene            complement(7674..8141)
FT                   /locus_tag="Htur_0007"
FT   CDS_pept        complement(7674..8141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0007"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   ret:RHE_PC00061 putative amine oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58908"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST4"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADB58908.1"
FT                   /translation="MTGLYYEEFEVGETIEHERRRTITESDNQRFCDMTMNQQPLHLDA
FT                   DFAMDTDFGERLVNGLYTMSLAVGITIPETTDGTIVANLSYDNVEHPEPVFHGDTIRVQ
FT                   STVTDKRETSDGERGIVTMHVEVFKVNEPDEPLVCEFDRTALSLKRKHAED"
FT   gene            complement(8145..9968)
FT                   /locus_tag="Htur_0008"
FT   CDS_pept        complement(8145..9968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0008"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: mxa:MXAN_3759
FT                   carboxyl transferase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58909"
FT                   /db_xref="GOA:D2RST5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST5"
FT                   /inference="protein motif:PRIAM:6.4.1.3"
FT                   /protein_id="ADB58909.1"
FT                   /translation="MELRVNTAATDQEAQAIAKALASHFGEEVELYPKRGDDLLATAAP
FT                   DESEILTDASEAAAEAIDAAAAGDGGSKNAASSGDDLGPTDREATLREEIDDILEGGPE
FT                   KYRDRLSEQGKLFVRDRLDLWFGENGLQFEDGKFANFDSWHPSGREGEAESGDRLPADG
FT                   LITGAAEFEGRDVHFMANDFTVKAGSMAEKGVEKFLRMQQRALKTGKPVLYLMDSSGGR
FT                   IDQQTGFFANREGIGKYYYNHSMLSGRVPQICVLYGPCIAGAAYTPVFADFTVMVRDMS
FT                   AMAIASPRMVEMVTGEEIDLDELGGPDVHARHSGSADLIAEDEEHARELVAKLIGYLPD
FT                   NADEKPPQTEGRAPERSPAGIDSVVPQAPNRGYDMFDVIERVVDADSVLELRPEYGSEI
FT                   ITAFARIDGRPVGIVANQPKQRAGAIFPDAAEKAAQFIWTCDAYDVPLLYLCDTPGFMA
FT                   GSGVEKEGILEQGKRMIYATSSATVPKQSVVVRKAYGAGIYAMSGPAYDPESVLGLPSG
FT                   EIAIMGPEAAINAVYANKLAAIDDPEERAQKEQELREEYREDIDVHRMASEVIIDEIVP
FT                   PSELRDELEARFAFYETVEKDLPDKKHGTIL"
FT   gene            complement(9979..10077)
FT                   /locus_tag="Htur_0009"
FT   CDS_pept        complement(9979..10077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58910"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58910.1"
FT                   /translation="MLEREPDGRPTATSQVAIIATADKNAPLVEPT"
FT   gene            complement(10080..11246)
FT                   /locus_tag="Htur_0010"
FT   CDS_pept        complement(10080..11246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0010"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bam:Bamb_1567
FT                   acyl-CoA dehydrogenase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58911"
FT                   /db_xref="GOA:D2RST7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB58911.1"
FT                   /translation="MNFEDTQERKLIRQTATEIADRYGPEHWREKEEAGEFSTEFWDEL
FT                   GEAGFHGLLVPEEYDGAGMGMEEMGLAMETLCAEGCGMAGTWYLVLTAGMAAVGLREYG
FT                   TDEQKERYLTDIATGERNFSIAITEPEAGTNTLNVATRAERDGDEYVLNGKKAWITFSD
FT                   RADNMILVTRTTPRDEVERGTDGISLFVVDMDDPNIDVSPIPKHAINYSKSCEVFIEDV
FT                   RVPAENLLGDEDDGWWVLVDMLNPERIGFAAAGTGIGKLAANAAIEYSNDREIFGAPIG
FT                   THQAVSFPITEAYAKMETAALMREKAAWLYDQGEECGYETNVAKATAVDAGIEAVKHAM
FT                   QAFGGWGYAKEYDVERWWREINLTRLAPVSQQMAYNHIGQQLGFPKSY"
FT   gene            complement(11336..13018)
FT                   /locus_tag="Htur_0011"
FT   CDS_pept        complement(11336..13018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0011"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dps:DP2097 acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58912"
FT                   /db_xref="GOA:D2RST8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB58912.1"
FT                   /translation="MVSEHNMPDYEQVCDGFAWEDIEEAADWDAPGELNVAHEVCDRHA
FT                   ENKEKVALYQVSEDGELTTTTFWELAEATNRFANVLEDLGIERGDRVFSYMPRIPEHYV
FT                   ALIGTLKRGAVFGGINERFGPDGISYRLSDCDATAIVTTADNRDTVADALENAPSVEHV
FT                   IVVSDDGRGLRRGDVSYRAAMETASREYEPADTGAEDDALLYYTSGTTGLAKGVLHEHR
FT                   WVLGVAATQKYAVDLQEGDCYWSTGDLGWLTGPINTLGAWFWGTALFTYEGEFDPETWA
FT                   DLLDTYPISVLFSVPTAYRMLREHEDVLEDVSLDLRHALSIGEPLSAGVVEWGEETLGV
FT                   TVHDTYGQTETGNMIINNYPTMEVRPGSMGKPLPGIEAAVVDPETGEVLEPGETGEIAQ
FT                   RGDYPCFFAEYWEKPDKTADCFVDGPDGEWYLSGDLAHLDEDGYFWFEGRADDVILSSG
FT                   YRIGPFEVESSLGEHEAVAEAAVVPKPHRERGNIVKAYIVPSEGATPSEELKEDIRTHV
FT                   KEELSAHEYPREIEFRDELPKTVTGKIRRTELQDEVEEEAEAT"
FT   gene            complement(13110..13733)
FT                   /locus_tag="Htur_0012"
FT   CDS_pept        complement(13110..13733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0012"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sgl:SG1901
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58913"
FT                   /db_xref="GOA:D2RST9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D2RST9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB58913.1"
FT                   /translation="MDAPDPFESASDETRGEMMRATYEALRTHGYSDLTIQRIGDEFPK
FT                   SKSLIYQHYDGKDDLLVAFLEFLLERFKADVPSDDDFEDARDHLLTLVEQPLAESNDEH
FT                   VDFVGAMTALRGQAPYDEAYWEQFADTDAFFREHVADIVRDGIEQGVFREVDPEQTAAF
FT                   ISATIDGAQSQHVTTGSEEAVDAVRRELTDYVERRLVVDGEDDS"
FT   gene            13761..14825
FT                   /locus_tag="Htur_0013"
FT   CDS_pept        13761..14825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0013"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: aeh:Mlg_2715 daunorubicin resistance ABC
FT                   transporter ATPase subunit; TIGRFAM: daunorubicin
FT                   resistance ABC transporter ATPase subunit; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58914"
FT                   /db_xref="GOA:D2RSU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU0"
FT                   /inference="protein motif:TFAM:TIGR01188"
FT                   /protein_id="ADB58914.1"
FT                   /translation="MACYSVRVPVSEMNSIDAQHVELTYADGTAAVTDLVLEVPEGEFF
FT                   GFLGANGAGKTTTIKIFATLLKPTGGTVTVNGYDVEAEPRSVRESIGYMAQETSVDPEL
FT                   TARENIRFACEAYGVPAADRGERIDDLLDLVDLADVADKVAKDFSGGMKKRLDAATALV
FT                   HEPPIVFLDEPTTGLDPKARNRLWDYFERINDRGTTVFLTTQYLEEADQLCDRIGVIRD
FT                   GTIVADGTPAELKDRVGGAVLEVELANADPDAEALERAREVALEAALFDDASIEVTDGG
FT                   LSVRSTAARQRGPELLVALKEADVPVTGFNVRDPTLDDVFLAITGEGLDEEEATTTETA
FT                   GGSGASDATTEVGR"
FT   gene            14822..15736
FT                   /locus_tag="Htur_0014"
FT   CDS_pept        14822..15736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0014"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: aeh:Mlg_2716
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58915"
FT                   /db_xref="GOA:D2RSU1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU1"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB58915.1"
FT                   /translation="MSTDAETGSANTDRGRTTAGNGFVRDTWINLKRWLIKTTRNPFVM
FT                   TVSLLNPIIFLVLFTEVFGGVTEGAVSQSLGTEASYVTFLVPAIVIQTALIGATTSGIG
FT                   LVDDIENGMFEKVLVSPMHRGAIFLGKSLSEVLRIVVQIGIILTLGYVLLYLDAGAPLT
FT                   DYVETGVLGALGIVAVGIVFSIWFTALSNVVALVTRDQESTIIAVNLLQFPLLFLSSAF
FT                   LPIEVLPEWVQTIAALNPITYGVDAARALMFGKDVMTVLEVSAFGGMWNTLVPALAVLG
FT                   ALDLVLGAVAVHFLNSASSSDVQ"
FT   gene            complement(16003..16440)
FT                   /locus_tag="Htur_0015"
FT   CDS_pept        complement(16003..16440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU3367 2-C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58916"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58916.1"
FT                   /translation="MNVRDALEADADALASIADSPTDVMRNLVHDRTVRVAEDGTHDPN
FT                   ADVSDSQFDGSDPEDLLGFISFDAREDTVHVTQLDGTSEACKQLLGEPVRFAQRESMAV
FT                   ELLVSPDSEAIEDAAEELGFERRGRGPRFDGAPTTRFRLEP"
FT   gene            16667..17845
FT                   /locus_tag="Htur_0016"
FT   CDS_pept        16667..17845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0016"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: rme:Rmet_1089 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58917"
FT                   /db_xref="GOA:D2RSU3"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU3"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ADB58917.1"
FT                   /translation="MRVVAKFGGTSLGSGDRINRAADSVAAAVEDGHEIAVVASAMGST
FT                   TDDLLDEITFETDEEDRAQIVSMGERTSVRMLKAALSARGIDATFLEPGGDDWPVVTDE
FT                   YGEVNVEETKKRALEVAGEMDATVPVITGFLAEGPDGSITTLGRGGSDTTAVMMGKYMD
FT                   ADEVVIVTDVEGVMTGDPHVVEGARNVGEISVDELRNLSFRGAEVVAPSALSYKDGELD
FT                   VRVVHYQHGDLLSGGTSIEGEFKNLVDLRERPLACLTVAGRAIRNQPGIFNHLSEALAE
FT                   SDVNIDAVASGMDTVTFYIDEEEAERAENILHREVIARDELSSVTVDSPVAVVRVTGGE
FT                   LPNQPGIISEIVNPLSEARIHLNDIITSATSVALFVDWEDREETLELTQNLF"
FT   gene            18002..18724
FT                   /locus_tag="Htur_0017"
FT   CDS_pept        18002..18724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58918"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58918.1"
FT                   /translation="MSTEQTDAEAFEDIDPDPDAVLDEFGVDSPDELVAAGGAHDTIPD
FT                   DAIDVDDTTAAELFADLEVQATEARALEGRQSADDAIDTDASDGSTDDESPPEFEEFEA
FT                   AFVGDPSVAGREDEGLVESTAAELNAVAERVFRSDEAAADDEVGETPADDEADALLESG
FT                   VITEAEAPTDSEEPTGGNAGDGGPVADVRDDARSDDSGSDRTLTVSRATDGMELVGPEP
FT                   TTTRVENDVFGCAGADEC"
FT   gene            18922..20274
FT                   /locus_tag="Htur_0018"
FT   CDS_pept        18922..20274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0018"
FT                   /product="Tryptophanase"
FT                   /EC_number="4.1.99.1"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58919"
FT                   /db_xref="GOA:D2RSU5"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR011166"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU5"
FT                   /inference="protein motif:PRIAM:4.1.99.1"
FT                   /protein_id="ADB58919.1"
FT                   /translation="MRMVAYKTKVAERIHLPSRDRRERALAEAGYNVFNLDAEDVFVDL
FT                   LTDSGTGAMSDAQWAAVMRGDESYAGSRSFDDLESAVRDVMGFSRVVPTHQGRGAENVL
FT                   YGTLLSEGDVALNNTHFDTTRAHVANQGADPVDCPVEGARDLESDEPFKGNFSLERARS
FT                   VVDEVGAERVPLVILTITNNSTAGQPVSVENTRRVRDFADEIGATFVIDACRFAENAGF
FT                   VRRREDEFTDADIDEIAREQLSYADAIVMSGKKDGLANAGGFVATDDEALFERCKQRAI
FT                   LYEGFPTYGGMSGRDVAALAVGLREAVEEAYVADRLDGVRAFADLLEDAGVPIYTPPGG
FT                   HAVYLDAGTALPHLAPDEFPGQALVCELYREGGVRGVELGSFAFPDTDRPELVRLAVPR
FT                   RTYHTEHFEHVAETAATVLEKREAVSGLEIVSEPENRELRHFTADLEPLSV"
FT   gene            complement(20316..20684)
FT                   /locus_tag="Htur_0019"
FT   CDS_pept        complement(20316..20684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58920"
FT                   /db_xref="GOA:D2RSU6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58920.1"
FT                   /translation="MALKGLLSGKPSRNAKLYIGIGLISLVKAVAVRNDRNRFRRELTD
FT                   AAMFIGVGLALRQYSTLKAEKRREIESQVPDWAIDLATSEQAQRGVRSLAKQRLGRQSE
FT                   PQAESSLKDRAQRALSSR"
FT   gene            complement(20762..21259)
FT                   /locus_tag="Htur_0020"
FT   CDS_pept        complement(20762..21259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0020"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rhi:NGR_b06920 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58921"
FT                   /db_xref="GOA:D2RSU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB58921.1"
FT                   /translation="MDDPHETRADSFGEAVGYVRTAIDDDILEVRRILDAAMLEPGDVE
FT                   TRIAEGSVLVAGDERGGTTGTAERILGTVVLEPFEKGEEGDGSGNGDRGAHVGAIGVRR
FT                   RHRGRGIGTALIDRAVEREGRLTARFDDGVRPFYERLGFSIEPIDEQRHRGVKVGRGLE
FT                   FD"
FT   gene            complement(21263..21799)
FT                   /locus_tag="Htur_0021"
FT   CDS_pept        complement(21263..21799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0021"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58922"
FT                   /db_xref="GOA:D2RSU8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU8"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADB58922.1"
FT                   /translation="MTESSPDLTLPNVGPGPDPLSLTDLTEPVAPADPTTTDEAEPAHD
FT                   AVLLLLHRDHHAGQCRRQVRAVADRYDEFRDRGCQVVSVVPEPRDRVEEWQERYDLPFP
FT                   LCADPEATAGEAFDQPVRLGPVGRHFDLVGRMPAAVVLDIRDPAALEVVATYRGRTNMD
FT                   RPEIDELLATLDRRT"
FT   gene            22117..22755
FT                   /locus_tag="Htur_0022"
FT   CDS_pept        22117..22755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0022"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /note="PFAM: Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58923"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSU9"
FT                   /inference="protein motif:PFAM:PF04967"
FT                   /protein_id="ADB58923.1"
FT                   /translation="MIAIFDIAHPDLALTPTIRDRPDASIEVVPHSTTDPETGLFFYLV
FT                   EGADEAVEDVLEQDHTVTDWMLADDLGSARIYRLQHSEETVLISPLTTELGGLLLNAET
FT                   TGRGWTTRVQLPDREALADLWDCCETRDISFELRRMFRRDEWTGETFPEVTDKQRAALV
FT                   SAHEEGYFEEPREISLEELAEQLGISSTAAGGRIRRGTGQLVASTLREE"
FT   gene            complement(22963..23310)
FT                   /locus_tag="Htur_0023"
FT   CDS_pept        complement(22963..23310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58924"
FT                   /db_xref="GOA:D2RSV0"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV0"
FT                   /inference="similar to AA sequence:KEGG:AN6619.2"
FT                   /protein_id="ADB58924.1"
FT                   /translation="MRIHHEREAKFYYFWPNLTVNVYGTADGAGTYIIVGPIDEGRFQL
FT                   VADHCFADPDLTEAKAEFVRTSRQLREEDFELIDRQQRGLESGGTVQARLGPNEHTVHK
FT                   RHRFAREAYEA"
FT   gene            23438..24583
FT                   /locus_tag="Htur_0024"
FT   CDS_pept        23438..24583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0024"
FT                   /product="Sarcosine oxidase"
FT                   /EC_number="1.5.3.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58925"
FT                   /db_xref="GOA:D2RSV1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV1"
FT                   /inference="protein motif:PRIAM:1.5.3.1"
FT                   /protein_id="ADB58925.1"
FT                   /translation="MVATGTRYDVIVIGVGGMGSATAAHLADRGSDVLGLERYDVPNTM
FT                   GSSHGITRIIRRAYYEHPSYIPLVERAYELWDDLADETGRDVIHRTGSIDAGPPDNIVF
FT                   EGSLRSCEEHDIPHEVLTSAEVAERFPGYDLPEGYKALYQPDGGFVVPEQAIVGHVETA
FT                   QAAGAEVRARERVLEWESTSDEGVRVETDRGTYEAENMVLAAGAWNYKFADVLEDLAVP
FT                   ERQVLGWFQPDRPSTFEPENFPVWNLKVPEGRFYGLPIYDVPGFKIGKYHHRDKQVDPD
FT                   DYEREPNREDERLLREVTENYFADAAGTTMRLATCMFTNSPDEHFILDTLPEHPQVAVG
FT                   AGFSGHGFKFASVIGEILADLAIDGDTDHPVDMFRFDRFDV"
FT   gene            complement(24825..25061)
FT                   /locus_tag="Htur_0025"
FT   CDS_pept        complement(24825..25061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58926"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58926.1"
FT                   /translation="MRVTVDVKGEDTHEIDLETVSASGTAADGETVPTYRDLLREVDLS
FT                   PHEVSVLVDGRPVPEDQPVESEHVTVLRLIKGG"
FT   gene            complement(25141..26226)
FT                   /locus_tag="Htur_0026"
FT   CDS_pept        complement(25141..26226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58927"
FT                   /db_xref="GOA:D2RSV3"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58927.1"
FT                   /translation="MSSNNNSRTLLVIALVAVVVAGTVPATVAGQAERTGGTVVVEEGE
FT                   TVDSLEAFGGTVIVEGTVTGDVSAVAGDVRIEGDVEGNLEAVGGSVTIAGTVQGDVEAA
FT                   GGSVTITEDGVVGGTTSIGAGTVVVDGTLEGDAEIGAETIQLGESASIAGDLRYGGNLQ
FT                   GNTDAVAGDIEQDSSVGVDLAPTIQPIASWLFAAYALVLNLVLGAALLALFPRFSDGVA
FT                   DRVSSAPARSGLAGLGVLVGVPILLIALAITVIGIPFSIVGAFAFVLVVWIGIVYGRFA
FT                   IGAWLLSLVGVGSRWLALLVGLVIGAALGLIPIVGGLLNLLVLLLGIGALAVGLYSHWR
FT                   TARRREREPRRGVGPDGPTTD"
FT   sig_peptide     complement(26140..26226)
FT                   /locus_tag="Htur_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.604 at
FT                   residue 29"
FT   gene            26384..27376
FT                   /locus_tag="Htur_0027"
FT   CDS_pept        26384..27376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0027"
FT                   /product="Replication factor C"
FT                   /note="PFAM: Replication factor C; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase; KEGG: hypothetical
FT                   protein; K10756 replication factor C subunit 3/5"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58928"
FT                   /db_xref="GOA:D2RSV4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR023748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV4"
FT                   /inference="protein motif:PFAM:PF08542"
FT                   /protein_id="ADB58928.1"
FT                   /translation="MSEADAEAAEPTPGRTEVWIEKYRPERLDEIKGHENIVPRLKQYV
FT                   ERDELPNLMFAGPAGTGKTTAAVGIAREIYGDDWRENFLELNASDQRGIDVVRDRIKDF
FT                   ARSSFGGYSHRIIFLDEADALTSDAQSALRRTMEQFSNNTRFILSCNYSSQIIDPIQSR
FT                   CAVFRFTELTEDAIEAQVREIAANEGIEVTDDGVDALVYAADGDMRKAINGLQAAAVMG
FT                   ETVDEETVFAITATARPEEVEKMVEHAIDGDFTAARAALEDLLTERGLAGGDVIDQLHR
FT                   SAWEFDIPEMATVRLLERLGEVDYRITEGANERLQLEAMLASLALEDDA"
FT   gene            complement(27462..29603)
FT                   /locus_tag="Htur_0028"
FT   CDS_pept        complement(27462..29603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0028"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: GAF domain protein; SMART: GAF domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58929"
FT                   /db_xref="GOA:D2RSV5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV5"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADB58929.1"
FT                   /translation="MTPPPRSRPRTVIYLAEIDAAARDGAAALERVDSGPQRLVQPLTT
FT                   DAVDSLGSWAAEADCVVFAETPTTAAGATLLEAVEACGSTPVILFSEATYAPSAARSTD
FT                   GIDGYVRRGTDDAVAHLADEIEWVCAGERAAAATALPAADSDAESDAVETSDTDDVADT
FT                   GDATGRPTAELLESLPDVAACEERDRLFERLVATAADAVGTEYGWLSTVHFGELTPRAT
FT                   TDAVAAEDLEPISRNGLLDEALRTGEPIRIDDLAADGCPEAPLEGMESLCCVPVADVGL
FT                   LLLAAAEPAAFDDRDRDLLAAWGRVGAAVLERVETETNLRTDRDRLRQELDRAEEIRDR
FT                   IAAERDELAAERDRLVAERDRARALFATVPEPAVHYEIDDGQPIVRRVNDAFTDVFDTG
FT                   PAAVVDEPLDAATVPPGLEHRQATLTEALRAGQRRQLVSRRETVDGVREFRLALVPLEA
FT                   AEADGATAHNPEGLIVYSDVTDANRRERELAATEARLESIAESLETDVRTPLNVARGYL
FT                   ELAEETGDAEHFAEVETAQERLRERVAELRAIARRDQMAIETEPVAVTDVARRAWIAVD
FT                   SGDARLVTREDRVLEADKAQLRELFEYLLRAAVESVGADGDGKGSDDAAAGDAPIVTVG
FT                   ATDDGFAVTGHPAGTDVTPIGREMMPVPGRLTAADGTGFGLGPVERIADAHGWDVGVAT
FT                   DEGATFAFRGIDPVDVSRD"
FT   gene            29814..30800
FT                   /locus_tag="Htur_0029"
FT   CDS_pept        29814..30800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0029"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: scl:sce3372
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58930"
FT                   /db_xref="GOA:D2RSV6"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV6"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ADB58930.1"
FT                   /translation="MDVTLLSTGGTIASTDADGGARPTRTGAELLEAVPELESHASLSV
FT                   DEVAQVPSFEMDAETLETVGERVRELEADPTVDAVVITHGTDTMEETAYYLDVTVQPET
FT                   PVFLTGAQRRPDEVSSDGPSNLLTAVRAAEAFVDRDAGGTFIAFNETVHSARSVTKTHT
FT                   SALEAFRSRNAGPVATVDRNGVAIHRRPRSETRLIDATSLEATVYTIKSGSAVTGDLVA
FT                   AALERGADGLVVEGTGLGNVTAGLADAARDAIEAGVPVVVTSRCLEGRVAPVYGGDGGG
FT                   EQLREYGAIFANDLTAQQARLRLALALEASDDEDAIREAFSPADSQT"
FT   gene            complement(30791..31690)
FT                   /locus_tag="Htur_0030"
FT   CDS_pept        complement(30791..31690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0030"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: pfs:PFLU1073
FT                   putative deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58931"
FT                   /db_xref="GOA:D2RSV7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV7"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADB58931.1"
FT                   /translation="MGTVDVAIGVDADCVAGWLGSYGGSDSPADLSRGLAAGNEGIPRM
FT                   LALFDEQDIETSWYVPGHTIDTFRNEIEAVAADGHELGVHGYSHENPTDLSREQEDEIL
FT                   EVSIDLIEDVTGSEPVGHRASWWEFSENTPELVEKHGFLYDSSLMERMFEPGWMRKGDS
FT                   WEKIRYEEDPETWMEPYRYGEETDIVEIPISWYRDDIPPMLFIKQPIYHAGYKDPEMMY
FT                   EQYYKRQFDYLYNRRGAGVYTFTIHPDIHGLPHMIPLLEEFIQYVKGHENAQFTTLETI
FT                   AETYKEDPSVYETESDYV"
FT   gene            complement(31876..32583)
FT                   /locus_tag="Htur_0031"
FT   CDS_pept        complement(31876..32583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58932"
FT                   /db_xref="GOA:D2RSV8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58932.1"
FT                   /translation="MSTDDCNQNRFDLRPAVSTVLDHPLAGLERRRTTIAVAYLSALIG
FT                   LFAVSYAGANVRVDDVLLDTLSLGFDHVSTVLIVAVTATVTVVPFAYAIWNGGPGLTFA
FT                   IPLVPVALGDLAAGQYVLGVDTAVALTAGAAASALALYAIDVRTADSLRPWRTAGGPAV
FT                   PRLLTVTVLTVVAAFGIARFVAVVPPRSLERYAPFAALWLVPFGIVASYWTVEVRTAVA
FT                   TRADHADSDRADT"
FT   gene            complement(32580..33260)
FT                   /locus_tag="Htur_0032"
FT   CDS_pept        complement(32580..33260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58933"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58933.1"
FT                   /translation="MQSRRSLLRTGGLAAVGTLGGLVALPSPPDATPADRTAEAAALPD
FT                   AVVGWTDDRITRETETPIARYQYRATAADPNRTDRDGFVATSPINVVLVPDAETDAAGL
FT                   ESVLQVLEAEGWLRDPDEYTRYAWDRTEGRFVRQQATAAESYFGASSRFHVRCWSFEGI
FT                   VSMQVHEDSAARPKHDVISYDRGRESIAAAFDAAGWDVSPSAIDLDNDQSDHDGLATVI
FT                   TEAP"
FT   sig_peptide     complement(33165..33260)
FT                   /locus_tag="Htur_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.900 at
FT                   residue 32"
FT   gene            33503..36280
FT                   /locus_tag="Htur_0033"
FT   CDS_pept        33503..36280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0033"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: Alanyl-tRNA synthetase; K01872 alanyl-tRNA
FT                   synthetase; TIGRFAM: alanyl-tRNA synthetase; PFAM:
FT                   Alanyl-tRNA synthetase, class IIc-like; phosphoesterase
FT                   DHHA1; Threonyl/alanyl tRNA synthetase SAD"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58934"
FT                   /db_xref="GOA:D2RSW0"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW0"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ADB58934.1"
FT                   /translation="MSELADEYRLEYFEEEGFERKECPSCGAHFWTRDHDRETCGEPPC
FT                   AEYGFIENPGFDEEYSLTEMREVFLSYFEDNDHERIEPYPVAANRWRDDVLLTQASIYD
FT                   FQPLVTSGETPPPANPLTVSQPCIRMQDIDNVGKTGRHTMAFEMMAHHAFNTREDIPED
FT                   KYAYHGEVYWKDRTVELCDGLLQELGADISEVTYIEDPWVGGGNAGPAIEVIYRGLEIA
FT                   TLVFMCMEQDPEGEYELKDGNRYSYMDTYIVDTGYGLERWTWMSQGTATVYEAIYPEMI
FT                   DFLKDNAGLSYTDEETEIVSRAARLSGQLDIDDVDDVEAARGEIAAEIGVSVDELRDLV
FT                   EPLEDIYAIADHCRTLAYMLGDGIVPSNVGTGYLARMVLRRTKRLCDNAGVDAPLDELV
FT                   DMQAQRLEYENRDTIRDIVRTEVEKYRETLERGGRRVETLAEEYAKKGEPIPIEELIEL
FT                   YDSHGIQPDMVEEIAEEAGAEIDVPDDFYSLVAQRHDTPEAVEAADEDEEDRFEDLPET
FT                   EKLYYDDQQRTQFEAVVLDVFEREEGYDVVLDQTMFYPEGGGQPADTGTLSTDDTAAEV
FT                   TDVQIEDGVILHRADENPGKGEFVNGQIDGGRRRQLMRHHTATHIVIHAARQVLGEHIR
FT                   QAGAQKGVDSSRIDVRHYDRISRADVKEIESLANELVMDNTQVSQDWPDRHDAEAEHGF
FT                   DLYQGGIPPGEQIRLIQVADDIQACGGTHVARTGDIGSIKILNTERVQDGVERITFAAG
FT                   EAAIESTQVKEDALYEAAEILDVSPEDVPETAERFFEEWKARGKEIEDLTEQLAAARAG
FT                   GGGGGEEVDVGDRTAVVDRIDADMDELRATANALVEEGKIAVLGSGQSGAQFVVAVPDD
FT                   SDVNAGEVVGELAGRVGGGGGGPPDFAQGGGPNVEDLDAALEDAPDVLRQIQDA"
FT   gene            complement(36327..36647)
FT                   /locus_tag="Htur_0034"
FT   CDS_pept        complement(36327..36647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58935"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58935.1"
FT                   /translation="MASVSGSNSGFRQIAGEVDVKGEGEVSIGGETYQSPAIESKHWNP
FT                   EKWPADVPFDDLSWSSQLTELVEKRVTQAVKGEDTVIASITIHLLPNQPVQTTRSRRLE
FT                   NI"
FT   gene            complement(36881..37573)
FT                   /locus_tag="Htur_0035"
FT   CDS_pept        complement(36881..37573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58936"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58936.1"
FT                   /translation="MSESLSIPYLFEEELDSRRIERFLRFCFDELNCSRSPPESEDTSQ
FT                   FGYTTEETDGIRYGCTIDDAIERITRVAGGTIWLWYDDLNVGIHINGWSADRPAVPNLS
FT                   LSIDEWYVKPWRNDRPDLIYDFVLELYDYLSPIYVYGDTYLDETTLSTEGLKEGRLEEV
FT                   YWVNGFGPDIAEQVGRERLLHAPAWQVDDREDGGVFLWEAPLPLSQIRQETDDKLRSYF
FT                   SLNSSSAN"
FT   gene            complement(37566..41906)
FT                   /locus_tag="Htur_0036"
FT   CDS_pept        complement(37566..41906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0036"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: mxa:MXAN_0962 putative
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58937"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW3"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ADB58937.1"
FT                   /translation="MRFNKERVVAVFFAVLMVTSAIAMPALASGPSATAANERSASVAA
FT                   HPGNGPAPNAGPPGQNGGPPGHDRGDANVTIPDLEENTSVDAILNATYRLEELEIENET
FT                   AAAVAVNDTVDAVNALVGEYRRVRYADSRAAFDRLADAQRSLAVLKDEVDGDDEAIVDA
FT                   ISEELYAAGNASARLAVSDANAVVAANEGEFRNPGQRQKAESALGNAVDGLERADRAVS
FT                   DGVSGNGTGKSKAKKSDRPIGPTDRAKALTHLENAWKHAERTLDTVEANTEPSLSLSQG
FT                   RPFERNGTVRVSIRAVLSDVRPYAYDNATVTVNGDADADAVSFATDEAAGTDAIGSTLV
FT                   DLGSDPENVTITVTATAAHDADRTVEATHDIRIAEEAVVRERPDPDEYRNVEVVNESSG
FT                   VSVAVGGDGLDDADVSITDETPTTDDPYRAGPMVRIENERPIDDATVEIPIDENALEAD
FT                   ANLSIVTWDPTSDEPWTPVETEIDRDAGVATAEVDHFSFFSVFRIEEWEDETSDTITLD
FT                   GNETDGEIGNGSGIETADFVFVNDESGSMSGSPTHYAELAGKRFVGALTDSERAGRVGY
FT                   ASGANLDQPLTTDHDAVNSSLERLSASGGTNTRAGLRVGLNHLEEEGWENRSAVMILLS
FT                   DGKSGSDPLPVAEDAAEAGVEISTVGLGNNINENELREIAAITGGDFYHVEREEDLPDT
FT                   FERVAENQTGPGLQDTNGDGIPDLVAEMDLSMPTGEPGVVGEPLNLDPTALDTSGDGIL
FT                   DNETVDIKYRVFQEDNETKLHAAVTYAEHHPARIDTTGDGLTDAEQLSDRTITYTDSRS
FT                   DSLEFLSELEDADDIDDLDGLEGDVLTTDTVRSDPLVDDSDGDGVTDAEEVRLGTDPES
FT                   RDTTGDGISDSEGLNGDYDPTLFDIEPPEITVTYATFNDPDADVELKDPVDVDWSNGKV
FT                   NFNDPVDASVRVSGSYEVDFTVTDSAGLDEARVVRDGDVEETVSLSGQWDDADVEFDVG
FT                   TVDTFTDAFAGSRVTVQADDRHGIVDGVGTTEAAAVEVGGVWAAASDELRAQGVSDPRL
FT                   EQDLGTLQGMTTGAGESIDSLRALYNEPIETITAVREIPGAIANFDEIIAAMPDSIEAQ
FT                   QQRNNPHDPDESPRLYESFRQGWYEGYIAWFVIEAAIPAGEAGKALKSSDRVRKTVDKI
FT                   STPRIRQAAQMAGRAGHTAKTPVRYGRLQFSRGLSTGIGLTQKAGENVLSRVSTVGQQY
FT                   RVAKLLNRHDVDGAAINRLDADGQEAIGKATARNGDDASRVMADGGPDPVARAYQLDLD
FT                   VNNENLVSNLFRHSEAVDFERVIDNLEELNRPNADIEGVDDLAKRLAAGDQSNVKGAAF
FT                   EAEVAVVRGSDNVEAVGKPNPYSRGEIDIETSDGRVIETKSGDYSQAADGSDKYIELEN
FT                   QIGHYQQYTEVEGGTIEVAFREEPHDDIKDMLNDNDAEVEIYNE"
FT   sig_peptide     complement(41820..41906)
FT                   /locus_tag="Htur_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.784 at
FT                   residue 29"
FT   gene            42174..42959
FT                   /locus_tag="Htur_0037"
FT   CDS_pept        42174..42959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0037"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: gme:Gmet_0843
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58938"
FT                   /db_xref="GOA:D2RSW4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB58938.1"
FT                   /translation="MPTASNGSVSLYYDHAGEGEPVVFVPEAGLGGWLWGWQHAAVAGP
FT                   YEAVVWDLRGTGRSDAPDGPYALETLAGDLEAVLSACEIRNAHLVGCGLGGTVALEAAR
FT                   TSSRVATLTLFGTAPRGEQFDLEALFAPPDDREALADSLEAGLSAEFLESQPADVREGI
FT                   VDWRADGDADRAGWEAQIAALEGFDATEWLVEVTQPTQVIHGGADELVSPSAGRTLADG
FT                   LPRGEFDTLEDAGHLCFVERSRDVNDRLLGFLEAHTDDE"
FT   gene            complement(42996..45074)
FT                   /locus_tag="Htur_0038"
FT   CDS_pept        complement(42996..45074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0038"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; UspA domain
FT                   protein; KEGG: mxa:MXAN_0260 putative cation
FT                   transporter/universal stress family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58939"
FT                   /db_xref="GOA:D2RSW5"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW5"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADB58939.1"
FT                   /translation="MQFAWSAAPSVVAVAIPDLPLEEPVLVFTLALAIFLVGPLLVRRL
FT                   GQPGIIGIVLFGALLGPGGTGLVAHSDAIVLLGEVGLIYLLFTVGLELDLRQFAEDPGS
FT                   AALFGLVSFGLPFVVGTAVVVVLLDLSLLAGLLLAAVFASHTLLAYPIVNQYDITGNRA
FT                   VTAVFGGILFTDTLALFVLALVRSAAETGLTAGVVVGKVLALVALLAGVWVVVPPIARR
FT                   FFQNFSEESYFEFLFVAVVFFGAASVATLLDIAPILGAFVAGLALNRLIPEGGTLLSRI
FT                   EFAGNAFFVPFFLLHVGMLVDATVIFRGRRTLEVAAVIVVVMVALKWLAAWFVARVKGY
FT                   TADERDVMFGLSIGQAAAALAITLIGYDVGLFDAAILNAVVLMLLVTAVASPWMTKRAG
FT                   QRLALADDVEPGDDAPADPRILLPVSHAADRQRHLLELALLFKDERERPIHTLTVVRPD
FT                   RSGDPDRAVDEAYDDLEELTAVGSEAEVLVDPEIRVDHNPASGIVRGALEVQADLLLLG
FT                   WDAQRSLGQRLFGSVIDQVLERTTDPVVVARLGHPVNTTDRLFVVLPEGIDHHEGFFES
FT                   VALLKRLADRLGAPLTVLAVGGSAHQYERLFGLVEPELDAEFRDLNSWRALHSILGDEA
FT                   TADDLVSVISSRPGSVGWHDELRELPYRLASLPPESFVLFHPREDDPEYDRQFLRFK"
FT   gene            complement(45208..45921)
FT                   /locus_tag="Htur_0039"
FT   CDS_pept        complement(45208..45921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0039"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rlt:Rleg2_2060 conserved hypothetical conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58940"
FT                   /db_xref="GOA:D2RSW6"
FT                   /db_xref="InterPro:IPR014470"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW6"
FT                   /inference="protein motif:PFAM:PF10028"
FT                   /protein_id="ADB58940.1"
FT                   /translation="MSRGDPDFDPEAPEQSEIGREMVDQSTGLGSVAAHLYRGEVERVT
FT                   TWRGRLDETTNWAVTVMAAILVYAFSSDGTSHAILLVGMLVMVVFLGIEARRYQGYDVW
FT                   RSRARLLQENLFANALDPSGGVERPRWRAELSEDYRNPSIKMPYSEALGRRLRRVYVPL
FT                   LTIMLVSWLFRIAAYHPGQTWRQAAALPGIPGPVVVGVVVLCVGLATGLAIWPRERRAK
FT                   GEVSERNYGEWKERR"
FT   gene            46093..47346
FT                   /locus_tag="Htur_0040"
FT   CDS_pept        46093..47346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0040"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mxa:MXAN_0225 putative long-chain-fatty-acid-- CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58941"
FT                   /db_xref="GOA:D2RSW7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB58941.1"
FT                   /translation="MAVPFVTLSLARRAERFPERTAVVDVSEERLYAPAETIHENRVSY
FT                   GELSAMTTRTAEHLSALGIEAGDVVCLLTRNRVASLAFLFACRRLGATFFPVSHWLTPA
FT                   SVERPFDAIEPALVVSEAAQRDLVRSIPFDRSVTLEELAEADRDAVSDPDERDRESESD
FT                   APLLFLHGDDGRPIAGYSASALEWNCISVLVAWGLSSADVVPLTPPLSSPDGLVRVALS
FT                   VLYVGGTLLLDRAFDPGDTLTAIAEENATLLAGRETAIRDLAAESGFDDAVDSLERVIV
FT                   EGAAADDALEAYREQDISIARAEGRLECPTAFCQSFAADVGANHVGTPVPDCRARLVDE
FT                   SGTVLEGAAEGRLELSGPVVADGYVSAAGTDDENWYAPAEEQSNDYDESGDRGRFADNW
FT                   FETDDRYRRDEDGTYRPQ"
FT   gene            47484..48224
FT                   /locus_tag="Htur_0041"
FT   CDS_pept        47484..48224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0041"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   hha:Hhal_1359 glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58942"
FT                   /db_xref="GOA:D2RSW8"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW8"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ADB58942.1"
FT                   /translation="MEQLRIAVLNAAHRDENTTRNFRRELDASLAEFDATDGEVPDGFD
FT                   YDGAVVTGSRSSVYWDDEWMQPIKEWVGDAIDRGIPFLGVCWGHQLLADVLGGTVADMG
FT                   AYEVGYSEIEHYGTSRLFDDIDEEFTAFTSHSDEVAELPPGADPLAENHYSNHGFRKDR
FT                   VFGVQFHPEYDTKTARELVHRKDLSDDRRQSVLEEITEENYQRACEAKLVFDNFLEFVR
FT                   EVRTENVAVAAECEDATATVGRSD"
FT   gene            complement(48410..50626)
FT                   /locus_tag="Htur_0042"
FT   CDS_pept        complement(48410..50626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0042"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: mei:Msip34_2458 protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58943"
FT                   /db_xref="GOA:D2RSW9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSW9"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADB58943.1"
FT                   /translation="MNAIAQSEVSRETYLGLGGVEYVLFYFLVAVTLAVFAYGVYRRFS
FT                   RYTEGDDDPFARVDGLLSRTVNAAKIVITNEKQFNRDLYGGLMHSFILWGFLTLLIATS
FT                   IIAVEQYGTELLLGLTFWEGDFYLTYQFIVDAMGLLFVVGIGMALYRRYWVQNHRLWGR
FT                   HTSNEDDIFIWTLFGLGIGGFLLEGFRIYISGMPSHEVVSFVGYGLAMAFDAVGLPTTG
FT                   AVLEGGALNPDYAAVDQLGFNAETLHWLTWWSHSLLALFFIAWIPHAGKPFHMLSSFAN
FT                   VVTRDEKAGRRLPNVPSDLDATNAESIDDFTWKEILDQDACTKCGRCSSVCPAKASNRP
FT                   LDPRDVILDLRKYREELEAGGEEKPIIADGGTSVINTETMESCMACMACMDACPVEIEH
FT                   LQSFTRLNRQMTDQGDVAPSMQDVFQNVMQNGNTFGDSPRNRGDWSEGLEFDVPDAREE
FT                   TVDYLWYVGDFPSYDERNKQVARSLATILKEADVSFGILFDDEKYDGNDIRRVGEELLY
FT                   VELAGHHVETWEDCEFDKIVCTDPHSYNTFKNEYPEVNFDEFADDPMMPFEYDEQWNED
FT                   GEIEVYHWTQAVEELVREGKLELSGTELDYTVTYHDPCHLGRYNDEYEAPRELIRATGC
FT                   ELDEMPRNRDNSFCCGGGGGGLWMDFEEEPKPSEERIREALEDTDNGPGVEKFVVACPM
FT                   CMTMYEDGRKTGGYEDEIEIVDVAELIVEAIGAEEEANLEVAAD"
FT   gene            50805..51395
FT                   /locus_tag="Htur_0043"
FT   CDS_pept        50805..51395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58944"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58944.1"
FT                   /translation="MNDKTEELRDIFTDVTDGEETVTESQENSRGSLERDDRSDEERLE
FT                   SVVQQMRERYAFETPLTDDELIAVARGFYDDEDDTDIAVDLDVDAETVFEARMSLHLVG
FT                   EDDADEVDLAAIRDREEDDATLADEYDVSEPQIRRYRRVAAAEDESRAANDRYRDEFDS
FT                   ILADAELSERMTTDVREDGLEDATEGMETDVEF"
FT   gene            51654..52349
FT                   /locus_tag="Htur_0044"
FT   CDS_pept        51654..52349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58945"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58945.1"
FT                   /translation="MSRALVPFSDLRTAAYCARKCYYQRTGDDVDREPPPSVERIRDLE
FT                   RRYEDLLEAPTGALEAEPIAVEPVQYRERLGATRDRLTAASDWKRLREPSERNVYAAGK
FT                   DCHGVVHKVLANPIEPVLVSSGEPPSDGVWESQSVHAVAAAKALAWEHEREIDRAWIEY
FT                   PARGVVRSLELTTRRKARYRRALRTVWDLDGPPARTTNRSKCESCEFAAQCGVRTRTLR
FT                   SLLPGFGSG"
FT   gene            52467..52829
FT                   /locus_tag="Htur_0045"
FT   CDS_pept        52467..52829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58946"
FT                   /db_xref="GOA:D2RSX2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58946.1"
FT                   /translation="MMWQDFVFLAGSVLSITFLAPTVRDPTAQVPLGSSVPSMTVGAVY
FT                   SFTYATMGMTFSAAGSLGVATMWSLIACYRSPGPVSGPQTIARFVASLPGRARESVVDA
FT                   LGSGPSATTEAEHAAD"
FT   gene            complement(52876..53484)
FT                   /locus_tag="Htur_0046"
FT   CDS_pept        complement(52876..53484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0046"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; KEGG: eba:ebA110 putative
FT                   translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58947"
FT                   /db_xref="GOA:D2RSX3"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D2RSX3"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADB58947.1"
FT                   /translation="MDDDDLERAAEAIRAGELVVYPTETVYGLGADGLDADAVERVFEA
FT                   KGRDRSKPVSVAVPTFETALEEGYVRASERERAFADEFLPGPVTLLCERTEALPDVLTA
FT                   GRDRVGIRVPDCEPALRFLEAAERPVTATSANVSGEPSARRVEDIGQQVLDEAVVLEAD
FT                   DLYESIEETVPSTVVDLEAETIHRRGALADEIEAWLEAN"
FT   gene            complement(53576..54088)
FT                   /locus_tag="Htur_0047"
FT   CDS_pept        complement(53576..54088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0047"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58948"
FT                   /db_xref="GOA:D2RTA5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTA5"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADB58948.1"
FT                   /translation="MPDFEVTDLGPADHLEAGEEGPDFTRPLVTDEFWEDRSLSDVVAD
FT                   EGRTILVCTPMIGSFVAKYIYDELDKRSWFDRADRIVGLTAATPYAVSSFLDENEHPFA
FT                   IFADPANDVAESLGIAHDLDGMTGISEPRAAVFGLEPDLTIDSAWVSTEWPEFPPYDDL
FT                   ESELGLE"
FT   gene            complement(54088..54405)
FT                   /locus_tag="Htur_0048"
FT   CDS_pept        complement(54088..54405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0048"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; Glutathione S-transferase
FT                   domain; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58949"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTA6"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="ADB58949.1"
FT                   /translation="MEASATAASDAPITFYRLQACPYCERVARLLNEYDLEYRSRFVEP
FT                   MHSRRDVVKRVAGVRSVPVVVDENTGVTMAESANIVDYLESTYGEDGQRADAAAESRGD
FT                   D"
FT   gene            54517..55920
FT                   /locus_tag="Htur_0049"
FT   CDS_pept        54517..55920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0049"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   dal:Dalk_3618 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58950"
FT                   /db_xref="GOA:D2RTA7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTA7"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADB58950.1"
FT                   /translation="MALSLSPAVVAAAYEVPVVGLEFDESMVTILGSVAILLLIALSAF
FT                   FSSSEIAMFNLPKHRLEGMVEDGVPGAKLVKSLKDDPHRLLVTILVGNNIVNIAMSSIA
FT                   TAILSLHFGGLVGVFLATFGITALVLLFGESVPKSYAVENAAPWSIRIARPLKATEYFL
FT                   FPLIVLFDYLTRQVNKLIGSTGAIESPYVTRDEIQEMIESGEREGVLEEEEHEMLQRIF
FT                   RFNNTIVKEVMTPRLDMTAVPKDAGIDEAIETCIQSGHARVPVYEGSLDNVLGVVHIRD
FT                   LVRDLNYGETEADDLELEDLIQPTLHVPESKNVDELLTEMRENRMHMAIVIDEFGTTEG
FT                   LVTVEDMIEEIVGEILKSGEDEPIEQLDDRTVIVRGEVNIEDVNEALEIDLPEGEEFET
FT                   IAGFIFNRAGRLVEEGEEITYDGVRITVETVENTRIMKARLRKLEQPTESLEEAPEEAE
FT                   SDEESVPSE"
FT   gene            complement(55921..56376)
FT                   /locus_tag="Htur_0050"
FT   CDS_pept        complement(55921..56376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0050"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   bcj:BCAL2909 long-chain acyl-CoA thioester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58951"
FT                   /db_xref="GOA:D2RTA8"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTA8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADB58951.1"
FT                   /translation="MPTVLDTYIKNRYRVQPNHANNNETLHGGNLMKWLDEIGAMSAMR
FT                   FAGETCVTARVNELDFERPIGIGDTAMVEAFVYDAGRRSVHVGLRAWREEPRTGETERT
FT                   TESSFTFVAIDESGSPVPVPELTVDSERGRELRDRMLEADADADSDD"
FT   gene            complement(56424..57428)
FT                   /locus_tag="Htur_0051"
FT   CDS_pept        complement(56424..57428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0051"
FT                   /product="Replication factor C"
FT                   /note="PFAM: Replication factor C; AAA ATPase central
FT                   domain protein; SMART: AAA ATPase; KEGG: Rfc5; replication
FT                   factor C (activator 1) 5; K10756 replication factor C
FT                   subunit 3/5"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58952"
FT                   /db_xref="GOA:D2RTA9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR013748"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTA9"
FT                   /inference="protein motif:PFAM:PF08542"
FT                   /protein_id="ADB58952.1"
FT                   /translation="MDAPLWTDTHAPELAELPQDDAREYLQRAVDEPINLLLQGPPGSG
FT                   KTAAARALARDAHADPDNDLIEINVADFFGRTKTEIKNDPRFAQFLVGRSSMSKRDMIN
FT                   HVLKESASYASVSGDYKTVLLDNAEDVREDFQQALRRIMEQHHRTTQFIIATRQPTKLI
FT                   PPIRSRCFPVPVRAPTSEETVGVLERIVEAEGVEYDADGLEFVAGYANGNLRQAILAAQ
FT                   TTVEDEGELTMQAAYETIGEVGLEDEIEGMLDDAEAGEFTDARKTLDDLLVDEGLDGGE
FT                   VLDSILGVARKRYQGELLARIHQLAADIEFEMQEGSSDRIHVSHLLAELGRDA"
FT   gene            complement(57485..58618)
FT                   /locus_tag="Htur_0052"
FT   CDS_pept        complement(57485..58618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58953"
FT                   /db_xref="GOA:D2RTB0"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58953.1"
FT                   /translation="MSSGLTFGTIKRVGAILLAIAIVLAAGLVIFQAPAIFGVEENPEA
FT                   SITFEDQRGDGESVTVDEVSLSEGGFVVVTGSDGETLAVSDYLEAGSHENVTVERTEDA
FT                   QAELVGQLTATVHRDTTDDESFAYEDSDGEEDRPYLEDGYPVSDTATVTGGTDDALDDS
FT                   FTVESLSAPDSATTNETIEITAEVANPTDLGSQQSVTLRLDGAVLEQQALELGAGETGE
FT                   VTFEIETTGLAPGNRTIGVYTEGDGKLDEIELTFHTTPGIEIVNGSDDSITASVATPEE
FT                   GFVAVEDGNDTVVGTSEQFGPGEHDNVTVGFDENATVEDDEELTAFVATGDPSEPENAT
FT                   PLEYEGEPIETTFTLADVDDEDGGDGESNESETDDGE"
FT   sig_peptide     complement(58541..58618)
FT                   /locus_tag="Htur_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.390 at
FT                   residue 26"
FT   gene            58851..59795
FT                   /locus_tag="Htur_0053"
FT   CDS_pept        58851..59795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0053"
FT                   /product="ribonuclease Z"
FT                   /note="TIGRFAM: ribonuclease Z; PFAM: beta-lactamase domain
FT                   protein; KEGG: mxa:MXAN_0663 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58954"
FT                   /db_xref="GOA:D2RTB1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB1"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ADB58954.1"
FT                   /translation="MPLRVTFLGTAGAIPTTERNPSAIFVAREGEELLFDAGEGTQRQM
FT                   MRFGTGFSVSHLFVTHLHGDHVLGIPGLLQTMDFNDREEPLAIHTPHGTRRQLKGLVNA
FT                   LGNRPSFPVRINEVGDGDVAYRADEYEVRAFATDHDARSVGYALVEDDRKGRFDRERAE
FT                   ELGVPVGPKFSKLHEGEPVELEDGTVVEPEQVVGDPRPGRAIVYTGDTRPAAATVEAAD
FT                   DPELLIHDATFADDRADRARKTAHSTARQAAEIANRAGADQLALMHLSSRYAGQTDAHL
FT                   EQAREVFAGDETDVFVPDDGQALEIPYPDGESE"
FT   gene            60119..62095
FT                   /locus_tag="Htur_0054"
FT   CDS_pept        60119..62095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0054"
FT                   /product="Protein of unknown function DUF460"
FT                   /note="PFAM: Protein of unknown function DUF460; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58955"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB2"
FT                   /inference="protein motif:PFAM:PF04312"
FT                   /protein_id="ADB58955.1"
FT                   /translation="MSTRTSALDAVVFGVDIQSGDVRGDAPSYALAVYDGEDVTRDVVT
FT                   HRKLRRLIDDEEPAIVATDNMYELAADKDQLIHFLGSLPAGTKLVQVTGAEQPEPLSRV
FT                   AKRHGIPYGKDPMQEAEAAARLAAHNVGHEVSAFTDTTEVKVSRGRSTGSGGWSEDRYT
FT                   RRIHGSVRKRAREVESELEDANLEYERDVREAYGGFANAVFTVQARPSDIPVSRNRSGD
FT                   VRVEIERERRDGIEFKPLVKRRDHVIVGIDPGTTTAVAIVSLEGDVLDVWSSRTSDTAD
FT                   VIEWIVERGRPIIVAADVTPMPETVEKFRRSFDAAGWVPDSDLPVDEKQHRTRDEPYDN
FT                   DHQRDAMAAALYAVDAHEDQFDRIAGKLPPGIDRGEVTARVVAGEESVEAVLRDLTDDE
FT                   SGEEEDSTTHEPRELTEEEKRIKSLERQVERLQSHVETLEGRVEERDERIEELESELTL
FT                   KRREERTQVRKDREVSRLERKANRLERERDEAREAVDELERKVERMKALWKLDHSNFSD
FT                   VSAKKEGLVPVKVVEKFTKGAIREADEQYGLASDDVVYLRDASGAGRSTAELLAGFEPR
FT                   VILKDGGLSEVADEILFDEEIPVGPADDVAMQEVDELAVAREDDVEAVIDDWHDRAEER
FT                   RRDRKASMVDQLISEHRAGDNEV"
FT   gene            complement(62155..62409)
FT                   /locus_tag="Htur_0055"
FT   CDS_pept        complement(62155..62409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58956"
FT                   /db_xref="GOA:D2RTB3"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58956.1"
FT                   /translation="MGYSLHYYDLVLLCIAASLGLGAGIGYATAIALEISIAVLGLVAL
FT                   GFIVHALFVNGPVDQPEELTDEVDIEEVPQVLSPVESAD"
FT   sig_peptide     complement(62317..62409)
FT                   /locus_tag="Htur_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.499 at
FT                   residue 31"
FT   gene            complement(62489..62668)
FT                   /locus_tag="Htur_0056"
FT   CDS_pept        complement(62489..62668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58957"
FT                   /db_xref="GOA:D2RTB4"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58957.1"
FT                   /translation="MLKNLDALGIVGLLILLGGIGLIASQNLLIALGMALIVGGLGLVI
FT                   KSLISGMLQNFGMF"
FT   sig_peptide     complement(62594..62668)
FT                   /locus_tag="Htur_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.488 at
FT                   residue 25"
FT   gene            62913..63203
FT                   /locus_tag="Htur_0057"
FT   CDS_pept        62913..63203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0057"
FT                   /product="translation initiation factor eIF-1A"
FT                   /note="KEGG: translation initiation factor eIF-1A; K03236
FT                   translation initiation factor eIF-1A; TIGRFAM: translation
FT                   initiation factor eIF-1A; PFAM: S1 IF1 family protein;
FT                   SMART: initiation factor 1A (eIF-1A)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58958"
FT                   /db_xref="GOA:D2RTB5"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB5"
FT                   /inference="protein motif:TFAM:TIGR00523"
FT                   /protein_id="ADB58958.1"
FT                   /translation="MSDDGNGGRKNLRMPEDDEVFATVTDMLGANRVQVRCADGQERTA
FT                   RIPGKMQKRIWIREDDVVLVEPWDWQDEKADITWRYEKSEADQLRDEGHIQ"
FT   gene            63648..64997
FT                   /locus_tag="Htur_0058"
FT   CDS_pept        63648..64997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0058"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: gem:GM21_1195 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58959"
FT                   /db_xref="GOA:D2RTB6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB6"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADB58959.1"
FT                   /translation="MKLSRRRLLGGIGAGAAAGLLGVPASAAESSIGTDTERVFVHPQT
FT                   SVLDGLGELLDVVEAVGGTTVLEYDNFEFVVAEVPSTGLDELRQDRRVATVEEDDETGI
FT                   PGDWSPSLSDIFGSPGGSDCSSHPDQRPSWGVERIGAHDVDSSGSDVDVGILDTGIQSD
FT                   HCSLSVAGGRNFTADGTAGDYEDRHGHGTHVAGIAGADDNDRGVVGVAPEANLYAVKVL
FT                   DDDGSGRYSELIAGIDWCMSNDVEIISMSLGGEAESSTLAGAIEDAHSAGHLLLCAAGN
FT                   EGNDGSDSCAAETMTYPATHEDVVAVTAMDENDRLASYSSVGSAVDLLAPGTNVTSSTV
FT                   DNEYAEASGTSMACPFVAGVAALVWETREEDGPGPNGPVREILGETAETVLGTCAEGDG
FT                   LVNAPSALGDERAAEGSDWSSGPVGGLRSLLERFVDLIVGFFEWLWSLVS"
FT   sig_peptide     63648..63731
FT                   /locus_tag="Htur_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 28"
FT   gene            complement(65379..66491)
FT                   /locus_tag="Htur_0059"
FT   CDS_pept        complement(65379..66491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0059"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: gur:Gura_0866
FT                   alanine--glyoxylate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58960"
FT                   /db_xref="GOA:D2RTB7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB7"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADB58960.1"
FT                   /translation="MTEKREYKDDYPDKTLYIPGPTEVREDVIEEMSQPMFGHRMDRMT
FT                   DLYTTIVEDTKEFLGTDNEVIILTGSGTEFMESSILNLVDENVLVTTCGSFSERQANVA
FT                   ERLGKSVDTLEYEWGQAVKPEDVRERLEESDTEYDVVTCVMNESSTGVRNPIEEIGDVV
FT                   AEFEDTYFVVDAVSALGGDLVEIDDHDIDVIFTSVQKAFAMPPGLAVCVVSDDAYEREL
FT                   ESDSASWYGGFQRSLDYYDRKGQTHSTPAIPVMLAYRKQMKYMLEEGHEARDERHREMA
FT                   EYTREWAREHFDMFPEEGYESQTVSCIENTRDIDVAATIDAVSEEYDFVFSNGYGSQLG
FT                   EQTFRIGHMGEHDLESIKELTDAIEDVADL"
FT   gene            complement(66695..67651)
FT                   /locus_tag="Htur_0060"
FT   CDS_pept        complement(66695..67651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0060"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   sarcalumenin"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58961"
FT                   /db_xref="GOA:D2RTB8"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB8"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADB58961.1"
FT                   /translation="MSNSDRLTRRTVVRAAGLATATAALAGCIDESSVDDPDDSSDADS
FT                   QPSDEQGSEPDETDDEGQSNGDEAADDDAEAAPLEIELRGELDGWRALEPAGIEGDVNP
FT                   TLPLEAGRTYRLGWMEGDGLGHNIEIRDARDDVIDDLSTPVTQEPGEEQWLEFEATEEM
FT                   AAYVCTPHESTMRGDIVIETPVDRGSDESDDEGSAAGQEVRIEPGTRVEFRAQTIEWEG
FT                   ITPASVEGLPNPTFVLEDGESYELGWTEGDGTVHNIEIRNDDNEVVDGLSTELTSEEEP
FT                   SDQFLTFEASAEMAVYACEPHQNTMQGEIRIEGATPE"
FT   sig_peptide     complement(67571..67651)
FT                   /locus_tag="Htur_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.864 at
FT                   residue 27"
FT   gene            complement(67868..68383)
FT                   /locus_tag="Htur_0061"
FT   CDS_pept        complement(67868..68383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0061"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   similar to hyphally regulated cell wall protein HYR1p"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58962"
FT                   /db_xref="GOA:D2RTB9"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTB9"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADB58962.1"
FT                   /translation="MVAGCGGGSGNGDENGNGNGSSDGYEIEPDTTVELEAATTEWTGI
FT                   APSDIEGESNPTLILQAGETYEIGWTQGDGSGHNIEIRDDSGEVVNDLATEQTDEEEPS
FT                   DQMLEFTASSEMTEYVCKPHSSNMVGELQVEGSNGGGNGNESEGNESGNESEGNMSEGN
FT                   ESGNESEE"
FT   gene            complement(68718..69950)
FT                   /locus_tag="Htur_0062"
FT   CDS_pept        complement(68718..69950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0062"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tmz:Tmz1t_1810 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58963"
FT                   /db_xref="GOA:D2RTC0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB58963.1"
FT                   /translation="MHSSDRDRIVLAAVVFAVLFSQLLLYPGVSTLVDALGADAATSAF
FT                   AATDLDASMWFLVAEFAGYVAFVGVWGAASDITGRRTPFIVAGALAGAASYAALAAVPA
FT                   IGSIPFEGVLVMRFVQGAMTIGAFSLTMTMLMDLEGGHGRNMGAAGIAIGLGAALGAPI
FT                   GGQLSEVNPLAPLLGAAGLLVVVGLLVTRVPDRSPDSRRAVRALLEGVRKRPALSIPFA
FT                   FGFIDRMTAGFFALVGTLYFQDAFGVGPAVTGLLLACFFAPFALLQYPMGALSDRIGRT
FT                   IPIVVGSVCYGVGILAVGAAPSVATAAIGMVGVGVLGALVSPATMALVTDIAAESERGL
FT                   AMAGFNVAGSLGFLGGFLVGGTVAGDYGYGLAFLAVGGLEIAIALLAVPVFLRLSIGRG
FT                   DEFATEDRGSL"
FT   gene            70067..70723
FT                   /locus_tag="Htur_0063"
FT   CDS_pept        70067..70723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58964"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58964.1"
FT                   /translation="MTLTRRGLLAAGATAGASALAGCTDFVADSLSSDRATVARAALQE
FT                   TGYAERTVEEVVVERTVGRFGLERTIEARNWYAEYDRAIALDALGLGRLQASVVSVLTT
FT                   PQVSVLGKTFNPVGDYSTDELVALIQSRYDELEGVERVGEESVSVLGTETTLVRYRAEA
FT                   RLIDAGTTVDVFLQVSEPVAHGDDFVIGVAVFPQARGFETESGNVRTLLEALEHG"
FT   sig_peptide     70067..70132
FT                   /locus_tag="Htur_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.866 at
FT                   residue 22"
FT   gene            70857..71537
FT                   /locus_tag="Htur_0064"
FT   CDS_pept        70857..71537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0064"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   sme:SM_b21433 putative methyl-transferase, S-
FT                   adenosyl-L-methionine (SAM)-MTase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58965"
FT                   /db_xref="GOA:D2RTC2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC2"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB58965.1"
FT                   /translation="MTQPTRDDETVKEFVRRHWDGRAATFDEEPQHGIHTDEQRDRWLE
FT                   VLRERIGDEPRRVLDAGCGTGVLSLLLAELGHDVTGVDFAPSMLERAREKARATDHSIE
FT                   FHRGDAESLAVPDDAFELLTARHLVWTLPNPAAAIREWQRVVEPGGRILLVEGYWDHDE
FT                   PWDEYEEIHDDLPLYDGRSPDELREVLLEAGLRDVEYDPLRDPTLWGRAPRHDYYLMSG
FT                   TVPR"
FT   gene            complement(71570..71908)
FT                   /locus_tag="Htur_0065"
FT   CDS_pept        complement(71570..71908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0065"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   sun:SUN_0506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58966"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC3"
FT                   /inference="protein motif:PFAM:PF08754"
FT                   /protein_id="ADB58966.1"
FT                   /translation="MQTVFHLIADDPDQQQTALTIAKNLTEDDSVEIGDIAIVAQAEGI
FT                   EPLTAGGDGSDMVEELLERGLSVKACGNTLELKDLAESDLVDGVETVPSGGGELTRLQD
FT                   EGYAYIRP"
FT   gene            72259..73590
FT                   /locus_tag="Htur_0066"
FT   CDS_pept        72259..73590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0066"
FT                   /product="O-acetylhomoserine/O-acetylserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: hypothetical protein; K01740 O-
FT                   acetylhomoserine (thiol)-lyase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate- dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58967"
FT                   /db_xref="GOA:D2RTC4"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC4"
FT                   /inference="protein motif:TFAM:TIGR01326"
FT                   /protein_id="ADB58967.1"
FT                   /translation="MSDDASDGTADESERPERGLGTRSVHAGQSPDPETGAMAPPIFQT
FT                   TSYVFDDADTAADRYALEDDGYIYSRIANPTVRTLEKRLASLEGGADAVATASGMAALD
FT                   SATLILAEAGDNVVCSTDTYGGTTAYLSKTASRREIETKFVPTLEYDAYDDAIDEDTAF
FT                   VHVETIGNPSLVTPDFERVAEIAHENGVPLVVDNTFATPALCRPLEHGADVVWESTTKW
FT                   LHGSGTTVGGVLVDGGSFPWGKHGYDEIAGPNHAYHDVDFSRDFPEAPFAATARYRSLR
FT                   SLGNQQSPFDAWQTLQGLESMPLRVEKHCENAQVVAEYLADHEDVAWVTHPGLETHPTH
FT                   DNATRYLSDFGGMVAFGLEGGFEAGKTFCESVEVAQFLANIGDAKTLVIHPASTTHGQL
FT                   TPEEREEAGVTDDLIRMSVGIEDPEDILADLEQAIEAATRAVSD"
FT   gene            73616..74827
FT                   /locus_tag="Htur_0067"
FT   CDS_pept        73616..74827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0067"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="KEGG: dol:Dole_0752 homoserine O-acetyltransferase;
FT                   TIGRFAM: homoserine O-acetyltransferase; PFAM: alpha/beta
FT                   hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58968"
FT                   /db_xref="GOA:D2RTC5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC5"
FT                   /inference="protein motif:TFAM:TIGR01392"
FT                   /protein_id="ADB58968.1"
FT                   /translation="MTTKDTIDLGEFQFLSGETIPSLEVAYETYGEFTGDNAVLVCHAL
FT                   TGSSHVARRPDSGGDTAGQARAWWGDVVGPGKAIDTSEYYVVCANAPGSCYGTTGPATE
FT                   NPETGEPYGTDFPPVTVGDWTRSQRKLLDELGVGRLRAVVGGSVGGMNVLDWLRRYPDD
FT                   VERAGVVASAARLDPQCLALDTVARRAITSDPNWNGGHYYGGPEPTDGLARARQIGHIM
FT                   YLSKPSMARKFGRRSAGREAVREEPTDPAAAFFPYREVESYLDYQADKFTDRFDANSYL
FT                   YMTRAMDDFDLSAGYESDADALAAFEGELLLLSFTGDWHFTTEQAEALAEAARESNVDV
FT                   AHHVVESDHGHDAFLVEPEKVGPPLSDLLETGLSGRAITDTADDDEPAETESFAPVHTS
FT                   LFSE"
FT   gene            74946..75761
FT                   /locus_tag="Htur_0068"
FT   CDS_pept        74946..75761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58969"
FT                   /db_xref="GOA:D2RTC6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58969.1"
FT                   /translation="MADERQLEYEDEQTADRSAQQPAVERANAGGSDLPIKQGAVFGAI
FT                   ALIATYLSHLFLTAIATARSTPAAGMVGEGEDASLVVAEMVASWKAAGWSYLSTFGTGF
FT                   EAEGEVASLGGVPNHGAASVSGAFSMSTLFLFLVTIGGIAAAGYAVARHTEADDAVEAA
FT                   KAGVTVAVPYFAFALLAALVMTHTFSEGPAIEALVGGEFSSGAVPGLEAADYLGSEGHV
FT                   TSEVEFGPSVTDAILYAGLIVPVVLGALGGVAAQREDALEKLMAKVDQL"
FT   gene            complement(75884..76279)
FT                   /locus_tag="Htur_0069"
FT   CDS_pept        complement(75884..76279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58970"
FT                   /db_xref="GOA:D2RTC7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58970.1"
FT                   /translation="MMWQDFIFMIGSGLSIIFLAPTLRDASARVPLGTSLPSMAIGFVY
FT                   GMTFLSLGMANSAMGSLAAGTMWALIAMIRSPTGMSITGRLSRLESPVLFASDLRRWLT
FT                   GSSSSIDAEQFVATDHQYQSSADGSAD"
FT   gene            complement(76497..77147)
FT                   /locus_tag="Htur_0070"
FT   CDS_pept        complement(76497..77147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0070"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /note="TIGRFAM: phosphoserine phosphatase SerB; HAD-
FT                   superfamily hydrolase, subfamily IB (PSPase-like); PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase type 3; KEGG:
FT                   hha:Hhal_1598 phosphoserine phosphatase SerB"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58971"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC8"
FT                   /inference="protein motif:TFAM:TIGR00338"
FT                   /protein_id="ADB58971.1"
FT                   /translation="MTVVAFDFDGTLSDSEMTVLLGDRRGVADDMAEITERSMNDEIDY
FT                   AESLYQRAALLESLPKAEADAAFDQVELREGAADLIAELNDAGVTTAILTGGFERGVAA
FT                   ALEREDVSVDHIVSNRLPMQDGELTGAVEGPLIEGTKDDALEDLADDVGVDLADTVAVG
FT                   DGANDLPMLEVAGLAIGFEPKPAVEPHCDVVVTSMAEAREVLFEEGVLAERGE"
FT   gene            77306..78205
FT                   /locus_tag="Htur_0071"
FT   CDS_pept        77306..78205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0071"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: eba:p2A115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58972"
FT                   /db_xref="GOA:D2RTC9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTC9"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADB58972.1"
FT                   /translation="MTTSATLEVLALALVPAILWGFTPIFDKRGMAAGGDSVQASLVVA
FT                   LVDSGIYWLVIAALYGRSAFSELTLEILAVFAFAGVVGTAVGRIAIFVGVDRVGASLNS
FT                   AILSTRPLFASLLALTWLGEPLGPVTGVGIVVLVAGLALLTASRGGDLSGWTPRDLLWP
FT                   IAAAATFAVANVARRYGMLETPLSALEAVALNETAGLVALVAYVFAVSGRDALERPRES
FT                   YRYFAGSGLLTAVAMLSLMTALGLESGRIALVDPLVATAPFFTLVFAAVLLRDVERVTK
FT                   GVVAGAVLIIVGAALITL"
FT   gene            complement(78355..79134)
FT                   /locus_tag="Htur_0072"
FT   CDS_pept        complement(78355..79134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0072"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; MOSC domain
FT                   protein beta barrel domain protein; KEGG: hch:HCH_04763
FT                   uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58973"
FT                   /db_xref="GOA:D2RTD0"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD0"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ADB58973.1"
FT                   /translation="MARLERLRVYPVKGLDGIELEATDVLAGGTLASDREFALFDADGE
FT                   VLNGKRTDRVHDLRTDYDAKTDALEVEAPDGEVARFDLEMECDRAADWFGDFFDEDLTL
FT                   ERDRELGYVDRREMGPSVISTATLETVAGWFEDEGMTVEGARRRLRANVEIGGVEPFWE
FT                   DRFVGEGAPAFEIDGVRFEGVTPCGRCVVPQRDPETGEPIDEFRQRFVRKREETFPDWA
FT                   DADAFDHYYTVMLISRVLEADRGEALRVGDSVSVVET"
FT   gene            complement(79273..79827)
FT                   /locus_tag="Htur_0073"
FT   CDS_pept        complement(79273..79827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58974"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58974.1"
FT                   /translation="MKELPTETANAPPHMTANQRSKQPNGSSAATGESSNNASKRRVGA
FT                   ASIVIVGSSASLEAAPPDAEDESAEVDAQSEEGQLVLVSLDDYRPGLTVRVVDRLPATT
FT                   VVRLLRPPDGGTVPVLTQPDEYTGYVARSRLEGGAVGTATHLFAREPLETGTTYKLVAD
FT                   AQVFSTRLNLFRVTARRVDEE"
FT   gene            complement(79942..80268)
FT                   /locus_tag="Htur_0074"
FT   CDS_pept        complement(79942..80268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58975"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58975.1"
FT                   /translation="MVQDDPGQILVFTYDYEAGEDFEVLSQLETSTTVQILQTAEEETV
FT                   PEISQPDEYVGHVVRYQVDGGPVSPTTLVFIRNGSISTGETGTLGEEATMFSPTLNLLS
FT                   TDVE"
FT   gene            complement(80271..80774)
FT                   /locus_tag="Htur_0075"
FT   CDS_pept        complement(80271..80774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0075"
FT                   /product="calcium-binding outer membrane-like protein"
FT                   /note="KEGG: pfl:PFL_0133 calcium-binding outer membrane-
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58976"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD3"
FT                   /inference="similar to AA sequence:KEGG:PFL_0133"
FT                   /protein_id="ADB58976.1"
FT                   /translation="MAKGALATGALTLGTGAFGTATVSAQADQVAVFANNYYPGGNFDV
FT                   IAPLQTSTTVEILQVDGETVSEISQPDEWSGHIIRYDIGEQAGITTFLFVRGQSLSAGD
FT                   SGTMGEDASVLSSDLNLIGTALGSSGDTVEEEDTVEEEDTVEENETTGNETTGNETVAD
FT                   MGGD"
FT   sig_peptide     complement(80691..80774)
FT                   /locus_tag="Htur_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.820 at
FT                   residue 28"
FT   gene            81526..83427
FT                   /locus_tag="Htur_0076"
FT   CDS_pept        81526..83427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58977"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58977.1"
FT                   /translation="MVLNSNGNRTLPRGVSRRRFVATAAGSAGLLSIAGTSSAQDDDGG
FT                   FSDARLVSTRDFDAATIQTLYTYRKRRALEVLLSDPEVHAVAEDMRSSYEAYDPYTNSL
FT                   DAVSVQGSPDVEIEGDLDEGVFDVTAVDRQIAYGLVDRRTDSLAALTITDPQDVSWRAW
FT                   EVGDAGLEEARLRRVFEDARVQEYVDGNDWFPSLPIAESITATGEIERGGVIPVALFVD
FT                   EGEAITAVVVDLDVRNDDVGSVSDVTRVERFVEVPPHELAATIVPADDTVLGTVPAVPL
FT                   ERRPWYTAVDGGHRIEEPPEPFDRAGWRIGWDDSGNHGVEIAAEFRDRPVFASLGSPAT
FT                   LSGYGLPERDGENTLEWFFPDDEFAFSGDLLVWDVHSAALGGPGLLGVVTYPAGADRPA
FT                   GFRFRSHYQTGARGAEGRDHRSGYRFGQSSHELATEFWNDGTIVPIWRRQGPGFVTDYA
FT                   STRTDSVFADAETDLETDPDTGTDGDASENGVPHHSIATVAMDVTPGTIDGVEIARYDG
FT                   DEWTTPETEFYLVGEPGTAVRFSNPEGPETIGVPLEDGMEVVVVRRSAGEVPGAQRLAD
FT                   RGIETAFVHPAQYIGDEPIQGERVVAWLLLEAATGRLPHPTGSTSFETQATMRLSGY"
FT   sig_peptide     81526..81645
FT                   /locus_tag="Htur_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 40"
FT   gene            83522..85108
FT                   /locus_tag="Htur_0077"
FT   CDS_pept        83522..85108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0077"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="TIGRFAM: D-3-phosphoglycerate dehydrogenase; PFAM:
FT                   D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding;
FT                   D-isomer specific 2-hydroxyacid dehydrogenase catalytic
FT                   region; amino acid-binding ACT domain protein; KEGG:
FT                   sfu:Sfum_3649 D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58978"
FT                   /db_xref="GOA:D2RTD5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD5"
FT                   /inference="protein motif:TFAM:TIGR01327"
FT                   /protein_id="ADB58978.1"
FT                   /translation="MKVLVTDPIADAGLDVLRDAGHEVETGYELEGEDLLEAVSDANGM
FT                   IVRSGTEVTAEVLEAAEELAIVGRAGIGVDNIDIDAATDEGVIVANAPEGNVRAASEHT
FT                   VAMTFAAARSIPQAHIRLKNGEWAKGDYLGAELDGKTLGVVGLGRVGQEVAKKLDSLGM
FT                   DIVAFDPYISEERADRLGAELVDFEDCLARADFLTIHTPLTPETEGMIGEEELDLLEGG
FT                   YIVNVGRGGIIQEDALAAKVEDGTLAGAALDVFAEEPLSPDSPLLEHDEIIVTPHLGAS
FT                   TEAAQENVATSTADQVNAALAGEPVANALNAPSIDESAFPRLEPYIDIAETAGKIAAQL
FT                   LEGRIEDIEVVYEGDIADEDVEFVTASALKGVFEPLEWQVNAVNAPQIAEDRGVDVTES
FT                   KTRQAEDFQSLISVTVSNDDDEVSVDGTLFAGDDPRIVRVDGYRVDAIPHGKMVVTRNT
FT                   DEPGVIGLIGSVMGDHDVNIAGMFNARETIGGEALTVYNVDSEIPDGAREELEADERII
FT                   GLNYITLNGQA"
FT   gene            85577..86674
FT                   /locus_tag="Htur_0078"
FT   CDS_pept        85577..86674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0B09867p"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58979"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58979.1"
FT                   /translation="MSRDIALLDMNRRKFIAATSVGVGMAGCLTGNGTDDGDDGTDGTN
FT                   DANIDVNDSEEGSHSSDPGTDGDGSQNDSNESSADSEPDESDDTNETDGEDDDENETDD
FT                   PSGQTTSFDSCTRATVSGSFADGDVAFASTGFYDEDGLFGNTIIEDGVVFGDAVDAPFS
FT                   GTVVFEIGDGAGVSEGSDEIVVTVPDYGGVGTVITSLTTEQADYAAGAPTTPNPHAEDC
FT                   LSELEAEAGGGDDNGGDGDSDTGDDGDTDGDDSESDGDAGDGAASFAVSILNTNSPVDA
FT                   GDSLEGTVEVRNTGGAAGSGTVDLIVGNDPTTVESRSVSLEAGERTTFTMGYQTPPVAS
FT                   DQEFPVRAETADDSDQQTVRVRGVQ"
FT   gene            86936..87310
FT                   /locus_tag="Htur_0079"
FT   CDS_pept        86936..87310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0079"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="PFAM: phosphoribosyl-AMP cyclohydrolase; KEGG:
FT                   dvu:DVU0113 phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58980"
FT                   /db_xref="GOA:D2RTD7"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD7"
FT                   /inference="protein motif:PRIAM:3.5.4.19"
FT                   /protein_id="ADB58980.1"
FT                   /translation="MDDDVSVDFGEDGLVPAVAQDAESGEVLMLAYVSPEALERTRETG
FT                   RAHYYSRSRDELWEKGATSGHVQEIEEVRVDCDADTLLYLVDQEGGACHTGYRSCFYRT
FT                   IDGENVGEEVYDPDDVYGDE"
FT   gene            87317..88498
FT                   /locus_tag="Htur_0080"
FT   CDS_pept        87317..88498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0080"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Tb-291 membrane-associated protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58981"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58981.1"
FT                   /translation="MSERAHRAGVDAGSGSGADGQSPLEALEGARRRFEEADRQIADAG
FT                   GDAVAEAAEAYRDATTLLEDYVDRATGTGRENFKAYVELEGQFDSLVSGLPDDLKGREA
FT                   FEEALDAIDKRRLSESDFERAHEALEPAARYAELLDEREAAREAIAEARTAAAKRRREL
FT                   GDEISERERLVELGEADLEAPVEELREPIEAYNEAIETAFEEYRLEASAREVFELLERS
FT                   RWYPFVDYERPPDDLETYVREDPAGEYTLPELLEYANYSRSKLEHYVSSADELKRRVAT
FT                   QQTFLDGIDAEPLTIPWPPGEAGALRHRVRECRPFVERVADEDAVAKLRSIRRLTTDPD
FT                   FEYDRLQTAAQAVARLSADERERLADGRVADELESLRRERERLEEALEVEDPI"
FT   gene            88575..88988
FT                   /locus_tag="Htur_0081"
FT   CDS_pept        88575..88988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0081"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: reu:Reut_A1213
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58982"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTD9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADB58982.1"
FT                   /translation="MTRQLLVPMDDSETARAALEHALSVFPNDEVTVVHVVDELEAGYG
FT                   GRPPMTDSGGTDADEPNFFADVREIAAEHDRRVETAVVEGTSAEAILEYVDANDVDGIV
FT                   MGSEGRSGVSRMLLGSVAEAVTRQASVPVTIVP"
FT   gene            89144..89653
FT                   /locus_tag="Htur_0082"
FT   CDS_pept        89144..89653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0082"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4638 CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58983"
FT                   /db_xref="GOA:D2RTE0"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58983.1"
FT                   /translation="MDDRLGTTLHTGLLLSTTAVLAWLSGFPMLFPSLGPSAFVLALFQ
FT                   DSDATSPRRVIGGHAIGVVAGLLAYHSFGVTLSITAATDPGSLAGLRLVSSGVVATMLT
FT                   AGGMLWTETRHPPACATTLIVSLGLLSTPLEGALIVVTVVVLVVAHELLLATERVGARY
FT                   GDRLRS"
FT   gene            89825..91675
FT                   /locus_tag="Htur_0083"
FT   CDS_pept        89825..91675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0083"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; SMART: PDZ/DHR/GLGF domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58984"
FT                   /db_xref="GOA:D2RTE1"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE1"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ADB58984.1"
FT                   /translation="MDALTTLLLLGLAAASATVLAMALEARGLLPPWVSVWGPVVTFET
FT                   ENGLGALDRLARPRYRRFWRRWSDVGTAISLLLLVAMTAVVLFAAYVALTREAATQVNQ
FT                   PRNALAIPGVNDFLPLAATPAILVGLAAAVVVHEFSHGLLARVEDVAVESAGLIFLALV
FT                   PFGAFVGIDEDDEAAASTAARNRIYVAGIANNLAVALIAFLALFLLVSTSIAAVSGVAV
FT                   GGVYAGTPADQAGLERGDVVTAVDGRAVEDADDLRTALDATDERVELTVAGGRDDARTV
FT                   TLERSVVVTSTLEGDAASADGGERSDSGTDGGDGNATTLEPGETITAVDGTRVDTEREF
FT                   RAALENRTVATLETEDSSTTIIAGAAVAAIDVDGPLATAGAPDPDGDPRTLVITRLEGE
FT                   RIVDSDDLLETLAEVSPGETVALEAVVDDERREYEVTLGDRNGEAVLGITTVPGTSGTT
FT                   VTDLGVDPHPSAQHLGILRGQPVADGLGSSPLERGFAVFALPFAGLIAGFSTANFGGFV
FT                   GSIADFYAVTGPLSVLGGSVFVAANVLFWTWWLSLLVGVFNCIPCYPLDGGKLLRTTVE
FT                   AAGSRTGLERPDRSATAAMVAASAVVVVAILLVLSSPFLG"
FT   sig_peptide     89825..89890
FT                   /locus_tag="Htur_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.506 at
FT                   residue 22"
FT   gene            complement(91998..93362)
FT                   /locus_tag="Htur_0084"
FT   CDS_pept        complement(91998..93362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0084"
FT                   /product="Phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="PFAM: phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain I;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: bbt:BBta_1817 phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58985"
FT                   /db_xref="GOA:D2RTE2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR024086"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE2"
FT                   /inference="protein motif:PRIAM:5.4.2.10"
FT                   /protein_id="ADB58985.1"
FT                   /translation="MQVFGSSGTRGVANEELTPAFVLRVAKAAGTAWGVDRVGLARDTR
FT                   YTGRMLADAAASGLASTGTDVDRLGILPTPGAQAYAERERIPVMVITASHNPPQYNGVK
FT                   LVGSDGIELAITDLEEIENVLLAEAFDVASWDETGRVREVDGVRASYIDELLAAADYET
FT                   ISDAELTVALDPGHGAGALTSPEFLRELGCRVVTVNGQPDGHFPGRDPEPVPDNLEDLG
FT                   ELVRATDADVGIAHDGDADRAIFFDETGEYVEGDATLAALAAAELEAGDTTVSAVNVSQ
FT                   RLVDVVTEVGADLELTPIGSTNIITRIEELEANGERVPIAGEGNGGIFFPDFRLSRDGA
FT                   FTAARFLELVAERPVSEIVAPYGGYANVRHNVAYESTAERDAMLDAAANHAQSADAELN
FT                   TRDGYRLDYGDAWVLARPSGTEPLVRVYAEARNRERADELADEMFETLTEAKAEV"
FT   gene            93445..94332
FT                   /locus_tag="Htur_0085"
FT   CDS_pept        93445..94332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58986"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58986.1"
FT                   /translation="MHSIEEKRVYGDREGALEAYVASSIGVVRVRVADDTVGEFGLCDR
FT                   CTARDIAATDGVVAIATDEDVRLLDLERGDDADDATVVDSGFGPAVAVGADNSGLVAAG
FT                   PDGGVARLESPSVGLGDAGSAREWTPLESDGVAAVRAIDGDLVGTESGVYRVHEGCLDH
FT                   AGLSDVRDVSAAGVPLAATEDGLYKLGNGWMQALEGAFETVAADPRSERGQLTRAHAVG
FT                   GDAVYAYDADDESWTEYDRSSAPIVGIGYGRTVYAVTERGTFLSATPDDEANRWRSQTI
FT                   GVSGVTGLAVPGGE"
FT   gene            94417..94926
FT                   /locus_tag="Htur_0086"
FT   CDS_pept        94417..94926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58987"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58987.1"
FT                   /translation="MSGIQRRRLLAATGVGLTGAIAGCLGSDETDGANGDENGDEDGNE
FT                   NETETEDDEIAESVSGTIVVDNLDDASHTFDILIEYDGQIQHWETRSPGADETLSFDHS
FT                   WSVDREQFRVTARLNGGEPVNITPSNWNESSCLSIFVRITDGETMTYSSNTDPGHCEST
FT                   TDDESE"
FT   sig_peptide     94417..94497
FT                   /locus_tag="Htur_0086"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.523 at
FT                   residue 27"
FT   gene            95017..95871
FT                   /locus_tag="Htur_0087"
FT   CDS_pept        95017..95871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0087"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: ppr:PBPRA2849 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58988"
FT                   /db_xref="GOA:D2RTE5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037514"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE5"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADB58988.1"
FT                   /translation="MTTIVSGSASQTLAASLADELEVSLAAVEYDRFPDGELLAAAPDF
FT                   DDDRAIIVGSTVSSDAHLELLQLQDAVREAGAEDVVTVLPYMGYARQDEAFEAGHPVSA
FT                   RAVARSISTGTDRVLTVNPHETAICEFFEPTATAVDAAGRLADPLPADLADPVFLSPDA
FT                   GAIDLAETVRDAYGDGETDYFKKTRHSGTEVEISPSDVDVAGRDVVVTDDIIATGSTMS
FT                   EAVGVLRDRDVGRVFVTCVHPLLARNAVTKLRRAGVETIYGTDTIEREVSAVSVAPAIA
FT                   DEL"
FT   gene            complement(95976..98063)
FT                   /locus_tag="Htur_0088"
FT   CDS_pept        complement(95976..98063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical LOC729792"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58989"
FT                   /db_xref="GOA:D2RTE6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58989.1"
FT                   /translation="MLVLLGTVPAGIAGAGGSPTASDPAAGSAGALESTAVSTATAESS
FT                   AATKTDAEAAAMAEADDILHRTIELRHLPDRPDVYEAEFTFDIPEPMSSLTVDLEDEAE
FT                   VQSTDGFEATDEGTYRWTGDGEAPSIRVRLPADRTGTGARVDSSRSGYSFVDTGEWGVV
FT                   PVPGVSVSYRREADVSIGIEETVTVDGPGATGGDIAVFGPVTEYERTENGETIRLVVPE
FT                   AADLHEDPDDILEALGDASDRLSIAPSDEEVFVAAVPSDADWGSRGLQYGAADAWVRAD
FT                   APLSEASNVWLHEYVHVHQRFANGEVGSDAEWLVEGGAEYHAASLAYEQGLISFSEFRD
FT                   HVERGERSPYADGVLAEPETWGHERTDYTKGALVYGELDRQLREATDGDRRLEDIVRTL
FT                   NAQDERVTAADVLAALEAAGGNELRASAERYAHTTSTPEMWSYYEHQATFGQSRTATTS
FT                   GLGDEPVTVDGREWERWDRAALSGPATEIGAGDVLAVPARERVTVPVALENVDDRAGTA
FT                   DATLQVDGDVVATERRVLEAGERATATLVWTPAKPGIYDVRVGGDRLTVYVRSTPSLTV
FT                   TDLRVEPAGVDPGETVTATASVATADSLPAAGRLAFRTASGTEHGEPIALAPGETGSVA
FT                   AELTFDDAGDYEISAGERTATVSVGGIKSTVESMPGFGVAAAAVALGLAVAISTVGRRR
FT                   H"
FT   sig_peptide     complement(97998..98063)
FT                   /locus_tag="Htur_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.612 at
FT                   residue 22"
FT   gene            complement(98661..101867)
FT                   /locus_tag="Htur_0089"
FT   CDS_pept        complement(98661..101867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0089"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG: bba:Bd2257
FT                   isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58990"
FT                   /db_xref="GOA:D2RTE7"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE7"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ADB58990.1"
FT                   /translation="MSRFGEVDDQYDPHELEGRIFDYWDDVDAYEQTVEHRSDGESFFF
FT                   VDGPPYTSGSAHMGTTWNKSLKDVYLRFLRMQGYDVTDRPGYDMHGLPIETRVEERLGF
FT                   ENKKDIEEFGEENFIQECKDYADEQLEGLQEDFQDFGVWMDWDDPYRTVEPEYMEAAWW
FT                   GFSKAADRGLVEKGHRSISQCPRCETAIANNEVEYEDVEDPSIYVKFDLEDREGKIVIW
FT                   TTTPWTVPANTFVAVDPEGDYVGVRAEKDGEEELLYVADAKHEEVLREGRYDDYEVVEE
FT                   RSGEELIGWSYEHPLAEEVPDHVDVEGALEVYAADYVDTDGDGTGLVHSAPGHGEVDFE
FT                   RGRELGFPIFCPVGSDGVYTEEAGTYEGQFVKDADPEITDDLEDNGALLASGTVHHSYG
FT                   HCWRCDTGILQIVTDQWFITITDVKDELLDNIEDSEWHPEWARDNRFRDFVEEAPDWNV
FT                   SRQRYWGIPLPVWTPEDRDDDEDMIVIGDREELADRVDQDVDPEDVDLHKDTVDDLTIT
FT                   EDGTTYTRVPDVFDVWLDSSVASWGTLNYPEDDSRFDELWPADFILEAHDQTRGWFWSQ
FT                   LGMSTAALGESPYQEVLMHGHALMPDGRAMSKSKDILIDPHEAIDRHGRDVMRMFLLSN
FT                   NPQGEDMRFDWDGMQTMENHLRTLWNVFRFPLPYMRLDEFDPTATTLEDVDSDLELIDE
FT                   WVLARLQSTKAEMTEAFEDRRQDRALDALIEFVVEDVSRFYVQAVRERMWAEEDSGSKR
FT                   AAYATIYQVLRESVALLAPYAPFISEEIYGTLTGDDGFDTVHMEDWPEVDEYWQDEQLE
FT                   DDVAILRAIEEAGANARQQAGRKLRWPVPRVVVAADDDRVVEAVERHTPLLEDRLNARE
FT                   IELVSAEDRWEELQYSAEADMSELGPAFGDRAGQVMNALNEARIDEPSLEAIEEAVADV
FT                   LEEGEEITDEMVSFVTQTPDGIAGTAFGLNGDDRGVAYVDASLTDDIESEGYAREVIRR
FT                   VQEMRKDLDLDVEERIALDLEIDDDRVADLVAEREDLIREEVRADEIGEIDDGHRKEWE
FT                   VEDVTMEIGVEPLAAAEASD"
FT   gene            complement(101968..102210)
FT                   /locus_tag="Htur_0090"
FT   CDS_pept        complement(101968..102210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58991"
FT                   /db_xref="GOA:D2RTE8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58991.1"
FT                   /translation="MGTAIPELLAELLPLVAYTIAAGVLTIGGFAAEYASMQHVGAGET
FT                   TVAFWLAAIGCVMLYAGVYGLGYQKVLARLFGVAE"
FT   gene            102306..102986
FT                   /locus_tag="Htur_0091"
FT   CDS_pept        102306..102986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0091"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   sun:SUN_1151 uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58992"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTE9"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ADB58992.1"
FT                   /translation="MTHVSPSPSDTNADPAYPTERNVIEPGCERCPALAEHRECISWGT
FT                   GPLEASVLVVGEAPGPGNPDADRWKGGNWTGKAYTSRHSGRRIRRMLERVGYGDDAYYT
FT                   NAVKCFPADPADPTSNREPTPEERTNCRGHLLTEIETVDPDVVLATGKHATTSVLAAED
FT                   HTLEGFIDAVLEPVDCERLETTLLPILHPSYQDVWIGRLGYEPDEYLAAIGEALEELCG
FT                   QVGE"
FT   gene            complement(103071..103772)
FT                   /locus_tag="Htur_0092"
FT   CDS_pept        complement(103071..103772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0092"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: ade:Adeh_0937 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58993"
FT                   /db_xref="GOA:D2RTF0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF0"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADB58993.1"
FT                   /translation="MEIIGHRGCADQFPENTRLAIREAARRLPAVEIDVRRCGSGELVV
FT                   FHDETLERVTGASGRVAETPWTELRDLTVLESGESIPRLETVLRAVPDDVTLQLELKER
FT                   GIASETLQSAMTAGADVRISSFLPEALAEIETNYLDVPNGLLFGDEPEENLSRAIELDC
FT                   THVFPHYDLCVETDVVSAARDRGFDVIAWKAARTTDDVRALREAGVDGVTADRWDVAPA
FT                   SLRASAESQRS"
FT   gene            complement(103962..104642)
FT                   /locus_tag="Htur_0093"
FT   CDS_pept        complement(103962..104642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0093"
FT                   /product="sugar nucleotidyltransferase-like protein"
FT                   /note="KEGG: hha:Hhal_0773 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58994"
FT                   /db_xref="GOA:D2RTF1"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF1"
FT                   /inference="protein motif:COG:COG1213"
FT                   /protein_id="ADB58994.1"
FT                   /translation="MRGVILAAGRGRRMRPYTDDVPKAFLEFDGRTLYDRQRDLLEPYV
FT                   DGTCVVLGYRHETVLERYDPVDPIVLEGWDRYENAASLLLALERIDDDLLVMNGDVLLD
FT                   ERVLGRLSGQFGALGGRLNLVGCVPGLQSTETAIRWDETGRVSAYGLIEGHQHAGFGVV
FT                   SREHRTAAMRILRERLEDWYPCVYPRTPTRPLLIPAERHVELNRPTDLDRLRAWLASDR
FT                   IRCA"
FT   gene            complement(104630..105616)
FT                   /locus_tag="Htur_0094"
FT   CDS_pept        complement(104630..105616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0094"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hhe:HH0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58995"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58995.1"
FT                   /translation="MVAVLYAIERPFMRKTFEAIDRHVDVESAFVPVRADARGCSDRIA
FT                   EIEVRDPGAVDENVRAIDPSVVVYNHRFGIERFSFYEEYPLVHVRHGASIGRGEIDVTA
FT                   RTMLEHVAAALAPGERWARAYRAAAPPDVTVAVVGLPEADALVDAPPPRERRVLYAPTN
FT                   YMVGRGAYANTARSVVECVADTEYELLFRPHPTDRREGPGLAVTRECRARIAELPNVVF
FT                   DETVTPTESMRRSDILVSDYSGSIAEWLHTGRPLVQLTDIDAPDRTVPEIGVTTDALDL
FT                   ALVDDLYRNGEPAPVARRRESWLEELGIPMDGRAGERAASEVLRCAA"
FT   gene            105985..106098
FT                   /locus_tag="Htur_0095"
FT   CDS_pept        105985..106098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58996"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58996.1"
FT                   /translation="MEHEVPISAMRQPLLGTPTEAVWYIERPRSSITILDR"
FT   gene            106224..106643
FT                   /locus_tag="Htur_0096"
FT   CDS_pept        106224..106643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0096"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG: similar
FT                   to histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58997"
FT                   /db_xref="GOA:D2RTF4"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF4"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADB58997.1"
FT                   /translation="MSTIFSQIVEGEIPARVVYEDETTIAFLDANPLAPGHTLVIPKDE
FT                   YERLNDVPDDVAEDLYATIHRLVPAVEESVDADASTVAFNNGEEAGQEVPHVHCHIVPR
FT                   FEGDGGGPIHAMFGGQADIDDDRLDEIADEIESRA"
FT   gene            106745..106978
FT                   /locus_tag="Htur_0097"
FT   CDS_pept        106745..106978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58998"
FT                   /db_xref="GOA:D2RTF5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB58998.1"
FT                   /translation="MLADIAAQFRAHPVATTLEVGSVVVCLFLFLGTLALFATGLPTGR
FT                   GDPWLVLIGVGAVFVVFWTALVPLYERFVYEP"
FT   gene            complement(107578..108627)
FT                   /locus_tag="Htur_0098"
FT   CDS_pept        complement(107578..108627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0098"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; Peptidase
FT                   A24B, FlaK domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB58999"
FT                   /db_xref="GOA:D2RTF6"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF6"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ADB58999.1"
FT                   /translation="MTLADVATTPDLLRLVAVPVFAWVAVRDIKTRRVSSAVWIPLSLL
FT                   GAVLLVWDGWLAWTTGGTAWTYDFLLPTAVSLGFVVPIAYLFWWVGGIGGADAKALLVL
FT                   ALFFPVYPEYAIGSQTFPLTTMPVEAFAFTVLVNTVFIGLAAPIFLAVRNAVAGRFTGV
FT                   MFIGWPVSWDAVPETHGRLLETPDGPSRGGLDLDALRMYLRWRGLTLADVRDDPDRYRD
FT                   PTTLPDEPNPPTDGAVTATVRSDGGARLEDDGELETDADDGDGLETDFDDDDFETSIDD
FT                   DPWGAAAFLEDIDGSAYGTRPAELREGLEVLATNETVWISPGTPFLVPTFLGLLVALGY
FT                   GNLFIGPLL"
FT   gene            complement(108880..109269)
FT                   /locus_tag="Htur_0099"
FT   CDS_pept        complement(108880..109269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0099"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59000"
FT                   /db_xref="GOA:D2RTF7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADB59000.1"
FT                   /translation="MPTVEYLNYEVLDDQGWDMDDDDLFEQAADAGLDDEDYGTLDVAE
FT                   GEYILEAAEAQGYDWPFSCRAGACANCAAIVFEGEIDMDMQQILSDEEVEEKDVRLTCI
FT                   GSAETDEVKIVYNAKHLDYLQNRVI"
FT   gene            complement(109578..110762)
FT                   /locus_tag="Htur_0100"
FT   CDS_pept        complement(109578..110762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0100"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: hch:HCH_00788
FT                   phosphate/sulphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59001"
FT                   /db_xref="GOA:D2RTF8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF8"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADB59001.1"
FT                   /translation="MNAEPLLIVGILTAIFVGYNIGGSTTGPAFGPAVGANVITKVMAA
FT                   GLMSIFFFVGAYTIGPQVVTTLGEELVTDTSIFTLRSNVAVLFFIGGALFVGNYAGVPA
FT                   STSMTAVGAIAALGLATGELDWSVLGEIVVWWIVAPITGFWVAGVVGRYFYPRINAWVA
FT                   IEGSTDGEPMISVDRSGAVPRLQFGADGDRREVTGAFVVVGIGCLMGFSSGTSNIANAI
FT                   APIYGTGDVDMVPLILIGSAAVAVGCFTIARRTLDTLGNDITNLPLTAAIVVAVISSTI
FT                   VVGLSAIGIPASFVVIATMSIVGLGWGRATRTTTLSDAARGEETRVSVGALTAEREGEQ
FT                   SPDIGEEEPEDIPKASDLFDPSTTARVILMQNVVPLISTVGAFITFRFVPIFGF"
FT   gene            complement(110924..111349)
FT                   /locus_tag="Htur_0101"
FT   CDS_pept        complement(110924..111349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0101"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rpa:RPA3434
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59002"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTF9"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADB59002.1"
FT                   /translation="MITRVLVPMDGSEMSGHALEYALKAHPDAEITVLTVVGEPSALWG
FT                   EATGLALADDLEEMADDHAEAVFDRARELVDAADSDATLETAVELGHPVRAILERADEY
FT                   DTIVIGSHGGSVADRLFVGNVAEKVVRRSPVPVTVVR"
FT   gene            complement(111486..112664)
FT                   /locus_tag="Htur_0102"
FT   CDS_pept        complement(111486..112664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0102"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: nis:NIS_0568
FT                   inorganic phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59003"
FT                   /db_xref="GOA:D2RTG0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG0"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADB59003.1"
FT                   /translation="MVSVLLVVGILVAVFVGYNIGGATTGPAFGPAVGADAISKTMAGV
FT                   LMTVFFFVGAWTIGRRVVETLGGDLVYDSAVFTLEASVGVLFFIGIALFIGNFFGVPAS
FT                   TSMTAVGSIAGLGLAAGELNWVVMGQIAIWWIVSPFIGFWVSLIIGRYFYSSLNRRVAM
FT                   VRSEGPLYRIDRSRRVPIPVPTETTNRRELGGVAMVIVIGCLMAFSSGTSNIANAVAPL
FT                   VGSGELEMNPAILIGCAAVGIGTVTIARRTLETMGNELTELPLTAAIVTATVSASLVIF
FT                   LSAIGIPASFVIIATMCIIGLGWGRATRPITVSDAVRGEESAPVSVGALTADEEGEELP
FT                   AIGDEEPERVPSAADLFDPATTARVVLMQNVVPMIATLGAYATFRFIPIFGI"
FT   gene            complement(112785..113168)
FT                   /locus_tag="Htur_0103"
FT   CDS_pept        complement(112785..113168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0103"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59004"
FT                   /db_xref="GOA:D2RTG1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59004.1"
FT                   /translation="MNPRRIDAIIDLAYGALIFVSVVLIVVEGTRVGLALGLGVLVSYA
FT                   LHVIWKMARFDPEWMTQEVEETVEEAVEQSIGEQVDAVQRQIETVDERIDRRPREDEIE
FT                   DLLEETVADESVDSGDETGETPR"
FT   gene            complement(113285..115141)
FT                   /locus_tag="Htur_0104"
FT   CDS_pept        complement(113285..115141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0104"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; TrkA-C domain protein;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: gsu:GSU2317 TrkA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59005"
FT                   /db_xref="GOA:D2RTG2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG2"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADB59005.1"
FT                   /translation="MSVPVALAQDLATRPELTTDVLVVFGVVAVALALFVTERLPIDVT
FT                   AILLIVILVVLEPWTGVDPETGISGFANEATITVLAMLILSGGISRTGLVQELGRRMAA
FT                   FAGDSLRRQLFATVAATAPVSGFLNNTPVVALLVPVVTDVANRGNTSPSKLLIPLSYAS
FT                   QIGGMLTLIGTSTNILASDISARLGSEYPELHRFSMFEFTRLGIVVTLVGSLYLIFVGH
FT                   YLLPERVPPRADYLEEYDVGDYIADVAVVPGSPLVGETVGEATDRFGPEVDVVQVVRDA
FT                   DRSVAPRRSTHLAEGDVLVVRTNRDAIATLEDAEGVELVGRSDSTATLSPDGESGIVTE
FT                   LVVALDSQLIGERLEPESFREEFGAAVLGLRRHGALVGDRIVGRRLDVGDTLLIQASPD
FT                   MLDRLSRRDGVIVAREPPRSEYRADKAPVAVAIMIGVVAIAALEIYPILITALAGVVAM
FT                   VVTDVLDANELYDAVEWDIIFLLAGVIPLGVALEQSGAAALLAFAIVEVAEVLPTIAVL
FT                   WLFYMLTALLTNVISNNASVVLLIPVAAAAAAGVGANPFAFVLAVTFAASTAFLGPIGY
FT                   QTNLFVYGPGGYRFSDYARIGAPLQLLLSVVTVLGIALFWGV"
FT   gene            115369..116103
FT                   /locus_tag="Htur_0105"
FT   CDS_pept        115369..116103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0105"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: csa:Csal_0517 1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino] imidazole-4-
FT                   carboxamide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59006"
FT                   /db_xref="GOA:D2RTG3"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG3"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADB59006.1"
FT                   /translation="MSAFPEFQVIPAVDMQDGEVVQLVQGERGTEKTYGDPVDAARRWL
FT                   DEGAEALHLVDLDGAFEGQRANGDAIDEVLETVDVPTQLGGGIRTADDAVDLLERGVDR
FT                   VILGTAAVENPDIVAEISERHPDSVVVSLDAKDGEVVVEGWTEGAGISPVDAAERYAEL
FT                   GAAAILFTNVDVEGKLEGVAAEPVRELVEATDVPVIASGGVATLEDVRALEDAGAAAVV
FT                   VGSALYEGKFTLAEAQSAIDSS"
FT   gene            complement(116496..116765)
FT                   /locus_tag="Htur_0106"
FT   CDS_pept        complement(116496..116765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59007"
FT                   /db_xref="GOA:D2RTG4"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59007.1"
FT                   /translation="MSNPSPLSNESIGPSGPESDRQHEQRLRRLVRSVKGPTQFLSFWV
FT                   AIALPFVHLPLLAQGLGDPQITVTFLLLLAVNVCALYVGHGYGQ"
FT   gene            117081..117671
FT                   /locus_tag="Htur_0107"
FT   CDS_pept        117081..117671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0107"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   tmz:Tmz1t_0906 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59008"
FT                   /db_xref="GOA:D2RTG5"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG5"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADB59008.1"
FT                   /translation="MSERTATRTRETAETSIELELAIDGDGEADVDTGIGFFDHMLTSF
FT                   AKHGLFDLTVDCDGDLEVDDHHTVEDVAIVLGEAFDEALGDRSGIVRYADRKVPLDEAV
FT                   AGAVVDVSGRPRFYFDGAFSQAQIGDFTSDMARHFGESLAMNAGLTVHLEVVSGENAHH
FT                   EVEALFKALARTLDDATRFDEHREGTPSTKGTL"
FT   gene            complement(117668..118537)
FT                   /locus_tag="Htur_0108"
FT   CDS_pept        complement(117668..118537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59009"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59009.1"
FT                   /translation="MRELRRCDFCGGDAAGAFEIVPPELEPTEAEQRRVVLCADCKNHL
FT                   QTLIEPLLARAGADGESSAAAAEDEDGSDQRSDDESDDDARAGESTSESGTVVASADES
FT                   TPKRSRASSPNATVSDASTGESDATGESDATGEDAAETDAAEAAEPDDRGTDAGGDAAI
FT                   DSNSLLEDGITFERSEPANGESDTSETESTTQEETDDTTESDDERSSDAETSASADRDE
FT                   SSQPPAAYGKVLRLLRNREFPLQRSAVESLAAGAYDLESHEVDAIIDHAIDRDEFVETR
FT                   GELRRPEA"
FT   gene            118647..119150
FT                   /locus_tag="Htur_0109"
FT   CDS_pept        118647..119150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0109"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59010"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR014424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG7"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADB59010.1"
FT                   /translation="MFDEIMEKFEGSPSQQAVIRLLLERGFSVNDDGRVVSGGIEIPNT
FT                   GIAREIGVDRRVVDSTTDVILKDPELRRIFQNISQVPSLMDLAPVLDLTVLTVTPDDAD
FT                   QKGIVAGITGLLAEHDISIRQTISEDPEFTDEPQLYLITDQELPGNVITEIRDLEFVRK
FT                   IELQ"
FT   gene            complement(119158..119583)
FT                   /locus_tag="Htur_0110"
FT   CDS_pept        complement(119158..119583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59011"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59011.1"
FT                   /translation="MNDETELETETIDRTLAEELLSVSRTAVGDELRSITYFTEDEVEQ
FT                   IYLRSDLERTADLVGFADHERLGFRSQSAYRNTQLGEYQATVRMFENGYLSRVIRGPHG
FT                   VWVTTDSMSMDRFKELTTATKSVLDDHVDTVSTDGDD"
FT   gene            119716..120366
FT                   /locus_tag="Htur_0111"
FT   CDS_pept        119716..120366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0111"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: cti:RALTA_B2159
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59012"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTG9"
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /protein_id="ADB59012.1"
FT                   /translation="MSRSYRTVAKAATADFVVQGSEFIGRVRPVDSVDAAESFVDAVSE
FT                   EYADATHNVPAYRVRVGDESGENGGRTEDAAGTGHFLREYSSDDGEPSGSAGKPALNVL
FT                   TQQEIENCAVVVTRYYGGTNLGVGGLVRAYSRAVKEAVEAAGVIEERPHETVSITVEYD
FT                   DSGTVRGILESEGYEFEADYQADVSFDVRVPLEEADAFRDRLRSATSGRADLE"
FT   gene            complement(120566..123271)
FT                   /locus_tag="Htur_0112"
FT   CDS_pept        complement(120566..123271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0112"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: azo:azo1917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59013"
FT                   /db_xref="GOA:D2RTH0"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH0"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ADB59013.1"
FT                   /translation="MSIDTSGTDTVSDEQTDEVLEEIERRRTLRGPAAVLVALIGISFS
FT                   AFQMWIAARGRQFGGTLPVIGEFQIISLQQLQVNAIHVTFALVLAFLLFPASEGDGFVA
FT                   QQLGRIPPAVRDRLGADHAVSRAITRLGDGVRWAVVDPSRDRITPLDVAMIALALWPAY
FT                   YITTEFDEIRSLPIIGLENASAIHELYPWLEPLVVPLASMGLPVDFPVAYLLGIVGILL
FT                   VLEATRRTLGVVLMGLVASFIVYARWGYMIPSDSPIGALAIQVIEWDNIVYNLWYTVEA
FT                   GVFSTPVSVSVRFIYIFILFGAFLEMSGAGKWFIDLAYSMTGTRKGGPAKASVVSSGFM
FT                   GMLSGSSIANTVTTGAFTIPLMKRSGYSPEFSGAVESSASSGGQILPPVMGAVAFLMVQ
FT                   LIGEPYSNIIIAATIPAFAFFFGMWVMVHFEAVKGGIGGIPRAELPDVSAAIRTGWFYL
FT                   IPLVLLVYFLVIARFSINRAGWYTIVTITALIAVVAAYNERTRLPLLGSIAALYLAQAA
FT                   ALASYGVGLGDAIQVALGLESASAAYSIRDAAVAAAADLGLIAILVSLAVMLARPRGDA
FT                   PLLELDEAVDDAATATAASIDRPALARNTGYRFGAFILKSMDSGARTATTVVVAVAAAG
FT                   VVPGVISVSGLGPNLAALINTVSGGSMLMLLVLTGLASIIFGMGMPTTAMYIILIAMLG
FT                   GPIEDMGVWLVAAHLFVLYFGLMADVTPPVAVAAFAGAGVAKADELKTASIAFLLSLNK
FT                   ILVPFAFVFSPGIVLARKVDGEWGLIGWSDVADVGFFLPEVIVPVIGMFVGVYALGVTI
FT                   IGYQYSAVDSTRRALYAVASILLMVPEIPLLVVEGALALAGLSIGLTGLWVTVSLRLLG
FT                   LAILASLSYRNYSRLPDEQSDPAAPTAGNA"
FT   gene            complement(123268..123828)
FT                   /locus_tag="Htur_0113"
FT   CDS_pept        complement(123268..123828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0113"
FT                   /product="Domain of unknown function DUF1850"
FT                   /note="PFAM: Domain of unknown function DUF1850; KEGG:
FT                   sfu:Sfum_3722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59014"
FT                   /db_xref="GOA:D2RTH1"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH1"
FT                   /inference="protein motif:PFAM:PF08905"
FT                   /protein_id="ADB59014.1"
FT                   /translation="MERSTRWYVSAVVVSILVVFVATGAVVASGATERTLVVADADSGE
FT                   PLLEVPVDEGDEVILSYTHSVEKTPVQDVYVVDGTELRADRMVFHSHGAGLPSDEPIER
FT                   TDEGFVVAGEGSHEEIVVSPGSIAGHELIVDGERYDLVEQSNGSVVLEVDGTIGDRLTA
FT                   LRGIGSAVDDRSESDVRSGKLLV"
FT   sig_peptide     complement(123742..123828)
FT                   /locus_tag="Htur_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.807 at
FT                   residue 29"
FT   gene            complement(123865..124863)
FT                   /locus_tag="Htur_0114"
FT   CDS_pept        complement(123865..124863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0114"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: oan:Oant_2429 TRAP transporter solute
FT                   receptor TAXI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59015"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH2"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ADB59015.1"
FT                   /translation="MIDNQKCINSFDGIANSMNQNINRRTFIAGIGGTGIAALAGCSGE
FT                   GNENQLAWHSGGTDGTYYPLSGEFKTIVEDQTDYSLQVQSTGASVENVSSLNSEDAEFA
FT                   LIQNDIAYFAVNGTGIEELEGNAMENIRGVATLYPETIHVITQADSGIDSLEDLEGASV
FT                   NTGDTGSGTQVNALQILETAGISEDDFDEQNADFGTAADQVQDGDVDAAFTVGGWPVGS
FT                   VENLATNQDIELVEISGDLREDIMADAEWFAEDTIPGGTYDGVDDDVDTVSVQAMIATH
FT                   EGVDEETVEGVTTAIFDNTDEIGTKSDFIDADSAQDGMPIDLHAGAEAYFN"
FT   gene            complement(125114..125968)
FT                   /locus_tag="Htur_0115"
FT   CDS_pept        complement(125114..125968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59016"
FT                   /db_xref="GOA:D2RTH3"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59016.1"
FT                   /translation="MTTRNSTERVALDDGDGPSDGRFRLAVAVYAGALLAGVASVAAAL
FT                   TAFVPGPLPGVYATGFAGGLVGGLALATADPRLPVRLGRTLGRRAAVVVPTVPFVVVWF
FT                   APLEAAVDVVALWAVITVFASGYVLSQLAGNRYVDAVAPGEPAETWQWTPPGAPVVDAL
FT                   LAGMWLVIGIGTAVTGAPVQGLLWLAIAVFWVTSCLVEGRWSFGPGRDRCEIRLYENGL
FT                   VKRRPYTKTFVPWREIGHTRLREGELVLDRGLRDVRFDRDELEDPDAVLEAVDRWLETS
FT                   AER"
FT   gene            126077..128257
FT                   /locus_tag="Htur_0116"
FT   CDS_pept        126077..128257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0116"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; WD40 domain protein beta Propeller; KEGG:
FT                   ilo:IL0517 acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59017"
FT                   /db_xref="GOA:D2RTH4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH4"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ADB59017.1"
FT                   /translation="MNAATTACRLAELYGPAGTTSSMNRIEAVDYHEITHVEEPRLSPS
FT                   DERVAFVRRTPAADESYAASIYTVPVGGDEAAQFTASDGVDSQPRWSPDGDRLAFASTR
FT                   GEGDREQVWLVPTDGGEARRLTSVVGGIDDLEWSPNGSRLLFSQRVAPEDREAGRDRTV
FT                   DPDYERETPDPRVIDRTIYRAGTEYIDGRRRHVYVLEVEAALSRDPEDNPDGTAITRLT
FT                   DEDGPADVPVDYVSPTWGDDETIYYAAKAAAAGEDPDDTLAYDLYEHGTDSGEIEAFTQ
FT                   TTGWLESGSIDATADGRVAFEFTPEDRTSMRQTEIRVHDRETGEERTPTEPLDRTVGHR
FT                   CGFEWAPDGETLYVTTPDEGSRVCWSVPGDASEDPTRVYGDGVTIADFSVGENAVAYVY
FT                   SEWDHPGDVFVTTRGGNEVHRLTRVNDDYLADRAVRQPEEVWFKTDDGTESQGWLLTPP
FT                   EFDADASPGERYPLVVEVHGGPHAHWTTAGTMWHEFQTLAARGYVVFWCNPRGSTGYGE
FT                   DRAIAIEGDWGEITLTDVLAGVETVCERDFVDDGEVFVTGGSFGGFMTAWAVAHSDRFE
FT                   AAVSQRGVYDLTGFYGSSDAFTLVEDDFGTTPWDDPDFLWNQSPVAHVADVDAPTLVLH
FT                   SDQDYRTPANTAELFVRGLQKHGVETRLVRYPREGHELSRSGEPAHVVDRLERIARWFD
FT                   GYSAYHESSPALERDRDAGLSSGDEDGDRNEE"
FT   gene            128473..128673
FT                   /locus_tag="Htur_0117"
FT   CDS_pept        128473..128673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_A0231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59018"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH5"
FT                   /inference="similar to AA sequence:KEGG:Reut_A0231"
FT                   /protein_id="ADB59018.1"
FT                   /translation="MDRNVGGFDRVLRIALGAALLVIGYRNRDRMAGTLAFVAGSDIFA
FT                   TAIIRRCPVNAALGIDTCSAE"
FT   gene            complement(128711..129088)
FT                   /locus_tag="Htur_0118"
FT   CDS_pept        complement(128711..129088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0118"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bja:bll1134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59019"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH6"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB59019.1"
FT                   /translation="MEYSVIDPDDLESVEDRPCDLRRVSDAAGLENVAINRFRAEPGEQ
FT                   LPLAYHYHERQEEAFVVLSGTLHVETPEGELEVPEGDVFTAQPESAHRAYNPADATETV
FT                   EVVAVGAPPVSDDAVPYEPDA"
FT   gene            complement(129154..129831)
FT                   /locus_tag="Htur_0119"
FT   CDS_pept        complement(129154..129831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0119"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; KEGG:
FT                   pna:Pnap_1726 uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59020"
FT                   /db_xref="GOA:D2RTH7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034331"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH7"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADB59020.1"
FT                   /translation="MTIEDRENAYLVTHALAKDTLSRLRDVETEQVSFRKGLVKLGRIC
FT                   GYEIIDGRMETEYVEIETPLEQTMGERVRGLDDVVIINVLRAATPFVEGLLKAFPRARQ
FT                   GVISASRDEEAGREEDGSFPISVDYVKLPEITEEDTVIIADPMLATGSTMCTVLEHVIE
FT                   NSPEPENLIVLSAVSAPEGLLRVGDAFPETDLLTVSIDDRLDDDGFIVPGLGDAGDRAF
FT                   RTT"
FT   gene            130200..130904
FT                   /locus_tag="Htur_0120"
FT   CDS_pept        130200..130904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59021"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59021.1"
FT                   /translation="MSDQPQFGGSSERFETGGQQGGQRMSNNQSEMQGTPQSSPTRGTQ
FT                   SSQAMRPMQEPQSTRGMQGGSQATFFEDHMTDELWIALEDFGELSHVAAWCATRCASGE
FT                   PELGRCARICQDIAEIAALNELLIARDSMFGPELADAFLRVADEGLPTLRQFQGRHSHV
FT                   LETVATIERTMNSCESLLRQVGEDSRGRQGSGTGAGSTESRGMQGMSEQGQYGQGMSGQ
FT                   STGGFEMTGQQY"
FT   gene            130910..131698
FT                   /locus_tag="Htur_0121"
FT   CDS_pept        130910..131698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ech:ECH_0499 VirB6 family type IV secretion
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59022"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59022.1"
FT                   /translation="MAASIAQQRSLYRSVPYDRGNRMEESISGFKVRGDWGDVVEHGER
FT                   ITRALRDAGVHDPDGADDTRFVDAFEEWQEWRPKAHETLDTDVSEKTADQASVEEGKGE
FT                   KAGKDPDEDIKTAGEKLSESYERLEDDDAEGAVGNWRESIDYVARAADSASRKALRRVE
FT                   DTVYQNVMTQLAPYYFDNELISANIQQSTRNGDNGEQFVFEVNVNDDVLKDDVSDLLAE
FT                   YEDSVDRWHVGVEKDTDAAEAIEGAEPPPEPDDDSRSTTN"
FT   gene            complement(131717..132736)
FT                   /locus_tag="Htur_0122"
FT   CDS_pept        complement(131717..132736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0122"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dat:HRM2_20380
FT                   GlnP5"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59023"
FT                   /db_xref="GOA:D2RTI0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI0"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADB59023.1"
FT                   /translation="MSASKAFGLERLRGTIGDVDRSLAVVVGVIFWGWLLTRWLYDWVI
FT                   SRLGVGPGAGEQFVSVAPIESAAAIFDDTVAVVGPIAVPMDWLASLLNGIALGIEIAPA
FT                   LAAGAWYTIVLTIASIALGLVIAVPVAVVRVYGGPFRWFALAYTELIRGTPLLAQLFVL
FT                   YYTPYLSVRLSDVDLIGRGFVPEYAFWIAIVGFTINGSAYQAEYIRGALESVDEGQLTA
FT                   ARAIGLSKLEGIRHVVLPQTLRYGIPAWTNELVYLIKYSSLAGFITVPELYYRASDIAS
FT                   STFEYTPIYVLLGLVYIGLVLSATNVMSRVERRVAVPGLGRAEGRQQGAGEDAATKTA"
FT   gene            complement(132779..133576)
FT                   /locus_tag="Htur_0123"
FT   CDS_pept        complement(132779..133576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0123"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dat:HRM2_20370 GlnQ4"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59024"
FT                   /db_xref="GOA:D2RTI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB59024.1"
FT                   /translation="MTEHRTDDAGGTDHATTRTADGPLLRIDDLYKSYGDEEVLKGIDL
FT                   EIDRGDVEVLVGPSGSGKSTLLRCLNRLTEVDSGDIYLGDLEVTAPDTDPDEVRQQIGM
FT                   VFQDINLFAHLTARKNITLGLRKVKGLSKAEARERADAELERVGLADQADSYPAQLSGG
FT                   QKQRVGIARALAMDPEVMLFDEPTSALDPELSNEVLEVMRGLVAEGMTMVVVTHEMRFA
FT                   RGGATNISFLADGQLVERGPPERLFENPTHDRTAEFFESIRHD"
FT   gene            complement(133573..134406)
FT                   /locus_tag="Htur_0124"
FT   CDS_pept        complement(133573..134406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0124"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dat:HRM2_20380
FT                   GlnP5"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59025"
FT                   /db_xref="GOA:D2RTI2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI2"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADB59025.1"
FT                   /translation="MDLAVQAADAAVTVPVGQLLPISEEAVGRRLGDDWEFVYRNAEYL
FT                   LWGAVISVLLTVTSILLGFLAGFPAGAIETYGNGYSRAFVRKFGVLLRGTPILVIMFIT
FT                   FYALPYEIVHDAVEALFSALDFVLGPTPFTAAVDVPGAFVAATLALGFRSAAYQSQIFR
FT                   GALQSIDEGQMEAARSIGMSRLEAIRHVIAPQALRRSVPGFQNEFTIVLKDTSIAFAIG
FT                   LAELLKRSEDLFTQQTTAILEVIVFISLLYFVLTFTTNRTLDYVNNRFAIPGESS"
FT   gene            complement(134418..135230)
FT                   /locus_tag="Htur_0125"
FT   CDS_pept        complement(134418..135230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0125"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: bpt:Bpet2241 glutamine
FT                   ABC transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59026"
FT                   /db_xref="GOA:D2RTI3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI3"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADB59026.1"
FT                   /translation="MREETETVDRRSYLKLSGITGLAATGFAGCLEDAGNGDDEGNQSD
FT                   GATGENEIIAGTAPGFPPFEMKEGGDLVGFDIDHLEAVVDETDYELTGWKEFEFGSLIQ
FT                   SLNSGEIDVIAAAMTINDERKEKLAFTDPYYSANQSVLVQTGGDFEPSSLDDLAGRDLG
FT                   AQSGTTGESIIEDEVDDANYRSFENYVYAVQELERGTLEAIVIDQPVAETFAANRDVEI
FT                   AFTFETGEKYGLGVRQDDDGLREALNEGIAAVEESGEYEEITQEWFGE"
FT   gene            135411..136604
FT                   /locus_tag="Htur_0126"
FT   CDS_pept        135411..136604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0126"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: pag:PLES_56011
FT                   putative phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59027"
FT                   /db_xref="GOA:D2RTI4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI4"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADB59027.1"
FT                   /translation="MVELVTIATFLVAALASLFMAWAIGAGSSGSTPFAPAVGANAISV
FT                   MRAGFLVGLLGFAGAVLQGANVSEAVGAELIRGVTLSPMAATIGLSIAAGLVAIGVFAG
FT                   YPIATAFTVTGAVIGVGLGMGGAPAWAKYTEIAALWILTPFVGGGMAYAIARLLRAELI
FT                   AERYLIMLLAAFVGVLVANIEFAILGPADAGGASIAQASSGWIPGPELAGVAAMTIAIA
FT                   IFWAVVVGLDLRSGLESGERHFLLVLGGLVAFSAGGSQVGLAVGPLIPLSGDLEIPLIA
FT                   LLVGGGFGLLLGSWTGAPRMIKAISQDYSSLGPRRSIAALIPSFMIAQSAVLFGIPVSF
FT                   NEIIVSAIIGSGYAAAGAGGGVSARKMGYTVLAWIGSLAGSIIISYVAFIAVAAVLG"
FT   sig_peptide     135411..135482
FT                   /locus_tag="Htur_0126"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.433 at
FT                   residue 24"
FT   gene            136734..137471
FT                   /locus_tag="Htur_0127"
FT   CDS_pept        136734..137471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59028"
FT                   /db_xref="GOA:D2RTI5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59028.1"
FT                   /translation="MDEDVSADANDAETIQWRRDASTSRAVRLLWSLGVGTFFATASIV
FT                   VFWRLYDLARQAGAGGLIVALFAALVVTVLAVATVGDTERHLATLTGPLPVDAPSGRGL
FT                   ERAVDAALGTIAMLAVMGSLMAVGRVVSQRELLAVGAGPFTGLAALLVPLALVALVLAS
FT                   FLRSVGALDPEEGTIYLYNPDQAIDLAVIRDASSRRVGDAAIVTLEYAQPDGQYVPGPR
FT                   RIVMPPEVAREVESLLERRASAQ"
FT   gene            137824..140010
FT                   /locus_tag="Htur_0128"
FT   CDS_pept        137824..140010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0128"
FT                   /product="response regulator receiver modulated GAF sensor
FT                   protein"
FT                   /note="PFAM: Bacterio-opsin activator HTH domain protein;
FT                   response regulator receiver; GAF domain protein; SMART:
FT                   response regulator receiver; KEGG: geo:Geob_3576 response
FT                   regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59029"
FT                   /db_xref="GOA:D2RTI6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI6"
FT                   /inference="protein motif:PFAM:PF04967"
FT                   /protein_id="ADB59029.1"
FT                   /translation="MIVDDGLRILLVEDNPGDARLIEEMLQETAVPLASAERGRDRRSD
FT                   VDCGTEAVEVLRADRLETGLERLAASSVDIVLLDLGLPDSSGLDTLTTVLERSAAVPIV
FT                   VLTGLSDERVGVRAVQQGAQAYLVKDEITSELLTRSLRHALERHQRETQLTALSTVSRE
FT                   LMSMTSFDDIAERAVTSAAESLDFPVAAICLYDTDRGELRPRAATDRAEELLFTEEPID
FT                   DAAEVSTRLSASCTEIVERVFATNQVDVATADDARSSLSDTDSPLRSRLTFPLGTHGVF
FT                   LVGSTNALTIPSIGVDYATILATNTEAALDRLSREQRLQEREAELETQTESLERLNRIN
FT                   AMIRDVVQSVVHATTRTEIEQAVCDQLAAADSFRFAWIGAHDSLSGTVTPNARSGVGNG
FT                   YLDSVPFTTDGDSAECGPVEAAVRTRELQIVEDVVQTLSSASRREEAMKRGYRSIASIP
FT                   LVYAETLYGILTVYADRPGIFTERVQSVLTELGETIAHAINAVESKRALISDRVVELKF
FT                   EVQDADIVFLELTAETGCECTLESVVPRMDDRLRVFFSTSGAAVDEVAEFAERALGIEE
FT                   FTLVAERAADCVFECTLREPNVVSFCLTQGVTVQTLTAADGAGQLTVELSSDADVRGFA
FT                   ERFQSAYPATSLVASREDERSVQTRQAFQTTLGDRLTDRQAEVLRTAFFSGYFESPRAS
FT                   SGRDVAATLDISQPTFNHHLRAALRKLLTLLYTD"
FT   gene            140185..140496
FT                   /locus_tag="Htur_0129"
FT   CDS_pept        140185..140496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59030"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59030.1"
FT                   /translation="MSATEPTTRHLSQSDEVCTTVALAVADATETPVDELPPLYTAIDP
FT                   DALNDIFQPRNGDRPQAGTHVSFSIAGCTVSIRDGTVTVSRDAETSDDQTASMPARAN"
FT   gene            140526..140726
FT                   /locus_tag="Htur_0130"
FT   CDS_pept        140526..140726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59031"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59031.1"
FT                   /translation="MDDDPSATDASDAPDRCANCATSLDRGSWHPTVGWTDADDTYHLA
FT                   RFCSDACRDEWHRSRDGADTP"
FT   gene            140754..140900
FT                   /locus_tag="Htur_0131"
FT   CDS_pept        140754..140900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59032"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59032.1"
FT                   /translation="MSDADAADDRIREEFREFTSDDGVGGVIVDPQNDRAWIASTLTCD
FT                   VEQ"
FT   gene            complement(140972..142087)
FT                   /locus_tag="Htur_0132"
FT   CDS_pept        complement(140972..142087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0132"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; KEGG: predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59033"
FT                   /db_xref="GOA:D2RTJ0"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ0"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ADB59033.1"
FT                   /translation="MYLLELGGEDDAFAAREAISAATGVRRIAPGLAVANAVNPERVRG
FT                   LAYTHRASDLLGRTDADLESARVLLETAPIDREGSVAVRATDVHGSTGVSTERAERELG
FT                   SILVNRGFTVDLDDPDHVLRAAFSEGPLEGGGELEADEETGDLFAAAGAEKDSLEESVS
FT                   VCALGWLAAESVRDFGDRAPTDKPFFQPGSMDPLLARAAANIAGARPGATILDPMCGTG
FT                   GGLVEAGLVGADVVGTDAQEKMVRGARENLEHFLDPETPSPTGVARGGWAVARGDGTRL
FT                   PLAEDAVDGVVFDAPYGRQSKIETHRLEDLVAGALEEARRVAPRAVMIADRSWASEARN
FT                   AGWGLEAAFERRVHRSLTRYVLVLERREPST"
FT   gene            142317..142877
FT                   /locus_tag="Htur_0133"
FT   CDS_pept        142317..142877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0133"
FT                   /product="TATA-box binding family protein"
FT                   /note="PFAM: TATA-box binding family protein; KEGG: global
FT                   transcription factor; K03120 transcription initiation
FT                   factor TFIID TATA-box-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59034"
FT                   /db_xref="GOA:D2RTJ1"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ1"
FT                   /inference="protein motif:PFAM:PF00352"
FT                   /protein_id="ADB59034.1"
FT                   /translation="MTDPKDTINIENVVASTGIGQELDLQSVAMDLEGADYDPEQFPGL
FT                   VYRTQNPKSAALIFRSGKIVCTGAKSTDDVHESLRIVFDKLRELQIQVNEDPEIVVQNI
FT                   VTSADLGRNLNLNAIAIGLGLENIEYEPEQFPGLVYRLDEPEVVALLFGSGKLVITGGK
FT                   KPKDAEHAVDKIVSRLEDLGLLE"
FT   gene            143304..143756
FT                   /locus_tag="Htur_0134"
FT   CDS_pept        143304..143756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59035"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59035.1"
FT                   /translation="MTIHTDQPTTASPASRRRADDGDDRADGTTVAIDDSIPQAAVRRV
FT                   LDSDRRRELLRCLLDADDSLELPALVARIADAEHDSTAVTSLLELRQRVHVSLCRTHLP
FT                   LLENYRVLDYDEIRGSVAPGARLSAFESALDLEALAGSEGAGLSQP"
FT   gene            complement(143819..144703)
FT                   /locus_tag="Htur_0135"
FT   CDS_pept        complement(143819..144703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0135"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: mxa:MXAN_4230 ATP phosphoribosyltransferase;
FT                   TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; Histidine
FT                   biosynthesis protein HisG domain"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59036"
FT                   /db_xref="GOA:D2RTJ3"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ3"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADB59036.1"
FT                   /translation="MRIAVPNKGRLHEPTIDLLERAGLHLENGADRKLYADTVDPDVSV
FT                   LFVRAADIPEYVADGAADLGITGYDQVCEARVDNVSELLDLEFGRCRLVLAAPEDGDID
FT                   GVDDLEGGIVATEFPNITEDFFADTGVEPDIVEVSGATELTPHVEMADAIVDITSTGTT
FT                   LKMNRLAVVEEVLSSSVRLFGREDVLDDPKVEEVQTALSSVKQAEGKRYLMMNVPRERL
FT                   DDVRDVIPGMGGPTVMDIAGEGGETSAGAGDDGGAVAVHAVVDERRVFETITEVKNAGA
FT                   SDILVTEIERLVE"
FT   gene            144838..147150
FT                   /locus_tag="Htur_0136"
FT   CDS_pept        144838..147150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0136"
FT                   /product="copper-translocating P-type ATPase"
FT                   /note="TIGRFAM: copper-translocating P-type ATPase; heavy
FT                   metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: afw:Anae109_1015
FT                   copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59037"
FT                   /db_xref="GOA:D2RTJ4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ4"
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /protein_id="ADB59037.1"
FT                   /translation="MDDHDHRAEDGPESSDTARDDGERADRTERSLLEDEADDAERGRA
FT                   EIRDRQERGDHVGHERGGHGEDHGGGMHSGGDHSDHGGGMHAGHETMFRRRFFVSTLLS
FT                   IPVLLYSEMLQGWLGFSVPAFPGSEWISPVFAVIVFAYGGVPFLRMAVPELRERAPGMM
FT                   TLISMAITVAFVYSLASVVVPTESAFFWELVTLIDIMLLGHWIEMRSVRRASSALDELA
FT                   RLMPDTAERITDDGESAGQRPADDRAQPGEIEEVPANELEEGDLVLVRPGASVPADGVV
FT                   ETGESDVNESMITGESAPVSKEPGDEVIGGTVNGDGSLRVRISATGEETTLAGIMRLVE
FT                   EAQGSKSRTQALADRAAGWLFYVALGAAVVTALAWTIATGFDSAVIERVVTVLVIACPH
FT                   ALGLAIPLVVAINTSLAARNGMLVRDRIAMEQARTLDTVVFDKTGTLTEGEQGVVDIAT
FT                   VDGVSEEEALAMAATVEADSEHMIAQAIREAADDRDVSRRTAADFEALKGKGVRATVDG
FT                   ERIYVGGPNLLSELEGDVPSALERFADRAGGNAQTVVYLVREGKPVAAFALADVIREES
FT                   YRVVDALHELGLEVAMMTGDSEDVARAVADDLGIDTVFAEVLPEDKDKKITELQEQGKS
FT                   VAMVGDGVNDAPALTRADIGIAIGSGTDVAVQSADIILVQNNPMDVVRLVKLSRASYRK
FT                   MQQNLVWAAGYNVFALPLAAGILAPIGILLSPAVGALLMSLSTVIVAINAQFLRRTDLS
FT                   VPSLPGVSTPREPRPAD"
FT   gene            147259..147894
FT                   /locus_tag="Htur_0137"
FT   CDS_pept        147259..147894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0137"
FT                   /product="alkylmercury lyase"
FT                   /note="PFAM: alkylmercury lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59038"
FT                   /db_xref="GOA:D2RTJ5"
FT                   /db_xref="InterPro:IPR004927"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ5"
FT                   /inference="protein motif:PFAM:PF03243"
FT                   /protein_id="ADB59038.1"
FT                   /translation="MTDDPCACDSSHEGRSNDLEPAPDRWLGDSQRLEAPLPSDVQAGL
FT                   GRVLGEGSIETLDKWVAEVRRRTNGSITVDDLCHADEETAHWGEIDGERYYFRCFYDAV
FT                   LLSALAERPVAIRTESPGGTAIEARAAGATDLTVDPETAAFSFGVDETVSPPSDGEPSH
FT                   ADVYAAVCPFVRAFPDRESYDQWADAVPAATVAMPLEGATELAAALLA"
FT   gene            complement(147935..148567)
FT                   /locus_tag="Htur_0138"
FT   CDS_pept        complement(147935..148567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0138"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /note="PFAM: Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59039"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ6"
FT                   /inference="protein motif:PFAM:PF04967"
FT                   /protein_id="ADB59039.1"
FT                   /translation="MREAHVSLTDPAFDRMGIAELVSLSRDAGVLGFEELACHGTGAVV
FT                   QVAVETPIDEDRLSDLECVDWWERIADSGDDHRYVIAFTAPELPEGLAERADELIGTCE
FT                   PNVTDRGATLSLVGSQETIAATIDEYETAGISPELRKFGTYDGRDHPLAELTDRQREAV
FT                   RTAYEMGYYEVPRTVTSEDVAAELEVDSSTVAELLQRAERNLLGRHL"
FT   gene            148732..149688
FT                   /locus_tag="Htur_0139"
FT   CDS_pept        148732..149688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0139"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mxa:MXAN_5584 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59040"
FT                   /db_xref="GOA:D2RTJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB59040.1"
FT                   /translation="MTAIRTNDLTKRFGDVVAVDGLDLRVREGEVFGFLGPNGAGKSTT
FT                   IDMLLDYVRPTDGTATVLGMDVREESEALRERVGVLPDGIGLYDRLTGRRHLEFAIEWT
FT                   DAADDPDAILDRVGLDDRDAARSVGDYSKGMRQRLALGMALVEDPDLLVLDEPSSGLDP
FT                   HGIRRMRDLVREEAERGTTVFFSSHILGQVEAVCDRVGILADGELVAVDTVEGLRKTVG
FT                   AGSELRLRVTDDPGVDIAAIDGVESVRSTDGRFRIACSDPRAKARVVTRLTTAGVEILD
FT                   VDSDDASLEDVFTAYTTDGDVGDAEPEAPALVEEVVP"
FT   gene            149685..150581
FT                   /locus_tag="Htur_0140"
FT   CDS_pept        149685..150581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0140"
FT                   /product="NosY protein"
FT                   /note="KEGG: pag:PLES_16661 NosY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59041"
FT                   /db_xref="GOA:D2RTJ8"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ8"
FT                   /inference="similar to AA sequence:KEGG:PLES_16661"
FT                   /protein_id="ADB59041.1"
FT                   /translation="MTVSWQDVARKDFEDAVRSRLLWGLTAVFVAFLAMSLLSAEQLFP
FT                   EPVTVDAAMALSGVAMLAQLFVPGIALAVGYTAVVGERRSGSLRVLLSYPFSRGEVVAG
FT                   KLAGRLLVTGTALAIGFAAASVLVVALYGVPDAATFVGFVAAGVLLGLTFTALAVGGSA
FT                   TASTRGRARTLTIGSFVGMVFFWKPVVVGIYYVVTGSLPGVQAESWYFLLKRLNPLEAY
FT                   RVVAGAVLDERVDAVPEFPLEDVPANAPAETLELSNRLAGEVPFYLADWFSAVVLLAWG
FT                   LVPVLAGYRLFEDADLG"
FT   gene            complement(150628..150825)
FT                   /locus_tag="Htur_0141"
FT   CDS_pept        complement(150628..150825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0141"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: psa:PST_3386 copper-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59042"
FT                   /db_xref="GOA:D2RTJ9"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTJ9"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ADB59042.1"
FT                   /translation="MSQTITVEGMSCEHCEQTVEDALEGVEGVQSVNVDREAARATVEG
FT                   DTDPQALVEAVDEAGYEAST"
FT   gene            150953..151543
FT                   /locus_tag="Htur_0142"
FT   CDS_pept        150953..151543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0142"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein MarR; SMART: Transcription
FT                   regulator, AsnC-type; TRASH domain protein; KEGG:
FT                   rlt:Rleg2_4344 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59043"
FT                   /db_xref="GOA:D2RTK0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB59043.1"
FT                   /translation="MRDLDETDMEILRLLGENARRPFSEIADEVDLSGPAVSDRVQRLE
FT                   EAGVIERFTLDVDQSQLRAGVPVFVRVTAPPGAVEDCRTASAEADAVEHVFVTADGEIW
FT                   FYARAEVRRVREWLEGLFPDGADCEYDVTLLDDAEWTPSLEGTQFALTCAECGNTVDSE
FT                   GESTRIDGEVYHFCCPSCSSRFEGRYDRLEEGV"
FT   gene            151628..154243
FT                   /locus_tag="Htur_0143"
FT   CDS_pept        151628..154243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0143"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: dal:Dalk_3003 heavy metal
FT                   translocating P- type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59044"
FT                   /db_xref="GOA:D2RTK1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK1"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADB59044.1"
FT                   /translation="MSTRTVHLDIRGMSCANCSQTISDALESLDGVSEASINFATDEGT
FT                   VEYDPAAVSLAELYAAIDEAGYEADRASRSIGITDMSCANCAETNESALESVPGVIEAE
FT                   VNYATDEASVAYNPADASLGDLYAAIEDAGYTPVRDDADGSDESDRDRRDAARQAEIRK
FT                   QRRLTIFGAVLSAPFLFFLADKFLLGGAYVPETVFGVSFGWVEFLLATPVYVLLGREFL
FT                   ENSYTALARNRTANMDVLIALGSSTAYLYSLVVLLGLLAGNLYFDTAAMILVFITLGNY
FT                   LEARSKGQAGEALRKLLEMEAETATLVDADGNETEVPLEDVSVGDRMKVRPGEKVPTDG
FT                   VVVDGQSAVDESMVTGESVPVEKGSGDEVIGSTINENGVLVVEATKVGEDTALQGIVQT
FT                   VKEAQSRQPEIQNLADRISAYFVPAVILNALFWGLVWFLFPEALAGLVGWVPVLGLVGG
FT                   GPAALSTFEFAVVVFASAVLIACPCALGLATPAATMVGSTLGAQNGVLFKGGDVLERAK
FT                   DVDTVVFDKTGTLTTGEMTLTDVVALEDEGEGKGARAAADGGDAAADGGAVATQSRLDE
FT                   SEVLRLAASAERDSEHPLAQAIVEGAEERGLELVDAEAFENVPGQGVRATVDGREVLVG
FT                   NRRLLESEGVDPSPAEGEMERLEGEGKTAMLVAVDGAVAGVVADADTVKESSADAVADL
FT                   RERGLDVMLITGDNERTARAVAERVGIDPDNVRAGVLPEDKADALEDIQSTGRKAMMVG
FT                   DGVNDAPALAVAHVGTAIGSGTDVAIEAADVTLMRDDPLDVVKAIRISEATLAKIKQNL
FT                   VWALGYNTAMIPLASLGLLQPVLAAGAMALSSVSVLSNSLLFRRYTPDRDYELLGRLRR
FT                   "
FT   gene            complement(154780..155769)
FT                   /locus_tag="Htur_0144"
FT   CDS_pept        complement(154780..155769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0144"
FT                   /product="protein of unknown function DUF95 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF95
FT                   transmembrane; KEGG: smt:Smal_3844 protein of unknown
FT                   function DUF95 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59045"
FT                   /db_xref="GOA:D2RTK2"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK2"
FT                   /inference="protein motif:PFAM:PF01944"
FT                   /protein_id="ADB59045.1"
FT                   /translation="MSGSDDDRTGRSEATAGREERPPADRRNDSRTDRPTVGLQDDREG
FT                   TVSSPEPDRGGTEPPADPGSRRNRIWAALLLSLAVVAVGTGGTILVAHDAPTAAAGAAV
FT                   LGAGLGAAGLAGRTVTPSLLSTLEAAWTEHRPYAWFSAALFAVGIGIGVALYAAGVDLT
FT                   ELLLEMITEDFGEGELPGGGVDPVGEITFEPTASFFIANNTPPFLAAIGGALTLGLVTL
FT                   LIMVFNGLLIGNVAAVLGAETGPVLILALIGPHGIFELPALFIAAGVGFRFVHRVGQRI
FT                   VGSRDALFTKAYLARTAVLVVFGWLLLVLAAFVEAYVTLLLADVLVPL"
FT   gene            155886..157184
FT                   /locus_tag="Htur_0145"
FT   CDS_pept        155886..157184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0145"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   dma:DMR_26020 amidohydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59046"
FT                   /db_xref="GOA:D2RTK3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR023512"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK3"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADB59046.1"
FT                   /translation="MTTLAITGGQVLLPDITVTRADVLIDQDDGEILEIGDDLADDADE
FT                   TLDAADSLITPGFVNGHCHVAMTLLRGYADDKPLDAWLREDIWPVEAELTADTVRAGTE
FT                   LGVLEMIKSGTTSFADMYFFVPTIAEAVADAGLRARLGHGVISVAKDDEAAREDAREGL
FT                   AVAEEIDGMADGRISSAFMPHSLTTVDGEYLAEFVPQARELGVPVHYHANETTDEVTPI
FT                   VEEEGVRPLAYAAEKGMLESEDFVAHGVHVDESEIGLLAEAGTSVIHCPASNMKLASGM
FT                   APVQRMREAGVTVGLGTDGAASNNDLSMLDEARDAAMIGKLAADDASAVPAGAVVEMMT
FT                   RGSAEAIGLDTGRLEEGAPADLAVIDLEEPHLTPRHDLVSHLAYAAAAADVRHTVCDGR
FT                   VLMRDREVLTLEEDAVRARASEAAETLIAAAEE"
FT   gene            157344..158372
FT                   /locus_tag="Htur_0146"
FT   CDS_pept        157344..158372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0146"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59047"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59047.1"
FT                   /translation="MNGYRLLAAALAAVMVCTALAPMGAAAATTDHDDLSVSVSQADDV
FT                   IVTVDANESVDNATVDVATVDENASYEGTGEYDVTNGTVALPTPAENVTVSVTATLGNE
FT                   TAETTATLEAADDEEDGEDEDDTYDADDQNGTAIGVEQDGADVHVVVTEDGEGVATDVT
FT                   VSTVDENASYADSGTHATDENGTLTLSAPDGNESVEVAFSATVGNESLETTATLEPAEE
FT                   TNDGIPGNFGALVGQFMEENASDNESDEPFGVRLAGFVVEHNPGNAPDHAGPPEHAGPP
FT                   SDDVDDDDDEKRQGPPEHAGPPDEDADDEDEEDVEDEEDVEDEEDDDENGGGPPGHAGP
FT                   DN"
FT   sig_peptide     157344..157427
FT                   /locus_tag="Htur_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 28"
FT   gene            158668..159957
FT                   /locus_tag="Htur_0147"
FT   CDS_pept        158668..159957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0147"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: hha:Hhal_0050 adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase, NAD binding; S-adenosyl-L-homocysteine
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59048"
FT                   /db_xref="GOA:D2RTK5"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK5"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ADB59048.1"
FT                   /translation="MTDTAYPPISEQLDDLESAREEGRRKMDWAAQHMPILESVREEFV
FT                   ADQPFEGERIGMAMHVEAKTAMLVETLAEGGAEVAVTGCNPLSTHDDVSAALDTHENIT
FT                   SYAKRGVDDEEYYAAIEAVIAHEPTITVDDGMDLVAAIHEDYPELIDGIVGGAEETTTG
FT                   VHRLRAMDADGALEYPVFAVNDTPMKRLFDNVHGTGESSLASIAMTTNLSWAGKNVVVA
FT                   GYGYCGKGVAKKAAGQNANVIVTEVEPRRALEAHMEGYEVMPMAEAAEVGDVFLTTTGN
FT                   RDVIVEEHFEKMQDGVLLANAGHFDIEIDLEALDDLAVDRFEARDGVEAYELEDGRKLN
FT                   VIAEGRLVNLAAPVSLGHPVEVMDQSFGIQAVCVREMLENGDAYDAGVHDVPDELDKEI
FT                   AEIKLEAEGVDHDSLTDTQREYMDSWDHGT"
FT   gene            complement(159989..160774)
FT                   /locus_tag="Htur_0148"
FT   CDS_pept        complement(159989..160774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0148"
FT                   /product="PAS sensor protein"
FT                   /note="KEGG: gur:Gura_4005 response regulator receiver
FT                   modulated diguanylate cyclase with PAS/PAC sensor; TIGRFAM:
FT                   PAS sensor protein; PFAM: PAS fold-4 domain protein; SMART:
FT                   PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59049"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK6"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB59049.1"
FT                   /translation="MTPATVAPVLEDPSPIAGELTALAVGDRRHTEQVEAAVDDDDQIA
FT                   VRTAPSVADALPELDDVDCFVGAYPPENGTGLLERVTEGTIDLPVVLLVDEGATVGDGV
FT                   RSHGWLDWVDRAAAIEDGERLRRRIRSLVKRRRLTGLTQRSLAGIELAGDAIAIVAPDG
FT                   TVQFANRGFAMQFGYGRDDLAGRPWRTLFTDDSVDRLETAAIPTVADGWRWTGSCTGRR
FT                   KSGKTVPVRVRLGGPENGGLVFVVEPLDAERGAATNDSA"
FT   gene            complement(160856..161113)
FT                   /locus_tag="Htur_0149"
FT   CDS_pept        complement(160856..161113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59050"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59050.1"
FT                   /translation="MPETTLDYHNDSLSLSVIEALADATDTDPVELEPLYHVVDPEALD
FT                   QLFQGNTPATARVQFSYGDHTVEVRSDGTILVDGTVHERP"
FT   gene            161392..167301
FT                   /locus_tag="Htur_0150"
FT   CDS_pept        161392..167301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0150"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: dol:Dole_0981 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: PAS fold domain
FT                   protein; PAS fold-4 domain protein; Bacterio-opsin
FT                   activator HTH domain protein; GAF domain protein; PAS
FT                   fold-3 domain protein; SMART: PAS domain containing
FT                   protein; GAF domain protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59051"
FT                   /db_xref="GOA:D2RTK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK8"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB59051.1"
FT                   /translation="MVSRSSRSATLDGSLGRRRSPGFLGVILVGTLLLCLGPQLHGSSI
FT                   VPLPFILGLAARGGADREPTLERLAGELETFVSRVRDGEVNEAIADPDADAEGVDFELD
FT                   RDDALGRLSTAIDELTTAVRERERRFGERERELRETNERLEAVIEASPAALVALDTDET
FT                   VTLWNPAAKRIFGWSEAEVLGESLPFVPDDRAEGHREIFDRLFEGESIAGLETQRVTKA
FT                   GERIDVSISAAPIYGADGEIVGTMGAIEDITDRKERERRLEATSARLEALFERSPDMID
FT                   VLDTEGAIVGANQRLCDKLGYTESELVGTKIWEHAKLFDAGEVTALLDDVETGERRKFE
FT                   DRYRRHDGTTFPVEVHLIRLDLAEENRFLAISRDISDRKARERDLRETKRRLELALEGT
FT                   NTGVWEWRLDSDNVSWDETSEAFIGLEAGELEESYEAFRQRVHPDDWPRVAAALERAVD
FT                   GDELYQAEFRMRHEGGDWRWFESRGRVVDDDGVTRLVGTRNDITDRKERERELERYREY
FT                   TDDLLDAVDDVFYVLDADGDLQRWNESLSAVTGYADAEIESMDALDFFAEADRATIADA
FT                   IAEVLETGSTRVEAPIQTVDGETIPYEFVATRLEDLDGNTVVTGIARDISERKRYERDL
FT                   ERTTELLEQAQRLASVGGWELDVREEPFEAMASDEFYRQLGLEPGTTLTPADAIERFHP
FT                   DDRPALRAVIEAAIEDGESYDLEARVRLDDGEERWVRAIGEPVRDGADEIVAVRGSMQD
FT                   VTEGKARERDLERTTRLLEQSQRLSNVGAWELDVREESPTVQWTDEVARIHGLSPEADV
FT                   DLEHAVEFYHPEDRDEVRAAIERAIERGESYDLEARIEPADDSDRRWVRTIGEPVSEDG
FT                   RVVKLYGSLQDVTDRKERERDLQRYETIIQAIGDPVYTLDESGRVQFVNDAIETLAGYD
FT                   PDALIGDDVSELLPPPDLERAREQVRELLREDEPYGTVETNFATADGDVIETETHVALL
FT                   PMDDGEFAGTAGVVRDITERKERERELERYETIIQAIGDPVYTLDASGTFRFVNDAIES
FT                   LSGHDPETLIGADVATVMSPENLETARELVRELLREGKPYETFEMDLETADGDVIEAEN
FT                   HMALLPSEDGEFAGTAGVVRDITERKERERELERTTELLEQAQRIAGVGGWELDVTTEP
FT                   YELTLTPQLERLFGRVGRAETLDVEDAVELYHPDDRSRVLSAVDDAVEHGESYDLEVRM
FT                   HTPDDEIQWVRTIGEPIADDGEVVAVRGSIQDITDRKRRERELERTTDLLERVQRMASI
FT                   GGWEVNVRADPSTSTWTDEMYRLHDLPSDVTPDLEQTIECYHPDDRAFVREQIEAAIET
FT                   ETGYDLEARIRTSEGEIRWVRAISEPIRDEAGELHKYRGTVQDISDRKRRELALESLHE
FT                   TARGLLNAETESTVADLVVDTAADLLETGDVGAGVYLLDSETNRFEPVSSTANFADRSG
FT                   GAPSVAVGDGDSVLWTTYVTGTQTVVDDAEIGDRSPLFGGDAPGGLLVPIGDYGVFVLL
FT                   ASPATIDDETRRLFETLVATTEAAFDRLESEANLRERDAELAAQNRRLRRQIQITEIIR
FT                   GIDRSLIGADGRDEIERTVPERLVAADNVSFAWIGDLDASGSTLEARTWAGDEPEYLDA
FT                   VDFGLEGESQEPAVRAARTGSPTVVENVVEDFQGEAWRTNALDAGFQSAIAVPLTFEEY
FT                   SYGVLTVYADEPDAFTDLERSVFAELGEGIASAINAAQTREALHAETLVELTLDLETDD
FT                   VLSRIATATGAAVTYEGLGTHGESEAVIFFETRGASAEAVRDVLDDLVSVTSARLVTES
FT                   DSRCLFEATVTGDVLATRLVRHGGSPRSIAVDEGRTEVTVDVPVTTDVREFVEMLRDQY
FT                   ERVDLRSRRHVQRTMHTRQELVTSLFEDLTDRQLEVLRTAYLAGFFEWPRESTGEEIAE
FT                   MLEVTQPTVNRHLRIGQQRLLERLFDDETLSVADGS"
FT   gene            167379..168209
FT                   /locus_tag="Htur_0151"
FT   CDS_pept        167379..168209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0151"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   xca:xccb100_0005 putative membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59052"
FT                   /db_xref="GOA:D2RTK9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTK9"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADB59052.1"
FT                   /translation="METSQRHRERTDGPLRSTLVAIGLTVFGVLVAPNFTTLPAFLLDP
FT                   ALISSPTEASVTARAALLSLNFVGIALAGAIYLAVTDRGWSYVDLRMPTKQGWIYAIAG
FT                   VVGILVFYVLVAVVVSMLSLPSSENNVMTYIGDDPTMVLIMIGVVFFFNAPAEEFLFRN
FT                   VVQKRLYEAFSRTHAIVIASVIFALVHFVSYAVLSDSLLATMVPIATVFGGGLIFGYLY
FT                   AKSENLLVPILSHAVYNGFQFGLVYLALVYDLEGAEPTTEALLDLVATIATLPL"
FT   gene            168273..168791
FT                   /locus_tag="Htur_0152"
FT   CDS_pept        168273..168791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0152"
FT                   /product="Resolvase, Holliday junction-type"
FT                   /note="PFAM: Resolvase, Holliday junction-type"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59053"
FT                   /db_xref="GOA:D2RTL0"
FT                   /db_xref="InterPro:IPR002732"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014428"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL0"
FT                   /inference="protein motif:PFAM:PF01870"
FT                   /protein_id="ADB59053.1"
FT                   /translation="MSQAKGDRRERELVNELDAAGFAVMRAPASGSATERELPDVLAGD
FT                   GEVFYAIEAKSSAGDPIYLTGEEVEALIFFAQNFGAKPRIGVRFDREDWYFFHPGDLHV
FT                   TDGGNYRVKKETAIAEGTDFDEFVGRSEKVTLEEVGDGGDGPDEEILRVLNAVKQDVMD
FT                   VEEAAELLE"
FT   gene            168882..169037
FT                   /locus_tag="Htur_0153"
FT   CDS_pept        168882..169037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59054"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59054.1"
FT                   /translation="MTDSTTVTRGTAVCENCGSVFAVRIWPDGRIRPIGSPANCPCGGT
FT                   EFRRLS"
FT   gene            169143..170639
FT                   /locus_tag="Htur_0154"
FT   CDS_pept        169143..170639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0154"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: dvm:DvMF_0946
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59055"
FT                   /db_xref="GOA:D2RTL2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL2"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADB59055.1"
FT                   /translation="MVTNSGLLSPIVRAGAAVVFALVAIAVAATVWTVTYLSWWQAIGL
FT                   ESASFPATVVALVPLAGLGYVAISTEGGPTLSTAAYVGCFAAASVAFFAAVWTIVFLVA
FT                   LLPLGAATASTAAGGTTLLLTVGTTATAAAAIAAAGRSADWALLLRMAVAVLLLALVTI
FT                   GFLGVIWLLVALVAAIAVGPVLGLYVAGAATLLAAGLLARREFRQVRSIEERLDATPTT
FT                   ADDLPGIHAATTKVAAQLGVPKPTIAVSETYAPEAMVVGFRPDESHLVLSYGAVTALSE
FT                   AELEAVIAHELAHVANRDAMVMTAVSTPLVLAEGLRARVRTDTFEEDEEWQPPEERPDA
FT                   DAEWGSEEIFGPNDEWRMEPPTETEEATDERDDDDGWFVRMTLFVIATVTWVVSRAIVA
FT                   VLSRSRETTADRTAVAVTGSPAALAGALRTLDDRIDRTPTRDLREAAGASSLSILPLEP
FT                   VTVDSDDPSLLERLRARLFWTHPPTEQRLAALEKLERERR"
FT   sig_peptide     169143..169229
FT                   /locus_tag="Htur_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.845 at
FT                   residue 29"
FT   gene            complement(170719..172656)
FT                   /locus_tag="Htur_0155"
FT   CDS_pept        complement(170719..172656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0155"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   aav:Aave_1841 acyl-CoA dehydrogenase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59056"
FT                   /db_xref="GOA:D2RTL3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL3"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB59056.1"
FT                   /translation="MSTGIDHGRFEEGRGVNYWDLDRPLERELRRLYTNEEFEWAEPRL
FT                   AEFGAVVGRTIADNADYVDDHGPELEPYDAHGEVWNRVRYPAEQFENDRLAYERGIVAD
FT                   AFEAPLDRDEPMPLAHTLAMQYLLSYADVGFDCPVAMTAGAALVLEKFDDGSLAEYYEA
FT                   LTSREYDDLIEGAMFLTEKQGGSDVGANETRAEYDPESGYWRLSGEKWFCSNVDAEGTL
FT                   ALARTPDAPEGTAGLSMFLVPHSDPDSDARPADGPYTKGDRLEDGPLEPEAVNDQLYRR
FT                   LKDKLGTTAVPTGEVEFTGAKAFLVGEEEKGFTQMTEMLNLERLSNAAAACGLMGRATL
FT                   ESAIYAANREAFGDTIDRYPLMRADLVDMTVAHEAATAFTFEAARLLSERERAERSARS
FT                   DDAASADGDAASTTADESADEAYRLMRLLTPIAKLRTGRMAVDTASYAMEIHGGNGYVN
FT                   DFVTNRLLRDAQVLPIWEGTENVLSLDVLRALEREDAHEPLLETIEDRLETVSHPALAD
FT                   AAETVESEYEELAAALATLATEDGEYAQLSAKCLAHYVFDIFTAALLLEQAQTSLEADD
FT                   GDRSDGSDENTESGRLALIAQRFVATELEDRPARGITGGDRDVLEAFEPIVRGGPVDPE
FT                   VLSAAAPADD"
FT   gene            complement(172926..173549)
FT                   /locus_tag="Htur_0156"
FT   CDS_pept        complement(172926..173549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0156"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59057"
FT                   /db_xref="GOA:D2RTL4"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL4"
FT                   /inference="protein motif:PFAM:PF04434"
FT                   /protein_id="ADB59057.1"
FT                   /translation="MNTTASPKTALPVPSSDHLEERSRRARTEPMSVLALGDGLYEVES
FT                   ASDHTYLVDLESGRCTCPDHVFREARCKHIRRVAIEITHGRTPPPGEIAVACHDCGDAV
FT                   FVDEDASEPFYCEAHVLRAGDTVRDRETDDRLTVVDVSDLRADAVTIGGSNTTVADYAT
FT                   NERYDDGVPVVGAVYPHATVAKNGVVPGSLKVYVFPRTRLEKTA"
FT   gene            173748..174017
FT                   /locus_tag="Htur_0157"
FT   CDS_pept        173748..174017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59058"
FT                   /db_xref="GOA:D2RTL5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59058.1"
FT                   /translation="MLDREQIIEISVAVSMVLLMLGTMIAIGTQYGGSSGTLSPEGGEL
FT                   LVGAITGFILLMLAVGIGLAYVLNDPEDGLEADDETDADTGSAI"
FT   gene            174062..174439
FT                   /locus_tag="Htur_0158"
FT   CDS_pept        174062..174439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59059"
FT                   /db_xref="GOA:D2RTL6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59059.1"
FT                   /translation="MSSPTADPESTRSRSTWTVIAAVIGTLVFGSAIVGLSAAVLEAPV
FT                   AVGAVAVLTLLAAAFAWRRAAASGETAADGEGSRDVWNAIPSWQYDGRHAESGGFTRGE
FT                   QESALREIQQQADDIEKRERN"
FT   gene            complement(174447..175529)
FT                   /locus_tag="Htur_0159"
FT   CDS_pept        complement(174447..175529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0159"
FT                   /product="DNA primase, large subunit"
FT                   /note="PFAM: DNA primase, large subunit; KEGG: DNA primase
FT                   large subunit; K02685 DNA primase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59060"
FT                   /db_xref="GOA:D2RTL7"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR023642"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL7"
FT                   /inference="protein motif:PFAM:PF04104"
FT                   /protein_id="ADB59060.1"
FT                   /translation="MQRLHARYPFLETARDAVATEAVDLATVVDQDRAVVDRARERVVA
FT                   AIADGETGEPRRDTRVELLSYPVARVLVSMVEERVLVRKYARAEAATAYDRFTADFEDT
FT                   TELKSVESTGLDLETLLAEFDLGGAVRETADGYRIDVGTYLPLAEDLWGDEWHLVNRAL
FT                   TDGEVPVDHDELLTLLREAIRGRIEDGLPFDVPEVIAAALEDEAAEIREVLADLELTQD
FT                   IDTVVPDLFPPCMKALLDDIQKGEHLPHHSRFAITAFLTSIGMTTDEIVDLYRINSSFG
FT                   EEMTRYQTDHIRGDSSPTEYSPPSCATMQSYGDCVNKDDLCERIPHPMAYYEERIDDAD
FT                   DDEIEDWREGESEEETASGD"
FT   gene            175703..176569
FT                   /locus_tag="Htur_0160"
FT   CDS_pept        175703..176569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0160"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pla:Plav_1675
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59061"
FT                   /db_xref="GOA:D2RTL8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL8"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB59061.1"
FT                   /translation="MPRATRDGVSIYYEYDESEGDGTPVVFVQGLGYGRWMWRWQREAV
FT                   ADDRDVIAPDNRGTGRSDAGLPPLLPRLPRKLRAPLLFKLAGYSIGGLAADLEEVLADA
FT                   GIRRAHVVGASMGGMIAQRYALEYTRAETLTLCCTSHGGPDAVPVPDETQEFIFDVPDG
FT                   ANERETIRHRMRPAFTERFTNRNPHLMDRIIEWRLEQDADDPAREAQAAAVLDFDVSDR
FT                   LEGLRVPTLVLHGTDDRVVPFENGLLLEEAIPNARLERFEGGSHCFFIEHADRVNEELR
FT                   AFLADHD"
FT   gene            complement(176594..176911)
FT                   /locus_tag="Htur_0161"
FT   CDS_pept        complement(176594..176911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59062"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59062.1"
FT                   /translation="MPSTDDPTDASDADEPAYTTTFDPDGGERASEAVITAVAALTGNR
FT                   PVDLEPLYEVVDPDALDSLIDHARRTDAGTHELWFAYAGYGIGVRSDGRIQFYDGAAPT
FT                   A"
FT   gene            complement(177051..177794)
FT                   /locus_tag="Htur_0162"
FT   CDS_pept        complement(177051..177794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0162"
FT                   /product="Proliferating cell nuclear antigen, PCNA"
FT                   /note="PFAM: Proliferating cell nuclear antigen, PCNA;
FT                   KEGG: hypothetical protein; K04802 proliferating cell
FT                   nuclear antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59063"
FT                   /db_xref="GOA:D2RTM0"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM0"
FT                   /inference="protein motif:PFAM:PF02747"
FT                   /protein_id="ADB59063.1"
FT                   /translation="MFKAIVSAETLTSALDSISVLVDECKIHLEEDGLEIRAVDPANVG
FT                   MVDLSLDASAFESYEADGGLIGVDLSRLEDIASMAESGQLVQLELDEETRKLQIQIEGL
FT                   EYTLALIDPDSIRQEPDIPDLDLPAEVILEGKDVNRSVKAADMVSDHIALGVDEGEEYF
FT                   YVDAEGDTDDVHLELTEADLIDLQVGPAHSLFSLDYLKDMNKAIPSDTEVTLHLGEEFP
FT                   VKIYFGFAEGQGQVTYMLAPRIQSD"
FT   gene            complement(177961..178230)
FT                   /locus_tag="Htur_0163"
FT   CDS_pept        complement(177961..178230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59064"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59064.1"
FT                   /translation="MADTPDVNAVETEDDYIHVRFRDPDRYDEIRTPDWAENPAESVSE
FT                   GSEVRTGKVEGEDDWEVTSVLIKKSVGEDKAAEQAREIVEKIES"
FT   gene            178379..179020
FT                   /locus_tag="Htur_0164"
FT   CDS_pept        178379..179020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0164"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   glo:Glov_3339 phage SPO1 DNA polymerase- related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59065"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM2"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADB59065.1"
FT                   /translation="MSDRESTAWEFETEFADVLEAVPDEHRDPERFVPGVGPLSADVML
FT                   VGEAPGGQEVEQGEPFVGQAGQQLDRALESIGHDRRELYITNLVKVRPPENRDPHVDEI
FT                   EAWWPVLEAELERVDPVVVVPMGSFATAELLETDETITDLHGEEFEREVPPASHASNEE
FT                   GTGSSSEGGADPGERTERIVRPSFHPAAALYDRSKVDAIESDLRAALESA"
FT   gene            179279..180064
FT                   /locus_tag="Htur_0165"
FT   CDS_pept        179279..180064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0165"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   deoxyribonuclease/rho motif-related TRAM; KEGG: eba:ebA4820
FT                   cell division protein FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59066"
FT                   /db_xref="GOA:D2RTM3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM3"
FT                   /inference="protein motif:PFAM:PF01728"
FT                   /protein_id="ADB59066.1"
FT                   /translation="MARKDDYYNRAKQQGYRSRAAYKLKQLDDLENVISGHDTVVDLGA
FT                   APGGWLQVAAEKVGPQGTVIGVDLQRIKDLEDETLNERVETIRGDMTEEKTRDRVTDAA
FT                   GGSVDVVVSDMAPNMSGEYSLDQARSLYLARQAFETALELLESGGNFVVKVFEGPDVDD
FT                   LRADIDDEFQYVRATAPKASREESSEIYLIGKGRLTAPVREGDELEVEIVDVGSEGDGI
FT                   ASVDGYRLFVPDAEPGDVVDVRIEDVKPNFGFAEPLEEE"
FT   gene            complement(180171..180353)
FT                   /locus_tag="Htur_0166"
FT   CDS_pept        complement(180171..180353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0166"
FT                   /product="putative transcriptional regulator, CopG/Arc/MetJ
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59067"
FT                   /db_xref="GOA:D2RTM4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59067.1"
FT                   /translation="MPKISVEIPQELLDDLDDHVGDDGKFVNRSDAIRASVRKTLDLLD
FT                   EIDERHDRLEADERE"
FT   gene            complement(180410..182776)
FT                   /locus_tag="Htur_0167"
FT   CDS_pept        complement(180410..182776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0167"
FT                   /product="Sec-independent periplasmic protein translocase"
FT                   /note="PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: aha:AHA_0089 twin arginine-targeting
FT                   protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59068"
FT                   /db_xref="GOA:D2RTM5"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM5"
FT                   /inference="protein motif:PFAM:PF00902"
FT                   /protein_id="ADB59068.1"
FT                   /translation="MSSAVDEDTAKAINAGRESIGVMLSTAQTHLQKVFIVFVIGFIGS
FT                   FYALRVFIWDFLEATAKAQMNETVAEATTIITRTPFEVILLQAKIGMLVGVIVAIPALL
FT                   FFSRHTLRRRGFDSAFPVSRGYIALFALTSFTLFWIGVGYAYGIFFPFAFEFLGSVAYD
FT                   AGVTPSWGITEFTEFIALLTISFGLAAQLPLAMSVLSYTEIVSYEMFRDKWRHAVVAIT
FT                   VFGAAFSPPDPFTLVMWALPLVALYGFSLGLAKVVANIRRRGAAELDTGTSFMKRRLLQ
FT                   FAGVLALITVGTSVFINQDGADTLDEAVFPLLPAPIRPEGTLGLETYAAEHGLLGDVAV
FT                   GAAVAAAVGFLVLLVYTIRVLQAPVYPREGDLRNADDPEDVDFETLSAEDIEEIPATVF
FT                   LSMEEEDALDHSRQAMYDDNREKAQAILDRFDTLQEQQAGDETDGEGGTAASDAAGAAA
FT                   AGDAAAAGSGGDDEESVFSSTAAGMLDAFTEDETTEDDIGGYAYDLAFIVNSLTSKAIY
FT                   IVGVFMAVLAASFLALYQGGFGVILAQFVDRVPEEVLREVSGGAGVAGAESTTELLEEL
FT                   GLVIALHPVEVLIFMVKVSTILAFISVVPLIMYWGWPAARERGLVRGDARVFLIWGLAM
FT                   FLGFGAGLLAGFYWIAPSVISYLISDAIQNGMEVSYRINSFSWLVIYTTLGVGFLFNII
FT                   VTMALFHVGGIVSYRTMLERWRPVVVGIFTLAAFASPQGVLTMLMLAIPLALTYLLGLA
FT                   LLYVFTAGGRLFGGGGSGGEPADPEPEPESGATPE"
FT   gene            182921..183895
FT                   /locus_tag="Htur_0168"
FT   CDS_pept        182921..183895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0168"
FT                   /product="Sec-independent periplasmic protein translocase"
FT                   /note="PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: sat:SYN_00305 sec-independent protein
FT                   translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59069"
FT                   /db_xref="GOA:D2RTM6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM6"
FT                   /inference="protein motif:PFAM:PF00902"
FT                   /protein_id="ADB59069.1"
FT                   /translation="MSDEPANRGDAEGTTEPQESPGEGPPIDDGRRDEPSIATDGGDEY
FT                   EPDDRPVETDGEGVVGDHADHGEADYPDPDDDIGGISTPPDDEEMPLADHIEEMVLRFA
FT                   VVLLFGATGTAIGLLGASEALEFIWLDVFPAQAEEVPPPHIYHPLELWMTRIKLSALLG
FT                   IMVALPTFVYECYKFMKPGLYPHERKYYLASVPLSVVLAALGMLFSYVLVLPVLFQYFT
FT                   YYAEGSADIAYALGETFDLIITLTGFLAIVFQIPLFIMLAIMMGVTTRRWLAQKRLYFW
FT                   AGFAGLSFMFTMDPTMMAPILVAVTMILLFEGTLLVLKWVGRD"
FT   gene            184275..186437
FT                   /locus_tag="Htur_0169"
FT   CDS_pept        184275..186437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0169"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: psb:Psyr_2099
FT                   molybdopterin oxidoreductase:molydopterin
FT                   dinucleotide-binding region:molybdopterin oxidoreductase
FT                   Fe4s4 region:BFD-like [2Fe-2S]-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59070"
FT                   /db_xref="GOA:D2RTM7"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM7"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADB59070.1"
FT                   /translation="MDRVTELVPTTCMRCAVGCGHVHRPVEQGYGLDVVRGDAAHPVNN
FT                   GLACQRGINESVDPGAEWLTRPLVRRNGELVPTTWETALERAAEGLDAALESGDGGEGV
FT                   AVLGSGQQTNEAAYALGKLARGGFGTPYYDANTTLCMASAVTAYYDAFGSDAPPPTYDD
FT                   IPEAETHLVWGANPAAAHPVMFRWINQSADDDDSELIVIDPIESETAEVADHHVPLSPG
FT                   GDLDLARAVLARVVETDRVDEAFVAEATDGFDALREDLPDAAEAAAAAGVSLEDVDRIA
FT                   AALEDPTLVYWGMGINQSVNGTAASGALIDCCLATGNLRPGSGPFSLTGQANSMGTRVC
FT                   SSKGSWPGQRPFTDPDHRREVAETWGVPESRLPDDPGPGPVGIVDEIGDDVSAVYAVAT
FT                   NPVAGMPDATRVREQLEDAFLVVQDAFRSETVELADVVFPAATWGESEGTTTNMERTVS
FT                   RVRAATETPSGVKTDLELIGDLADRLVPDLFDDSLEPNAVFDELAALTEGTPADLSGIS
FT                   YDRLDEEVAVRWPAPEPDVSGGYRYYEEPATDEEGEDADATVREESWSFPTPSGRAQFS
FT                   TGEAQPLPESTDEEYPFTLTTARRPDAYNSGVRARDDDPVARVSPATAAALADELEARP
FT                   GESDEDDPAEYAHVVSRRGSITVRVERDESIPDGVVWLPIHQPAVNELTLSDVDPRSKE
FT                   PNFKQCAVRLEAPREQEARAVAEASA"
FT   gene            186468..187826
FT                   /locus_tag="Htur_0170"
FT   CDS_pept        186468..187826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0170"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   smt:Smal_2231 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59071"
FT                   /db_xref="GOA:D2RTM8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB59071.1"
FT                   /translation="MRERPPEPPDSSDASAPAVRGTPRRGVASATLGFFVGFAGVVCYG
FT                   PVASEFQDAMGLSGLLVGLLVAAPQLTGSLLRIPFGAWVEDVGAKKPFLVLFGLSIVGM
FT                   GGLSALLLTAYPDGLTMAHYPIVFFFGALSGCGIATFSVGTTQTSYWYPSEKQGTVLAV
FT                   FGGLGNTSPGLFTLVLPVALAVLGLTGAYLAWFAFLIVGTVAYASYAVDAPYFQFVKRG
FT                   VEEREARRRAEACGQDLFPGGDAMASIRGAASIPRTWILVALFFTSFGGFLALTTWLPS
FT                   YWQAVHGVDVRTAGALTAVAFTLLAAVIRVPGGIVSDRLGGEPTAIVSFGAIALATLLL
FT                   VVTREFVLAVAATILLGAGMGVASAAVFQLVPKYVPDAVGGASGLVGGIGAFGGFVIPP
FT                   ILGLFVDLQGTPGYATGFVVFLGLGVASIGLSSGLYRTRSALVPADSSAPAND"
FT   gene            188180..188728
FT                   /locus_tag="Htur_0171"
FT   CDS_pept        188180..188728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0171"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG: ilo:IL2352
FT                   ferritin-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59072"
FT                   /db_xref="GOA:D2RTM9"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTM9"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADB59072.1"
FT                   /translation="MSSQETTVRQQAGTVDENALRLDQDKAEQIVEALNSELANSYVLY
FT                   HQLKKHHWVVEGAEFLPLHEFLEEAYEHVEEGADHIAERAQALGGVPVSGPSNLEERAT
FT                   VEFEGEDVYDVRTMFENDLEMYGDIIESMRGSIELAENLGDPATGEMLREILVHLEEDG
FT                   HHFEHYLEDDTLVLESALH"
FT   gene            188742..189323
FT                   /locus_tag="Htur_0172"
FT   CDS_pept        188742..189323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0172"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   eic:NT01EI_1677 metalloregulation DNA-binding stress
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59073"
FT                   /db_xref="GOA:D2RTN0"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTN0"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADB59073.1"
FT                   /translation="MAQKQGRLVREPDTGERRQEWGTIAENALRVDPADAEVIVDALSV
FT                   DHAGSFNLFYLLRKHYWTAAGAEHEAVADFLEDAYKRVREMNDDLAIRIVELGGIPPNT
FT                   PPTLQDRAEVHLEAEDLYDLRTSLDGDLEGYATLIVSMRDHIALAEERGDPGTGELLRD
FT                   HLEALEEDAHVIEQLLEAETLVQAEVLQDR"
FT   gene            189320..189889
FT                   /locus_tag="Htur_0173"
FT   CDS_pept        189320..189889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0173"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   dda:Dd703_1214 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59074"
FT                   /db_xref="GOA:D2RTN1"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTN1"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ADB59074.1"
FT                   /translation="MTSTPHLRRPDPSHVRQEWGTVAENSLRLERDVAEQLVTALNSEI
FT                   SGLYILFNQVRKHYWLAEGAEWGPISDFLEDAADRLTEMTDDIAIRITALGGVPACGPM
FT                   GIRQHAPIFIEEAHHYDVRSSLERDLDGYATLAVQWREHIELADQLGDVATSELLRRHL
FT                   KTLEADAHVLDRYLADDTLVLRDATG"
FT   gene            190602..192413
FT                   /locus_tag="Htur_0174"
FT   CDS_pept        190602..192413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0174"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: Os02g0765900; hypothetical
FT                   protein; K00366 ferredoxin-nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59075"
FT                   /db_xref="GOA:D2RTN2"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTN2"
FT                   /inference="protein motif:PFAM:PF01077"
FT                   /protein_id="ADB59075.1"
FT                   /translation="MVHKKEEQKEDCYGDEVREHIERFAENGGFEAIPDDEIDKWTTRF
FT                   KFWGVFQQRSGQEEYFMMRLTNASGILEPEQLRRIGEVAKEYAKGPVANPEFGNGWIDL
FT                   TTRQSVQLHWLKLEDIPEIWEQLEAVGVHSRSAGGDTMRNISGCPLHGKAEEFVEAGPL
FT                   LERFEEELRKDDALANMPRKFNISASGCTVGCAQDSLNDIGFEPATKEIDVSGGAGGSS
FT                   DSSDGGEEVRGFNVRIGGGLGGRQPRAATPLDIFVRPENAYEVGRGFVELYHDYGNRQN
FT                   RSKNRARFFAEDWGMEKIRETLQEEYVDFEMHTAGEDFREEYTYNAGRPVEDGQHDHVG
FT                   VGDQKDGQNYVGLSVPVGRLPAEDAIELADLADEYGSGEVRLTRRQNPVIVDVADEDLE
FT                   ELLAEPILEEYPAEPSPFERGAMACTGTEFCSIALTETKGRMARMLRWFNKNVELPDDV
FT                   GKIKMHYSGCTADCGQAMTADIGLQGMRARKNGEMVEAFDIGVGGGVGEDPSFIDWIQQ
FT                   RVPADEAPGAIRNLLEAYAAHRSEGQAFREWVEATGEEQLVEFCEPEETDFEAPYMDDA
FT                   KQSWYPFAESESAAAAAGEGSVAPSDD"
FT   gene            192543..193208
FT                   /locus_tag="Htur_0175"
FT   CDS_pept        192543..193208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0175"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   acp:A2cp1_3224 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59076"
FT                   /db_xref="GOA:D2RTN3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D2RTN3"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADB59076.1"
FT                   /translation="MAAEDRATRHEFSRTTTAGLAIALFGLPLLSGATRALRIDLHPLV
FT                   TIAAQWALLGLVVGITIEIEGRSLRSLGVRQPSRRDAVPLLVAAVLGFFALAATGPLID
FT                   ALGLPERRVTGLDVDRVGVGVAVAFAVTVGVVEEVLYRGYAIERLAERTGSARLAGVIS
FT                   WAAFTLSHAVGWRLGDLLQVSLAALVFTLAYLYRRSLVPVVGAHIAIWLFGVLGAVYG"
FT   gene            complement(193245..193604)
FT                   /locus_tag="Htur_0176"
FT   CDS_pept        complement(193245..193604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59077"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59077.1"
FT                   /translation="MMDADVPSAWNTEESRTYSPVDTDREMQYRTYRHESGDLRLKVAP
FT                   ASLDGEDHPGYALTATSYPGLDLSETIRVRTVLTFERCNSIARDFMDLFSANYDGPGSL
FT                   EDALDYAYERTREHR"
FT   gene            complement(193845..194786)
FT                   /locus_tag="Htur_0177"
FT   CDS_pept        complement(193845..194786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0177"
FT                   /product="tRNA methyl transferase-like protein"
FT                   /note="PFAM: tRNA methyl transferase-like; PP-loop domain
FT                   protein; Queuosine synthesis-like; asparagine synthase;
FT                   KEGG: dal:Dalk_2473 ExsB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59078"
FT                   /db_xref="GOA:D2RU09"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU09"
FT                   /inference="protein motif:PFAM:PF03054"
FT                   /protein_id="ADB59078.1"
FT                   /translation="MTTLEAKLEAAREDLAGRDGVLVAFSGGVDSSVVAALAHDALGED
FT                   AVACTAKSETLPEAELEDARRVADEIGIRHEIVSFSELESDDFVENDDDRCYHCRTMRL
FT                   GEMLETAREVGVETVCDGTNADDPGAGHRPGLQAVEELEVHSPLLAHDVTKEEVREIAD
FT                   RYGLSVADKPSMACLSSRIPTGLEVTEERLTRVEHAEALLRQWGFDQFRVRDHDGLARI
FT                   EVAPEELERALTREFAETVREELSELGFDHVTLDLHGYRTGSVSPESETEPGTDGDGER
FT                   AGGTQNDESAAGSDEPLVEDVFAADSRSRSDD"
FT   gene            complement(194863..195837)
FT                   /locus_tag="Htur_0178"
FT   CDS_pept        complement(194863..195837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0178"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: cja:CJA_0838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59079"
FT                   /db_xref="GOA:D2RU10"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU10"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADB59079.1"
FT                   /translation="MDFGVLSTAGIARKAFLPALEATDHEATAVASRDGERARTFADDH
FT                   GIDESYEGYDDLIADANIDAVYIPLPNGLHAQWTKRAADAGLDVLCEKPLTVDAGEARE
FT                   VVEHCEDRGVTLMEGFMYLYHPRTERAIELAQDKLEDVRSVTAAFKFPLFDRPDDVRLS
FT                   PDLDGGSLMDVGCYPVSLVRQILGEPERAYAHADDSRGAGVDTELAGILEYDDGSSARV
FT                   ASGFDTQKVQRYRVEAENGWLEVRDAFDAPTDEPLELEYRIDGRHAVETFDAIDQYSLE
FT                   IEEFASSVENDRPPRTDGEEAIANMRVIDALAESAERDRPIEV"
FT   gene            195989..196558
FT                   /locus_tag="Htur_0179"
FT   CDS_pept        195989..196558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0179"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbu:CBU_1950 hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59080"
FT                   /db_xref="GOA:D2RU11"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59080.1"
FT                   /translation="MSVSDRLRQLRATSDEREGPESMREQSRAEHALYSAIRGLQAGFV
FT                   ATIIMTAFRLPILRSLPPSANFWSQYVTGDDPEEHPFMGLVLHFVYGIQAGAIFGGLFA
FT                   LQDAERSIEPEQRGIVWGSIYGMVLSAFGSQFMLKELLDIRLDTDELALFHAGHLVYGL
FT                   SLGAWVGSRTEGVEDPETEYEYDDGN"
FT   gene            complement(196613..197710)
FT                   /locus_tag="Htur_0180"
FT   CDS_pept        complement(196613..197710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0180"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59081"
FT                   /db_xref="GOA:D2RU12"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU12"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ADB59081.1"
FT                   /translation="MNTSIEVEYWVVDTDGELTEPGALAEVSERTEREFVEPLFELKTP
FT                   PCETIGELRATFAEQLEEVLSTAAAEEKRLVPLGTPINCGAIDRRPSERGRIQKEVLGE
FT                   DFAYAKYCAGTHIHVEKRNVADQLNTLIALDAALALVNSSPYLDGERVANSARAHCYRK
FT                   KCYGDLPKHGQLWHYVDTVGEWCRRLEDRYEEFKRAALEEGIDEVAIEDNFSTDNVVWT
FT                   PIRLRDEMPTVEWRSPDAALPSQLLRLADDLEMVMERVHNTNVEVESVSDSRHAGHVTD
FT                   DGIRLPTFETACEFANSAIDDGLESADVVGYLDRMGFSVDDYHPISTRIDGRQYVTRGD
FT                   ARDLRLEYANRLEEDVDELVETVGV"
FT   gene            198024..198578
FT                   /locus_tag="Htur_0181"
FT   CDS_pept        198024..198578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0181"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rec:RHECIAT_PA0000356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59082"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU13"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB59082.1"
FT                   /translation="MTSLSTTAAISNPVTGERIAFRERTEAGLRFEYALDPDGFAVGKV
FT                   DHVHPGQRERIAVEEGRLGVRIGGDEWTATPGTRFAVPPGSDHTIWNDGDEPVRTTIEL
FT                   RPALESHRLFETLFGLAREGKTNGWGLPGPLQLAVIADAYRDEFALARVPLALQRALAT
FT                   ATAPAGRLAGHRARYDRFSAE"
FT   gene            198890..201220
FT                   /locus_tag="Htur_0182"
FT   CDS_pept        198890..201220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0182"
FT                   /product="Nitric-oxide reductase"
FT                   /EC_number="1.7.2.5"
FT                   /note="KEGG: shl:Shal_3554 nitric-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59083"
FT                   /db_xref="GOA:D2RU14"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU14"
FT                   /inference="protein motif:PRIAM:1.7.99.7"
FT                   /protein_id="ADB59083.1"
FT                   /translation="MRVSRKQLATFLAVIFVANLVVMGGGAWLSYENEPEIPETIVGPD
FT                   GEPVATSDDVQSGKMVFQENGLMNQGSMLGRGSYYDVDYTADALELKTEHMRDYYAQEE
FT                   HDTAYEDLESSEQAAIDAQVREELQSSEYTDGERVEYSAAEAYAHEQVRQDYVERYHEG
FT                   DRGRGIQDGLIPTEEEAEQFADFALWTAWISHTDRPGTDVSFTNDFPYSPDAGNEAGGA
FT                   VITWSVIAMVLLVAGAGVAIWLYQAVELPEPEAAGVSIPHPKEIDLTPSQLLSTRFVLI
FT                   GALLFVLQTFMGGLLAHYYVERDDFFGLYEVFGIDILEYLPWTIARTWHVDLGILWIAT
FT                   MWLGAGLFLAPLLTGREPRKQALYIKGLIGALLVVAVGGLAGIWLGINNFFDGQLWWLL
FT                   GNEGLEYLEIGRVWQAGLLVGFLGWTALVARGFKPLLDREPRYGLAHMIVYAGGSIGLL
FT                   FMAGFLYTPKTNFVITEFWRWWVVHMWVEGVFEFFILVVIALTLVSMNLLTKKSAEKAV
FT                   IFQAALVMGSGIIGVSHHYWWAGLPEVWLPIGSVFSTLEFIPLLFILYEALGQYRAMDA
FT                   AGKDFPYRMAFYFIVASSVWNFFGAGVIGFFINLPVISYFESGTYLTVAHAHGAMFGAF
FT                   GFLAMGMAVYILRVTTRDAHWSDRRLRWSFWLCNAGLALMLFLSLLPVGFLQLEVAFTE
FT                   GYAASRSLEFYNGGLIQTLFWLRMPGDTLLIAGAIVFAWDVVVKLLFQRKPTAEETRSH
FT                   VIADRIFGESDAVDPVDPVSDDD"
FT   sig_peptide     198890..198964
FT                   /locus_tag="Htur_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.940 at
FT                   residue 25"
FT   gene            201324..202496
FT                   /locus_tag="Htur_0183"
FT   CDS_pept        201324..202496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0183"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   ade:Adeh_0503 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59084"
FT                   /db_xref="GOA:D2RU15"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU15"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB59084.1"
FT                   /translation="MRWPADTDIGSPERIPRYVVGFGVTLTLVLIGEIALYRVFVPTFV
FT                   FRGVFLVGVITTIPFLVGIAFGGRWLRTSDLSPARYPRVVGWLLGGLVGFLFVNLALIV
FT                   TMPTESWVQAVSWIRWAIALGAGIGLLVGCLEGRAIERTLAAERASLRAEHVEEQREYL
FT                   DYLNGILRHEVLNTATIINGYASLLYEEAATTDQQRRWAEIVIAESEEMSTVIDDVRIL
FT                   LQSADGELQLEAIDLSRLLTDEVRKLEHKCGPVEVETSIPPDVSVRADDLVARVFGNLL
FT                   SNAVEHNDASTPRVSVAVDPGPETVRVEIADNGPGIPDSTLETIFERTESHGSSHGIGL
FT                   YLVRQLVSRYDGAVEVAETGPDGTTFAVELPAASESQSTASSSAHSTEAP"
FT   gene            complement(202569..203243)
FT                   /locus_tag="Htur_0184"
FT   CDS_pept        complement(202569..203243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59085"
FT                   /db_xref="GOA:D2RU16"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59085.1"
FT                   /translation="MSTHVDEIDWARIVERLLYLFPPIVGVGIVGVLQDTEPGVPGLQF
FT                   VLLLLSGFGYTALTLGLLVAIFFDARRIRRRPRAGGNWTPNPWLNAAAALVSAPIAGVA
FT                   YLVRRHRRFGTPAGRSDWWLVVAVSLATTLFGFVAAAVAIVFTIPGLLAAAVGLAGTVA
FT                   IGSFPVAIHRDAAYVCTRTRSWRPNPALYLGIAFLSLFVPPLQPIVAGYYLVRRHDAVG
FT                   RP"
FT   gene            complement(203403..204749)
FT                   /locus_tag="Htur_0185"
FT   CDS_pept        complement(203403..204749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0185"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   dat:HRM2_20470 HemL"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59086"
FT                   /db_xref="GOA:D2RU17"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU17"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADB59086.1"
FT                   /translation="MNDDNSRDLYDRALSVMPGGVNSAVRAAIEPYPFFVQKGEGGHVI
FT                   DADGNRYVDWVLGLGPLLLGHDLPEPVQAGIQQKASEGPMYGTPTEVEVDLAEFVVRHV
FT                   PSVEKIRFVNSGTEATTSAVRLARGYTGRNKIVVMQGGYHGAQESTLVEGDHENPRPSS
FT                   AGIPQSFAEHTLPVPFNDEDAVREVFEEHGDDIAAVLTEPILGNYGIVYPEEGYHEFLR
FT                   EITDEHGSLLIFDEVITGFRVGGLGCAQSEFGVTPDLTTFGKIIGGGFPVGAIGGRAEI
FT                   VEQFTPSGDVFQAGTFSGHPVTMAAGLETLKFAAENDVYEHVNGLGDRLRRGLTDIVAD
FT                   QAPSYTVTGTDSMFKVIFTREGPGPDSLEEQCPAGCRQDPTCPRYDYSPKNAGDVKNAE
FT                   TERWRRIFWGQMKEQGVFLSQNQFECQFVSYGHTEDDVEETLEAYKHAL"
FT   gene            complement(204910..205287)
FT                   /locus_tag="Htur_0186"
FT   CDS_pept        complement(204910..205287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0186"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   bav:BAV1638 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59087"
FT                   /db_xref="GOA:D2RU18"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU18"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADB59087.1"
FT                   /translation="MTDADGNESNDGDLEMITAIIRPDRLGEVKKALAEVGAPSLTVTN
FT                   VSGRGSQPAKKGQWRGEEYTVDLHQKVKVECVVADVPTEDVVEAIGEAANTGEPGDGKI
FT                   FVLPVEDAYQIRTGKTGKDAV"
FT   gene            complement(205915..207582)
FT                   /locus_tag="Htur_0187"
FT   CDS_pept        complement(205915..207582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0187"
FT                   /product="ammonium transporter"
FT                   /note="PFAM: ammonium transporter; nitrogen regulatory
FT                   protein P-II; KEGG: dat:HRM2_45610 Amt"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59088"
FT                   /db_xref="GOA:D2RU19"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU19"
FT                   /inference="protein motif:PFAM:PF00909"
FT                   /protein_id="ADB59088.1"
FT                   /translation="MEPTLLQSETEIEMLMEAVNYTWILVATFLIFFMHAGFAMLEAGQ
FT                   VRSKNVANQLTKNLLTWSVGVTVFFLIGSTVEGLVAGNGFAFQFNAEAVSWMDWLYGAV
FT                   FAMTAATIVSGAVAGRAKLRAYVTYTFLLAAVIYPVVTGMTWAGGHVESIVGTPFSDFA
FT                   GGMIVHGMGGIAGLTAAWILGPRMDRYNDDGSANVIPGHSLTFAVLGTLILAFGWYGFN
FT                   VGTSAIFTEGSFDGAILGRVALTTTLSMACGAMGAGLVALLKTGKVDTLYVANGLLAGL
FT                   VGITAIPDASTWWGAILVGTLAGAQLPIVFGLTESIGIDDVCAVFPVHGSAGVLGTLLF
FT                   PVVATTEYMNELGATRPEAFVAQVTGVVAITVWTVGMTALIWFLFKLAGQARVTPEHER
FT                   NGLDVSEHGVDTYPEFGQPDVATDGGTDDGKVIRTDGGKPNDGELKMITAIIRPDKLGD
FT                   VKKGLAEIGAPSLTVTNVSGRGSQPAKKGQWRGEEYTVDLHQKVKIECVVADIPAQDVV
FT                   EAIGEAANTGEPGDGKIFVLPVEDAYQVRTGKTGQDAV"
FT   gene            complement(208086..209111)
FT                   /locus_tag="Htur_0188"
FT   CDS_pept        complement(208086..209111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0188"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   acp:A2cp1_1503 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59089"
FT                   /db_xref="GOA:D2RU20"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU20"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ADB59089.1"
FT                   /translation="MDLTHRPRRLRRDRVRGLVSETSLEPTDLIAPVFVDATTDERVPI
FT                   ESMPGHERVPIDEAVARVEEVLETGVEAVMLFGIPESKDPEGTRAWAEDGVIQEALRRI
FT                   TSETDAYVITDVCLCEYTDHGHCGPLEEELRNESGVAEDGPACEPTLTVDNDATLEALE
FT                   KIVISHARAGADMVAPSGMMDGMVGTIREALDSAGYEHVPIMSYAAKYESAFYGPFRDA
FT                   ADGAPSFGNRRHYQMDPANSREALREVRLDAEQGADVMMVKPALPYLDIVSAVRREFDH
FT                   PVAAYNVSGEYAMLHAAAEKGWLDLEEVALESLLSIKRAGADLILTYFAEDVARRLPAG
FT                   Q"
FT   gene            209325..210497
FT                   /locus_tag="Htur_0189"
FT   CDS_pept        209325..210497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0189"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dar:Daro_1885 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59090"
FT                   /db_xref="GOA:D2RU21"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU21"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB59090.1"
FT                   /translation="MRWRYNETVLAACTLAFLATMAARLVISPVVPQITDSFGVSNAVI
FT                   GLALTGMWMAYFLAQFPSGILADRYGERRIILVAVGGTAIASALLAFAPLFPLFVLFVA
FT                   ALGFVAGLHYSVATSLLTRTYDEIGAAIGVHNSGGPIAGLVVPPVAAWIGVRYGWRAAI
FT                   AVGVVVAVPIFLLFARAVRPIEPQRPDQPMAERFELGPLVELLGRPKIAFTVALAVLGD
FT                   FVWQAVASFLPTFLVAYRGQSATTASLVFGGYFLVQGITGVGVGAASDRYGREVATAGC
FT                   MLLAVAGIAVLLAVPGLPAVAGAVVLLGIGLGWGGALLPRFMDHLSAAERSAGFGLVRT
FT                   VYGFVGALGSVVTGTLADLFGWGVSFGFLAALLALVFVALAVNRAFSLGY"
FT   sig_peptide     209325..209393
FT                   /locus_tag="Htur_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.794 at
FT                   residue 23"
FT   gene            210682..210780
FT                   /locus_tag="Htur_0190"
FT   CDS_pept        210682..210780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59091"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59091.1"
FT                   /translation="MAVWFSDGGDEVRPIGSASGCPCGESSFRVFD"
FT   gene            210870..211646
FT                   /locus_tag="Htur_0191"
FT   CDS_pept        210870..211646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0191"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   bch:Bcen2424_6373 transcriptional regulator, TrmB"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59092"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU23"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADB59092.1"
FT                   /translation="MALEELGLTEYEARCFVALTRISRGTAKEVSQVADIPRSRVYDTI
FT                   ERLDRKGLVNVQQTEPREYKAVAVDTACRRIREDYDSRINAAENALGNLKTPDSTDDEG
FT                   MWAITQNEHVTDRVVTFLEDADDAVHYLVPAPEVAETRIVEALASAADRGVAVYIEVPT
FT                   EDEREEFADAVPGADVALSPDIATTNEIHSEWPGQLLMADQESIVATGIKESDLPDVTQ
FT                   QVAVWTYGHDHGFAVWMRELLDDRLEIRHEERSLEE"
FT   gene            211734..212057
FT                   /locus_tag="Htur_0192"
FT   CDS_pept        211734..212057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0192"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: sfu:Sfum_4046 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59093"
FT                   /db_xref="GOA:D2RU24"
FT                   /db_xref="InterPro:IPR009157"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU24"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADB59093.1"
FT                   /translation="MAIDPQFHENRDKVDEHAGHAVWGPVDEPEELGIHGTHVAVDFDL
FT                   CIADGACLEDCPVDVFEWVETPGHPESEEKADPANEAQCIDCMLCVDVCPVDAIDVDAG
FT                   RSA"
FT   gene            complement(212075..212239)
FT                   /locus_tag="Htur_0193"
FT   CDS_pept        complement(212075..212239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59094"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59094.1"
FT                   /translation="MNCHYCDREAAFAAESDGLKVGLCEEHFRERLQELAEADGLETLK
FT                   EKVDVDRAE"
FT   gene            complement(212295..213083)
FT                   /locus_tag="Htur_0194"
FT   CDS_pept        complement(212295..213083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0194"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: dvl:Dvul_2305 phosphotransferase
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59095"
FT                   /db_xref="GOA:D2RU26"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU26"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADB59095.1"
FT                   /translation="MPYADLHVHTTRSDGSLDLESIPDAARYGGVEVVAVTDHDRLQPF
FT                   DAPVVERDGVTLVNGIELRVETPHGERVDLLGYGVEPTPELEGIVDRIQRNRIERGRAI
FT                   VDCVETRLDVDLGVTVDEGFGRPHVARAIEAHPDVEYGYQDAFDELIGYGDPCYVARDV
FT                   PSFERGLAALSGASRLVSLAHPLRYRDPEAALGLTAEPDLEAVELHYPYGRDDVDVDVV
FT                   ERAVERNGLLVTGGSDAHETELGVEGLSRREYEATTIADS"
FT   gene            213259..213546
FT                   /locus_tag="Htur_0195"
FT   CDS_pept        213259..213546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59096"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59096.1"
FT                   /translation="MLLNGTGEVIDDHEYPATTEELIENYGDRTLELPNGSETVGDVLA
FT                   RLESETFEYPEEARFAVYSAVSDKAIGRVGYSDRDPTPTGSPYSPDAVSF"
FT   gene            complement(213881..214954)
FT                   /locus_tag="Htur_0196"
FT   CDS_pept        complement(213881..214954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0196"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   mlo:mlr1136 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59097"
FT                   /db_xref="GOA:D2RU28"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU28"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ADB59097.1"
FT                   /translation="MLSSMRAAVLEEHGEPLSIEDVDAPEPAPDGAVVELEACGVCRSD
FT                   WHGWQGDWGWLGLETQPGQILGHEPAGRVVAVGDEVESVAEGEHVAVPFNLGDGSCPRC
FT                   QRGHSNICENVMPLGFVEQAQGAFAEQVHVPVADHNLVKLPDGVSSVDMAGLGCRFMTS
FT                   FHALAHRADVGAGDWVSVHGCGGVGLSAVHIADALGANVVAVDLTDEKLEKARELGAVE
FT                   AVNAEDVEDVPGEVQAITDGGANVSMDALGIATTSQNSVSSLDAHGQHIQVGLTTQDEQ
FT                   GMVSLPTDAMVMQEIEFIGSLGMPPTRYDEIFRMVSTGKLEPEKVVSETIGLEDVSDKL
FT                   ESMTDFETVGIPVIDNF"
FT   gene            complement(215092..216099)
FT                   /locus_tag="Htur_0197"
FT   CDS_pept        complement(215092..216099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59098"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU29"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59098.1"
FT                   /translation="MARPLRFRYSPASWSEERVRHEILQPLRSNIGARAVAPRFDIGAD
FT                   WETHRFEMQNGDVALFARNDEGAYWMGNTETPSSLWKTDKFGWREIPYHVSRWAQRELL
FT                   STLHEEDPWLADYPHLSWFFLPVFMSKDGRESTRAFFGEHAAGFPDAGRRETTGFFEDF
FT                   LSTGVLDEYRHVMSGKLGTSDHVDRVRMSAAMAEFIAAKILTDAGYDVEPEIEVTTGHS
FT                   LDFRAEDENTNVLVEVTRPQPPINRAAAGPVAAVRDTAETKTNGQLAEHGGGAVLFVDC
FT                   SSFRDDAWNAVRAEQPDVRHRPAVVYRVRPDGRVEGYTKGRVPLDLAGAIDILN"
FT   gene            216201..216374
FT                   /locus_tag="Htur_0198"
FT   CDS_pept        216201..216374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU30"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59099.1"
FT                   /translation="MSMGAYDEDEHERREQQASRVDADFDDERTIYHGEVEYDSGESTE
FT                   ALLDQFEQMKSN"
FT   gene            complement(216483..217523)
FT                   /locus_tag="Htur_0199"
FT   CDS_pept        complement(216483..217523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59100"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59100.1"
FT                   /translation="MEVHCEGCAGCCMDWRALLEDGENEGAIDSVGTASERRHRPFDDG
FT                   EGDGRPPIDDDANFVALARDEVRGFLEAGMAAALTPRFWRARDESEGVEIDGRSVAAVA
FT                   GRPVFFVGLRKPPKPVAPFDREEPAWLPTCVFLDPMTLQCRIHDGERFPDECGAYPAHN
FT                   LALEQETECERVEAAFGGERLLETEVDADLDGLLLGSQALGAKLFAHPRPEDLEGIVER
FT                   TANGTLTAADRAECLAVAAASSPGTLAISEYHYEWGKERALEAASDETATDHRDSSTDS
FT                   DAGDDRSDDAPDSERDRDESWVGPAIREWHRRRAAADGTVPDPDVATEVEDDRGAPGTP
FT                   GWDALE"
FT   gene            217604..217849
FT                   /locus_tag="Htur_0200"
FT   CDS_pept        217604..217849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59101"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59101.1"
FT                   /translation="MARNTCDGCERTISVAGGIANLWTFGENDGSDGTAMALELADGSE
FT                   HLLCYPCIEALPDEPTADDVARLEQVDEEHSQLSVQ"
FT   gene            218265..220109
FT                   /locus_tag="Htur_0201"
FT   CDS_pept        218265..220109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0201"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; KEGG: pna:Pnap_0984 DEAD_2
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59102"
FT                   /db_xref="GOA:D2RU33"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU33"
FT                   /inference="protein motif:SMART:SM00491"
FT                   /protein_id="ADB59102.1"
FT                   /translation="MNPERIFEEFPAPSYRGTQEQALRDIQDAFAAGNDVVLVRAPTGS
FT                   GKSLLARAVAGCARKIDDADPSDATGAYYTTPQVSQLDDVAADDLLADLNVIRGKSNYS
FT                   CILPDERDTPVNQAPCVRERGYDCSVKHRCPYFSDRAIASNRNIAAMTLAYFMQTAGSE
FT                   VFRKRDVVVVDEAHGLAEWAEMYATIQLGPRTVPFWDDLRVPEIDDLDRAVRYAENLQQ
FT                   KCTRRKDEVLAQDSLTTAEVRERDRLQELIGELDWFVSDYRDPQSPTTWLVDQSELSGA
FT                   RTSGDADGNDDPAGGPLTIKPMNPEKYLQHTVWDRGNKFALLSATILNKEAFCRQVGLT
FT                   PENVALVDVEHTFPVENRPLYDVSQGKMTYEQRDETTPKIARTIVRLMARHPDEKGLVH
FT                   AHSYDIQERLADLLADFGVGDRIRTHDRDGRDAALDGWKASDDPDVFLSVKMEEALDLK
FT                   GDLCRWQVLCKAPFLNTGDSRVAHRLEEGQWAWYYRTALRTVIQACGRVVRAPDDHGAT
FT                   YLADSSLLDLFERARTDMPDWFEAQVVRMERPELPEFQPSAALGGGASSTRGSGGADDA
FT                   DGRERRTRTDRSRTRSRSRRSGRSSNSSPVADVWDTDG"
FT   gene            complement(220371..221621)
FT                   /locus_tag="Htur_0202"
FT   CDS_pept        complement(220371..221621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0202"
FT                   /product="protein of unknown function Met10"
FT                   /note="PFAM: protein of unknown function Met10; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59103"
FT                   /db_xref="GOA:D2RU34"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030867"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU34"
FT                   /inference="protein motif:PFAM:PF02475"
FT                   /protein_id="ADB59103.1"
FT                   /translation="MPEDPDTIDDALERAEADAPLAAIVEKTRAETAIESLRAEGVYDD
FT                   SRKVREARGRRDAMPVDPANESKTGVQTGNDATSEDGSEREQVALPVTEPPTETRVLEI
FT                   VRQLEPERRNPDLEDLLADRGWTDAQLEAVPGSWAVIGSVILVTVPEGCPDGGELGEAL
FT                   LEIHGEADSVLADEGIANDGTAGTHREPRTRLIAGERDTETIHTEHGTRYGLDPAKVMF
FT                   SPGNQAERARMGELGSTDERVFDMFAGIGYFTLPMARAGARVTATEINPTAFRYLLENA
FT                   MLNDVGDRVDAYMTDCRELAGELEADRVVMGYYGSGGSGGETDEFDGEASGADDGDGTR
FT                   TDEAHEFLPAALEALSPGGVVHYHEATPESRLWDRPLERLAAAGEAAGREFEVLEKRRV
FT                   KSHSAGVAHVVVDARFE"
FT   gene            complement(221614..222822)
FT                   /locus_tag="Htur_0203"
FT   CDS_pept        complement(221614..222822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0203"
FT                   /product="NMD3 family protein"
FT                   /note="PFAM: NMD3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59104"
FT                   /db_xref="GOA:D2RU35"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU35"
FT                   /inference="protein motif:PFAM:PF04981"
FT                   /protein_id="ADB59104.1"
FT                   /translation="MSESRAFCPRCGDPVPERSASDADGEPANDPLRPGAEVELCDSCY
FT                   FEGFDFVDAPDRIDVRVCAQCGAVYRGNRWVDVGAQDYTDIAIEEVSEALAVHVDVEDV
FT                   AWQVEPEQIDENTIRMHCYFTGVVRGTPVEEQVMVPVKIARQTCLRCGRIAGDYYASIV
FT                   QIRAEERTPTTDEMDRAKEIANTVVADMEATGDRNAFVTEMGEVDEGLNIKVSTNKIGK
FT                   KISNKMVEEFGGTVNDAETLVTEDEDGNEVYRVTFAVRLPPYTPGDVIELADDDGGPVI
FT                   VRSARGNLKGVRATTGERYEASYEEGNAPDARKLGDLEDAVEATVVTVEDENAVQVLDP
FT                   ETYRATTVSRPDYFDPEAETVPVLKSRAGLHVLPDPDPDTGDEGEDESGHYDPYANRDE
FT                   DDA"
FT   gene            complement(222881..224548)
FT                   /locus_tag="Htur_0204"
FT   CDS_pept        complement(222881..224548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0204"
FT                   /product="Pyrrolo-quinoline quinone beta-propeller repeat
FT                   protein"
FT                   /note="SMART: Pyrrolo-quinoline quinone beta-propeller
FT                   repeat; KEGG: hypothetical protein LOC776324"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59105"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU36"
FT                   /inference="protein motif:SMART:SM00564"
FT                   /protein_id="ADB59105.1"
FT                   /translation="MVEHERRRVLQYAGLAIAGGSLTTSAAAADEDDEPASIGEAAGWS
FT                   SLGGNPGNNAISTESGPKAPVTVAWEYDRSGPTAVVDGTVYLTTGGEVHALDAADGSLE
FT                   WKTGAIGASGTPAVTDEAVYVGGERLTRIERDGTLCCQADLGYDEAIPSPVVADGRVLV
FT                   VAGGILCAVDARDLEVRWEFDPADGTLYEQPVAVGDGAVFAASESRLFARELADGAERW
FT                   TDDDPAGTDEYSHFTAPSDRQVSHPVATDDVVAVGSVDSEPEAVWENGHVTLYDAETGV
FT                   KRTKSESAITPGPVTDRRFFARSTHDLDGFDRETGENDWETVYGMYHVSSAVVADGTVY
FT                   AGATVNGDGYTADEMPEPETGVYAFDENGEVEWAIATDERPSLALADGTIYASGETLLA
FT                   IRPEANEAGDESDGEDDTGDDAPEDDGGDAEDGSGESDGDDGAAEPDDEPTNETEANGA
FT                   EQDSGSDDVDGGNGTNDADEEGGISEGATNGTERTDDGSNSDAGEGDGDENASGEDAND
FT                   GMPGFTAGAGIAGGALSLEWLRRRETDGGAGADDEKKS"
FT   sig_peptide     complement(224462..224548)
FT                   /locus_tag="Htur_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.622 at
FT                   residue 29"
FT   gene            complement(224946..225707)
FT                   /locus_tag="Htur_0205"
FT   CDS_pept        complement(224946..225707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0205"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: bch:Bcen2424_3253
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59106"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU37"
FT                   /inference="protein motif:PFAM:PF02633"
FT                   /protein_id="ADB59106.1"
FT                   /translation="MPSPSSVRLEECTWPEVETALENGRRTAIVAVGSIEQHGPHLPLN
FT                   MDALDGDELSRRIAAELGDALAAPTIRPGCSGHHMEFPGTITVPPETLMDLIRAYCRSL
FT                   DDHGFEHVVLVPTHGGNFAPVSTVAPEIAREIDANVIALADLDDHMALLNEGLRDAGIE
FT                   YQEDVIHAGAAETAMILAIDEGLVRTDRLEAGPEGSISTARLLSEGFKSITENGVLGDP
FT                   DEATPEAGDAIFDAVTAAYVERIEAERDAVR"
FT   gene            225835..226716
FT                   /locus_tag="Htur_0206"
FT   CDS_pept        225835..226716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0206"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; peptidase M56 BlaR1;
FT                   KEGG: gsu:GSU1567 M48 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59107"
FT                   /db_xref="GOA:D2RU38"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU38"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADB59107.1"
FT                   /translation="MKWQADWGLRFRMFLTMFLLFALYIVFAGVIAAYMGSFVVFVVLF
FT                   GGMSLVQYYFSDTLTLRSMGAKTVSADEYPELHASIERLSQQADLPKPKVAVVDSKVPN
FT                   AFATGRNQKNAAVCVTTGIMRTLDQDELDGVLAHELAHVKNRDMMVMTIASFLSTIAFM
FT                   IVRWGAFFGGGHGRGRQGGGGGIIVAILVSLVVWIISYLLIRALSRYREYAADRGAAAI
FT                   TGNPSALASALLKISGEMDKVPKEDMREEAEMNAFFIIPIKSGVVGRLFSTHPPTEKRV
FT                   EQLRTLERELAA"
FT   sig_peptide     225835..225936
FT                   /locus_tag="Htur_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.367 at
FT                   residue 34"
FT   gene            226858..227415
FT                   /locus_tag="Htur_0207"
FT   CDS_pept        226858..227415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0207"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59108"
FT                   /db_xref="GOA:D2RU39"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU39"
FT                   /inference="protein motif:PFAM:PF04307"
FT                   /protein_id="ADB59108.1"
FT                   /translation="MVEPIGHVAMALLFAVPAWFLWGRRPAVTFAVLTQATALFPDVDI
FT                   YLREHFVRPLLQHHGITHTVPFMLVVGGIFGVGAAYALTPVLNANRLIHSDSITPGTTF
FT                   VFTTAAFWAGGLSHVAVDLLSAEPDAAIAPLWPLYRDDVVVNIVAYDSTPVNLGLIVTA
FT                   IVVHVVLYRAERYPYETRWRVG"
FT   gene            227512..228117
FT                   /locus_tag="Htur_0208"
FT   CDS_pept        227512..228117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59109"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU40"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59109.1"
FT                   /translation="MGLVDELRSVLGLRAETDARRDADPEDLFGMSTAYLTMEADLGYE
FT                   SSDVGALCFSGVDSTSFHDAVDEVEAILEAGREETGTEFSVTSDDHGYHWVVLEDDDPE
FT                   DLITSMHFAADTFIEHDYGSRLLAAVFAYENRDGPAYWIYSFRRGRFYPFAPRSGRERD
FT                   SSVEFKLEAKLDGELEIERDKEYWYPLWPSEGGTHPWE"
FT   gene            228498..230138
FT                   /locus_tag="Htur_0209"
FT   CDS_pept        228498..230138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0209"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; GAF
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; GAF domain protein; KEGG: lch:Lcho_1464
FT                   multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59110"
FT                   /db_xref="GOA:D2RU41"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU41"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB59110.1"
FT                   /translation="MRDVSNQLAGRLLAAAGLVLSLFHLTNVVGLRGTSARALVAVTPL
FT                   LLSLGLVAVGVLLARGRLLSARFVGRILAWTCAGVLALSALGAWLFAATVVGEVSLLNP
FT                   LAAMVNVATVGALVGLLVGVYDVRGLERQRSIEQLNRINDTLRIATRELVDKTERAELE
FT                   QAVCDRLSESAPYEAVWIGRYDEGDVHVRPVAWSGFDDEYFESLEVTVDDTPTGTGAGG
FT                   RAIKTRELQCVPNVFEDPTMEPWWHLLEMHGVESLAVVPIDHGDTVYGFFSIYADRQNV
FT                   FDAHEREVLAELGETIGHAIASIDTRERLAERERELARQNERLDAFAGVVSHDLRNPLN
FT                   VATGNLELAREERDDESLRRTADALARMDALIGDLLTLARQGKLVDDCARVPFRPVVEA
FT                   AWSTVGSSAATLRIDGDLGVISCDRDRLQQLLENLFRNSVEHGTTNGRPAADEVAENAD
FT                   PKVTVTVRRTDEGFVVEDDGPGIPADSRQSVFEMGYTTSDAGTGFGLNIVRSIAEAHGW
FT                   DVSVGESPAGGARFEFTGLESTELESASS"
FT   gene            230229..231422
FT                   /locus_tag="Htur_0210"
FT   CDS_pept        230229..231422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0210"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; SMART:
FT                   Pyrrolo-quinoline quinone beta-propeller repeat; KEGG:
FT                   cps:CPS_4249 outer membrane protein assembly complex
FT                   subunit YfgL"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59111"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU42"
FT                   /inference="protein motif:PFAM:PF01011"
FT                   /protein_id="ADB59111.1"
FT                   /translation="MSDWNQFKGDPHRSGVRRDTAGPDRVTEAWTADLAGPPGSPVLDR
FT                   DTVFVGTRRGNCYALERETGRRRWTVETASEVKTSPVVGRDALYLAAGDGTVRALDPGT
FT                   GEQRWETELAGALESPLALSDGLLYAGHAAGLSVLEAETGTRVWTHETETAVAGAPAVD
FT                   RAADRERQGWGADRDETEIDLLSLDDAEMDEGVSDRDRVYVGTAAGTVIALEADTGEKL
FT                   WNAPTSGAVVDGPTVADGRVYVADEDGTLVAFHADTGQSWFTYEIQDAFTSSPTVLPAA
FT                   DATFVGAADGYLHVTDTTFGRRKLRGWLFSKKGVALDGPVRSSPVVAGDVLCIGDATGS
FT                   LYGVDVADDAEDCDLVWFVDLEHEIADTPALGSDALFVGTDDGRLHRLEWKSDRSAP"
FT   gene            231614..232645
FT                   /locus_tag="Htur_0211"
FT   CDS_pept        231614..232645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0211"
FT                   /product="DNA repair and recombination protein RadA"
FT                   /note="KEGG: meiotic recombination protein DMC1-like
FT                   protein; K10872 meiotic recombination protein DMC1;
FT                   TIGRFAM: DNA repair and recombination protein RadA; PFAM:
FT                   Rad51 domain protein; SMART: AAA ATPase;
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59112"
FT                   /db_xref="GOA:D2RU43"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011938"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU43"
FT                   /inference="protein motif:TFAM:TIGR02236"
FT                   /protein_id="ADB59112.1"
FT                   /translation="MPEADLETLPGVGPATADKLHDAGFDSYQSLAVASPSELSNTADV
FT                   GESTASDIVRAARDAADIGGFETGSTVLERRNEIGKLSWHIDEVDDLLGGGIETQSITE
FT                   VYGEFGAGKSQVTHQMAVNVQLPKEVGGLHGCAIFVDSEDTFRPERIDDMVRGLPDEAI
FT                   DATLEDREIEGSADDEAAVDELVEDVLDKIHVAKAFNSNHQMLLAEKAKELAGEHEDSE
FT                   YPVRLLCVDSLTAHFRAEYVGRGELADRQQKLNKHLHDLDKVGNLYNCAVIVTNQVASN
FT                   PDSFFGDPTQPIGGNILGHKSTFRIYLRKSKGDKRIVRLVDAPNLADGEAVMRVQDGGL
FT                   KPE"
FT   gene            complement(232684..233013)
FT                   /locus_tag="Htur_0212"
FT   CDS_pept        complement(232684..233013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59113"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59113.1"
FT                   /translation="MIVHSLSTDARPSDSVTEAIVDAVSDIERCDPLTLPPLWDVIDPE
FT                   ALDELFAPTRRGRPRTGHVGFVYAGYEVTVAVDVLGSEAPASQSEAAASDDGDETISVS
FT                   LESLE"
FT   gene            233403..234776
FT                   /locus_tag="Htur_0213"
FT   CDS_pept        233403..234776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0213"
FT                   /product="2,4-diaminobutyrate 4-transaminase"
FT                   /note="TIGRFAM: 2,4-diaminobutyrate 4-transaminase; PFAM:
FT                   aminotransferase class-III; KEGG: avn:Avin_25640
FT                   diaminobutyrate-2-oxoglutarate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59114"
FT                   /db_xref="GOA:D2RU45"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU45"
FT                   /inference="protein motif:TFAM:TIGR00709"
FT                   /protein_id="ADB59114.1"
FT                   /translation="MIGDESDTDDLLTQQARRESNARTYPRSLPLAIDRAEGAILEDVD
FT                   GNEYVDCLAGAGTLALGHNHPAVVERMERLLERDRAVHTLDLTTPVKERFVDRLLESLP
FT                   DEFAANAKVQFCSPAGTDAVEAALKLAKTATGNRSMLAFQGGYHGMTNGALSLMGDTAA
FT                   KEPIPGLMPDVHHLPYPHAYRCPFGLGGEDCWRTSAEYVERTLSNPDSGIVDPAGMIVE
FT                   PVQGEGGAVPAPAEWLREMRRITREREIPLIVDEIQTGLGRTGELYAVEHADIVPDVMT
FT                   LSKAVGGGLPLSVVVYDESLDVWEPGAHAGTFRGNQLGMAAGVATIEHVLENDLDDRAA
FT                   EMGDRLRGHLEETAAQFEAVGDVRGRGLMLGMELVDPDGEPDSLGHYPADGDLASAVQS
FT                   EAFDRGLIVETGGRHGSVVRFLPPLTISKSQVDEVGEIIRESVRAVVADDRTPTEVPT"
FT   gene            234773..236356
FT                   /locus_tag="Htur_0214"
FT   CDS_pept        234773..236356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0214"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   vsp:VS_1947 diaminobutyrate--2-oxoglutarate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59115"
FT                   /db_xref="GOA:D2RU46"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR021115"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU46"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ADB59115.1"
FT                   /translation="MTGQRSAVDRDRPPAADADPTPPPTAATAFLGGPDGNAAYADAIE
FT                   RARDVLLESFATSAGPYAGTDHETLRERIADLQVVPDDGSSIEDTLETVADDVLADSVR
FT                   VHDPGCVAHLHCPPTVPALAAELLLSGTNQSMDSFDQAPAASVLEERVVDACCDLFDYP
FT                   TGADGVFTGGGTESNFLGLLLARDWYCERRFDRDVQTEGLGPEAASDLRLLCSDAAHFT
FT                   AEQAAHHLGLGEDAVVSVPTDDDRRIDLEALDSTFERLEADGRHPFAIVATAGTTDFGS
FT                   IDPLAALADRAADRDLWLHVDAAYGGACAISDRLRPKLEGIDRADSIAVDFHKLFYQPI
FT                   GCGAFLLRDGDRYRHLERNAAYLNPERDDAAGVPNLVSKSTRTTRRFDALKPFVTFNAL
FT                   GRTGVADCVEYVCELADAVADEIRADPALELCCDPELSAVVFRYRPETDSESGSLPTAA
FT                   VDRVNRAIRDELLADGEVILARTEVDGTAALKLTLLNPKTTLSDLRDVLEAVVDRGEAL
FT                   ETDREVIDSA"
FT   gene            236353..238290
FT                   /locus_tag="Htur_0215"
FT   CDS_pept        236353..238290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0215"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: sme:SMa2404
FT                   RhbC rhizobactin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59116"
FT                   /db_xref="GOA:D2RU47"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU47"
FT                   /inference="protein motif:PFAM:PF04183"
FT                   /protein_id="ADB59116.1"
FT                   /translation="MTPRQTTPETDEHGVDATRVARDATLHSFLNCYRHETGTGEFVPA
FT                   SDAPIDREPDSGLVLRIPLANQGIECFVPVDYRSPTGRHLFDLPAYYRAGAGASGTDPN
FT                   GTGLEADPEPAELDYTTLATLATKELELARGADPNRDDLIERVVRSCRNVERYVDARAD
FT                   DAETLYGTDVSFREAEQSLVFGHLRHPTPKSRRGMERDAERYAPELEGSFPLHYVRADS
FT                   SIVESESARADSAAAWVRETLREDPNVDEAFLERLADDDVLLPVHPWQAERLFERPEVQ
FT                   DLVSAGKLESLGELGREFYPTTSVRTLYAPDSPFMVKGSLAVEITNSLRTNKRPELERG
FT                   VAISDLLATELGDDLRDRFPGFDVIRDPAYLTIDPDALGLEGDESGFEVVLRANPFQGE
FT                   DDRRATPVVALCQDAIGDETSRLGRIVESIAEREGRDAAAVSEEWFRRYLEISVRPLLW
FT                   LYLERGIGLEAHQQNSVLTLDEAGYPDEFRYRDNQGYYFPENAYDRVEAVCPGVGDRAG
FT                   TVCPDAVADERIRYYVVLNNALGVVNAFGTAGLVDERRLLAVLREELESLREFDRPGTS
FT                   ILDPLLESDTVPRKANLLTRFRGLDELEAPSLDEQSVYADVQNPLVDLPGDDSADAAES
FT                   PDAPEPEVGR"
FT   gene            238287..238964
FT                   /locus_tag="Htur_0216"
FT   CDS_pept        238287..238964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0216"
FT                   /product="Siderophore biosynthesis protein, conserved
FT                   region"
FT                   /note="PFAM: Siderophore biosynthesis protein, conserved
FT                   region; KEGG: sme:SMa2406 RhbD rhizobactin siderophore
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59117"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU48"
FT                   /inference="protein motif:PFAM:PF10331"
FT                   /protein_id="ADB59117.1"
FT                   /translation="MTARETTRGPHATVVSEYEFEYYDETIDRHIGFRPVDLERDLGRL
FT                   YAWLGSDHVKPYWDLDEPLPEFRETLREKLADDHQTLYVGCLDHVPMSYWERYWAAEDD
FT                   LSAYYDAEPADQGIHLLIGPPEYLGEGYATPLFRAMMALEFSHPETDRVVAEPDARNDA
FT                   VLAVLERCGCELRRQFEFAEEEKTAALVVCTRERFEREIWPPTATADGDDADARPAEVS
FT                   DDD"
FT   gene            238957..240465
FT                   /locus_tag="Htur_0217"
FT   CDS_pept        238957..240465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0217"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /EC_number="1.14.13.59"
FT                   /note="KEGG: sme:SMa2408 RhbE rhizobactin siderophore
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59118"
FT                   /db_xref="GOA:D2RU49"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU49"
FT                   /inference="protein motif:PRIAM:1.14.13.59"
FT                   /protein_id="ADB59118.1"
FT                   /translation="MTEEDRTISVVDGDDATTGDDASEPVVDRGHYDVLGVGLGPFNLG
FT                   LAALLDGAESDCDLEAVFLEREPEFAWHEGMLIEGATLEVPFLADLVTMADPTNPYSFL
FT                   NYVRERDRIYEFYFYETFQIPRREYDDYLRWVAETVPTTQFEREVTSVEYETADAGDER
FT                   GGANGTADDGTFVVEAVVPETGQRYRYRADDLVMGVGSRPALPEFARDHADGDAPLFHT
FT                   ADYLERRADVLEADSITVVGSGQSAAEVVLDLLERQSDNGFRLDWLTRSDGFFPMEYSK
FT                   LGLQHFTPEYTEYFYDLPQSRKDELLPDQDLLYKGIDPETSERIYDTLYERSIGDRDPD
FT                   FGMLATTAVRDIERVDGSYWLECEHRQQEEAFALETDAVIFGTGYQRPTPTFLEPVADR
FT                   IAFDDRGRFRVSEDYRLEGDLGGADDDGGRVFVQNAEMHTHGVGTPDLGLGCYRNAVII
FT                   ERLAGREVYPVDRDTVFQDFDVDQFADHAPVRTDAPRSLTPDTE"
FT   gene            240469..242334
FT                   /locus_tag="Htur_0218"
FT   CDS_pept        240469..242334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0218"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: fph:Fphi_0922
FT                   IucA/IucC"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59119"
FT                   /db_xref="GOA:D2RU50"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU50"
FT                   /inference="protein motif:PFAM:PF04183"
FT                   /protein_id="ADB59119.1"
FT                   /translation="MQNPRHDTETEYGLDGIDTLDDVLTEDRWTDVGQELLAKILREFT
FT                   YEDLIEPEPVDGDRADDASDGEWTTYEIDLEGTRYRFDAVERFWDSISVRVDSIERDAG
FT                   DGFEPADDPLEFVVDLEPTIDMDSITASHLVREYTNTLLADAHIDAEDDDATDANESVL
FT                   DMSYAEIEGEMTGHPWLTFNKGRVGWGYDDYRDYAPERAESIRLSWCAVSREAAEFVSV
FT                   EGLDHESLLESELGGHYDRFRAELEGRGLDPDEYLFLPVHDWQWENTIVPLFGKQLATD
FT                   EIVPLGEGPDEYLPMQSIRTFVNADEPGKHNVKLPMMISNTLVWRGLPGERTEAAPLVT
FT                   EYVKDVRDSDPFLRDECEVVLPGEIAGVNFDHPTFDALEAPAYQYNELLGTVWRESVTD
FT                   LIDDGERAMTLSSLLHVEDGEPVISKLVDRSDLELEAWLDELFATMLPPLLHYLYRYGT
FT                   AFSPHGENTILVLEDDRPSRLAVKDFVDDVNVAEAPLEELQDLPDDLEDVLLSVPPEEL
FT                   RLFVVYGLFVGVYRYLADLLVRHHDYPEERFWGQVRAVIEDYHEQFPDLEDRFELFDLL
FT                   EPTFPKLTLNRNRIVDFGYGDRPERPHAIEHGTVPNPLSEVDPER"
FT   gene            complement(242443..242862)
FT                   /locus_tag="Htur_0219"
FT   CDS_pept        complement(242443..242862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0219"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="TIGRFAM: SUF system FeS assembly protein, NifU
FT                   family; PFAM: nitrogen-fixing NifU domain protein; KEGG:
FT                   dno:DNO_0833 NifU family SUF system FeS assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59120"
FT                   /db_xref="GOA:D2RU51"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU51"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ADB59120.1"
FT                   /translation="MGLGSDMYRQQILDHYKNPRNYGELEDPTFTHIGENPMCGDEIRM
FT                   DVKLGDDEETIEHVAFKGDGCAISQASASMLSKELRGKTLEELQEMDRNDVIGMLGVDI
FT                   SPMRVKCAVLAEKVAQDGAEIYQGELDVEKTTTED"
FT   gene            complement(243040..243288)
FT                   /locus_tag="Htur_0220"
FT   CDS_pept        complement(243040..243288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59121"
FT                   /db_xref="GOA:D2RU52"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59121.1"
FT                   /translation="MQENTIGRPRRDPFETLVDVLAEASRYDLLLGVVPVVFTVALVAA
FT                   HVLSLPVVHAMFVAATIGALVVIDACYLNPPIDQGSP"
FT   gene            complement(243416..244051)
FT                   /locus_tag="Htur_0221"
FT   CDS_pept        complement(243416..244051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0221"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: dal:Dalk_2318 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59122"
FT                   /db_xref="GOA:D2RU53"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU53"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADB59122.1"
FT                   /translation="MLEAVRTRARSYFEAAPPGHDWHHVQRVETLAETLVDRHQSGSID
FT                   ERVVTLAVYLHDIGREKEDSGEIDDHAAWGARESRRILEDVGADPATIDGVAHCVRAHR
FT                   YSNAVEPERLEAKLVSDADNLDALGAVGIARTFAHGGALGEPIYDPAVPVADDETAAGA
FT                   TQYNHLHEKILALPERLYTDVGRELAERRAAFVREYVAQFDAELTGER"
FT   gene            complement(244125..244568)
FT                   /locus_tag="Htur_0222"
FT   CDS_pept        complement(244125..244568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0222"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rpf:Rpic12D_5348 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59123"
FT                   /db_xref="GOA:D2RU54"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU54"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB59123.1"
FT                   /translation="MSSVTVALRRADESDLPYVERLLSDEGLPSADVRSSPARFYVGDD
FT                   GDERIGIGGLERYGTDGLLRSVVVERSARGNGYGAALCAALERRARADGVETLYLLTTT
FT                   AAEFFADRGYEYVERTDAPPAIRETAEFDELCPASAACLRKSL"
FT   gene            complement(244626..245180)
FT                   /locus_tag="Htur_0223"
FT   CDS_pept        complement(244626..245180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0223"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: tgr:Tgr7_3180 riboflavin biosynthesis
FT                   protein RibD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59124"
FT                   /db_xref="GOA:D2RU55"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU55"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADB59124.1"
FT                   /translation="MTRGTVTLYIAASLDGFVATADGGVEWLEEYASDGENGADGNFEA
FT                   FFADVDCLVMGSRTYEQLLSFDGWPYGERPTFVVTSRDLPLATAHVELVAGNLRELVDG
FT                   LEERYDRIWLVGGAALAQSFLREGLVDEIRLTVVPVLLGGGIRLFDDDGTEHTLETLEC
FT                   TSFESGLVELRYDASRCTPSV"
FT   gene            complement(245548..246792)
FT                   /locus_tag="Htur_0224"
FT   CDS_pept        complement(245548..246792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0224"
FT                   /product="cysteine desulfurase, SufS subfamily"
FT                   /note="TIGRFAM: cysteine desulfurase, SufS subfamily; PFAM:
FT                   aminotransferase class V; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: reh:H16_B1515 cysteine
FT                   desulfurase (SufS)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59125"
FT                   /db_xref="GOA:D2RU56"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU56"
FT                   /inference="protein motif:TFAM:TIGR01979"
FT                   /protein_id="ADB59125.1"
FT                   /translation="MSQQNLESLDVGAIRDEFPILEREFDGQQVVYLDNAATTQTPDPV
FT                   VDAMSDYYRESNANIHRGIHHLSQEASIMYEEAHDRVAEFINADGREEVIFTKNTTEGE
FT                   NLIAYAWGLNELGPGDEIVLTEMEHHASLVTWQQIGKRTGADVKYIRIDEDQRLDMDHA
FT                   RELITDDTAIVSAVHVSNTLGTVNPVSELTDLAHEHDALSFIDGAQAVPNRPVDVKAID
FT                   ADFYAFSGHKMAGPTGIGVLYGKQHLLEEMEPYLYGGGMIRKVTYEDSTWGDLPWKFEP
FT                   GTPQIAEAVGLEAAIDWLEDIGMERIQAHEEEIARYAYERLESEEDVEIYGPEPGPDRG
FT                   GLVSFNVEGVHAHDLASIMNDHTIAVRAGDHCTQPLHDKLGVPASTRASFYVYNTREEV
FT                   DKLVAALDDARQLFA"
FT   gene            complement(247219..247518)
FT                   /locus_tag="Htur_0225"
FT   CDS_pept        complement(247219..247518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0225"
FT                   /product="Protein of unknown function DUF424"
FT                   /note="PFAM: Protein of unknown function DUF424"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59126"
FT                   /db_xref="InterPro:IPR007355"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU57"
FT                   /inference="protein motif:PFAM:PF04242"
FT                   /protein_id="ADB59126.1"
FT                   /translation="MLVTERQTQEGLLVAVCDEDVLGETFESDDISLTVTEEFYGGEAV
FT                   DESAVVDSLSRAAVANLVGTRAVELAIEEGFVDEANVLEVGSTLHAQLLRMQQF"
FT   gene            complement(247522..248406)
FT                   /locus_tag="Htur_0226"
FT   CDS_pept        complement(247522..248406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0226"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59127"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU58"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADB59127.1"
FT                   /translation="MTDREGDREGDHRFSDGEGFDDAYEEFDLDPPELAVDPGKVDPID
FT                   SRVVTDTLDDQNIATDDVDATELLDVGLNYMQINRYEQATDAFERTAQFAEDERLEQEA
FT                   WVNKGVAHAELEEYDAAIGAHREAINIDDSSEHAATAETNLAYALWEFGETSQALDHAE
FT                   RAVEIDDRFAEGWYNRAFFLSERGLAEEALHCIDNAIRLGMRNSKVLEEKAEILEELGE
FT                   YDEAEEIADEAIEMRERAEQRVMEERKEMQGESLGGPQSQSQPQRGQGRQGGFDIADPG
FT                   QASDRDEEDWRLE"
FT   gene            248523..249437
FT                   /locus_tag="Htur_0227"
FT   CDS_pept        248523..249437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0227"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_3201 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59128"
FT                   /db_xref="GOA:D2RU59"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU59"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB59128.1"
FT                   /translation="MTAITVENVSKRYGTVTALDRVDLTVDEGEVFGFLGPNGAGKSTL
FT                   INVFLDFAQPDDGRAAIFGHDCQAESVEAKSRMGVLPDGYTVYDRLTGRQHLEYAIEAK
FT                   EADVEPMAVLDRVGIRDAADQPAGGYSKGMAQRLVLGMALVGEPDLLVLDEPTSGLDPH
FT                   GIKQIRTVIREERERGATVFFSSHILEQVEAVCDRVGILYDGELVATDTIEGLRDSVGG
FT                   TTKLLITVDRAESDVLERVESLAGVERAWPNPEANRVEVTCSNDAKMDVLITLNEAGVD
FT                   IENFRTEEASLEEMFVEYTSGAS"
FT   gene            249437..250261
FT                   /locus_tag="Htur_0228"
FT   CDS_pept        249437..250261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0228"
FT                   /product="ABC-2 type transporter"
FT                   /note="KEGG: lch:Lcho_1479 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59129"
FT                   /db_xref="GOA:D2RU60"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU60"
FT                   /inference="similar to AA sequence:KEGG:Lcho_1479"
FT                   /protein_id="ADB59129.1"
FT                   /translation="MSWTTIARREYAATGDSRAIRWLLALLAGACILSGYLYPVLGSEP
FT                   YTTKAFVGFGFLTGSIDYLLPLIGVFLGYGAIVTERTSGQLTLLLSLPYSRRDLVVGKL
FT                   VGRSLAFATTLVAALAVAGALVAYPFGSLSLGWYLAFVALTVLYGVIFTGIATAVSILT
FT                   RSKHLATAGSFGAYGLFVPVWGAARSALRYGLESIGLIDGALPDPALFLFGLNPVTLYD
FT                   RLVAGFFVDGGASAYAESNAWYLSEWLALPLFLAWVVVPVALGHLRFRNTDL"
FT   gene            250323..251132
FT                   /locus_tag="Htur_0229"
FT   CDS_pept        250323..251132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0229"
FT                   /product="ABC transporter transmembrane protein"
FT                   /note="KEGG: tbd:Tbd_1393 ABC transporter transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59130"
FT                   /db_xref="GOA:D2RU61"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU61"
FT                   /inference="similar to AA sequence:KEGG:Tbd_1393"
FT                   /protein_id="ADB59130.1"
FT                   /translation="MNWQPTARKDFRDSIRSRTICVLIAVLVGLFVLGSAVFGPESGAF
FT                   PAFVETAFGNVYGLVPLIGIVVGYKAVLYERESGSLVLALSLPQSRRDFVAGKLVGRSL
FT                   VLGLPLVAGLVVAGAVAAAQYESVAPLSYLTFVGATLLYGVAFVSIALACSMSFATDRQ
FT                   VLVRAIGLYVALDRAWIWLVDTIVAVLFRFNTPSPIPDWAVALQLASPSEAYRHLVAVR
FT                   FEFDSAQAHLAAEVPSLVNSWTALIVLAGWILGPVAIGYLRFRDTDL"
FT   sig_peptide     250323..250472
FT                   /locus_tag="Htur_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.784) with cleavage site probability 0.355 at
FT                   residue 50"
FT   gene            251231..251968
FT                   /locus_tag="Htur_0230"
FT   CDS_pept        251231..251968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0230"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SRP40.1; nonribosomal protein of the nucleolus
FT                   and coiled bodies"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59131"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59131.1"
FT                   /translation="MSPLNRPQSTATPSASADRSRTDRVLSRRTFIAAGSATALASLAG
FT                   CSAVADFLADMALQEVNVFNGADESVSGTIEVVDPDGETVLEETFDLDAEPEDDGSDEN
FT                   TEATAQYDDVWTDAGDYEVTVALDDPLEEGTDDSSDESGNETNETNESDSTPVEELANE
FT                   SDDGESTPVENGGGETDDANETDGNETDSDDPSQSGPSKTDTVSIDDTDEQSLVIGIAQ
FT                   EEPADLISYHVIEDFSDLEDEFE"
FT   sig_peptide     251231..251383
FT                   /locus_tag="Htur_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.756 at
FT                   residue 51"
FT   gene            252105..252662
FT                   /locus_tag="Htur_0231"
FT   CDS_pept        252105..252662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0231"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: sfu:Sfum_2529 2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59132"
FT                   /db_xref="GOA:D2RU63"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU63"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ADB59132.1"
FT                   /translation="MRLFVSVDLPDDLAAPVADLQDEFADAGGLNFTDPEQAHLTLKFL
FT                   GDVDEDRVPALERELEAAVADADVDHFTVRYGGLGVFPSLDYISVVWLGTETGGEELTR
FT                   LHEAIEERTTAMGFEPESHDFTPHVTLARMEHAGSKDRVQELVRERDPTIGETTVEEIR
FT                   LTESTLTDSGPVYSTVESFPLE"
FT   gene            252852..253820
FT                   /locus_tag="Htur_0232"
FT   CDS_pept        252852..253820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59133"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59133.1"
FT                   /translation="MTPSLPTGLTDVAASGRIVSRREVLAAVGGAAGVSWSRADAPSVA
FT                   DAAADTSVQVRVYSGPLPLRLRLPNAVAGSGDWPPSLRDATAAVEDAITQVLDYARERS
FT                   RLESLEITVERAGSIQLSRSAVQRPSDAVVPSLETVLDGFHRRLRERDALTGSTCHLLL
FT                   CWEPLNYQVGYGGTLSPNAHVGDDADGSPGDALTVANVGASEVWDSRDVTRNMAIHETL
FT                   HTFLSSDVVEAVGDSPCDHDLGAAIRTADETLHVSPMASAYAGRNEIGSGTRFHGTGCY
FT                   DHEAFHRHGGTDGVENWTHTTELSEATLEGATRYLERTVGP"
FT   gene            253899..254051
FT                   /locus_tag="Htur_0233"
FT   CDS_pept        253899..254051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0233"
FT                   /product="Ribosomal protein L39e"
FT                   /note="PFAM: Ribosomal protein L39e; KEGG: hypothetical
FT                   protein; K02924 large subunit ribosomal protein L39e"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59134"
FT                   /db_xref="GOA:D2RU65"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU65"
FT                   /inference="protein motif:PFAM:PF00832"
FT                   /protein_id="ADB59134.1"
FT                   /translation="MGKKSKGKKKRLAKLENQNSRVPAWVMMKTDMEVQRNPKRRNWRR
FT                   NDTDE"
FT   gene            254054..254332
FT                   /locus_tag="Htur_0234"
FT   CDS_pept        254054..254332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0234"
FT                   /product="Ribosomal protein L31e"
FT                   /note="PFAM: Ribosomal protein L31e; KEGG: rpl31; 60S
FT                   ribosomal protein L31; K02910 large subunit ribosomal
FT                   protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59135"
FT                   /db_xref="GOA:D2RU66"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU66"
FT                   /inference="protein motif:PFAM:PF01198"
FT                   /protein_id="ADB59135.1"
FT                   /translation="MSASDFEERVVTVPLRDVKKGANHEAADYAMRLVREHLAKHFAVD
FT                   EDAIRLDPSINEEVWSNGRSNPPRKLRVRAARFDEEGEAVVEAEVAD"
FT   gene            254335..255000
FT                   /locus_tag="Htur_0235"
FT   CDS_pept        254335..255000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0235"
FT                   /product="translation initiation factor eIF-6"
FT                   /note="KEGG: eukaryotic translation initiation factor 6;
FT                   K03264 translation initiation factor eIF-6; TIGRFAM:
FT                   translation initiation factor eIF-6; PFAM: translation
FT                   initiation factor IF6; SMART: translation initiation factor
FT                   IF6"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59136"
FT                   /db_xref="GOA:D2RU67"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU67"
FT                   /inference="protein motif:TFAM:TIGR00323"
FT                   /protein_id="ADB59136.1"
FT                   /translation="MQRLAFAGSAYVGVFARATDSCVLVRPDVDDDVVADLTDELEVPA
FT                   VQTTVGGSSTVGALATGNENGLLVSARVLEYEREALEEAVDLPVAELPGNINAAGNVVL
FT                   ANDYGAYVHPDLPRETVQIVKDTLEVPVERGDLAGVRTVGTAAVATNSGVLCHPKATDE
FT                   ELDVLEETLDVRADVGTVNYGAPLVGSGLIANESGYVVGEDTTGPELGRIEDALGYLE"
FT   gene            complement(255205..255516)
FT                   /locus_tag="Htur_0236"
FT   CDS_pept        complement(255205..255516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59137"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59137.1"
FT                   /translation="MSELDAGDLLPSERMRKQVLEGEVTQIHRGHRYAEEGDTFAIEDT
FT                   TFEVTDVTERTLGDLTDEDAQAEGMDDLEGYRRLLERAHDDFEWDDDSEVVRHRFEQR"
FT   gene            255850..256026
FT                   /locus_tag="Htur_0237"
FT   CDS_pept        255850..256026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59138"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59138.1"
FT                   /translation="MSRFAVTGRVTDYDGFAARETAAVTENESVGRERVLSRLESRCGP
FT                   KRRQIELEDITQQ"
FT   gene            256023..256472
FT                   /locus_tag="Htur_0238"
FT   CDS_pept        256023..256472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0238"
FT                   /product="prefoldin, alpha subunit"
FT                   /note="TIGRFAM: prefoldin, alpha subunit; PFAM: Prefoldin
FT                   alpha domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59139"
FT                   /db_xref="GOA:D2RU70"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU70"
FT                   /inference="protein motif:TFAM:TIGR00293"
FT                   /protein_id="ADB59139.1"
FT                   /translation="MSQQQLQQLSQELQEIEEQIEALEQSVEGVQQQKTETDEAIEALE
FT                   TLDTDSTVQVPIGGGAYLRATIEDIDEVIVELGADYAAELEEDDAVDALESKKENLDDR
FT                   IDEINSEIAELETESEELEQQAQQLQQQAMQQQMQQMGQGQQPDE"
FT   gene            256494..258083
FT                   /locus_tag="Htur_0239"
FT   CDS_pept        256494..258083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0239"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: amc:MADE_03537 signal recognition particle
FT                   GTPase; TIGRFAM: signal recognition particle-docking
FT                   protein FtsY; PFAM: GTP-binding signal recognition particle
FT                   SRP54 G- domain; GTP-binding signal recognition particle
FT                   SRP54 helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59140"
FT                   /db_xref="GOA:D2RU71"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU71"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADB59140.1"
FT                   /translation="MFDNLKEKLGSFRKDAEEAAEENVEEVDEDELEEADVEELEAESE
FT                   SAAGEDDATTPDAPDTTGEPVDEPEGDLEAETAAPDETTAGAEPETDEPEPASTSAATE
FT                   TADAAETAGAASTDDPSAAEPEPEAESEPDSEPETETESEADEEESSGLDLKGIIKRGS
FT                   EADEQTDETEDEPAADVEPADGAESELEAETAAGAETASAETADAVEADALEDEEEDAD
FT                   AEADADEESSSTGFGTKARSLVKGKFVIEEEDLEAPLHELEMALLSSDVEMGVTDEILD
FT                   NLRDELIGETRSFTTSTGDVIEEALRDAIYDVISVGQFDFDERIAAAEKPVTIVFTGVN
FT                   GVGKTTSIAKLSRYFEERGYSTVMANGDTYRAGANEQIEQHAEALGTKLITHEQGGDPA
FT                   AVLYDGVEYAEANDIDVVLGDTAGRLHTNEGLMDQLEKIDRVVGPDMTLFVDEAVAGQD
FT                   AVNRAREFNEAAEIDGAILTKADADSNGGAAISIAHVTGKPILFLGVGQGYDDLEPFDP
FT                   EEMVDRLLEDDE"
FT   gene            258261..258806
FT                   /locus_tag="Htur_0240"
FT   CDS_pept        258261..258806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59141"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59141.1"
FT                   /translation="MVGLSLGAAGCFESDLTSSESEESLESGVVPADEFDCDDVDRPDP
FT                   SPPIRDEALEPATYPTPPNPLLESAGEYVRDFEAAYQHNAFLEEYGSETEEFEFDLEAR
FT                   DAKPVDAESDREAKLVSLVFDLTTKIRRTPEKSERSIRVTYYVDEHIVLRARYSGLADE
FT                   PTFDPNPRSAGGPVACFH"
FT   gene            259081..260790
FT                   /locus_tag="Htur_0241"
FT   CDS_pept        259081..260790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0241"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; KEGG: hypothetical protein;
FT                   K00366 ferredoxin- nitrite reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59142"
FT                   /db_xref="GOA:D2RU73"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU73"
FT                   /inference="protein motif:PFAM:PF01077"
FT                   /protein_id="ADB59142.1"
FT                   /translation="MVSMNTTEQYKQNKHPLDVIDDVYDYADEQLSFEEIEERAGGGEW
FT                   ERLKWAGMYAQKQEGYFMIRTKVPGGKLTPEQAEVIGEVTEDYAVAPEEYGGEEQNELW
FT                   GDAYLDITTRQDIQKHWIRVEDVPEMWERYDEVGLTTVQGCGDSARNVLGCPAAGLDDH
FT                   ECFNAQPVIDAVSDYFTNNREYANLPRKFKITITGCAHDCAQSQINDVGLVPAKKEVDG
FT                   EYLYGFHARVGGGLSDGPRMGSELDVFIRPEDAVEFCRAVAQTFKELGDRNNRGVCRMR
FT                   YLVEQMGPEKFEEAVRDRCTIDLPTGGENLTVGYQGDHVGVHEQKQDGLNYVGFNVIAG
FT                   RMGGDEFAEAARAAEKYGTEDASVRLATDQNFLITHIPDENVDDLLAEPFAREYSPDPG
FT                   PFSRGAVGCTGNEFCNYAIIETKKRTKRWARELDERIDVPDDIEAIRMHMSGCSASCAQ
FT                   PQIADIGFRGETVKLEDENSTNAEGDNIVEGMDFGLGGSLGADNEFLDWVENAVPAQSV
FT                   IPALEQLFEAYSEGRDDGEKFYEWTRRIDNERLRQIMQGADAPVARGVAHGD"
FT   gene            260780..262396
FT                   /locus_tag="Htur_0242"
FT   CDS_pept        260780..262396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0242"
FT                   /product="Coenzyme F420 hydrogenase"
FT                   /EC_number="1.12.98.1"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: dol:Dole_1150 coenzyme F420
FT                   hydrogenase/dehydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59143"
FT                   /db_xref="GOA:D2RU74"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU74"
FT                   /inference="protein motif:PRIAM:1.12.98.1"
FT                   /protein_id="ADB59143.1"
FT                   /translation="MGTNGDERRFPHVPASDDDDDAVVVPDAEGGASRSRENTDHAREG
FT                   AIATDGGANAEGDSCSPDTCTCGEKTAESAASAGSADDKRVATDGAGAANVDEMGELGE
FT                   LEFTEPAENVSQDVYDDAPDVRVGIPDGVDLETPEYSIRSQMNDIETPDEKTWFMELDE
FT                   AVIDEGRCIQCGTCVAACPSDSIGVGDDDLPELVKMCTGCSLCWDFCPRGGMRYERQWK
FT                   ITGGEDNVKGAGDPITEFSAKVDDDWTDNAQDGGVVTGVLSTLLEEGEIDGALVATESE
FT                   EEEWKAESFLATTTEELIENAGTVYNQTLALGNLDLKQWEHKLPDKDWDDLSLAIVGTP
FT                   CEIEGIRALQDFEWDYQAQNEGIRAVDYTIALMCTKNFNYHSLMGEQLEEKRGISPSEI
FT                   GKMDVLNGKMMVYDHDGEMIVEEDIENFHDAALKGCDECADFTGFCSDITVGSVGSSDE
FT                   YSSVIIRTEQGMNAWELTEPKLDYHDLEDRSAVGKLQGWDKKKAFESLERPFDPDAPRF
FT                   IDYTDHAENYGTALNPHDQGH"
FT   gene            262696..263409
FT                   /locus_tag="Htur_0243"
FT   CDS_pept        262696..263409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0243"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG:
FT                   rlt:Rleg2_1172 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59144"
FT                   /db_xref="GOA:D2RU75"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU75"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADB59144.1"
FT                   /translation="MSRGIGVLPAVQDALPDWAALLVALLTQLGDVWFLVLLVGLVYWF
FT                   RPDDREEAAVLVGLMLAGFSLVTALKYAFALPRPGRPLAELEALGPLARSLYEATGTAD
FT                   GYGFPSGHAVLTTVVYGGLAWRLSIGTARQRAAAAATVVSLVCASRVALGVHYFVDVVA
FT                   GVAIGLAFLVVVNRLTARYPTDQQTVAFAIAVAVGVVALVTSGAAVDAVLVFVATLAVF
FT                   GGLQFARDARDRSSA"
FT   gene            complement(263435..264394)
FT                   /locus_tag="Htur_0244"
FT   CDS_pept        complement(263435..264394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0244"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: afw:Anae109_1325
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59145"
FT                   /db_xref="GOA:D2RU76"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU76"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADB59145.1"
FT                   /translation="MADLIGIFASAIGPIVAIAGVGYVLATVKQIDPEPLNMAVVYVLA
FT                   PALVFHSLAVTELAAATLARVTVGVVLFTAAMWGLAELTGRATGEREPALSALILVAIF
FT                   TNSGNLGIPVSDFAFGDIGRETAVLYLSVQSVLMYTLGVYIASRSSGSAGLEGVRRVFY
FT                   IPLAYAVVAALVARALDLVPPADTAAMETLQLVGDASIPLMLLILGIQLARTDTASAVS
FT                   RAWSATALKMVVAPVIGLGIALLIGFENQTVARVFVLETAMPAAVTPLILVIEFAGGAR
FT                   SEGVLVSEYVSTCVFLTTLLSIPVLTVLIAILQSGVVL"
FT   gene            264925..265536
FT                   /locus_tag="Htur_0245"
FT   CDS_pept        264925..265536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0245"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   psb:Psyr_1500 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59146"
FT                   /db_xref="GOA:D2RU77"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU77"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB59146.1"
FT                   /translation="MTADARIRVATPDDAAAVRDIYAPFCESTAVTFEETPPTEAEVAN
FT                   RIASTLETYPWLVCEIDGAVAGYAYASRLRERRAYQWTVELSVYVADDARQSGVGRALY
FT                   ESLFAVLERQGVRDGYAVTTVPNPETERFHERLGFERCVDFPAIGHSEGEWRDVAWWRR
FT                   SIGEKTADPEPITPLPTLRDRLDEADWNALVRTGVNRLES"
FT   gene            265626..266294
FT                   /locus_tag="Htur_0246"
FT   CDS_pept        265626..266294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0246"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: sfu:Sfum_3508 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59147"
FT                   /db_xref="GOA:D2RU78"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU78"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADB59147.1"
FT                   /translation="MDPSEYGTYLVTQQSISGDRSTVDVVRDAIAGGVDVVQLREKDTD
FT                   ARWRYELGLELRELTAEADVDLIVNDRVDVAEAIDADGVHVGQSDLPVGVARDLLGPEA
FT                   IVGCSTATVEEALEAEAAGADYLGVGTVYGTTSKEVDRYKDGVGPERIAEIVDAVSIPV
FT                   VGIGGITADNAGPVVEAGATGVAVISEITAADEPRAATAALADAVETAKGVGDGSVADE
FT                   "
FT   gene            266287..267126
FT                   /locus_tag="Htur_0247"
FT   CDS_pept        266287..267126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0247"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /EC_number="2.7.1.50"
FT                   /note="PFAM: hydroxyethylthiazole kinase; KEGG:
FT                   dal:Dalk_0685 hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59148"
FT                   /db_xref="GOA:D2RU79"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU79"
FT                   /inference="protein motif:PRIAM:2.7.1.50"
FT                   /protein_id="ADB59148.1"
FT                   /translation="MSNPLPDGITDDELADSLRAIGRGSPLVQHLTNEVTMNDVANLTL
FT                   HWDALPVMADSPGDAGEMAAGAAAILLNTGQVPEGKVEAMHEAAETAAERDIPVVLDPV
FT                   GVGATPTREAVAEALLEDVDFSIIKGNYGEISALAGVEAEVKGVESVGEYDEIEDAARS
FT                   LAASTGATVVASGVEDVVATGDGAVRLSAGHERLSEVVGTGCMLGATLAAFRGAVDDAP
FT                   TAAVHGALAFGIAGERAAEMPHEGPASFRTNFHDAVAGFDPETATELDLEERLERVD"
FT   gene            267201..267473
FT                   /locus_tag="Htur_0248"
FT   CDS_pept        267201..267473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59149"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59149.1"
FT                   /translation="MARENLEDAAATLREAADAASDDETRERLENQADQFANLAEADRG
FT                   PDHGKLARHEHILSDISDEEGGEVADLVDDALESVRAFRETVEGV"
FT   gene            complement(267545..268180)
FT                   /locus_tag="Htur_0249"
FT   CDS_pept        complement(267545..268180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical LOC594198"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59150"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59150.1"
FT                   /translation="MTDAEAFVEAVEEDNQTALSRLGSSKSLYADTDGDIDTEPVLRAT
FT                   ADAEHAAWQTFLEWADDESYEAAREAFETTAEEEQGHYETVLDHLGDEEYEPQEVPALH
FT                   EYLRGLESTVERVGAFVGRILASQRSKDQVVGYFVGDADPQTASVFREFGDDLDAQLER
FT                   ATDLLEDVCEDEDDRERAHEAADGAIEAAYDEYVESLEAMGANPKPVC"
FT   gene            268367..269563
FT                   /locus_tag="Htur_0250"
FT   CDS_pept        268367..269563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0250"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   maq:Maqu_1796 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59151"
FT                   /db_xref="GOA:D2RU82"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU82"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADB59151.1"
FT                   /translation="MKRRVYLATAGATLFAGCSALTGSETDEKNGDDNGDDNGDENGSS
FT                   DPINEDPGSFDEFEDLSNWTVMEGSMSADEERTHVGSQSARMDAAESDTRVMIKREFDS
FT                   PRDLSDELPALAFASDREVNPVVQLSDTDGNRLLLQCAVEADGSFARHDLGYRKTVGDP
FT                   DLSSIAHTKISFWAGDREMSLWVDDYHFVKRPDTGKVLLEFPDESAAVDAAPALAEHDL
FT                   PATAFVKTDYVGGSGYPSVDDLESLQEDGWTIASEGATGTDLTALDAESQKAEITSAVS
FT                   WLEDHGFDAEYFSYPLNRYDDTTLELVKEHHDLGFVGGFPGHGHVTNPAMVPRATNPDA
FT                   EEAETLLEWTADQRTITTVSFRDLENLDATLELVADLESNGDLEVITPSDLASDYLHE"
FT   sig_peptide     268367..268438
FT                   /locus_tag="Htur_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.630 at
FT                   residue 24"
FT   gene            269699..270145
FT                   /locus_tag="Htur_0251"
FT   CDS_pept        269699..270145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0251"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: vsp:VS_2709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59152"
FT                   /db_xref="GOA:D2RU83"
FT                   /db_xref="InterPro:IPR024464"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU83"
FT                   /inference="protein motif:COG:COG4711"
FT                   /protein_id="ADB59152.1"
FT                   /translation="MKIRRPRRPRQFRVADSAQQIVGGFLLAGPFVVTEEVWILAGSMS
FT                   AIQAVLTVCVVSAIGYGALYTADTTRDPDVEQEVAGVPVRFISLLLVSFGSVLILALLF
FT                   NAPTAFLDDVETRSAVTWITFKAVSVGSVFSIVGAATADSVFSK"
FT   gene            complement(270268..271125)
FT                   /locus_tag="Htur_0252"
FT   CDS_pept        complement(270268..271125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0252"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: mms:mma_0256 thiosulfate
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59153"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU84"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADB59153.1"
FT                   /translation="MATDYANDVLVSADWAEERLDEFQDDDSDLRLVEVDVDTEAYEEE
FT                   HAPGAIGFNWETQLQDQTQRDILEKEDFEELLGSHGISEDDTVVLYGDNSNWFAAYAYW
FT                   QFKYYGHDDVKLLDGGREYWLENDYPTTDEEPDFSETEYDAAGPRESIRAYREDVENAI
FT                   ERGVPLVDVRSPEEYSGEVLAPPGLQETAQRGGHIPGAKNISWAAVTNDDGTFKDYDEL
FT                   EELYAEEDIDGDETTVAYCRIGERSSVAWFALHELLGYEDTVNYDGSWTEWGNLVNAPI
FT                   EKGN"
FT   gene            271407..272204
FT                   /locus_tag="Htur_0253"
FT   CDS_pept        271407..272204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0253"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: noc:Noc_0191 thiosulfate
FT                   sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59154"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU85"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADB59154.1"
FT                   /translation="MNDSVVVTPDWLAAHREDPQVRIVDVRDAWEYDGIGHVPGAVSIP
FT                   FDSYRDESDVDRGTLPGAEAFADLCSEAGISPEDTIVAYDDTHGVFAARFVLTALEYGH
FT                   DDVRLLDGDYSAWNREYETSSETPDVESTEYEPDPLAPEESPLVDYAAVEAALERGALF
FT                   VDTREAHEFEEARLPGAVRFDWREVVDDETRRLKPADELEELLAEYGITPDREIVLYCN
FT                   TARRISHTYVVLRALGYENVSFYEGSLTEWLANDGEVESGEVE"
FT   gene            272537..274405
FT                   /locus_tag="Htur_0254"
FT   CDS_pept        272537..274405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0254"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase (glutamine-
FT                   hydrolyzing); PFAM: asparagine synthase; glutamine
FT                   amidotransferase class-II; KEGG: hha:Hhal_1512 asparagine
FT                   synthase (glutamine- hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59155"
FT                   /db_xref="GOA:D2RU86"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU86"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADB59155.1"
FT                   /translation="MCGIVGAYGWTHDETLSSMLDWIEHRGPDEEGSYLDRDAGLMMGA
FT                   RRLSIVDLEGGSQPKWNEDETVGVVFNGEIYNHGELRERLSREGHQFESECDTEVLVHL
FT                   WEEYGEEMVSHLEGMFAFSIWDRETETVFLARDRFGIKPLYFGKTDRGYVWGSELPALL
FT                   IGGVDRTIDPAAVYNHFSLEYTPAPQTLLEDVWKVEPGQSVTITDDGVETRKYWDLLEL
FT                   ETGTRTTSMAAAADRLRTLLERSVEKRLMADVPVGAFLSGGLDSSAVTGIASQLKDDQL
FT                   KTYSVSFTDDRLDESDEARLVADHFGTDHHEVDIDLSSMDLFGEMMQYLGEPTGHLQML
FT                   PMYALSERASQDVKVALAGEGADELFAGYPWYQHVPEHKRKVDFMPEFTHDVAGAVAQV
FT                   APVGNKHLRYFSGLKNNEEMLLNHVCGFTTFRPEPDEFLRTGESAATSGLRANVGEVTA
FT                   EVADPALEQHMSTYETGYTLPDYHLYKADHMSMAQSLELRVPFLSKEMVEFAHSLPAEL
FT                   KVNDDDVKRVLKTAVSDLLPDQILEREKMGMRPPVEDWFEEEHDSIETWFTREKLRQTP
FT                   YVDANRATALRDAHRRGEESVGRTLWMILTYVAWYHSFIDEQNAVV"
FT   gene            complement(274472..276049)
FT                   /locus_tag="Htur_0255"
FT   CDS_pept        complement(274472..276049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0255"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; GAF
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; GAF domain protein; histidine kinase A domain
FT                   protein; PAS domain containing protein; KEGG: geo:Geob_3780
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59156"
FT                   /db_xref="GOA:D2RU87"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU87"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB59156.1"
FT                   /translation="MPDRSEPSVTGGDDAATAAYERITDAVFALDSEWRFTFCNEQAER
FT                   LLRRSETELLGTVVWEAFPDAFSPFRATYERAMDTQEPVAFGARSEPLDDWIEGRAYPS
FT                   ENGLTVTVRVDTEHVRRRERLDRRRTALQNAYEVIADPDRSLDEQLQSLLGVVRETIGT
FT                   EYGTLSCVHEDADEYIFEAVDAPPDADLEAGDTTALEATNCERVVSSERTLVLQDVDAD
FT                   APELADRAGNAEWGISCYLGTPVVVDGDVYGTFCFYDMEARTEAFSDWEVTFVELLGNW
FT                   VSAELERREYEADLETSNERLEQFAYAASHDLKEPLRMVESYLSLIERRYGDVLDEDGR
FT                   EFIDYAVDGAERMKAMINGLLAYSRVETRGAPFEPVDLNAVFEDVRSDLELQLTETSAE
FT                   LSRESLPRVEGDPDQLQQVLQNLLSNALQYSGDEPPRVRVSAERRGDEWIVSVSDEGIG
FT                   VDPDDADRIFDVFQRLHSHEEFDGTGIGLALCERIIERHDGEIWVESVPGEGATFRFTL
FT                   PAATARES"
FT   gene            complement(276082..277536)
FT                   /locus_tag="Htur_0256"
FT   CDS_pept        complement(276082..277536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0256"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine nucleotide-
FT                   disulphide oxidoreductase; KEGG: maq:Maqu_0242 putative
FT                   mercuric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59157"
FT                   /db_xref="GOA:D2RU88"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU88"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ADB59157.1"
FT                   /translation="MDEYDLIAVGGGSGSQVATAAAERGLETAVIERGPLGGACITRGC
FT                   VPSKALIHRADIADSVRHAEAFGVGAALEGVDYGEMTAAIHDTVYEKADRQEASLEDAE
FT                   NVTLYRGEGRFADERTLEVDLNDGGDVEVRGDSVVLGVGGRPMIPPIDGLEDVDFLTSD
FT                   DALFLDEQPDSLVVVGGGYIGAELGYFFAALGTDVSLVGRSERLVPREDDAVSEVVTES
FT                   LERYCDVYTGYEAAKVAENDTGVVVTAEPNEGGDGDDGESSTGDGVELEADDLLLATGR
FT                   RPNTDTLNLEATGVETDDGEYVVVDDRLETTCDGVWALGDIVGEQPFKHAADYEAKTVS
FT                   ANLLEDGDQAVDYGAMPHAIFTEPQVASVGRTEGELEDADREYESATVPFDAAPLGMIM
FT                   DADDGFVKVLAAPDGEILGCHIVGPQASTLIQEVVTAMEGGGTVDDVAEPVHVHPALSE
FT                   VVYTAFDELSSSEFSTAPDWRDVSDE"
FT   gene            complement(277604..278779)
FT                   /locus_tag="Htur_0257"
FT   CDS_pept        complement(277604..278779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0257"
FT                   /product="ribonuclease BN"
FT                   /note="TIGRFAM: ribonuclease BN; PFAM: ribonuclease BN;
FT                   KEGG: scl:sce8659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59158"
FT                   /db_xref="GOA:D2RU89"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU89"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ADB59158.1"
FT                   /translation="MNVRRDRVETVLRAIVHELKVERVTFMAGSIAYNAFLSLLPLLLL
FT                   LLTIISSVGDEGLERGLLSITRAALTPGAADVLVEELQTSTAGASLLGLAALLWGALRI
FT                   FRSLDMAFSDIYESQAENTFLDQLRDGLVVLVSVAAVVAVVIVLESLGGGLEAVGGTAG
FT                   WLLHRLLLVVATGVALVPMYYLFPDEPKITVVEVLPGVGVTAVGLVTAESAFRLYVEYG
FT                   STNAENGLLSGVIVLMTWLYVSGLVILVGAAVNAVLSNRSEDVSIEPVIGGVALEAGSA
FT                   GATVPDGADGAARTVDPIRTIGALEDRLPTASDVRIVVDGESVQVPPPDRVDGDRETSA
FT                   IPFVDDSVGVGLRWNVRDGDAEADSDTEADEGAADETTESDAVRDAARRDA"
FT   gene            complement(278871..279368)
FT                   /locus_tag="Htur_0258"
FT   CDS_pept        complement(278871..279368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_1116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59159"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59159.1"
FT                   /translation="MARRRVLRGGTGLAATALGIATLGGQAAAHFPADLEIDVKPGTDR
FT                   APINPNSCGVIPVAVQGTDEFDPTNEVVRYRFGAPDVVESGDGARPMHDGHGVDMDGDG
FT                   RDDLLLLFPAADAGFDGDESTARLEWERSEDGAHGLAGTAPIRIVGRRGRKRGRGRGGS
FT                   SQ"
FT   sig_peptide     complement(279279..279368)
FT                   /locus_tag="Htur_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.841 at
FT                   residue 30"
FT   gene            complement(279590..279811)
FT                   /locus_tag="Htur_0259"
FT   CDS_pept        complement(279590..279811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59160"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59160.1"
FT                   /translation="MSSDADADPSEYEALEDADVTMRETEHGLHIADDEVTGVSSQGQT
FT                   PEEAVRNLAEAVRSYREATDDDPGDDWL"
FT   gene            279958..281349
FT                   /locus_tag="Htur_0260"
FT   CDS_pept        279958..281349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0260"
FT                   /product="GTP-binding signal recognition particle SRP54
FT                   G-domain protein"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54
FT                   G- domain; Signal peptide binding (SRP54) M- domain
FT                   protein; GTP-binding signal recognition particle SRP54
FT                   helical bundle; KEGG: srp54; signal recognition particle 54
FT                   kDa subunit; K03106 signal recognition particle subunit
FT                   SRP54"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59161"
FT                   /db_xref="GOA:D2RU92"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU92"
FT                   /inference="protein motif:PFAM:PF00448"
FT                   /protein_id="ADB59161.1"
FT                   /translation="MVLDDLGSSLRGTLDKLRGKSRISEEDIEEIVKEIQRSLLSADVD
FT                   VSLVMELSDNIKERALEEEPPAGTPARDFVLRIVYEELVDLIGDSTELPLEEQTILLAG
FT                   LQGSGKTTSAAKMAWWFSTKGLRPAVIQTDTFRPGAYEQAKEMTQRAEVDFYGNPDNDD
FT                   PVEIARKGLEKTSEADVHIVDTAGRHALEDELIDEIEEIEDVADPDTSLLVLDAAIGQG
FT                   AKDQAQQFDESIGIDGVVITKIDGTAKGGGALTAVDQTDSSIAFLGTGEEVQDIERFEP
FT                   DGFISRLLGMGDLGQLAERVERAMEQTEMEEEDWDPEDMLQGSFTLHDMQKQMEAMNNM
FT                   GPLDQVMDMIPGFGGGIKDQLPDDAMDVTQDRMRTFSVIMDSMTEAEKEYPKAIGASQI
FT                   ERIARGSGTTEEEVRELLQQYKMMEKTIKQFQGMGSEQEMQRMMKQMQQGGGGGGGMGG
FT                   MGPFG"
FT   gene            281477..282511
FT                   /locus_tag="Htur_0261"
FT   CDS_pept        281477..282511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59162"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59162.1"
FT                   /translation="MNRRQYLTRTGIPLATLAATAGCLDDLPGSDSSDDSVAVADRTGD
FT                   RELDRAVGELNEAALALFAADDFEEPTDVEFDASVPTERIESARAHLETAADELDDDRE
FT                   SEIELLRTYAGVLERLVDVTETVTDETLEADLEAVFDAIGGDDAADGDEGGDDADSDDE
FT                   SADDDDLEAASATIDERTDEFAVAETNHAEAAADVESFDEAFERLVRIDPAELADGVAT
FT                   LGDAVGSLVTLGDGLESLLGGYEDLQTGREHMENQAYGKAETAFGNAQSTFETATTTLE
FT                   EDEEPPGGIADHVDTAICQSEHLTDAAAAFEEWAIAAADGEPVAAQNHKETGEESVDAA
FT                   GDCT"
FT   gene            complement(282598..283542)
FT                   /locus_tag="Htur_0262"
FT   CDS_pept        complement(282598..283542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0262"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   KEGG: pmy:Pmen_1493 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59163"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU94"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADB59163.1"
FT                   /translation="MHDTISVSEIMVTDVVTAPPDATASRAATLLRDEGVSSVVVVRDG
FT                   EPIGIVTEGDFLEHLCERTDLGSVELTDVLSAPLETIAPDTSIVDAVAILRESGFEHLP
FT                   VVDGGSDADDPADLAGILTTTELSYYVPHLARRTGGLGADRPRQRVRTDTQYERDDWTF
FT                   EYRADNESTVDVGDVARFSKVISESDVEAFAEISGDTNRLHLDAAYAAETRFGERIVHG
FT                   VLATGLISAALARLPGLTIYLSQESSFLAPVPIDDRVTAVCEVVDDLGGSKYRIETTVT
FT                   DGDGTTVLDGDAVVLVDDLPPEATAEDEPVAHD"
FT   gene            complement(283682..284257)
FT                   /locus_tag="Htur_0263"
FT   CDS_pept        complement(283682..284257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GG19588 gene product from transcript GG19588-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59164"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59164.1"
FT                   /translation="MTATELTRRRFGLGFTGVLSLLASGCLNSITGGDDHEHEHEHDDP
FT                   PWERGGLYELDQGTYPYTYQDGPNPDMHLAIVPTDEDGDHGLFHAGETATELFENGEAD
FT                   TVSDGDTVQPSSETLYRVDFESEGETTIELEIESDGLYSLFTAHDPDEFDAALRSETGE
FT                   ELTPTVTEEHSSHSHDDESHSHDDEHEH"
FT   sig_peptide     complement(284168..284257)
FT                   /locus_tag="Htur_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.517 at
FT                   residue 30"
FT   gene            284657..285547
FT                   /locus_tag="Htur_0264"
FT   CDS_pept        284657..285547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0106 FG-GAP repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59165"
FT                   /db_xref="GOA:D2RU96"
FT                   /db_xref="InterPro:IPR001695"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59165.1"
FT                   /translation="MILNWIKERKRATALVGVLLIVVAGVGMITLGGVAADNPFTVSDS
FT                   STDTSTTSGSEDTANEEATPVDEENSTTPSTTESDSEPSDDQVEDDQVEDQPEVNFVPG
FT                   VRNFDVSIEEFDESSADVEDGFVTPGEHRLLRFDMIIYNVGDADAELGHPENRSDLFEY
FT                   SDSHNHAHLKGFNKYKILDEAGNEMNAGKKQTFCLRDNFQTRSNASSSAKFDCDYQGIS
FT                   AGWADVYPASLPGQYLVIDDLPDGEYTLQATTNAEGTIDEKCDDDNTVRVDLRINNDTV
FT                   TVHSSQDDYVKPPSC"
FT   sig_peptide     284657..284764
FT                   /locus_tag="Htur_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.839 at
FT                   residue 36"
FT   gene            complement(285596..286009)
FT                   /locus_tag="Htur_0265"
FT   CDS_pept        complement(285596..286009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0265"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59166"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU97"
FT                   /inference="protein motif:PFAM:PF01877"
FT                   /protein_id="ADB59166.1"
FT                   /translation="MTDIYRVDVEITAPIYDTEVTSRVVDAVANIFPNADLEEEFGEVR
FT                   AEAHAMDHFSDLLHRQEILDTARGEFFANREGDTFSFALKKQAAFEDRINFSVGEPDEL
FT                   GEISVRVRVEEPTVEEYIDHIAPPTEDGRPVDA"
FT   gene            complement(286006..286602)
FT                   /locus_tag="Htur_0266"
FT   CDS_pept        complement(286006..286602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0266"
FT                   /product="Dephospho-CoA kinase-like protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59167"
FT                   /db_xref="GOA:D2RU98"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU98"
FT                   /inference="protein motif:COG:COG0237"
FT                   /protein_id="ADB59167.1"
FT                   /translation="MHVIGTVGLPGSGKGEAATVAREHGIPVVTMGDVVRQETADRGLD
FT                   PTKDHGKVAQALRDENGPTAIAERSLPMIEDRLEDHDTVLVDGIRSDTEVDVFEERFGE
FT                   AFTLVSIEAPFEMRAERIDARGRDAAEDDGGEGLAARDERERGFGMDDAMDRADVVVEN
FT                   TDSLEAFHERIEAIIREGPGSESEPTPDSVSNTDP"
FT   gene            286966..287346
FT                   /locus_tag="Htur_0267"
FT   CDS_pept        286966..287346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59168"
FT                   /db_xref="UniProtKB/TrEMBL:D2RU99"
FT                   /inference="similar to AA sequence:KEGG:AN3551.2"
FT                   /protein_id="ADB59168.1"
FT                   /translation="MTGPKLDRRRFATTVGAGAIAALAGCSDVGSQENESSDDDGSSAD
FT                   GSDPGANETGNESGTGENGGAEPGADENDSEDDGMSGPSTDENDSADDENASDDGFESD
FT                   NPFSDNDSSADNGSDAEGDTSL"
FT   sig_peptide     286966..287061
FT                   /locus_tag="Htur_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.878) with cleavage site probability 0.556 at
FT                   residue 32"
FT   gene            287494..287871
FT                   /locus_tag="Htur_0268"
FT   CDS_pept        287494..287871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:blr2954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59169"
FT                   /db_xref="GOA:D2RUA0"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59169.1"
FT                   /translation="MSQRSLFVRAIWFLAVGWWATPIVVNLAWALNVTVVLAPIGIKLV
FT                   NLVLTVLTLAEPRTFTNLDSARGQHSLLTRALYFVLVGWWLNFLWANLAALFAVTIVGL
FT                   PVAIWLVNRLPFVTSLYRFHG"
FT   gene            287922..287996
FT                   /locus_tag="Htur_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            287922..287996
FT                   /locus_tag="Htur_R0001"
FT                   /product="tRNA-Arg"
FT   gene            288536..289774
FT                   /locus_tag="Htur_0269"
FT   CDS_pept        288536..289774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0269"
FT                   /product="peptidase C45 acyl-coenzyme A:6-aminopenicillanic
FT                   acid acyl-transferase"
FT                   /note="PFAM: peptidase C45 acyl-coenzyme A:6-
FT                   aminopenicillanic acid acyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59170"
FT                   /db_xref="GOA:D2RUA1"
FT                   /db_xref="InterPro:IPR005079"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA1"
FT                   /inference="protein motif:PFAM:PF03417"
FT                   /protein_id="ADB59170.1"
FT                   /translation="MDDTAVDTIAYDDTIAGVDSFAEHARRRAETEREAVEWAIDELES
FT                   IVDTQGVDLEPLLEYARRSRESLPDRHRRAYEAMADVFDVDQAVYEAYVFAYSELCEEL
FT                   AEGEGRSEKNPKGVGNGIGEGCTNALVTPPRVESDGGIDTGGDAGTTGPLVLKNRDIAG
FT                   RGTRPKSIVEQPPIDDYYGILTIDTCGTVSMFKGVNDQGLVAANTYIDCEGEGEDVTPE
FT                   TRLRNGTVIRMLLEECATIEDAREFLESRLTRRLMGQTLFLADDTDAVLLEVDPAAERI
FT                   IDDDDPVVTRTNHFVCSASTEAESSTKRRQRALELLEGDEQLDREDLWRFARDHVNGPG
FT                   DDSICRHPEPETDEPHAFGQLTTASSAIFEGGSPAIEAAMGNPCEAERIRCAFGDEIPT
FT                   DLRTGQRWLDRLH"
FT   gene            complement(289929..291809)
FT                   /locus_tag="Htur_0270"
FT   CDS_pept        complement(289929..291809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0270"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: geo:Geob_3565 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-3 domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59171"
FT                   /db_xref="GOA:D2RUA2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR018106"
FT                   /db_xref="InterPro:IPR025847"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB59171.1"
FT                   /translation="MSERIESDAQSEVGYPATGSETLTYSPELRGSAPSLDAHEHANDH
FT                   FALIYESREEQFAAAIPFIRKGLERDERCLYITYENTRAEVIEAMRAYDIDVDTALDSG
FT                   QLSIHDEEETYLRNETFDADETLEFIDAAIEDATEEYEALRMTGEMSSVLEEDPDGEEL
FT                   VKCEAKANYLFDDADGIALCQYNRERFPADVIRDVISTHPLLIHDNRISSNVYYTPPKE
FT                   FFGPEKADCEVDRQLGMLREQTDVKDRLSKREQRLRELAEDLQENEERLQLALEAGEMG
FT                   MWELDLQTKDSPIRSRQHDRIFGYEEPIEEWTFETFLDHVHPDDRENVERSFEQAFEAG
FT                   KWEFECRIIRTDGEEREISAQGAFHSDDEGDPVRAVGVVRDVTDRKERERQLRELVERL
FT                   EESNERLEQFAYAASHDLQEPLRMVSSYLRLIENRYGDAFDEDGEEFLEFAVEGADRMR
FT                   EMIQGLLEYSRVEAEGEPFQAVDLNVVLEDVCEDLQLRVDDSGAEITSERLPTVEGDAN
FT                   QLRQVFQNLLSNAIEYSGQEPPRIHVSAERDGAKWILSVRDEGIGIDPDHADRIFEVFE
FT                   SLHTNDEHAGTGIGLALCERIVERHGGDIWVESTPGEGSTFSVTLPDPEA"
FT   gene            complement(292076..293167)
FT                   /locus_tag="Htur_0271"
FT   CDS_pept        complement(292076..293167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0271"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59172"
FT                   /db_xref="GOA:D2RUA3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59172.1"
FT                   /translation="MNTSLEVEYWVIDDDGDLVSPGSLLDYSEQIDPEFVEPMLEIKTT
FT                   PCSSMAELREEFLGLIEEIVDAARERDKRLVPLATPLHAAPSEIPYRDKRGTDLQRRIV
FT                   GPAFDDARVCAGTHMHFEQSNVADQLNMLTALDPAFALVNSSSHYRGEHILECARPFLY
FT                   RRSCYEPCPDQGQLWPYVDSAAEWEEELETAYDCFRERALERGVDSAAFDDEFAPYDAV
FT                   WTPVQLRKAMPTVEWRSPDTALPSQVLRLAETVRSLVSRADARGTTIGDGDPTDTHGNN
FT                   EGSVTLPLFDSVETVTDAAIHDGLENAGVRNYLQNLGFEPSAYDPLASRLPDSRLSKRR
FT                   AKDLRLEAARGLEADLERRRVRA"
FT   gene            293573..294343
FT                   /locus_tag="Htur_0272"
FT   CDS_pept        293573..294343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0272"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: dvm:DvMF_0260 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59173"
FT                   /db_xref="GOA:D2RUA4"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA4"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADB59173.1"
FT                   /translation="MSDETSADESERNASVIVIGGGPAGLSAALFTAKNGLETTVFDAD
FT                   ETWMHKAHLFNYLGIGSVGGSEFMATARQQVDDFGADRRQGEEVTAVGDSGEGFVVETS
FT                   VASETQRADGDSAEQSRGKSESSRPSGDDVSRDSADRSSGRRSREEAADDDGEYEADYV
FT                   VLATGANRDLAEELGVDFAENGTVDVGVEMETSVEGAYATGAMVRPEEWQAAIAVGDGA
FT                   AAALNILSSERGEHYHDFDVPADAERVFGELVAE"
FT   gene            294349..294969
FT                   /locus_tag="Htur_0273"
FT   CDS_pept        294349..294969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0273"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rhi:NGR_b20950 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59174"
FT                   /db_xref="GOA:D2RUA5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB59174.1"
FT                   /translation="MSQDHPNPVTPELPDSPVHTTGTDHITIWGSNEADTIEFYRDLLG
FT                   MPLVLRQPNLDDPSQTHLFFDTGDGRILTFFVSDDRPSARGQRAGVGAVHHLCFSVDPD
FT                   EYEETMQALEDAGHGYNVFDRGIFHSIYTRDNNGLVIELSTDKYEIPDDRRGEVLAKAQ
FT                   ELREEDGADYAKDEHLRGAIEALGLEVVEHDLPDADAGVGGVE"
FT   gene            294966..295634
FT                   /locus_tag="Htur_0274"
FT   CDS_pept        294966..295634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0274"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   reu:Reut_B4695 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59175"
FT                   /db_xref="GOA:D2RUA6"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA6"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADB59175.1"
FT                   /translation="MSVGDGADGPHQGQPLVTGGTALEDAEAAIVLTHGRGATAQGMIQ
FT                   IANEVGREGVAFLAPQAARKTWYPNSFLEPVERNEPGRTSGLRAIGDAISEANDAGIPT
FT                   ERVMLMGFSQGACLASEFVARDPRRYGGLAALSGGLIGEDVDPDDYLADDPDLEETPVF
FT                   LGCSDVDPHIPEERVHETADVLESMNADVTKRLYEGMGHGVNEDELEFVSGMVADLVDD
FT                   "
FT   gene            295741..296250
FT                   /locus_tag="Htur_0275"
FT   CDS_pept        295741..296250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59176"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59176.1"
FT                   /translation="MEPNGTDRRGTDRRAVLSTVAGAVAAVSVAGCLGGADSEDDEPEP
FT                   GLDQATAVEGDTDPEAWRDVESLRFDGYVGGWLGLEPSAIEGVENPTLVLVEGREYEVT
FT                   WENKDGIHHNFAFWDEDREVVEDYSTDGTDVEGERETLVFEATPEMDTYRCEYQPAGQK
FT                   GPVELI"
FT   gene            complement(296257..296673)
FT                   /locus_tag="Htur_0276"
FT   CDS_pept        complement(296257..296673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0276"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: sat:SYN_02544
FT                   universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59177"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA8"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADB59177.1"
FT                   /translation="MKVLVAYDGSAPAQKAVEYAFDEYADEEITLLRVVEFADGYTEAS
FT                   IRAIQDLLDDREEEAAAKLREDLMDLVDTSGVDFRMEVASGDPAREVVKYAEENDVDHI
FT                   LVGSHGRKGVSRILLGSVAERIVRRAPVSVTLVR"
FT   gene            complement(296803..297981)
FT                   /locus_tag="Htur_0277"
FT   CDS_pept        complement(296803..297981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0277"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: azo:azo2135
FT                   putative phosphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59178"
FT                   /db_xref="GOA:D2RUA9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUA9"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADB59178.1"
FT                   /translation="MSALLLAVGLLVAAFVGYNIGGSTTGPAFGPAVGAGVIGKVVAAA
FT                   LMSVCFFAGALTVGPEVVDTLAGDLLRDQSVFTLRSSAAVLLVIGGALFLGNYAGVPTS
FT                   TSMTAVGAVAALGFAAGELNRAVLGEIVTWWLLAPVVGFWVAGVVGRYWYPRLHAWLAL
FT                   EEGRRERPLVRVVSSGITPRPDVESTDGRRELSGAVTVVAVGCLMAYASGTSNIANAVA
FT                   PLYATGELELDPLLLLGSAAVAVGAFTIARRTLETLGNDITALPLPAAIVVAVISSAIV
FT                   VSLSAVGIPASFVIVATMSIVGLGWGRASRTPTLSDVARREDAPTAVGALAADGEHGSP
FT                   ASSAQETADAPKAASLFDPSTTARVVVMQNVVPIVATVGAFVLFEFVPLFGH"
FT   sig_peptide     complement(297916..297981)
FT                   /locus_tag="Htur_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.432 at
FT                   residue 22"
FT   gene            complement(298237..299340)
FT                   /locus_tag="Htur_0278"
FT   CDS_pept        complement(298237..299340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0278"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   gur:Gura_1909 peptidase M29, aminopeptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59179"
FT                   /db_xref="GOA:D2RUB0"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB0"
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /protein_id="ADB59179.1"
FT                   /translation="MDPRIREHAEVIANHSVDLQEGDNVVVDAHPVAEDLVVALHEVIG
FT                   DQGANPVTVSQRTGERQRRAFLRAGDDEYETPEHELALIQNTDVYIAIRASDNVTQTSD
FT                   VDPETQAAYQQAHRPILEERLSKRWCLTQYPAPANAQLAEMSTEGYENFVWDAVNKDWE
FT                   EQREHQEHMVEIMDPADEIRIKSGDTTDVTMSIAGNPTLNDHGEHNLPGGEVFTAPQPD
FT                   SVEGEVLFDMPLYHQGREITDVYLEFEGGEVVDHSAAKNEDVLTEVLNTDDGARRLGEL
FT                   GIGMNRDIDQFTYNMLFDEKMGDTVHMAVGRAYDDTVGEGNEANDSAVHVDMIVDMSED
FT                   SVIEVDGEVVQRDGTFRFEDGFEESGI"
FT   gene            complement(299420..299659)
FT                   /locus_tag="Htur_0279"
FT   CDS_pept        complement(299420..299659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59180"
FT                   /db_xref="GOA:D2RUB1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59180.1"
FT                   /translation="MSETVSETDSARPRRSLARGAVLALRTAAFWLLLLGFGGWVIDEG
FT                   GEVTLESPFTLAFGAGVGCALASIYLGIFLANRD"
FT   gene            complement(299668..299793)
FT                   /locus_tag="Htur_0280"
FT   CDS_pept        complement(299668..299793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59181"
FT                   /db_xref="GOA:D2RUB2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59181.1"
FT                   /translation="MFDLIPDDPVIIAIVVILLTLIFFSYLLIRRTILEFRDGMR"
FT   gene            300479..301822
FT                   /locus_tag="Htur_0281"
FT   CDS_pept        300479..301822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0281"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: GSVIVT00037716001; hypothetical protein
FT                   LOC100245692; K03609 septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59182"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB3"
FT                   /inference="protein motif:COG:COG0455"
FT                   /protein_id="ADB59182.1"
FT                   /translation="MIAIAGAKGGCGKTTTTLGLAEAFGRAGTPALAVDADRQLPNLHV
FT                   RGGIDREPTLVAARGEDDVLQAAQTDPRSSNVALLPAPKSSEQLDMETAIERLSPDSVQ
FT                   SLIDCPSGAGPDVVDPLSVADAVVVVTTADDRSLDAAETTVEMANRLGVPVLGAIINQS
FT                   TDIPETVRSWVDVPVLGVVPEVDDPLSSDDSRAVYDEIVRTLQTKNATVRTPPAYADEL
FT                   LGTGIDTLDRRLGGGFPPGTVVALTADPASQSEQLLYQTTAVRGSLYITTRRSERNVDR
FT                   AIESSTLETGSPTVRRIDGEGAEPFDRFREILDKLPDGANLLVDTASALERRDRRAYVA
FT                   FLNDLKDRMAETNGVAVLHCPTRTVPENREITTHFADVVLELETVSSGVGADVEHYLSV
FT                   PKHRADCGFSETIELRFDGTSNAITVPADGELGAGSAPGVTAERRSDE"
FT   gene            complement(301873..302571)
FT                   /locus_tag="Htur_0282"
FT   CDS_pept        complement(301873..302571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0282"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   gme:Gmet_0428 NifH/FrxC:cobyrinic acid a,c- diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59183"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB4"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADB59183.1"
FT                   /translation="MIVAVTGGKGGVGKSTTSLNLGYELDAVVVDGDLATADLPPGTGP
FT                   DLHDVLAGRADPVAAVERFGPVRYLSCGRTLAGARAADLSALDRVVERLEREYGRVVID
FT                   CPAGLARDVGTQLETAHLAVLVTTPDEAALVDAVRTRRVAADLETPIASVVLNRADRDE
FT                   HGDLASRVEERFGATTTIVEDRATVDEAQSRWLPVDDVDPDCPAVGAFDEIARTIERSE
FT                   QRISSRIGVH"
FT   gene            complement(302568..302933)
FT                   /locus_tag="Htur_0283"
FT   CDS_pept        complement(302568..302933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59184"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59184.1"
FT                   /translation="MVEVEATCERHEDVTLVQATVTNTRSTPQTIRLRSRLEGPVWPPR
FT                   AGSVAAPEWDDSGWTGTVKPGRTRGLGFASPVPPIESPVEIAEVRRADGDESPSSKTVL
FT                   ADLEEWAPTTDVLSREL"
FT   gene            303196..304209
FT                   /locus_tag="Htur_0284"
FT   CDS_pept        303196..304209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0284"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type
FT                   II"
FT                   /EC_number="1.2.1.59"
FT                   /note="KEGG: ajs:Ajs_2165 glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type II; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase; dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59185"
FT                   /db_xref="GOA:D2RUB6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR006436"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB6"
FT                   /inference="protein motif:TFAM:TIGR01546"
FT                   /protein_id="ADB59185.1"
FT                   /translation="MIQVAINGYGTIGKRVADAVREQPDMEVRGVAKTRPNFEAETAVD
FT                   KGFPLYAAVEERADQFADAGLEIAGPVEDLVDAADVVVDATPSGIGAENKSMYEAYDTP
FT                   ALYQGGEDADLVDTSFNARSNFEDATGADHVRVVSCNTTGLSRVIAPLREAYGVEKVRA
FT                   TLVRRGGDPGQTSRGPINDILPNPVTIPSHHGPDVETIFDDLDIDTLGMKVPATLMHMH
FT                   SLNVTLEEEVDASEVRDLFAEESRLFLIPERMDIDGSGKLKEYALDAGRPRGDVWENCI
FT                   WEESISTVGDDLYLFQGIHQESDVVPENVDAIRAVLGEADAEESIETTNETMGIGL"
FT   gene            304335..304736
FT                   /locus_tag="Htur_0285"
FT   CDS_pept        304335..304736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0285"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG:
FT                   ret:RHE_CH01245 HSP20 family molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59186"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB7"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADB59186.1"
FT                   /translation="MRRDDRDEPFDDLFREIERMMNEMMNGADANVDFSSSSDVGNGFG
FT                   MDTHVDIHETDDEVRVVADLPGVEKDNIELECDGKTLTISAESEHRQYDERVSLPTRVN
FT                   EHTASATYNNGVLEVVFDPAEQSSGISLE"
FT   gene            complement(304767..305639)
FT                   /locus_tag="Htur_0286"
FT   CDS_pept        complement(304767..305639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0286"
FT                   /product="RimK domain protein ATP-grasp"
FT                   /note="PFAM: RimK domain protein ATP-grasp; protein of
FT                   unknown function DUF201; KEGG: ank:AnaeK_2282
FT                   alpha-L-glutamate ligase, RimK family"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59187"
FT                   /db_xref="GOA:D2RUB8"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB8"
FT                   /inference="protein motif:PFAM:PF08443"
FT                   /protein_id="ADB59187.1"
FT                   /translation="MIELAVANAKQTFRRMQEPLSERGIRVHHVPVRERTIALGDPPWD
FT                   ADDYDVGFVYPGRLMEGGVADALLEIPWLNDHETVLTSRNKAEVLARLGRADLPVPESV
FT                   YVSNDVGEAELTDVFERFEPPVVVKPNSTTRGVGVAKAHDLDSFLGICDYLSLVHDYKA
FT                   TGDQSFLVQEYLPDATDYRVMVLEGEYVGAVERRLPDEAVAEGQWKHNVHRGAEATGVE
FT                   LPDEYRELAERVAAALEIPFLGVDLLETDDRLVVNETNARPTIDDETKYEPDFYDRLAD
FT                   AIRTAADRQ"
FT   gene            complement(305998..306528)
FT                   /locus_tag="Htur_0287"
FT   CDS_pept        complement(305998..306528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0287"
FT                   /product="ribosomal protein L10.e"
FT                   /note="TIGRFAM: ribosomal protein L10.e; PFAM: Ribosomal
FT                   protein L10e/L16; KEGG: ribosomal protein L10; K02866 large
FT                   subunit ribosomal protein L10e"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59188"
FT                   /db_xref="GOA:D2RUB9"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUB9"
FT                   /inference="protein motif:TFAM:TIGR00279"
FT                   /protein_id="ADB59188.1"
FT                   /translation="MSDKPASMYREISKPAYTRREYITGIPGSKIAQHKMGDISADPED
FT                   YPVQISLITEEEVQLRHGSLEASRLSANRHMLKNAGENNYKMILRKFPHHVIRENKQAT
FT                   GAGADRVSDGMRQAFGKIVGTAARIDAGERIFTIWCDVDDAEFAKEAMRRAYNKISPPC
FT                   RVVVEKGEEQLIA"
FT   gene            complement(306752..306982)
FT                   /locus_tag="Htur_0288"
FT   CDS_pept        complement(306752..306982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59189"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59189.1"
FT                   /translation="MMEQTHADAGLTELPTELNSAQGKLVYLYLEATDGATVDELGQVL
FT                   AMKKIDILSVCNSLSSQQLIEKCDGTYVPIR"
FT   gene            307548..308729
FT                   /locus_tag="Htur_0289"
FT   CDS_pept        307548..308729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0289"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; CBS domain containing protein;
FT                   SMART: CBS domain containing protein; KEGG:
FT                   afw:Anae109_3134 peptidase M50"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59190"
FT                   /db_xref="GOA:D2RUC1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR016483"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC1"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ADB59190.1"
FT                   /translation="MPRSFRIGSLFGIPIKLDLTFLLVLPLFAYLIGAQIEPVAGLLND
FT                   GLAAGIDVGAITSGPMPWILGLAAAIGLFVGVVLHELGHSLTAQRYGFPIDSITLWLFG
FT                   GIAALSEMPEDWRQEFTIAIAGPIVSVFVGVGSYALFLIVPESLDGARFVLGYLAVLNV
FT                   VLAGFNMIPAFPMDGGRVLRAFLARSQPYAKATQQAASIGKLFAVLMGLFGLFAGGNII
FT                   LIGVAFFVYIAASSEAQQVTMKAAFQDVTVGDIMTPAGDLHTVEPETTIAELVQRMFTE
FT                   RHTGYPVIDTDAFEGERLVGLVTLTDAREVDPVERDAFTVDEVMSTDLKTITPDSDAMT
FT                   AIEEMRENNIGRLLVVDDGDLVGLISRSDVMTAFDIVQKSGAVSSGGLPRTAN"
FT   gene            308858..309883
FT                   /locus_tag="Htur_0290"
FT   CDS_pept        308858..309883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0290"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: afw:Anae109_0897 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59191"
FT                   /db_xref="GOA:D2RUC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB59191.1"
FT                   /translation="MPPAIETVDLVKEYGDLRALQELSLTVEEGEFFGLLGPNGAGKTT
FT                   FINTLVGLVRKSGGEARVFGHDVEADYREARDAIGLAPQEFNVDRFFPIKEVLMHKAGY
FT                   HGIPEDEAAERADEVLKRVGIYDKRDERFDWLSGGMKRRLLLARALVTDPDLLILDEPT
FT                   AGVDVQLRHDLWELVTELNEEGTTILLTTHYIEEAERLCDRVAIMNEGRKVTVATPDEL
FT                   KERGTDTISVRLESGVSASAAADLETDLGAYAHEVTTSGETLEVRVDDGGSTAPRLLND
FT                   LEARGHEIADLEITRTSLEEIFVDLTRSEDRTVTRSSASSADEGEESETTPAEREQEGV
FT                   A"
FT   gene            309883..310695
FT                   /locus_tag="Htur_0291"
FT   CDS_pept        309883..310695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0291"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: vpa:VP2510
FT                   putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59192"
FT                   /db_xref="GOA:D2RUC3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC3"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB59192.1"
FT                   /translation="MLPKLSVGFRALFRREVLRFVRRPKNTFMPPAITNVLYFAVFGLI
FT                   LGGRIDQIAGFDYILFIVPGLVVLGAISNAFENASFSIFHGRWNEYIHETLTSPLSYAE
FT                   MVVAYVAASAVRGLIVGVIIAAVGRLFVPISIEHGLFLVATMVVITALFAGCGIIGGLV
FT                   ARDFDDLTVMNQFILRPLVFFGAVFYSLETFEQAWQVQLSLVNPMVYMVDSVRYGLLGH
FT                   SDLIGVGILPAPYTEFAPLFALGVLTAATVLVLAIDVYLFKIGYGLTD"
FT   gene            310755..311288
FT                   /locus_tag="Htur_0292"
FT   CDS_pept        310755..311288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0292"
FT                   /product="conserved hypothetical protein-like protein"
FT                   /note="KEGG: smt:Smal_2895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59193"
FT                   /db_xref="GOA:D2RUC4"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC4"
FT                   /inference="protein motif:COG:COG3296"
FT                   /protein_id="ADB59193.1"
FT                   /translation="METDHCPHCGASLSPSANYCSECGEAVNDDSWGSSSAESSWGGAD
FT                   DRSLDGAGDSSWDAGNPWSGSSPEYASGRRPEGDTTLAAITHVLAIFTWAIGPLIVLVA
FT                   TEDPFVEENARNALNWQIAFTIYMTVSFFLTLVVVGIVPLLVLPMVDLVFCVLAAIKAA
FT                   DGEAWSYPATPDIV"
FT   gene            complement(311345..312148)
FT                   /locus_tag="Htur_0293"
FT   CDS_pept        complement(311345..312148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0293"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59194"
FT                   /db_xref="GOA:D2RUC5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC5"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB59194.1"
FT                   /translation="MVVSESESISLPDDRTLSFATYGDPDGAPLIFHHGTPGSSHLGAL
FT                   LSDSARARGVRVIAPSRPGYGRSDPNPDGTFETWAGDCRALVDALGLEWVAVAGFSGGG
FT                   PYALAVAAHHADRVSDVGVIGAPVPAHDGGPFGPLVGFPRLLGIAFRFGAIVARFRGDR
FT                   FVVDQLTDRAVDDETARIVGQDFRVGLSAGPSGAVRESRALAADWSLPLPDDVTVWHGI
FT                   DDENAPIGPVRTAYEDRPAVTLREIDDDHLGTLCSVRDEVLGLAE"
FT   gene            complement(312273..313289)
FT                   /locus_tag="Htur_0294"
FT   CDS_pept        complement(312273..313289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0294"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: rpa:RPA2201 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59195"
FT                   /db_xref="GOA:D2RUC6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC6"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADB59195.1"
FT                   /translation="MAETRQWRLASRPVGEPTSENFELVTVDRPEPDNGEVLVKTLYQS
FT                   VDPYMRGRMRDAESYAEPWDVGDPMRASVVGEVLESNAGQFSAGDIVTGDLLWAEHAVA
FT                   DANELQPVNPDHGPISTALGVLGMPGVTAYWGLNDVGDPKPGDTVVVSAAAGAVGSVVG
FT                   QLARLSGARVVGTAGSEAKIEWLTEELGFDAAINYKETDDLSAAVDEACPDGVDVYFDN
FT                   VGGPITDAVWPRLNLDARVAVCGQIALYNETEVPTGPRKLAKLIETRATVEGLLVSDYQ
FT                   PRWGEALERLSQFVQNGDVQYRENVVEGFENAPDAFLGLFEGENIGKQLVKVAEYDG"
FT   gene            313436..314140
FT                   /locus_tag="Htur_0295"
FT   CDS_pept        313436..314140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0295"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: esa:ESA_02959
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59196"
FT                   /db_xref="GOA:D2RUC7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC7"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ADB59196.1"
FT                   /translation="MESPRDTLETLLAGNERHVEALPEDYFAEVQTGQHPTVVAICCSD
FT                   SRVSHEGMWGIDRPGAVFTPSNIGNQIWDEDDGERIVDGGVLYPIHHTGTDVVVVVGHT
FT                   GCGAVTAAYHVVTGEEPPGPQGVDKWVDQLVPVIEEALESGLIDTDADEERVINQLVEY
FT                   NVDYQVRSLTEADEIPDDVTVYGFVYDFQGVYGDEPGRTYLVSVDGETDPDALAGLAPE
FT                   GYEATARSLFHQ"
FT   gene            complement(314188..314844)
FT                   /locus_tag="Htur_0296"
FT   CDS_pept        complement(314188..314844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0296"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   gsu:GSU1208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59197"
FT                   /db_xref="GOA:D2RUC8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC8"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ADB59197.1"
FT                   /translation="MGQSLLAALFGDPFAVMNTIGLIAFALVGSSKAIREEFDVLGITI
FT                   VGLAMAFAGGATRDILVTRVPLALQSPIEIGLGLLGVGLAIALSVVLTTPDTHPITLVA
FT                   DAIGLAAFTTTGAIVATEAGVSVFGVIAIATINAVGGGAFADILLDRSPFILFDDFYAS
FT                   CAVLGGSVYFVAATVGVSGNTAAGICAVVTVVTRLAAVTYDWNLPTIQGLGLVEH"
FT   gene            complement(314984..317497)
FT                   /locus_tag="Htur_0297"
FT   CDS_pept        complement(314984..317497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0297"
FT                   /product="Protein of unknown function DUF2309"
FT                   /note="PFAM: Protein of unknown function DUF2309; KEGG:
FT                   lpf:lpl0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59198"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUC9"
FT                   /inference="protein motif:PFAM:PF10070"
FT                   /protein_id="ADB59198.1"
FT                   /translation="MTRKETDDRRRIEECIDRAAERIGSVWPLHSFVTANPLSGFEDEP
FT                   FHEAIAEGERLFGGRGYPHPSVFRRAWETGRIDPDALRAELEARGIDRDPETLLDEMAE
FT                   TEAERGTETDDATAAVDRVLTKWLAAFLDQGRAKWSMPNREAGFYAAWREMAPHDGDVP
FT                   GCDDPDDLPETATEALEAALSDYPDSRLMDVLEHHLAALPGWSGFIKQRTDADANAWQE
FT                   QYPITLPEYLAVRLTLADLLDAPIDPEAVDDGSTDDATTAATAVTVDASDADGEVPLPE
FT                   IWLTAWERSYREHLLEEIDDSVTDPSEADDGERPAAQLVFCIDTRSEVIRRHIEAQGPY
FT                   ETHGYAGFFGVPMRHRKHDSHAETDACPPIVDPQHRVVDRPDEESDAATTRGRWTGVAS
FT                   AVRNHFTTLKSNVVAAFTFVEGAGSAYGSAMAARTLSPSAIAALERAVEERVPGYHEAA
FT                   SPAVDYDAYDDHGHADHALPQGMTLEEKVEYAATAFELMGWTEFARLVVFAGHASETTN
FT                   NPFDSSLDCGACAGNPGGPNARVLAEICNDEDVRAELCERGIDVPEDTVFLAGEHNTTT
FT                   DEIELFDNAVPESHREDLASLRADLEAARADSAAERTASAGDDAVGEVERKAADWAEAR
FT                   PEWGLAGNASFVIGPRELTEDRNLDGRAFLHSYDWTTDPDGDALEAIFTGPLVVTQWIN
FT                   NQYYFATVDNAVYGSGSKITQNPIGNVGVLQGNGGDLMTGLPLQSLKVDDDQPYHQPLR
FT                   LTAVIHAPVDRVTEILRKHGDVRTLLDNGWIGDLTVVDPEQDNAVFQYAGDLEWATEAE
FT                   VEVEAEATPEPETEPAPVPQTADDD"
FT   gene            complement(317487..318986)
FT                   /locus_tag="Htur_0298"
FT   CDS_pept        complement(317487..318986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0298"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: lpp:lpp0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59199"
FT                   /db_xref="GOA:D2RUD0"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUD0"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADB59199.1"
FT                   /translation="MTDESAPTSDDAVAQLSEPTPSTSVVPRASTWTVWALFALSLGVL
FT                   ALAARNGAGWEFSSALRVDGLTAVMWVVVTFFSGIVHSYSRRYMAGDRHIDRFYYRVLG
FT                   FTLVVMTLTAANHVALFAAAWLAMGLLMASLIGHVREWEQARAASALARRYFLASSGLL
FT                   AASLALLAWATGATTLTGIFGALEGVSRTVGLVAAGGIVLAAIIQSALFPFHNWLLSSM
FT                   TAPTPASALMHAGFVNAGGVLLTRFAPVVADHLAIMSFVVLLGAVSALLGQAMILVQTD
FT                   VKRKLGCSTIAQMGFMILQCGLGFFAAAIAHLVLHGFYKAYLFLSSGAAVEQAVPKDGK
FT                   DTHLGFSGIAVSLATAVGGGVLFGVLTGKATSLELNSGTILTLVVVLTTLTAARDILRR
FT                   STLPASVRFVSAPLVVLTAISGYAIAFNAVSTMLSGVPMTHVSTEMTVAHYLVVALFVG
FT                   AYLVAELGWYRSSKRLYVSLLNLSQPDPNTVLTDKEDYNDA"
FT   gene            complement(319292..319756)
FT                   /locus_tag="Htur_0299"
FT   CDS_pept        complement(319292..319756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0299"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   SMART: Transcription regulator, AsnC-type; KEGG:
FT                   cvi:CV_0561 AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59200"
FT                   /db_xref="GOA:D2RUD1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUD1"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADB59200.1"
FT                   /translation="MTDYELDAVDREILYALQEEARNLSSSEIAERTDASSSTVRKRIQ
FT                   RLESEGVIKGYSANIDYTKSGYPIRMLLYCTASIPERGDYIDDILAIPGVVSVQELVTG
FT                   EQNLLVTAVVKNDREITPIAQEISDMGLTITDEVLVRSHRSTSFDEFASQ"
FT   gene            319977..320195
FT                   /locus_tag="Htur_0300"
FT   CDS_pept        319977..320195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59201"
FT                   /db_xref="GOA:D2RUD2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUD2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59201.1"
FT                   /translation="MRRFLESDTGFYYAVGLFTVLVFLGGLVVLAVVSPGDIGATELGG
FT                   LVVGFFLFMLVFFVSVTVRRLEDRDEL"
FT   sig_peptide     319977..320072
FT                   /locus_tag="Htur_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.619) with cleavage site probability 0.612 at
FT                   residue 32"
FT   gene            320306..320500
FT                   /locus_tag="Htur_0301"
FT   CDS_pept        320306..320500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0301"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: tmz:Tmz1t_1251 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59202"
FT                   /db_xref="GOA:D2RUD3"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUD3"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADB59202.1"
FT                   /translation="MAKGTVDFFNDTGGYGFIETEDADEDVFFHMEDIGGPDLEEGQEL
FT                   EFDIEQAPKGPRATNVERL"
FT   gene            320660..320779
FT                   /locus_tag="Htur_0302"
FT   CDS_pept        320660..320779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59203"
FT                   /db_xref="GOA:D2RUD4"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUD4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59203.1"
FT                   /translation="MFAPAIGVPELSIILFNLVLVLGALGGVWYLLGRLRGAL"
FT   gene            320824..321189
FT                   /locus_tag="Htur_0303"
FT   CDS_pept        320824..321189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0303"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; Cupin
FT                   domain protein; KEGG: tdn:Suden_0432 cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59204"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUD5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB59204.1"
FT                   /translation="MSDPLIRRRDEIEYETVDAADGLEKGVLVSDDHGAPHFAIRRFVL
FT                   EPGAEVPKHTNDVEHEQYVLEGEYTVGIGNEEYAVEAGDSLLIPAGTVHWYRNEGDDPG
FT                   AFICAVPNGDDEIELLE"
FT   gene            321277..322386
FT                   /locus_tag="Htur_0304"
FT   CDS_pept        321277..322386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0304"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pol:Bpro_4778 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59205"
FT                   /db_xref="GOA:D2RUD6"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUD6"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADB59205.1"
FT                   /translation="MVEAQSVGERAATRDREGWVTGTLVLFCLASAIITVVAGLVQVTF
FT                   GEYSMTFVEAWGAVFEPTVMFNLEAWSAFLFGTELPEMSTDSVVVWNLRLPRVFVAIIA
FT                   GATLAISGAIFQAVTRNELASPFVLGVSSGAGFAVLATLVVFTGFAPYLPLIAAVGGTV
FT                   AFLVVYGIAWKGGTSPVRLVLAGVIVNMVFQSLQQGLFFFVDDLGVAQTAIAWLTGSFT
FT                   GTGWGEVRIALIPGIASIAVALASSRQLNVLLLGETTAKSLGMRVERVRFFLSAVAILA
FT                   ASVAIAVAGIVSFFGLVVPHIVRNVVGGDYRQLMVGCLFAGPALMVTADVGARLALGGM
FT                   QMPVGVVTGLVGGPYFLYLMRKQQSMGEL"
FT   gene            322386..323237
FT                   /locus_tag="Htur_0305"
FT   CDS_pept        322386..323237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0305"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: kpe:KPK_3972 iron-enterobactin
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59206"
FT                   /db_xref="GOA:D2RUR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUR3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB59206.1"
FT                   /translation="MSQNESQMTQERITDGDGVAVESALVGEDLALSYPTTEETIVECA
FT                   RLDIPENAVTALVGPNGSGKSTLLKSLSNHLEPERGTVRIHGEELDTFNRKELARELGV
FT                   LSQENDSLSSITVEDLIYHGRYPHRGFFDSVSEEDHAAVERALELAGIEELRDAELGQL
FT                   SGGQKQLAWIAMVLAQDTDVLLLDEPTTFLDVHHQFRVLETIRQLNEEKGVTVAVILHD
FT                   IAQAARFADYLVAMHDGELYDWGPPEEVVTEQLLADVFGVEATVQHEPELQVLPRRALP
FT                   ER"
FT   gene            323411..324544
FT                   /locus_tag="Htur_0306"
FT   CDS_pept        323411..324544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0306"
FT                   /product="ABC-type Fe3+-hydroxamate transport system
FT                   periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59207"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUR4"
FT                   /inference="protein motif:COG:COG0614"
FT                   /protein_id="ADB59207.1"
FT                   /translation="MTDESLWTRRNVLRTSGAVAGTAALAGCITGEENGDGNGDGDGGD
FT                   DVDGPYTVSMPPVGEVEFESVPQTWAAGTGDWADMGIALGLEPPKALYLTRRLHTGYYD
FT                   DIPDVSVDPNAIDSLWDDELTREEFLTLAEEVDLFVMDPNFLKGRANWSDEDIEQVETT
FT                   GTPFFGNTIFSRDYPWHQDYDYLSMYEAFEKLAEVFQEQERFSEFETLHDDFQSELESV
FT                   VPTGDGPGAAVLYPQLEEDSFLPYLIDESTTFKHLRDLGVEDALATSDVEDFHSGRGSV
FT                   DYETLLEIDPEYILLRTEQYLSEEEFQQDIVEPMQSHNVGQELTAVQNGDIYKTLPFYQ
FT                   GPIINLVATQRLAQQLYDVEDDLFDPQAVSDIVNGDF"
FT   gene            complement(324638..326989)
FT                   /locus_tag="Htur_0307"
FT   CDS_pept        complement(324638..326989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0307"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: aeh:Mlg_1098 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59208"
FT                   /db_xref="GOA:D2RUR5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUR5"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADB59208.1"
FT                   /translation="MDLNPLRGVPGVRSSYALRFGAALFVVLLVVGVFGGVIYAHTGSE
FT                   LEDDVESRLVSDAESDAERLDGWLESSERNLESLTRSLEFRNDDRVSISDSLHRLNERP
FT                   GFEGAYYVDAGNGTVDIEAGTDAVVEDGRLSEAADERLSSAIEAEGRVTFTETFETADG
FT                   RPAMLAVSTVPGDSDHVVGLVDLESLSRAVIASDSTKDAVVVDGSGTVVLAEDRSLLLR
FT                   DDVLEAGAVGGDAGTTSIESGAGEETVVGYAPIENGNGEWTMTTRVPAAQAYSLQSDIS
FT                   LQILGMLGVVFASIVVLGATVGRNTARSLRDLSERAAAIEDGNLEEPVESERRDELGEL
FT                   HRSIDRMRRSLRERLEETEAARAEAERARTESERFSRHLERTADEYGETMRACADGDLT
FT                   RRLEPDDESEAMETVAREFNGMMDDIEATVAATRAFADAVDQSAESTAEGVAEVRSASE
FT                   QVTTSVQEIADGAERQSTQLTAIADEVNELSTTTEEIAATSSQVATLAERTAATSTDAR
FT                   ESARRAIDGMNAIEAEADEAVAEVDRLEDELEAIDDLLAFIGDVTQQTNVLALNASIEA
FT                   ARSRSDDAEFTAVADQVKSLAEDTQEAATDIEARLERVNEQADRVAAVVRETDERIAAH
FT                   RNAVETSVAALEEISEFADETNDGIQEISAATQQQAAATQEVVSMTDDVTAISEETSAE
FT                   AETVAAAAEEQTSSLVTVSHTATSLSERAQDLSDALSTFEVAVEPDAELEPTNGEGDDA
FT                   VPSDTDESTAGGADEASTDGSQEFTWTESQ"
FT   gene            327195..329261
FT                   /locus_tag="Htur_0308"
FT   CDS_pept        327195..329261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0308"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: DNA double-strand break
FT                   repair Rad50 ATPase; K02349 DNA polymerase theta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59209"
FT                   /db_xref="GOA:D2RUR6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUR6"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADB59209.1"
FT                   /translation="MSKQVQEVETIFCHATGDDYLIVVERDGKRLFRAKLGLSETSAGP
FT                   RPAKFRLKQGSSEEPRQPDEFVELARRAGRIRISEQTAPEKRRELREMLEGYQLEDKSK
FT                   TVRTCRYCASAGRYSPITTETAVKDDNDWICRDCARQELERQLTYSGSGEVTAAAKDRL
FT                   EDLMLEVQDLERIVNLLQGQLDPDLTKFDTISATTDEVDPVRVDSLNLHPGLQNLLEDR
FT                   FETLLPVQSLAVDHGLFDGDDQMVVSATATGKTLVGEMTGINRVLNGKGKMLFLVPLVA
FT                   LANQKYEDFQDEYGHLVDVSIRVGASRISDNGNQFDPNADVIVGTYEGIDHALRTGKDM
FT                   GDIGTVVIDEVHTLKEEERGHRLDGLISRLKYTCEQRAKRRDDYGGAQWVYLSATVGNP
FT                   EQLATALESKLIEFEERPVPIERHVTFADGQEKVRIENKLVRREFDTESSKGYRGQTII
FT                   FTNSRRRCHEISRKLDYSAAPYHAGLDYKRRKKVERQFGEQELSAVVTTAALAAGVDFP
FT                   ASQVVFDSLAMGIEWLSVQEFHQMLGRAGRPDYHDKGTVYVLVEPDCSYHNSMEMTEDE
FT                   VAFKLLKGDMESVMTHYDEAAAVEETLANVTVGGKAAKALNDRMLGDVPTKHAVGKLLE
FT                   YDFIDGFEPTPLGQVVTQHFLDPGEAFALLDGIRKDAHPYELIADLELRDDDL"
FT   gene            329399..330103
FT                   /locus_tag="Htur_0309"
FT   CDS_pept        329399..330103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59210"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59210.1"
FT                   /translation="MEPATPSVIDPPANVLLVHEKHCEPAVCPDLCHDTGATADLRVSF
FT                   ADNRPDRPDPDEVTGKVGLLTVGDVLIEDAAESARDFDQRVVVDAVRDPTDLSAIGVAV
FT                   SRFCKHWSDERLTVCFDSLDALLRSTPPKDVFQFVHVLTNRLSSVDAYAHFHFDPTRHD
FT                   DRVVSTFGEIFDAVVAEAGSEDSLPEATDEDVAELLAAWTDGTDDSDSELEFAVEPSTE
FT                   ATDEDIARILGN"
FT   gene            complement(330162..330416)
FT                   /locus_tag="Htur_0310"
FT   CDS_pept        complement(330162..330416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59211"
FT                   /db_xref="GOA:D2RUR8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59211.1"
FT                   /translation="MTGLEILVLIAVLVGVLVAAVLVRALAPFIVNAVAGLVVLFLSHV
FT                   VFGLSIAVTPVVLVIVGLGGILGAAAVILFALFGVAFVP"
FT   sig_peptide     complement(330315..330416)
FT                   /locus_tag="Htur_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.460 at
FT                   residue 34"
FT   gene            330502..330574
FT                   /locus_tag="Htur_R0002"
FT                   /note="tRNA-Pro1"
FT   tRNA            330502..330574
FT                   /locus_tag="Htur_R0002"
FT                   /product="tRNA-Pro"
FT   gene            complement(331147..331905)
FT                   /locus_tag="Htur_0311"
FT   CDS_pept        complement(331147..331905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59212"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59212.1"
FT                   /translation="MIVSMVALSTVAAGAATAAAANADDGADTDLEVTVDAPDSVATTE
FT                   ASTFDVTVTTADGEPAETDVVFEINGEEIQEEVTASTDDTGSVTFTAEGIALPEGDYEW
FT                   TVTAGDEERSGTLTVTDTADDGATNETGATDTEAADDDTEAAGNDTTASENDTATDDTA
FT                   VDNDTEVAGNDTTTSENDTAADNDTEPADNDTTTSENDGATDDTAADNDTESADNDSET
FT                   EEDESVPGFGIGGALSAVLAGTLLLARQRS"
FT   sig_peptide     complement(331834..331905)
FT                   /locus_tag="Htur_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.869 at
FT                   residue 24"
FT   gene            332486..333367
FT                   /locus_tag="Htur_0312"
FT   CDS_pept        332486..333367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59213"
FT                   /db_xref="GOA:D2RUS0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59213.1"
FT                   /translation="MGPLQPSRRTLLTAAASCALAGVAGANSNAESDSDLTRDSQQILD
FT                   GTDHETTVYRTVAAADGPTVLVVGGVHGNEVAGYEAASAIAEWEIDAGTLVTIPYANAD
FT                   AVEQRTRTGEDGVDLNRQFPEGEEPTTDLARELWTVVDNYDPDVVIDLHESIGIYAGGP
FT                   VDGVGQAIFHSNSTETATDAEQAADAVNRNHVDKPGLEFETDTFSKPENEPSGLLVHKA
FT                   ARDLNAQSFLIETLSRGPDLETRIHWHTRLVTNLVEEGLFEPEPATDDSAGDTSDDSDD
FT                   EPVIEECPEDAL"
FT   sig_peptide     332486..332578
FT                   /locus_tag="Htur_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.488 at
FT                   residue 31"
FT   gene            333418..333963
FT                   /locus_tag="Htur_0313"
FT   CDS_pept        333418..333963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59214"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59214.1"
FT                   /translation="MDNRGIRVGYFPGSPLAAGERLLMGGEYLVLFVDNPHMKSESIRD
FT                   PDSDDERPVRLLSDTESFVTLPPAPDDATVAVVRTDPDVRLLTTISTNEESAWPGVSQA
FT                   PGRIVETDDGRRSEFRLDVDTFVDADILDVTDETGTRSVRSMTVSYRRESHLERLRRRL
FT                   RRWWATRGTRPARPVPRL"
FT   gene            complement(334066..334509)
FT                   /locus_tag="Htur_0314"
FT   CDS_pept        complement(334066..334509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59215"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59215.1"
FT                   /translation="MSGAERPTRRAVLAAVGTGATTTGVVGGDDAPRVTDGGYDVDSDR
FT                   IHIRIRDCYTATIQTQNPDAEVVTAGLYFRETDRYDFHQTRVEFPYELDLREFDWAREQ
FT                   GAVLTDVTVEDIDFTALAEKSVPEDWGCEESDVDHDRDCSDDA"
FT   sig_peptide     complement(334423..334509)
FT                   /locus_tag="Htur_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.569 at
FT                   residue 29"
FT   gene            334697..335347
FT                   /locus_tag="Htur_0315"
FT   CDS_pept        334697..335347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0315"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   rpf:Rpic12D_0355 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59216"
FT                   /db_xref="GOA:D2RUS3"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS3"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ADB59216.1"
FT                   /translation="MSKSGGGVTARLKRWLINGTALTIPLVITILALILVVDFVLGMLS
FT                   PIVRGVMFVWPNEPPEAVVQLAMMVSLFAFFLLVGIVAEYTPGKAISQRVHATMETIPG
FT                   VSTIYESVRRASKLLVDDDTDQFQDVKLVEFPHRDAYMLGFLTAQTPPEIETQVENGPM
FT                   VTIMVPLAPNPTTNGFIMHMPAEHVYDVDVTVEEAFRAIATLGVASDDLGDAT"
FT   gene            335692..337794
FT                   /locus_tag="Htur_0316"
FT   CDS_pept        335692..337794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0316"
FT                   /product="MCM family protein"
FT                   /note="PFAM: MCM family protein; ATPase associated with
FT                   various cellular activities AAA_5; magnesium chelatase ChlI
FT                   subunit; SMART: MCM family protein; KEGG: MCM4; Essential
FT                   helicase component of heterohexameric MCM2-7 complexes
FT                   which bind pre- replication complexes on DNA and melt the
FT                   DNA prior to replication; accumulates in the nucleus in G1;
FT                   homolog of S. pombe Cdc21p; K02212"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59217"
FT                   /db_xref="GOA:D2RUS4"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027925"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS4"
FT                   /inference="protein motif:PFAM:PF00493"
FT                   /protein_id="ADB59217.1"
FT                   /translation="MAQAGNSELVDSFEQFFRNYYDNEIKQLAQQYPNEQRSLHIDWQD
FT                   LYRYDPDLADDFLAQPEQLQRYAEEALRLYDLPIDVSLGQAHVRIHNLPETESPEIREI
FT                   RARDMNSLVEARGIVRKATDVRPKIEEAAFECQLCGTLTRVPQSSGDFQEPHECQGCER
FT                   QGPFRVNFDQSEFVDSQKLRIQESPEGLRGGETPQSLDVHVEDDITGEVTPGDHVSATG
FT                   VLRLEQQGDQQEKSPVFDFYMEGMSVDIDEEQFEDMDITDEDKKAIYDISNQDDVYEQM
FT                   VASIAPSIYGYDQEKLAMILQLFSGVTKQLPDGSRIRGDLHMLLIGDPGTGKSQMLSYI
FT                   QNIAPRAVYTSGKGSSSAGLTAAAVRDDFGDGQQWTLEAGALVLADQGIAAIDELDKMR
FT                   AEDRSAMHEALEQQKISVSKAGINATLKSRCSLLGAANPKYGRFDQYEPIGEQIDLEPA
FT                   LISRFDLIFTVTDQPDEEKDRNLAEHIITTNYAGELTTQREEMTSLDVSAEEIDEMTDQ
FT                   VDPEIDAELLRKYIAYAKQNCHPRMTEAARNAIRDFYVDLRAKGTDEDAPVPVTARKLE
FT                   ALVRLSEASARVRLSDTVEESDANRVIEIVRSCLQDIGVDPETGEFDADIVEAGTSKSQ
FT                   RDRIKNLKQLISDIEEEYDDGAPVDIVMERAEEVGMDQSKAEHEIEKLKQKGEVYEPST
FT                   DTLRTT"
FT   gene            complement(337858..338757)
FT                   /locus_tag="Htur_0317"
FT   CDS_pept        complement(337858..338757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0317"
FT                   /product="Transcription factor TFIIB cyclin-related
FT                   protein"
FT                   /note="PFAM: Transcription factor TFIIB cyclin-related;
FT                   Zinc finger TFIIB-type domain protein; SMART: Cyclin domain
FT                   protein; KEGG: hypothetical protein; K03124 transcription
FT                   initiation factor TFIIB"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59218"
FT                   /db_xref="GOA:D2RUS5"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS5"
FT                   /inference="protein motif:PFAM:PF00382"
FT                   /protein_id="ADB59218.1"
FT                   /translation="MVNTDSAPVCPECDGRLRTRGTETICEECGLVSSEDAIDRGPEWR
FT                   SFDGEETDQRRTGAPLTRSRHDRGLSTKIGYGSGSSGKYSARLTGRKRRQIARLRREHN
FT                   RARISSKADRNQVYGFTEIRRINTHLSLPESTREQSCALFESAQSEGLLQGRSLEGFAA
FT                   AAVYATCRTRSNARTIDEITDVARADEDELTVAYDALNRELGLPTGPIDPTQYLPRYAS
FT                   QLDLETAIENRAREYVDTLLEEGLIGGRNPSGVAAACLYKAAGERAEWPTITQADAATV
FT                   ADVAPVTIRSTVMNLREL"
FT   gene            complement(338906..339178)
FT                   /locus_tag="Htur_0318"
FT   CDS_pept        complement(338906..339178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59219"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59219.1"
FT                   /translation="MSADRQGTDPTPPPIDSSDQRPSVPLAARIERTQLELRVAALEDA
FT                   LEASERRRQAVIDRYERLLEDRAATDGSSVSDGRLPALVERFRDS"
FT   gene            complement(339294..340553)
FT                   /locus_tag="Htur_0319"
FT   CDS_pept        complement(339294..340553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0319"
FT                   /product="threonine synthase"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: abo:ABO_0807 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59220"
FT                   /db_xref="GOA:D2RUS7"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS7"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ADB59220.1"
FT                   /translation="MSLSLSADQPAVPDDADDGVWLECIECGETFAPFDDVRYTCDDCD
FT                   SLLEVRYADLPTFDDFEGEGVWRYADALPFESGVSIQEGATPLYEVPRLEESIGVEALR
FT                   IKHEGMNPTGSFKDRGMTVGVKVAKELGVGRLACASTGNTSAALAAYGSRGGMETLVLL
FT                   PAGKVAAGKIAQASLHGARILEVDGNFDACLDIVQELAGQGEAYLLNSLNPFRLEGQKT
FT                   IGLEILEGFLADYDTVPDRIVLPVGNAGNTSALYKAFRELVQAGELDEDDVPKLTGVQA
FT                   EGAAPMVEAVENGADEVRRWEDVETRATAIRIGNPVNAPKALPGIRETGGTAVAVSDEE
FT                   ITEAQRDLAGEGIGVEPASAASVAGLRKLRAEGIVDDDERVACLTTGHLLKDPDAAAAA
FT                   GSDPEPVPADTDGVLEHLQD"
FT   gene            complement(340607..340990)
FT                   /locus_tag="Htur_0320"
FT   CDS_pept        complement(340607..340990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0320"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   xac:XAC0451 MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59221"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS8"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADB59221.1"
FT                   /translation="MTDRSQHRLGELMEQSDPPFEEVMSCVFGIENHETRTYLVLRQRP
FT                   GSTIDELADALERDRSTVTRSLSTLRDRGLVRRDRRLLDGGGYVYQFTAVPVPETKAML
FT                   HEALDAWAATVHEVIDEFDGAPP"
FT   gene            complement(341037..341282)
FT                   /locus_tag="Htur_0321"
FT   CDS_pept        complement(341037..341282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59222"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59222.1"
FT                   /translation="MPDPLRIDAGECTADEIITAIRDGRRVVVTTTILDAEHEVTLRYD
FT                   GSVFYCDTPTRLHRHESEREMRACIRKMGYGAVEDA"
FT   gene            341406..341876
FT                   /locus_tag="Htur_0322"
FT   CDS_pept        341406..341876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0322"
FT                   /product="conserved hypothetical membrane spanning protein"
FT                   /note="KEGG: cbu:CBU_1950 hypothetical membrane spanning
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59223"
FT                   /db_xref="GOA:D2RUT0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT0"
FT                   /inference="similar to AA sequence:KEGG:CBU_1950"
FT                   /protein_id="ADB59223.1"
FT                   /translation="MSQETATRTDERTTTALAPWQAGTVGGILGAVVFGAMMAMQTPAV
FT                   LEAAIPAMYGLEGGLAGTILHVSHGAVLGVVFAALLVAAGRSHLGAGSALVAGLVYGIA
FT                   VWAVLAVVVMPIWLSAVGFGMAPAVPNVAVESLVGHAAYGLILGVTYSLLAR"
FT   gene            complement(342060..342989)
FT                   /locus_tag="Htur_0323"
FT   CDS_pept        complement(342060..342989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0323"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: gem:GM21_3742 ornithine carbamoyltransferase;
FT                   TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59224"
FT                   /db_xref="GOA:D2RUT1"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT1"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADB59224.1"
FT                   /translation="MTTATNETEPRHFLDVDDVTPAELDAILERAAEYKRAQHAGEDHE
FT                   DLEGQTLGMIFQKPSTRTRVSFETGMTQLGGHAVFLGEDDIQLGRGEPLKDTSRTLSRY
FT                   VDAVMARVFKHGNMEVLAEYSSVPVVNGLTDDAHPCQTLADLLTIREQEGGFEDVSAAW
FT                   IGDGNNVAQSFAVGAALTDIDLTVATPEGYGIDDAVLERARDLGGDPTTTHDPVEAATD
FT                   ADIIYTDVWISMGQEDERDVRMNDFEGFQISADLLEHTADASVMHCLPAHRGEEITDDV
FT                   IESDRSVVFDQAENRLHAQKALLSWLLE"
FT   gene            complement(343009..344079)
FT                   /locus_tag="Htur_0324"
FT   CDS_pept        complement(343009..344079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0324"
FT                   /product="N-acetyl-ornithine/N-acetyl-lysine deacetylase"
FT                   /note="TIGRFAM: N-acetyl-ornithine/N-acetyl-lysine
FT                   deacetylase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein; KEGG: hypothetical protein; K01438
FT                   acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59225"
FT                   /db_xref="GOA:D2RUT2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010175"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT2"
FT                   /inference="protein motif:TFAM:TIGR01902"
FT                   /protein_id="ADB59225.1"
FT                   /translation="MNADSSEPTDVSAAEARELLIDLVSIPSPTREEREAAKRLVEFFE
FT                   VHDREVWIDAVGNVRAPADDAVLLTSHIDTVPGDIPVEVEESGDDEILWGRGSVDATGP
FT                   LAAMAAAAVRTGVSFVGVVGEEVDSKGSRYLVDDREEQPDAVVNGEPSGADGITLGYRG
FT                   LIAGTYVATSESGHTSRPDPNAIQHAVRWWSAVEEYFEGDEYEPVFEQVTTKPVDIEGG
FT                   VSDDGLSVEATMDVQLRVPPALDVGAVREATEAELEVGTVTWKDKVPPVMMSPRTEVAR
FT                   AFRVAIRKEGGDPRLVRKTGTSDMNIYAGAWDCPMVTYGPGDSDLDHAPDERLPLSEFD
FT                   QSVSVLERVARTLSEQ"
FT   gene            complement(344076..345224)
FT                   /locus_tag="Htur_0325"
FT   CDS_pept        complement(344076..345224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0325"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   hha:Hhal_0727 acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59226"
FT                   /db_xref="GOA:D2RUT3"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT3"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ADB59226.1"
FT                   /translation="MSDLDFVSGSKPIGIERGEGVFLYTADGTEYIDAGASFACTPLGH
FT                   SHPAVVEAVQEQVGDLTFVDSSYPVEARENAYASFVASTPDGLEGAWFCNSGTEANEAA
FT                   LKFARSATGESKIVAATRSFHGRTMGALAATWKDKYKKPYEPLAGDIEFVPYGDGDELA
FT                   DAVDDETAAVILEPIQGEGGINVPPAGYLETARELTDEAGAALVLDEVQTGMGRTGSMW
FT                   ACQNAGVTPDILTTAKGLGNGLPVGAVAVQDWIADGAASHNATFSGGPVVAAAVHATVS
FT                   TLVEEERPAHAAEIGDYLMTELESALGDSVREVRGEGLLVGLELKRGANRAARDLAMNH
FT                   QVLALPAGRTVLRLLPPLVIDEAEADRLVNALTAVVASDTES"
FT   gene            complement(345221..346078)
FT                   /locus_tag="Htur_0326"
FT   CDS_pept        complement(345221..346078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0326"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: afw:Anae109_0632 arginine biosynthesis
FT                   bifunctional protein ArgJ; TIGRFAM: acetylglutamate kinase;
FT                   PFAM: aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59227"
FT                   /db_xref="GOA:D2RUT4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT4"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADB59227.1"
FT                   /translation="MTTVVKIGGARAVDPEGALADVASLVEDGEDVVLTHGGSTAVDET
FT                   LEDLGKEPTYVETPGGVVGRFTDEETMDVFKMVMPGKLNTDLVESLHNEGVDAVGLSGT
FT                   DGKLLEGKRKSAVRVKEDGKKKIKRGDHSGKIESVNADLLETTLEGGYTPVVSVPMLGK
FT                   EKSGGYTAVNADADRAAAAIAGALEADLVVLTDVSGIYEDPDDESTKIDSASTPEEFEA
FT                   VKDAAEGFMTKKVMASEEALEGGAASVIVATANADEPISSALDGEGTTLEPGVLDTDTE
FT                   EVTQ"
FT   gene            complement(346080..347156)
FT                   /locus_tag="Htur_0327"
FT   CDS_pept        complement(346080..347156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0327"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: hha:Hhal_0880 N-acetyl-gamma-glutamyl-
FT                   phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59228"
FT                   /db_xref="GOA:D2RUT5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT5"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADB59228.1"
FT                   /translation="MAVGTETGADANAETVTATVIGGSGFTGGELLRLLAGHPNFELTE
FT                   VTSRSKAGKSVGSVHPPLRGTDLRFTEPEDLESVDVLFAATPHGVSMGQIDEFFEIADT
FT                   VVDLSADFRLESEEQYDEWYDGHESPEYLEKAEYALPEINRENLKGAGLIAGGGCNATA
FT                   TILGLYPLFEHDILEGGEQIVVDVKVGSSEGGAGGGEASSHPERSGVVRPYAPTGHRHE
FT                   AEIEQFLDTSVSFTCHAVDMIRGASATNHVFPSGPVSKGDLWQAYRACYEDEPFVRMAA
FT                   GGSGVYRYPEPKSVAGTNLAEVGFELDPSNKRIVVFSAIDNMMKGSAGQAVHAANIALG
FT                   LEETAGLEFTGLHPVGAP"
FT   gene            complement(347156..348040)
FT                   /locus_tag="Htur_0328"
FT   CDS_pept        complement(347156..348040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0328"
FT                   /product="lysine biosynthesis enzyme LysX"
FT                   /note="TIGRFAM: lysine biosynthesis enzyme LysX; alpha-L-
FT                   glutamate ligase, RimK family; PFAM: RimK domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; KEGG: bph:Bphy_5945 alpha-L-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59229"
FT                   /db_xref="GOA:D2RUT6"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011870"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT6"
FT                   /inference="protein motif:TFAM:TIGR02144"
FT                   /protein_id="ADB59229.1"
FT                   /translation="MTLQVGILYSRIRKDEKLLLNELRERDHEIEKIDVRKQTFDISEA
FT                   PEEFADLDIVVDRCLATSRSLYATQFFEAYGIPVVNSHETADICADKVKNSLALEKAGV
FT                   PTPATKVAFTKETAMEAIEEFGYPCVLKPVVGSWGRLMAKIDSKDAAEAILEHKATLGH
FT                   YEHKVFYVQEFVEKPGRDIRVLATDGEPIAGMVRSSDHWITNAAKGAETDVFEPDEEAK
FT                   ALVKKASDAVGGGLLGIDLMETEDGYTVHEVNHTVEFKALDGAVETDVAGTVVDWLESK
FT                   ADAETEDELEVSA"
FT   gene            complement(348037..348201)
FT                   /locus_tag="Htur_0329"
FT   CDS_pept        complement(348037..348201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0329"
FT                   /product="lysine biosynthesis protein LysW"
FT                   /note="TIGRFAM: lysine biosynthesis protein LysW"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59230"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT7"
FT                   /inference="protein motif:TFAM:TIGR01206"
FT                   /protein_id="ADB59230.1"
FT                   /translation="MTECVECGAEVSLHDDLEVGEIVDCTTCGAELEVVDTEPPVLERA
FT                   PELEEDWGE"
FT   gene            complement(348520..350184)
FT                   /locus_tag="Htur_0330"
FT   CDS_pept        complement(348520..350184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0330"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: pla:Plav_1602 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59231"
FT                   /db_xref="GOA:D2RUT8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT8"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ADB59231.1"
FT                   /translation="MTEESAHDGPAFESEAATDGGTDPDSEGGERSTGSRSSSDSGSDG
FT                   VVRRDRFSGGPARSFLSSLAADERIFEADLEVDRAHTVMLAEQGIVEDDVAGQILTALD
FT                   AIEVDGHDSLPDGEDVHEAIETAVIERIGAEGGKMHTARSRNDEVAACIRYRLREDVLE
FT                   SIETTLALRESLVAVAEAHAETIMPGYTHLQPAQPTTVAHWALAYEGAVRRDTARLLEA
FT                   YGRINESPLGGAAFAGTTFDIDRERTAELLGFDGGPASNARGSSAEQRSAVVVENSMDA
FT                   SSSRDFLLEATQALSTHATTLSGLAEDVVIFANRGFVDLSDDYSSTSSIMPQKKNPDTL
FT                   ELVRAVAGDAAGGVQGLTTTLKGLPRAYNRDLQRATTHAWDTVDAVTEASEVAAGAVAT
FT                   ADWNEETLAAEAGEGFSTATGVADLLAANGLPFRTAHELVAHAAENSAERSSADSHAAK
FT                   PRDNGADYDALEAAARDVLGEPLESLVDPDAVEEALDPAASVASRDSQGGPAPEAVADQ
FT                   LELARESQSDDQATLEELDAALEAAHEALREEVNGYV"
FT   gene            complement(350187..351476)
FT                   /locus_tag="Htur_0331"
FT   CDS_pept        complement(350187..351476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0331"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: fph:Fphi_0552 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase; Queuosine synthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59232"
FT                   /db_xref="GOA:D2RUT9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUT9"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ADB59232.1"
FT                   /translation="MTRVALAFSGGLDTTVCVPLLEEEYGYDDVIGVTVDVGQPASEFE
FT                   EAEETADALGLEHYVVDAKEEFADLCLEGVRANATYQGYPLGTALARPVIAEAILEVAE
FT                   EQDCTGIAHGCTGKGNDQLRFEAIWRDSDLEVIAPVRELGLTREWEQEYAAEKDLPVEG
FT                   GSGGDWSIDTNLWSRSVEGDDLEDPNYVPPEDIYAWTQAPTGETQEIEITFEKGYPVAV
FT                   DGVEYEPVELIEHLNGVAGAYGVGRTDSMEDRMLGLKVRENYEHPAATTLLNAHEALEG
FT                   LVLTQEEREFKQLIDQKWSKKGYEGLIDAPLVGALEGFIAETQKRVTGTVTIRFEGGQA
FT                   RAVARDSKFAAYSAEHASFDTETVGKIKQEDATGVAKYHGFQRRLANEAIAANAEDVEK
FT                   PELATDGSGGDASEASGSSSEQGSDVEDEE"
FT   gene            complement(351854..352990)
FT                   /locus_tag="Htur_0332"
FT   CDS_pept        complement(351854..352990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59233"
FT                   /db_xref="GOA:D2RUU0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59233.1"
FT                   /translation="MDLREQGRWALFWVLVGIGCMLVATVAVPIGAAADAGSQGVALQD
FT                   EGSASDRLDEADEILIDVFVHENGSATFVVDYRFENQTDEEWGQLSSDVQSNQEVYADS
FT                   QEDRWNDILREGENATDRDMAIENVTVATDNSSAPREMGHVVVTFEWDSFAYPQLTQIE
FT                   AGSALVGLSLPSGTWLQVYAPEGYTIDEVSPEPEGDGGSVTGGSEDSDLESVRWGDAGD
FT                   PFSSTPPTIVMIEESNETDPSTEADPGTDGPRPWLLVLGALALLATVGAAGWWLRGDRA
FT                   GDRSASVTNGGSTTNGNAAAPEDEMPPPELLSNEERVLQLLEKRGGRIKQQEVVSELDW
FT                   TEAKTSQVVSGLREDGEIDVFRIGRENVLALPDGEDEE"
FT   gene            353076..353270
FT                   /locus_tag="Htur_0333"
FT   CDS_pept        353076..353270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59234"
FT                   /db_xref="GOA:D2RUU1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59234.1"
FT                   /translation="MHDSRGELEVETLLKIVLALFAIFLAFQILEMVIGGIASLLGPFF
FT                   VLVQLGVALVIVLWLLERI"
FT   gene            353324..353824
FT                   /locus_tag="Htur_0334"
FT   CDS_pept        353324..353824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59235"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59235.1"
FT                   /translation="MYSVNVPVPGRVRRLADELYPELVGFDRVREDHSCLLKRLGEADH
FT                   VAQLQHRAHRALEGEPAVEARITGIDYFEEPPLGTAPVVYLAVESPGLESIHADLTDSF
FT                   ETVEGLEGGDYVPHVTLARGGDLEAAKRVADREIEPIQWTVSELEFWDGTYKLPVSRVS
FT                   LPA"
FT   gene            complement(353848..356019)
FT                   /locus_tag="Htur_0335"
FT   CDS_pept        complement(353848..356019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0335"
FT                   /product="DEAD_2 domain protein"
FT                   /note="PFAM: DEAD_2 domain protein; SMART: helicase c2;
FT                   Helicase-like, DEXD box c2 type; DEAD-like helicase; KEGG:
FT                   RAD3; DNA helicase component of transcription factor TFIIH,
FT                   DNA excision repair complexes"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59236"
FT                   /db_xref="GOA:D2RUU3"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU3"
FT                   /inference="protein motif:PFAM:PF06733"
FT                   /protein_id="ADB59236.1"
FT                   /translation="MSETAGYMRFFPYDQPYENQREAMDRIHNSLTRGQDVLFEGACGT
FT                   GKTLSSLVPALEVAREQDKTVVITTNVHQQMRQFVAEARAITREEDIRAIVFKGKSSMC
FT                   HIDVGYEECQALRDNTRAVVDAERDKRQLERRQRELLEESQGGDGGAADARSAVMDELE
FT                   SIEERLEDLEEQNVCDYYRNNLTQDTDDFFAWLFEDVRTPEEIYEYAEREGFCGYELLK
FT                   EGIEGVDLVVCNYHHLLDSMIREQFFRWLGRDPEDVIAVFDEAHNVEDAAREHATRTCS
FT                   ERTFDSALDELADADDPRSEDAANVLSAFHRALVETYEDSFGFGERERIDENWEDISIA
FT                   NEDRKDDLTLEFLQRYSGRGIEDDLEAAMKLGQELDEQYEEAYREGETATRTECQTLQA
FT                   AAFVSAWMNEGSKEGLYPVVSVTRDAGTDEIYGRAELYTCLPRQVTGRLFEEVYGTILM
FT                   SATLQPFDVTEDVLGLEDPVTMAYGLQFPAEHRRTYAVETPPLFSSDRDDPAVQEEVAE
FT                   TIHDAVRMTPGNTLAFFPNYGEAERYAKRLEGRTEKTVYLDEPGTSVEELRQQFVADDG
FT                   AVLCTSLWGTLAEGVSFDGDDAHTVLVVGVPYPHLDDRAEAVQEAYDAAFDGTETGWRY
FT                   AVEIPTVRKTRQALGRVIRSPEDVGVRALLDRRYSRSAKSDLGRYSVNGTFPHEEREEL
FT                   IDIDPEKLKFSMLNFYGDHDAYDGETPAP"
FT   gene            356210..356629
FT                   /locus_tag="Htur_0336"
FT   CDS_pept        356210..356629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59237"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59237.1"
FT                   /translation="MAIPGYDSSNVAEYTLEQVGARVDIVAGVVPDAFGLEKSADEPPV
FT                   DALADPVDLAALDEVKAIEAMRIALVYDPSRLPPGASPTDVAVAVDTDEGWEPLESTVD
FT                   LEETTVTAVLNDRPPGSTVVAGYDDRDDESVEPAD"
FT   gene            complement(356641..357594)
FT                   /locus_tag="Htur_0337"
FT   CDS_pept        complement(356641..357594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0337"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   pin:Ping_2733 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59238"
FT                   /db_xref="GOA:D2RUU5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADB59238.1"
FT                   /translation="MVTMASSTSVVLAALFANGAIAILKFGGYLLTGSPAMLSETYHSI
FT                   SDTGNQIFLLVGIKYGAQEATRSHPFGHGKAQFFYSLLVSIMLFGIAGWESAHHGYDAL
FT                   THGGVHRASEDVTLLGQPLDPVYVNYAVLLGAIAFESYALWKAYQGISRQMDEHGWTSL
FT                   REAFRKTSDVTTLTALTEDTIALAGAGIALFGIYLTRTTGNPMYDAGSALLIGIMLMGF
FT                   AVALAWQNKRLILGESLPKEDEDELRRIVADWDGVTELIDLRTVYFGAEELLLTADVAF
FT                   DPALDAETIDERITALERALQDHDDQIQKVYIEPET"
FT   sig_peptide     complement(357535..357594)
FT                   /locus_tag="Htur_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.851 at
FT                   residue 20"
FT   gene            357683..358210
FT                   /locus_tag="Htur_0338"
FT   CDS_pept        357683..358210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0338"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: pca:Pcar_1503
FT                   phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59239"
FT                   /db_xref="GOA:D2RUU6"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR020935"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU6"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADB59239.1"
FT                   /translation="MIAIFSDTHSSDGHDLEGEALSVAREADTVIHAGDFTSASALEAF
FT                   QRECNLLYAVHGNADGPAVRERLPTARTVEAGGVRFAVTHRRDGGETGLAIFGRSRDAD
FT                   VVVFGHSHRPTVTETEDLLLLNPGSHADPRGNRPGFAVLEERANGDGLEGEIHEPDGTV
FT                   LESFELEVRHER"
FT   gene            complement(358359..359141)
FT                   /locus_tag="Htur_0339"
FT   CDS_pept        complement(358359..359141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGAP002456-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59240"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59240.1"
FT                   /translation="MADIDRIDHRLAAVERAVIDGDYEVDELGDLATLTETVERLETRL
FT                   DEQERRLAALEAKTESLTGFVDNVESVNDDVERQAATAVATVDRLEDRIDELESALEAV
FT                   RRETTGAEAATGRPKALAGSDPDDTGRQNATSTATEVAFSERETEPDDDGAKLPENAVS
FT                   EIVGSISSDGDDGGVDDGFEWGAEESAADESAASSPAGEPGAAGMNAAEQESVDRLLAD
FT                   PESDRSESAVGEATTEDAGDEEPVDSGGLLSSVRSKLS"
FT   gene            complement(359307..360386)
FT                   /locus_tag="Htur_0340"
FT   CDS_pept        complement(359307..360386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0340"
FT                   /product="ATPase-like protein"
FT                   /note="KEGG: pla:Plav_1044 ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59241"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU8"
FT                   /inference="protein motif:COG:COG0433"
FT                   /protein_id="ADB59241.1"
FT                   /translation="MSFVIGRGDELAEGPAGRLGRYRALDGSEGADLFLDLDGPHAMLV
FT                   VGKRGYGKSFTMGVIAEELARSRGVAPVIVDPMGVFDTLAEDAEGNPVPTDVVSSPAVE
FT                   ATSLDPKSWCALLDLSPESGAGSLVWQAATESATIAAMRDHVEATDAPDADKRAAINHL
FT                   NLAASWDVFDPDGLSAADLGGPEVTIVDVSGLEARAMNAICRGVGEALYRARVRGTIDR
FT                   LPWLLLDEAHTFFEGVAEPALRTILTRGRAPGVSLVTATQRPGAVPPVGISQSDVLVSH
FT                   RLTSEADLEALESAQPTYMNGSLDDRMPTEPGEVVVIDDATETVHAAQVRWRDTPHGGD
FT                   SPRASDYIDSDTAPTVGTD"
FT   gene            360646..362004
FT                   /locus_tag="Htur_0341"
FT   CDS_pept        360646..362004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK24884 gene product from transcript GK24884-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59242"
FT                   /db_xref="GOA:D2RUU9"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59242.1"
FT                   /translation="MDTVAYESVIGVSYGLLIAVVTASLVAAVAIGLGYVQRRRLPRAA
FT                   SGVIAITLTVGIGYAIGVFAVDPLSAQAVRIATALFVTGVIAAYAGSLGWRLATELPRK
FT                   TSLPVERGRTLSGDAIDAVDVMGQVTIRASGEVRAFEGYPPLDPDLRAALEDGAWRLPA
FT                   DLPLAELETRLEDRLQTTYDLEAASVAVDGRGWATITAAPPSNGIARQVPKGWRAVSVP
FT                   ALLPTGLAPGDDVLAMTDLTTVAGTVLSTTVRGGKGLRADGGHTRGTPAADSSTAIDDR
FT                   PTGTETGEAARPSATAVRGGEGQVTVAVPTTDAETLLEADRARIVVEPGETTHEFDAVS
FT                   LLERDGTAIRKVTLTEPILEALDNDALGLEVFAVRRDDIGETCDAGETDRTDDETGHAD
FT                   ATAGEWQFDPDPSAIAVGVEAFLLGTDGSAVDADPDPDAAPRDGDRRSIEVAY"
FT   gene            362006..363262
FT                   /locus_tag="Htur_0342"
FT   CDS_pept        362006..363262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59243"
FT                   /db_xref="GOA:D2RUV0"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59243.1"
FT                   /translation="MTMLALEMIGAIDLLGTALQSGDAFGGSTTVEWTRTALLGILGYG
FT                   LLAGVGALTVAFGYRGATVRKSPHGAAVLAGLALPSGWLVLEALRRGEVVVDSPLVHYT
FT                   SGSYLLGLVAAGALAATGGYRLGDHLACGVYDVTELETDGSAADLVRSAGLAVAVALPE
FT                   SIDDAEGYPAVDDAVKRKLAGRQLRFPNDLTLPELRSRLEARLESDFDIGYVRAELSED
FT                   GAVEAVSVGDRTHGISPSLGPDRVAVAVAGDPPARASTGDPVEVWTDGDTRQFVATGTL
FT                   RASTGPITTLLVDADDAEAFDPGQRYRLTTRPETPSAGHALVAAIRTGDETVTATTAED
FT                   GGPLESEFAGWVPGRVLAIERDDEIVSLPADKDPLEAGDTLYVFGTPDELEASPSDADD
FT                   STLEADADEPPEATPQTVD"
FT   gene            363391..364347
FT                   /locus_tag="Htur_0343"
FT   CDS_pept        363391..364347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppd:Ppro_3281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59244"
FT                   /db_xref="GOA:D2RUV1"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV1"
FT                   /inference="similar to AA sequence:KEGG:Ppro_3281"
FT                   /protein_id="ADB59244.1"
FT                   /translation="MSELRGAAETAVRQCLALESQESCAIVTDDDRVPIGEALYEVASE
FT                   ITDDAVIVRYPPGETHGSEPPEPVAAAMAGADVVLAPTTKSLSHTRARTEANEAGARVA
FT                   TLPGITEDVFTTGLDADYESIAAHCEDVRAQVADADEVRVTTPAGTDITFGIGDREWLS
FT                   DTGIVHEAGQMSNLPAGEVFVSPETADGTFVVDGTMRPHGLLEEGQRLTFEVEDGLVTQ
FT                   ISDDEIRETVEGAAEDVGDAAYNLAELGIGTNVAVTDLVGSVLLDEKAGGTVHIAIGDN
FT                   AGIGGETEAPIHLDGILREPTVYADGESIDLPTATDA"
FT   gene            364506..365087
FT                   /locus_tag="Htur_0344"
FT   CDS_pept        364506..365087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0344"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59245"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59245.1"
FT                   /translation="MRDTREYDIQGIELVDDRYTVEQGLIRNKYRALDAGGNTVLKGKQ
FT                   KMFKLKEEFPFTDGDGNEVFTVKAGGIMDVAGNYVLSDAQTGEDLVALDNDYSLLRDTW
FT                   TIRDATTEEKLAEINSRGAMVTLARNVVPFGEWIPHKYEITDAEGAHVGSISGRISLRD
FT                   RYDITIDDASTVPKEPIVAAAMVIDAIQGN"
FT   gene            365204..365857
FT                   /locus_tag="Htur_0345"
FT   CDS_pept        365204..365857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0345"
FT                   /product="Uncharacterized Zn-finger protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59246"
FT                   /db_xref="InterPro:IPR012041"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV3"
FT                   /inference="protein motif:COG:COG1326"
FT                   /protein_id="ADB59246.1"
FT                   /translation="MSEIPDRVPTPCPSCSPDLETVHEVLTEGGGTLTVRCSECSHVHK
FT                   IQPEREREVTLDVVVSQGGESFTANVTTPEDETVEVGDEFILETEEVLSTVRVTSVELD
FT                   GQKRREEASVEDIETVWTREVDNVAVNVTVHPQDGSRDDSRSVTVHVPGDYEFEVGEVE
FT                   QFGDDEFEIDAFVVRNDAAGYDRDRYEMEGDSVPAKDAKRIYAYDQQTSAWSAW"
FT   gene            365977..366642
FT                   /locus_tag="Htur_0346"
FT   CDS_pept        365977..366642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0346"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: mca:MCA2831 protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59247"
FT                   /db_xref="GOA:D2RUV4"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV4"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADB59247.1"
FT                   /translation="MFRNFGSDSESDPDDYEAARERMVRTIASRVDDDRVLEAMESVPR
FT                   HAFVPPDRRDRAYEDRPLPIGDGQTISAPHMVAVMADLLGLDSGDEVLEIGTGCGYHAA
FT                   VTAELVGDEAVATVEYSAELADRAREQLAELGYDGVDVRTGDGREGWPEHAPYDAAYFT
FT                   CATAELPDPVADQVRPGGTLLAPIGSGFQTLVEATKRGDGRLERTEHGGVRFVEIRGQ"
FT   gene            366718..367467
FT                   /locus_tag="Htur_0347"
FT   CDS_pept        366718..367467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0347"
FT                   /product="Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; KEGG: rpa:RPA0376 putative L-isoaspartyl
FT                   protein carboxyl methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59248"
FT                   /db_xref="GOA:D2RUV5"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV5"
FT                   /inference="protein motif:PRIAM:2.1.1.77"
FT                   /protein_id="ADB59248.1"
FT                   /translation="MDPAVLREDMVDGLESAAKDVLHDEVVAVAMRDVPRHEFLEDDRS
FT                   AYADREHEVLGTRVLAPSTAARLLQALALEDDHEVLIVGAGVGYTAGVVAEVVGETNVH
FT                   AVDISRPLVVEARQNLARAGYEGVLVDRRDGADGLPEYAPFDRVLLEAAAVEPPRALLE
FT                   QLTDDGRLVFPRGTQRQRLEAVSADGRRSQFDPVSFAPLLVEGEQSGAVERNRTAREDR
FT                   EYAVRRAESRRGWEQDWIEWEESIGSQ"
FT   gene            complement(368049..370151)
FT                   /locus_tag="Htur_0348"
FT   CDS_pept        complement(368049..370151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0348"
FT                   /product="response regulator receiver modulated GAF sensor
FT                   protein"
FT                   /note="PFAM: Bacterio-opsin activator HTH domain protein;
FT                   response regulator receiver; GAF domain protein; SMART:
FT                   response regulator receiver; GAF domain protein; KEGG:
FT                   rfr:Rfer_1825 response regulator receiver modulated
FT                   diguanylate cyclase/phosphodiesterase with PAS/PAC
FT                   sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59249"
FT                   /db_xref="GOA:D2RUV6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV6"
FT                   /inference="protein motif:PFAM:PF04967"
FT                   /protein_id="ADB59249.1"
FT                   /translation="MTKPITVLIVDNEPGFADLAGEMLERERDAIVAEAATNATAALEI
FT                   LEQREIDCIVSDYEMPQMTGLELLERVREGDPDLPFILFTGRGSEEIASEAIAAGVTQY
FT                   LQKESGKEQYALLANQITNAVSQYRTETELRESERRYERTLTTLHETTRDLMRASTKRE
FT                   IYQSAVDTAGEILDVPVAAAYTFEPTNGILVHAASIRESRELVDPEMQFEQGEGHVWEV
FT                   FSEGESAYYGDVTRDADTKTLSRSELIVPLGTHGVLVAGTEDVDGFDETMTELLHILAA
FT                   NTEAALDRAEREQLLRDHDRTLTQQNEELTRLNHTNEIVREINHGVAQASTRTEIETTV
FT                   CERLADTERYCFAWIASSDDEPSEPTAWAGIDAAFIDRVRDDGECAPELSLVAETLETG
FT                   RVQIVRNVLEADGWDRRRKEALTYGYQTILAVPLTDTERQYGVLLVHVAGVDSVGDSEL
FT                   EVLGELGETIGHAIRSVERTRAMLTDSRLELELAVHDSRLLLNRFAEYVEGAVTIEGII
FT                   ERDDDVVMFVSAPDTADLTPLEEWASLETVSIVSEGDDEILFEVTVTSSPILEILRTFD
FT                   VQLRTATARNGSTTLVLEVPQRVETRSLVEAIREGYPETELEARRETTSTRSARQLDTH
FT                   LEERLTDKQFEALQAAHYSGFFEWPRESTGEDLADALDITPPTYHYHLRAAERKLVTLA
FT                   FNGQSS"
FT   gene            complement(370261..370680)
FT                   /locus_tag="Htur_0349"
FT   CDS_pept        complement(370261..370680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59250"
FT                   /db_xref="GOA:D2RUV7"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR021671"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59250.1"
FT                   /translation="MAPRNTKQTGDETEAQIIAALIEHGYSVSIPFGDNDRYDLVVDTE
FT                   HGLRRVQCKTGWIEDEVVRFKTASKTTVDGTVALTDYDGDIDAFAVRCKDTDELYWVPL
FT                   EAAGRKNTYLRLTEPEIDHPNVKRAERYRFERRLP"
FT   gene            complement(371042..371114)
FT                   /locus_tag="Htur_R0003"
FT                   /note="tRNA-Asp2"
FT   tRNA            complement(371042..371114)
FT                   /locus_tag="Htur_R0003"
FT                   /product="tRNA-Asp"
FT   gene            complement(371427..371499)
FT                   /locus_tag="Htur_R0004"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(371427..371499)
FT                   /locus_tag="Htur_R0004"
FT                   /product="tRNA-Asp"
FT   gene            371817..372044
FT                   /locus_tag="Htur_0350"
FT   CDS_pept        371817..372044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0350"
FT                   /product="RNA polymerase Rpb5"
FT                   /note="PFAM: RNA polymerase Rpb5; KEGG: RNA polymerase
FT                   Rpb5, N-terminal domain containing protein; K03013
FT                   DNA-directed RNA polymerase II subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59251"
FT                   /db_xref="GOA:D2RUV8"
FT                   /db_xref="InterPro:IPR000783"
FT                   /db_xref="InterPro:IPR020609"
FT                   /db_xref="InterPro:IPR035913"
FT                   /db_xref="InterPro:IPR039531"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV8"
FT                   /inference="protein motif:PFAM:PF01191"
FT                   /protein_id="ADB59251.1"
FT                   /translation="MVDVSQHELVPEHTVLDEDALEEVLDEYAIDRTDLPKIKRSDPAL
FT                   PDDAEIGDVIKIVRNSRTADQAVVYRLVVE"
FT   gene            372045..373619
FT                   /locus_tag="Htur_0351"
FT   CDS_pept        372045..373619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0351"
FT                   /product="RNA polymerase beta subunit"
FT                   /note="PFAM: RNA polymerase beta subunit; RNA polymerase
FT                   Rpb2 domain 2; RNA polymerase Rpb2 domain 3; KEGG:
FT                   predicted protein; K03010 DNA-directed RNA polymerase II
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59252"
FT                   /db_xref="GOA:D2RUV9"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUV9"
FT                   /inference="protein motif:PFAM:PF04563"
FT                   /protein_id="ADB59252.1"
FT                   /translation="MSMELNREKRREISREYFAKERIAEHHYRSFNAFLNRGMQEVVDE
FT                   KETIDTDIGDKEGEEPVHVKLGDVRVVTPRVREADGSEELLYPQEARLRNITYSAPVFM
FT                   EMSIVKGEEGDQRVVDSTETKIGRMPIMVGSDKCNIAGFSDEELVEIGEDPADPGGYFI
FT                   VNGSERVLMTSEDLAPNKILAEYDTKYGDEIQVAKTFSQRRGYRALVLCERNREGLLEV
FT                   SFPSVSGSINFVTLVRALGLESDEEIVHKVSNDPEVVKYMLENLEAAEVQSEEEAIEEL
FT                   GKRVASGQGKNYQLKRANYVIDRYLLPHLHEDGVEEEDVRINKAHYLCRMAEACFELAL
FT                   GRRDSDDKDHYANKRLKVSGDLMKDLFRTALNKLARDVKYQLERANMRNRNLSVSTVVR
FT                   SDVLTERLEHPIATGNWVGGRSGVSQLVDRTDFMGVLSHLRRLRSPLSRSQPHFEARDL
FT                   HATQWGRIGPSETPEGPNCGLVKNFAQSMELSQNVEDEQELKRELASMGVEGIPGLEGI
FT                   ERSTADD"
FT   gene            373626..375455
FT                   /locus_tag="Htur_0352"
FT   CDS_pept        373626..375455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0352"
FT                   /product="DNA-directed RNA polymerase subunit B"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase subunit B;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2, domain 5 protein; RNA
FT                   polymerase Rpb2, domain 4 protein; KEGG: rpb2; RNA
FT                   polymerase II core subunit; K03010 DNA-directed RNA
FT                   polymerase II subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59253"
FT                   /db_xref="GOA:D2RUW0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019969"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW0"
FT                   /inference="protein motif:TFAM:TIGR03670"
FT                   /protein_id="ADB59253.1"
FT                   /translation="MSSQQRDAKVYVNGSLVGTHPDPHELAEQIREARRIGDVSEMVNV
FT                   SVKERTREVIVNADAGRARRPLLVVEDGEPRISQQEIEALQDGDLEFDDLVDHGYVEFI
FT                   DAEEEEDILVAVDEEHLTEKHTHLEIDPSLIFSIGAGMIPYPEHNASPRITMGAGMIKQ
FT                   SLGLPSANYRIRPDTRQHLLHYPQLSMVKTQTTEQIGYDERPAAQNFVVAVMSYEGFNI
FT                   EDALVMNKASVERALARSHFFRTYEGEERRYPGGQEDRFEIPSQDVRGARGEDAYNHLD
FT                   EDGLVNPETTVDENSVLLGKTSPPRFLEEPDDMGGLSPQKRRETSVTMRSGESGVVDTV
FT                   TLMEGEDGSKLSKVSVRDERIPELGDKFASRHGQKGVVGHLAPQEDMPFTEEGVVPDLV
FT                   LNPHALPSRMTVGHILEMIGGKLGSMEGRRVDGTPFLGEDEDELRDGLEDAGFDSAGKE
FT                   TMYSGVTGEKIEAEIFVGVIFYQKLYHMVSNKLHARSRGPVQVLTRQPTEGRAREGGLR
FT                   IGEMERDVFIGHGAAMTLKERLLDESDREFIHICANCGMSAVENVEQRRVYCPNCDEET
FT                   DIHEIEMSYAFKLLLDEMKALGIAPRLELEDAV"
FT   gene            375459..378383
FT                   /locus_tag="Htur_0353"
FT   CDS_pept        375459..378383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0353"
FT                   /product="DNA-directed RNA polymerase subunit A'"
FT                   /note="KEGG: predicted protein; K03006 DNA-directed RNA
FT                   polymerase II subunit A; TIGRFAM: DNA-directed RNA
FT                   polymerase subunit A'; PFAM: RNA polymerase Rpb1 domain 1;
FT                   RNA polymerase alpha subunit; RNA polymerase Rpb1 domain 3;
FT                   RNA polymerase Rpb1 domain 4; SMART: RNA polymerase I
FT                   subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59254"
FT                   /db_xref="GOA:D2RUW1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012758"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW1"
FT                   /inference="protein motif:TFAM:TIGR02390"
FT                   /protein_id="ADB59254.1"
FT                   /translation="MQNSTPKDIGQLSFGLMQPEEYREMSATKIITADTYDDDGFPIDM
FT                   GLMDPRLGVIDPGLECKTCGKHSGSCNGHFGHIELAAPVIHVGFTKLIRRLLRGTCREC
FT                   SKLLLTEDERDEFREDITESRKLGRDLNDVTKAAIRQARKKDRCPFCGEIQYDIDHEKP
FT                   TTYYEVQQVLTSEYSQEIAAAMQGEGEDAERMSPDELAEQTDIDLMRVNEILSGSFRPR
FT                   ESQRKAIEKALDIDLTEEDTNKLMPSDIRDWFENIPDEDITVLGIDPEKSRPEWMILTV
FT                   LPVPPVTARPSITLDNGQRSEDDLTHKLVDIIRINQRFMENREAGAPQLIIEDLWELLQ
FT                   YHVTTFMDNEISGTPPARHRSGRPLKTLSQRLKGKEGRFRGSLSGKRVNFSARTVISPD
FT                   PTLSLNEVGVPDRVAKEMTQTMNVTERNLEDARRFVSNGPEGHPGANYVRRPDGRRLKV
FT                   TEKNCEQLAEKVEAGWEVNRHLIDGDIVIFNRQPSLHRMSIMAHEVVVMPYKTFRLNTV
FT                   VCPPYNADFDGDEMNMHALQNEEARAEARVLMRVQEQILSPRFGENIIGAIQDHISGMY
FT                   LLTADNPRFNETQALDLLRATRIDELPEPSGIDDEGEPFWTGYDVFSELLPDDLDLEFT
FT                   GTVGEPVVIEDGQLIEGTIAEDEVGEFGGEIVDTITKVYGNTRARIFINEVSTLAMRAI
FT                   MHFGFSIGIDDETIPEEAQSRIDETIEDANDRVEELIEAYENNELESLPGRTIDETLEM
FT                   KIMQTLSRARDNAGNIADEHFDDENPAVVMANSGARGSMLNLTQMAGAVGQQAVRGERI
FT                   NRGYEDRTLSHYEQNDLSAEAHGFVENSYTSGLTPREFFFHAMGGREGLVDTAVRTSKS
FT                   GYLQRRLINALHELETQYDGTVRDSSDTIIQFEFGEDGTSPVKVSSSDENDIDVDQIAD
FT                   RVLDTEFESEAAKNEFLSTSSELTNLSEHADNRLVEGSEVTSDD"
FT   gene            378376..379569
FT                   /locus_tag="Htur_0354"
FT   CDS_pept        378376..379569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0354"
FT                   /product="DNA-directed RNA polymerase, subunit A''"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, subunit A'';
FT                   PFAM: RNA polymerase Rpb1 domain 5; KEGG: similar to
FT                   AGAP004703-PA; K03018 DNA- directed RNA polymerase III
FT                   subunit C1"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59255"
FT                   /db_xref="GOA:D2RUW2"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR012757"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW2"
FT                   /inference="protein motif:TFAM:TIGR02389"
FT                   /protein_id="ADB59255.1"
FT                   /translation="MTNVEYDVTDDMIAVVEDTDLPRRLKDKVYATLEDRGDATVQNAD
FT                   DLAKAVEARYLDTRVDPLDPVGTVSAQSIGEPGTQLTMNTFHYAGVAEIDVTQGLPRLI
FT                   ELVDARKTPDTPMMTVYLEDEYAAEREKAHEVVWNIEATKILALGDVSTNVADMRVQIS
FT                   LNEDTLRERMITPEEVAEIIEDNLGVSTVQQGTEIQFGPEEPSYRDLLQLVEELRDITF
FT                   KGIEEVSRVVIRREELEEGEQFVLYTEGSAFGDVLEIEGVDASRTTCNNIHEIHRNLGI
FT                   EAAREAIIEETNNTLAEQGLDDVNVRHLMLVADMMTNRGEIESIGRHGISGSKESVLAR
FT                   AAFEVTVNHLLNAAIHGETDELDGVTENVIVGKPIKLGTGDVDLRMGSTKSSGSQAD"
FT   gene            379573..380013
FT                   /locus_tag="Htur_0355"
FT   CDS_pept        379573..380013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0355"
FT                   /product="NusA family KH domain protein"
FT                   /note="TIGRFAM: NusA family KH domain protein; PFAM: KH
FT                   type 2 domain protein; KEGG: nam:NAMH_0269 transcription
FT                   termination factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59256"
FT                   /db_xref="GOA:D2RUW3"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010212"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW3"
FT                   /inference="protein motif:TFAM:TIGR01952"
FT                   /protein_id="ADB59256.1"
FT                   /translation="MGVTLDDDARQYLAAFEDVTDVSGQDCLVTDAPTADADERLIVVV
FT                   SSGRMSEAIGPEGRTVRQYEERVGKPVRLVEDADDPEAFVANALSPAAVYNVTISENDD
FT                   TVAYVEVADEDRGVAIGSNGRTIEAARTLAQRHFGIDDVQLI"
FT   gene            380366..381877
FT                   /locus_tag="Htur_0356"
FT   CDS_pept        380366..381877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0356"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pcr:Pcryo_1015
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59257"
FT                   /db_xref="GOA:D2RUW4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW4"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADB59257.1"
FT                   /translation="MMDTSDSAAKGSDVDELGIAPENGWNALYLDGEWVPASDRDLIDV
FT                   ENPATRTTLTTVPSGTEDDVDEAYAIAEEAQAEWAERPPQERAAVVSEACELLGEYADD
FT                   LATLFAVECGGVQLKADFEIQLAQGTMDVGAGLAMRDGGRRKDSVTPGKENLLVREPAG
FT                   VVGVITPWNFPLYLTSRVVAPAIALGNSVVVKPDEHTPLTGGLVLARAFEEAGLPDGVL
FT                   NVVPGYGHEIGDHFSGHPVPSVMSFTGSSEVGRGVGQRAVGSYTEPALELGGNNAHVVL
FT                   SDADLERAIDAGAFGSFTHQGQECISINRHLVHESLYEEYVAGLADRAEQLPIGDPLEE
FT                   GSLVGPVINESQRDKIVGFIEESVERGATVEAGGSHDGLFVEPTVLSGVTNDMPAACNE
FT                   HFGPVAPVIPFETDEEAIRLANDTEYGLSGSVHSTDVARARDVADAMETGMVHINDQPL
FT                   NDEPHVAFGGVGASGMGRYNDEWILETLTSVKWISIQREPREYPY"
FT   gene            complement(381944..382597)
FT                   /locus_tag="Htur_0357"
FT   CDS_pept        complement(381944..382597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59258"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59258.1"
FT                   /translation="MATTNTVFVTTSWFKRLVGLSHEESRSSDELPTVDDRIGFDGSLE
FT                   DSEVIGRSPLSYIAAGESVSSFVGKQIANKLAEYGLEDIEPDEWYPLEIPLAMLYDMRD
FT                   EYGGVRMRNMGQNVPEHVEFPPELSEVDNALRGIDTAYHQNHRGSEIGSYEFQQEGPNE
FT                   GIMICENPYPCEFDKGLIKGVAKKFANNPVEVEEVGDQCRSDGDHRCEYRVEWL"
FT   gene            382971..383399
FT                   /locus_tag="Htur_0358"
FT   CDS_pept        382971..383399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0358"
FT                   /product="ribosomal protein S23 (S12)"
FT                   /note="TIGRFAM: ribosomal protein S23 (S12); PFAM:
FT                   ribosomal protein S12/S23; KEGG: 40S ribosomal protein S23;
FT                   K02973 small subunit ribosomal protein S23e"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59259"
FT                   /db_xref="GOA:D2RUW6"
FT                   /db_xref="InterPro:IPR005680"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022863"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW6"
FT                   /inference="protein motif:TFAM:TIGR00982"
FT                   /protein_id="ADB59259.1"
FT                   /translation="MANGKYAARKLKKDRQNQRWSDSDYARRARGLREKSDPLEGAPQG
FT                   RGIVLEKVGIEAKQPNSAIRKCVRVQLIKNGKQVTAFCPGDGAISFIDEHDEVTIAGIG
FT                   GAKGRAMGDLSGVNYKVDKVNGVALKELVRGNAEKPVR"
FT   gene            383402..384010
FT                   /locus_tag="Htur_0359"
FT   CDS_pept        383402..384010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0359"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: RPS5; Ribosomal protein S5, component of
FT                   cytosolic 80S ribosome and 40S small subunit; K02989 small
FT                   subunit ribosomal protein S5e"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59260"
FT                   /db_xref="GOA:D2RUW7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005716"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR026018"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW7"
FT                   /inference="protein motif:TFAM:TIGR01028"
FT                   /protein_id="ADB59260.1"
FT                   /translation="MAAEDQPDPDAPAGGADVGAQLFGTWEIDEIAYEDPSTERYITVT
FT                   PVAHTAGRHASKQFKKSQISIVERFINRLMQTEENTGKKQKTLNHVRDAFELIHERTDE
FT                   NPVQVLVTAVENAAPREETVRLKYGGISVPKAVDVAPQRRVDQALKFLAEGVYNDSFKT
FT                   PTPVEEAIANQLVGAANYDVQTYAVSQKEEKERVAAAAR"
FT   gene            complement(384077..384256)
FT                   /pseudo
FT                   /locus_tag="Htur_0360"
FT   gene            complement(384321..386324)
FT                   /locus_tag="Htur_0361"
FT   CDS_pept        complement(384321..386324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59261"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59261.1"
FT                   /translation="MKPKFNATGEGLVIVDPIERRQSLLQTDTTLSLRSTTASKIPYPM
FT                   DSAVEITTSGFEIPSSNVVYVRDSNWTLIDEVRLNEQLDLPEKEYIIDISTGIKLYATA
FT                   KSEVHIQNKDRNTVIRFGERTPITVSARSHHTRPATTISTTAEPTDVMEAISMFGSALK
FT                   TTGSERSYPTLRGHPPTITVDNELNIPDELTLPNTGVRIEVPPTLRHAFVVAPLAYYLA
FT                   ATVVPGPKPRLVTDSGFSCSLESKDGFNSVVSRVIRQIFLLDCIVRTEGTTPIQLYERQ
FT                   ELESVLDFNIEDIYGQPLENQLEAYLSTPFAEIASYIPEWRLKTDLKEIPEHVEFLPFI
FT                   VAGLGTISVEQDASAPTQIAFDGTSANTTDESETVTASQSWHDGHTEITSTILLSAFEN
FT                   GIDQTPRDGPLEIVVVCNDQAMRDELLSVYSSYGNRDDLPFDITVFQDLTTAELEEVLS
FT                   RKSDFLHYIGHIDSDGFRCSNGQLDAANVEKIGAKAFLLNACQSHDQGLQLIEAGSISG
FT                   IVTLDTVANKEAVRIGRTISNLLNYGYSLYAALDITRMETNLGNQYHVIGDGKKTITQP
FT                   ETGLWSIYAIDTDSGSATISIKSYSGNQEQKGSLFIPYLNSIDEYYISPNQIGPISVEK
FT                   PQLVKFINSDRFPVLLDGQFQWSNEIKLSDLH"
FT   gene            386464..387093
FT                   /locus_tag="Htur_0362"
FT   CDS_pept        386464..387093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0362"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bph:Bphy_3958 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59262"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59262.1"
FT                   /translation="MNSSLYLTTFNSICPPSIDRAVLLKSTSRLFVVHPTLSLPDLGTD
FT                   QARIAATVRQADFDRSILDQIDDSYDLLVLDWELETPDARGVLDAFRQRAPETQILALA
FT                   DDVPTDDPVDRGADELLVRPLSDGKLQSTIERLLLQQAYETAMDDFFRLSTERALLESE
FT                   LQAGLDVTDRYRSVVSDLYDARERTAAIRDELSSDEFDQALRQLLE"
FT   gene            complement(387375..389438)
FT                   /locus_tag="Htur_0363"
FT   CDS_pept        complement(387375..389438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59263"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59263.1"
FT                   /translation="MKPKFEPVDDGLEIIDPIERHRYRLTTHERVDPEPVDPDRIQFPV
FT                   TTAVEVTTGMITLPTNESVYVRDEDGAMISEVRPNKQSSLPADTYTLDLSGPLKVYACV
FT                   ESSVYIYSDSERTYITLDESTRATIGARSYHRRPAGTITTSSEPSDIMQAVSIFGSALK
FT                   STTPERSYPTLRGHPPIVELGNELRIPSEFDRPDTGIQIEVPPDLGSIFVVTPLAYYLG
FT                   AEVIPGSEPRLTTENGFKFDLDENEGLELTVERLLKRLFFLDCVVRTEGTTPLPLYERQ
FT                   LTEPKLGFSLENVYNMDLVDQIEEYLAVDHSIVESVFPKWRATTELQGTSSEVEFLPFL
FT                   ADSLALVNIVEGQTQETENQVRAIEGFTRGSSTRNTNPNRGISKGSISNTLPDTTTIKQ
FT                   DWDCLGTTSITGITPLSAFYNSIEQTPREDPIEIIVICNDSEMREELKAVNDIYGNRAE
FT                   LPFDVSIYYNTTVEQLRSVLSKEIDFFHFIGHIDDEGFQCTDGKLEITAVDETGVDAFF
FT                   LNACQSHDQGLQLVKAGSIGGIVTFSDVINNSAVKIGETIARLLNRGFPLHAALDIARK
FT                   DTLVGEQYCVVGDSKTTIAQSETAPPFVCLIDSEGDTFSMTIDTYTKNEFRKGSLFIPY
FT                   LDGEDDYFLVSGRSGDYSLDRDQLADFLEMEMFPVVTNGNVVWSENVDVDRL"
FT   gene            complement(389515..390240)
FT                   /locus_tag="Htur_0364"
FT   CDS_pept        complement(389515..390240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59264"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59264.1"
FT                   /translation="MFSRKGWGSGSGDEQFTAELSQLKRRGASVLVVGAVRTEQRQEVS
FT                   RRLLGQATSQPRRRVLVSTTGEGHAMSHLADSYDTKSATTALVNYETQSRGATAANSGS
FT                   QSMESVSMQADDSPTTAATLADLGIAVSNAIEEFERNDTSLAPGELRIAVDSLVPLLEE
FT                   YGAERVFKFAHLTNGRARDADGMIHYHLPLDRDSDVVSVLSPVFDIVIELRDRNGVFQE
FT                   RWTINDGDHSSGWLSIEQS"
FT   gene            complement(390371..391141)
FT                   /locus_tag="Htur_0365"
FT   CDS_pept        complement(390371..391141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59265"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59265.1"
FT                   /translation="MNIRVQGPGPTSPFLSARDLFETEHDLSLPVDVQLRDDPDERTWA
FT                   GHYDDRHVLNISRQAASSAMARELALHEFAHMARYEQEHPSHTQSTEEVLFLALAGKSV
FT                   ERRKLSHCYQIANHMKDIYADDITLAVGPGEKLLSFLESSLAMAVADRPETPSRPGFER
FT                   LSASSDPEITAVNAAFALALAERHDLVADDHRLYDLAHAAAMDAPDVDFEGFKRRFREL
FT                   ARDPDSSTYRQVLVDATRAYVSSPESRADGPAAD"
FT   gene            391479..393665
FT                   /locus_tag="Htur_0366"
FT   CDS_pept        391479..393665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0366"
FT                   /product="translation elongation factor aEF-2"
FT                   /note="TIGRFAM: translation elongation factor aEF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: translation elongation factor EF-2 subunit; K03234
FT                   elongation factor EF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59266"
FT                   /db_xref="GOA:D2RUX3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004543"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX3"
FT                   /inference="protein motif:TFAM:TIGR00490"
FT                   /protein_id="ADB59266.1"
FT                   /translation="MGRRKKIVQECERLMDEPENIRNIAIAAHVDHGKTTLSDNLLAGA
FT                   GMISDETAGEQLAMDTEEDEQERGITIDAANVSMTHEYEGTNHLINLIDTPGHVDFGGD
FT                   VTRAMRAVDGALVVVDAVEGAMPQTETVLRQALREGVKPTLFINKVDRLISELQEGPEE
FT                   MQQRLLSVIHDVNELIRGMTQDMDDIEDWTVSVEDGTVGFGSALYKWGVSMPSMQRTGM
FT                   DFGEIMELERNDKRQELHERTPLSDVVLDMVCEHFPNPVDAQPRRIPRIWRGDAESELA
FT                   EQMRLVNEDGEVVFMVTDISMDPHAGEIASGRVFSGSLEKGQELYVSGTAGKNRIQSVG
FT                   IYMGGEREEVEEVPAGNIAAVTGLKDAIAGSTVSSTEMTPFESIEHISEPVITKSVEAQ
FT                   NMDDLPKLIETLRQVSKEDPTIQININEDTGEHLISGQGELHLEVITQRIEKNQGIPVN
FT                   TGEPIVVYREQPQNPSDEVEGISPNRHNRFYISIEPMTDELVDTIKLGEASMDMPEQER
FT                   REALQEAGMDKDTSQNVEHIHGTNILIDDTKGIQHLNETMELVVEGLEEALDNGPLANE
FT                   PVQGTLIRLHDARLHEDTIHRGPAQVIPATREAVHKALIDGKIKILEPMQDARIDVPND
FT                   HMGAASGEIQGRRGRVDDMYQEGDLMVVEGIAPVGEMIGFASDIRSATEGRASWNTENA
FT                   GFEVMSDSLQRDKIMEIRERKGMKLELPPSIDYL"
FT   gene            complement(393923..395302)
FT                   /locus_tag="Htur_0367"
FT   CDS_pept        complement(393923..395302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0367"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: geo:Geob_1192 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59267"
FT                   /db_xref="GOA:D2RUX4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX4"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADB59267.1"
FT                   /translation="MIDRTYLRENPEEVREALDDRGADVDLEEILEIDERWRELKAKGD
FT                   ELRHERNQITQQIGELVAEGKDEEREEAIEQSKELKSEIEDIETEADELKDELDERLLE
FT                   VPQIPDESVPKGVDERHNVEDRRWGFDDSHDLPEEVTPHYELGEELDIIDEQRAAKTTG
FT                   SGFYFLKGAGAQLEHALIQFMMDLHREQGYVDLFPPIPVKSSSMRGTGQLPKFADDAYR
FT                   LGGSNEEDYEDEDLWLCPTAEVPVTNMYADEILLQDDLPLKHQAYTPNFRREAGEHGTE
FT                   TRGIVRVHQFNKVELVNFVEPEESYDRLENLLDEAEEVLRQLGLPYRILELCTGDLTFA
FT                   SAKTYDIEVWAPGDDMDDGPEEGGRWLEVSSASNFEDFQARRAGLRYRPERHESAEYLH
FT                   TLNASGLAIPRVMVAILEYYQNEDGTVTIPEPLRPYMGGKEVIEGHEKVGESALGAGER
FT                   E"
FT   gene            395443..396657
FT                   /locus_tag="Htur_0368"
FT   CDS_pept        395443..396657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0368"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; PhoU family protein;
FT                   KEGG: dps:DP2627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59268"
FT                   /db_xref="GOA:D2RUX5"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX5"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ADB59268.1"
FT                   /translation="MDPLEGETSSVSIEYEPVSVKDVLVEMKDTAELLIDLSYSAVLHR
FT                   NADLAREVLRLEERMDVLKLRARMSLMMAVRKPADAEELAPVLGIVAAADEISDAAGDI
FT                   AKIVLEEMGLPEAMRAALPEAAETLVRGVVDPDSVYADRTLQDIDLESETGVRVIALRR
FT                   GDEWLLNPGPNTTVKSDDVALLRGPDPSIGDVCEVLTGDVYESPSVDDPGIPDLERAVD
FT                   TIIHMKNLSELAVDLAYSSVLFDSAELAEEVRNLEVEVDAMQSRFEAWTLRAAADADDP
FT                   VVLRGLIRLGTSTEAISDAAINISEGVLRDIDVHPVVQLAVQESDEIITRVEVAPGSDL
FT                   DGIAVTGGVPDVESTMSVIAIRRPGEGWLLVTDADAELQGGDVLISKGTRTSAAAFEEL
FT                   AQVQP"
FT   gene            complement(396671..396811)
FT                   /locus_tag="Htur_0369"
FT   CDS_pept        complement(396671..396811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59269"
FT                   /db_xref="GOA:D2RUX6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59269.1"
FT                   /translation="MIGFLRTMPIRKGSETLVPFALAAVIAILGALIYLELVTVLLEYA
FT                   G"
FT   gene            397190..398299
FT                   /locus_tag="Htur_0370"
FT   CDS_pept        397190..398299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0370"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bam:Bamb_5638 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59270"
FT                   /db_xref="GOA:D2RUX7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB59270.1"
FT                   /translation="MNAALKPLDEQVIVITGASSGIGLTTARMAADRGASVVVAARSED
FT                   ALRRLTAEIQADGGEATSVVADVSDREDVREIRRVAEDTYGGFDTWVNGAAVSIYGELD
FT                   EVPIEEMREQFDVNVWGLLYGSLEAADHFKSRGREGSIVNVGSIVSERAVLLQGSYSAS
FT                   KHAVKGFTETFRMELEREDAPVSVTLIKPSAIDTPFPDHAKNHMDEEATLPAPVYAPET
FT                   VARAILHAAENPQHEVTVGAGGKGMTVLGQHAARLLDKIMEVVFYRQQRTGDPPRPDAP
FT                   DGLEEPTGSLDQRGGYEGHVAETSLYTSLRQRRELPGSSALGAGLVAGAVYAGYRLLRD
FT                   GRDSSGDVAAPEPESKADAEERRLEMPRL"
FT   gene            398487..398837
FT                   /locus_tag="Htur_0371"
FT   CDS_pept        398487..398837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0371"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_1897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59271"
FT                   /db_xref="GOA:D2RUX8"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59271.1"
FT                   /translation="MVVVTLFVVSLLTGGLGIYVGARLVVGEEEPLHAILTGLLGAVVW
FT                   VVGGVLLGWIPLLGQLLVLAVYAWMVDRRYPGGWRNAVSIALIAWLVTLVVLTVLASLG
FT                   FATYEAIGVPFA"
FT   gene            complement(398860..399222)
FT                   /locus_tag="Htur_0372"
FT   CDS_pept        complement(398860..399222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0372"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: ret:RHE_CH02237 CrcB family integral
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59272"
FT                   /db_xref="GOA:D2RUX9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUX9"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADB59272.1"
FT                   /translation="MTLEPALIVGVGGAVGAVLRHWVSLRLASERFPWPTLAVNVLGSF
FT                   GFALALFAGASESTLRLVGTGICGAFTTFSSFSVETVGLYERGDRRLAVANAAGNLALS
FT                   LAAIGLAWMIVDVGPL"
FT   gene            complement(399219..399632)
FT                   /locus_tag="Htur_0373"
FT   CDS_pept        complement(399219..399632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0373"
FT                   /product="Camphor resistance CrcB protein"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   nam:NAMH_0645 CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59273"
FT                   /db_xref="GOA:D2RUY0"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY0"
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /protein_id="ADB59273.1"
FT                   /translation="MTATHPLVRLETLALIAVGAFAGAILRFLAMGLGSDVRAILAVNA
FT                   LGSAALGFIVYEAEYAGLLGRRSRLFLSTGLLSSLTTYSTFAIQTALAADPVVLAAIVA
FT                   GNYGFGFAGVLAGRTVARRLGAVFEPGTGGETA"
FT   gene            399814..400725
FT                   /locus_tag="Htur_0374"
FT   CDS_pept        399814..400725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0374"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: cvi:CV_1005
FT                   cation efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59274"
FT                   /db_xref="GOA:D2RUY1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY1"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADB59274.1"
FT                   /translation="MATDGAESGQRGFTRAAVVNVLGNAVKIVVEGAAGWLFGSVALLA
FT                   DAAHSIADLIASLVVLIWGRSSYDEPDDTHPHGHDRIEPLTALFVGAIIALLGLNLLYE
FT                   SAQGILHGVEVEFSPLLLGALAFSIADMYLVYRYTTVINEALNSTALKALAVDCLNDIY
FT                   TSFAAVVGVVGVLLGQPLLDPIAGGFVSLLVVYQGVEIGRENVDYLIGAAASPEQRAEI
FT                   VDALRSHPDVQGVHDLTVFYDGTVLEVEVHVEVDGDMPFRQAHDVESELVDRVRDLEDV
FT                   GDAHVHLDPSGIGEWKERLDEH"
FT   gene            complement(400810..402162)
FT                   /locus_tag="Htur_0375"
FT   CDS_pept        complement(400810..402162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0375"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   acp:A2cp1_0532 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59275"
FT                   /db_xref="GOA:D2RUY2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031623"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB59275.1"
FT                   /translation="MSGATRRRRGERPARVFPWTVSGLGLLSAGVFVAWCLWFRSLLTL
FT                   TAVVVGFVTVCLPALALVWAGVRLARSGIGADRYGRVLQWCFGGGIGFLAVNVFVMAFF
FT                   PWNGLVGNVAWAQFSLNAGAGTGFLVGYVEARAIQREVEATAAVARAEQREEDRELLTY
FT                   LSDLLRHEVLNSTQIIGGHATLLLEDADDSTRASLEAIDRESEELTDVIDDIRAMLNAT
FT                   QPSAGGTVVTLENVLADEVTDLERRFDDVEVEALVPADVRVEGNEGIGWIFANLLENAV
FT                   EHNDSEPPRVEVTVATTDETVTVRIADNGPGIPTPVRETLFDRRSDNHGLGLYLVRILA
FT                   TRYGGHVDLAETGPDGSVFAVTLSRAGDERAAEPPNRRRTDSDPAAAGGGRRLAAGSRR
FT                   RRGSRRRRETWTAVSDGDGPHRSGTDRDETERSRRDRFGRGRLRRGTVLKR"
FT   gene            402311..403237
FT                   /locus_tag="Htur_0376"
FT   CDS_pept        402311..403237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0376"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ade:Adeh_2964 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59276"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB59276.1"
FT                   /translation="MTTEIGTVHEVTAGDCADCYYIDTGMYDTPEYGAVYIVDDDRPAV
FT                   VETGLGTNHELILEALAELGIDREELAAIAVTHIHLDHAGGAGYLAEACPNADVYVPSP
FT                   GAGLLVDPTRLVEGTKAAVGDQWEFYVEPKPIVKDRIVELEDGDVVDLGTHELRVHEAP
FT                   GHAFHQVVFEDPANDAVFTGDAAGIWVPETEEIRETSPPSDFHLEQCLEDVETLKAIDP
FT                   DVLLYTHFGPREVGDDAADALEAYATVLEEWVATVAEKRAELEDDAAVIDYFAGSEEMA
FT                   DVWGERKAGAEAAMNARGVLGYLDERD"
FT   gene            403416..405374
FT                   /locus_tag="Htur_0377"
FT   CDS_pept        403416..405374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0377"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   gem:GM21_2093 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59277"
FT                   /db_xref="GOA:D2RUY4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB59277.1"
FT                   /translation="MDWRDAEREYEDETIRETTLGRMFERSAERNANRPAQRYKGGIYD
FT                   RSLTDSVIRSATPGEFRPLSYAEMRDIVRKLSAGFHDLGVDAGDRVGLFANTRMEWAQC
FT                   DFALLSAGAAVTTVYTSSSPRQVEYLLDDPDADAVVVENAALLERVLEVEDELDLEFVV
FT                   SIDELDGYDDRDDIYTLDEVYDRGAETFDLEAYEKRLDAVELDDLASLIYTSGTTGQPK
FT                   GVQLTHWNFRSNVNAIRKRFARRPDRDDDVPTLDEESLAMSYLPLAHVFERTAGHFVLF
FT                   ASGSCIAYAESPDTLQEDFSAVGPTTATSVPRVYEKIYDGIREQASESGAKRKIFEWAT
FT                   DVGVAYQRADSPGPILRAKQALADKLVFSTVREALGGEIDLLISGGGSLSPELCQLYHA
FT                   MGLPIFEGYGLTETAPVVSTNPPDATKIGTIGPALSNVDLRVDETVADQEAFDGDPGEV
FT                   GELLVAGPNVTEGYWNKPGATQGAFTEDDDGERWFRTGDIVHLRPDGYLEFRDRLKQLI
FT                   VLSTGKNVAPGPIEDAFAASEVVEQAMVVGDGEKFIGALLVPNTAHVREWADEEGIDLP
FT                   DDPEAMCDDERVREHVQEEVDRVNQQFEKHETIKRFELVPQEFTEENDMLTPTMKKKRR
FT                   VILERFEDRVDRIYADD"
FT   gene            405553..407433
FT                   /locus_tag="Htur_0378"
FT   CDS_pept        405553..407433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0378"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   sodium/hydrogen exchanger; KEGG: dol:Dole_2292
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59278"
FT                   /db_xref="GOA:D2RUY5"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY5"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADB59278.1"
FT                   /translation="MTAAEGGNLLVLIATIVGLGVISQLLSARFRVPSVLFLIISGVAI
FT                   GPEGLGLLTLDSFGESGLSTIVGLSVAIIVFEGAFHLKATKIKEAPSAVLRLTTVGAAI
FT                   AFLGTAAAVRFFLEANWDIALLIGALLIATGPTVITPILKVVPVRDRVAATLETEGIVN
FT                   DVTAAILAVVLFKAMTVRELTADIYLQLFAERLGTGLLVGVVVAAIVWAVLQYVDISPD
FT                   DAPRNARLLTLAGAIVAFGTADYVFAEAGVAAAATAGLILGNANLPYEEEIEAFKGDVT
FT                   LLVLSFVFITLAALLEFDQLFALGLGGVAVVVAVMLVLRPLLVFLSTRGDRFTFEETVF
FT                   MSAVGPRGIIPASVATLFAIRLQTEAPPTNAAGADLLVGTVFLVILVTVVLEGGFARQI
FT                   AEKLDVIPMRVLIIGGGRVGRSLAERLEARGENVVIIEADLATLEALRNEGFTARRGDG
FT                   TDVDMLREAGAENAKTVVAATGDDDANLLVAQLAKSNFDVENVIARANNPSNASAFEDL
FT                   GVQTISAAESTAWAIDNQIERPALSNWMSELGRSGDVQEIEITDDALVGERIVDIGDDL
FT                   PNGVLIALVSRNGTSEVPTPDVELQRGDHITLIGRNEAVSEAIERYGKPV"
FT   gene            complement(407484..408101)
FT                   /locus_tag="Htur_0379"
FT   CDS_pept        complement(407484..408101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0379"
FT                   /product="MgtE integral membrane region"
FT                   /note="PFAM: MgtE integral membrane region; KEGG:
FT                   spe:Spro_2531 MgtE integral membrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59279"
FT                   /db_xref="GOA:D2RUY6"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY6"
FT                   /inference="protein motif:PFAM:PF01769"
FT                   /protein_id="ADB59279.1"
FT                   /translation="MSAGGDVRRGDEPTEELPQENLPREWTVSGIVSTLVPLLLALSIL
FT                   QMVSGTVLESFEEQLLSYPSLLVLVPVMIGTAGNLGSIMCARLSTQLHLGTLEFSPTNP
FT                   DIRANVGAVIGLAATVFVMLGFAAWGIGNVLGGNLGLGTLLVITIVSGMLLAVWVVLVS
FT                   TVSVYLSYRFGYDPDDTTIPIVTNVCDITGVLILFGVVTVVL"
FT   gene            complement(408098..408697)
FT                   /locus_tag="Htur_0380"
FT   CDS_pept        complement(408098..408697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0380"
FT                   /product="MgtE integral membrane region"
FT                   /note="PFAM: MgtE integral membrane region; KEGG: similar
FT                   to solute carrier family 41 member 1"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59280"
FT                   /db_xref="GOA:D2RUY7"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY7"
FT                   /inference="protein motif:PFAM:PF01769"
FT                   /protein_id="ADB59280.1"
FT                   /translation="MQRPQTFRQMLGHDSAIDVYRQALPVILVSLVAGLFSGTLLGTET
FT                   MREGIESVPGILLLLPAFLATRGGVYGSLGARLSSGLHQGLIDPHFEWNDRLRNAIVAS
FT                   FCNGMIVSVFIAVLSWGVSLVLGREANLLELLVVLIVAALLSAFAMLGVLLTVIFKGYR
FT                   RGLDPDNVIGPVVTTVGDVFGVAFLLIGIWVAGVVL"
FT   gene            409007..409726
FT                   /locus_tag="Htur_0381"
FT   CDS_pept        409007..409726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rlt:Rleg2_2060 conserved hypothetical conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59281"
FT                   /db_xref="GOA:D2RUY8"
FT                   /db_xref="InterPro:IPR014470"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY8"
FT                   /inference="protein motif:PFAM:PF10028"
FT                   /protein_id="ADB59281.1"
FT                   /translation="MTDSSNDEFDPTAPDQREIGREMVDDSTGLGSVMAHAYRGEIDRV
FT                   GTWRQRLDESTTWAVTLMAAILTWAFSSTDNPHYILLIGIVVVTIFLGIEARRYRDYDV
FT                   FRSRARVIQENLFANALDPSQGTESHDWRAELSRDYRRPTLKVSLYEALANRLQRVYLA
FT                   LLSVLLVAWVFRITAFAPRQDWLTTAGIARIPGIAVVVVVGVFYVVLLGVTFWPRERHA
FT                   KGEFREGDSDDWKETDR"
FT   gene            410199..410405
FT                   /locus_tag="Htur_0382"
FT   CDS_pept        410199..410405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59282"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59282.1"
FT                   /translation="MSESEVTRWEYETLRPPRDETQKEAEDPKAELNQLGAEGWEFVET
FT                   IDYEGGGTKYLVFKRPAQSGDSV"
FT   gene            410402..411418
FT                   /locus_tag="Htur_0383"
FT   CDS_pept        410402..411418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59283"
FT                   /db_xref="GOA:D2RUZ0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59283.1"
FT                   /translation="MTDETDISTANTMRERSGESRIKLWLLLRANRFLVSSILTSAVFV
FT                   AFVIAVAALDPPFSRQIESGDMIDTMFSTMITVIVTGTTLVVTIGQLVLSQENGPLGDQ
FT                   RERMSSSMDVRDFTEELIGSPSPADPSEFLRQIIGITAQRTTALRESIDKNDNENLREE
FT                   VDEFAESVTGNADTVRDQLEGAQFGSFDVLFAALNFNYSWKIFQVERLANEHEESLNEE
FT                   ERGLLDDLKTALSLFGPAREHVKTLYFQWALIDLSQMILYAAVPALAVAGIMVAIVDAG
FT                   TFPGSTLGLDHIILIVGGAFAVTLVPFMLFVSYVLRIVTIAKRTLAIEPLILRESQR"
FT   gene            411861..412130
FT                   /locus_tag="Htur_0384"
FT   CDS_pept        411861..412130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59284"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59284.1"
FT                   /translation="MLPPRRSSFRTTVTALHPGTTVRYHYRTGDSLATVVEYTDRVVTF
FT                   VGPDCDGRFTHDQIDRLLEDDRLEVVLDDETHLPDDEPELLRSD"
FT   gene            412551..413255
FT                   /locus_tag="Htur_0385"
FT   CDS_pept        412551..413255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0385"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59285"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59285.1"
FT                   /translation="MTNDNSNRFDLGRRPVLSGLAGALATGAVGTAAASGDDHHAGADD
FT                   TAQDESADQPPEAVPNEFENDIEILNYALTLEYLEAVFYTRGLRNIDESALEQQFEGWG
FT                   PIQDQVVNRLRVVRDHEITHAEVLGQTVESLGGEPAQSPEFDFGTAVQDPAEFIATAAL
FT                   LEDIGVSAYAGAAPYIDTFELVPPALSIHSVEARHASFLRELNGEIGFPEAFDDPRSRS
FT                   EVLELASGFIVE"
FT   sig_peptide     412551..412655
FT                   /locus_tag="Htur_0385"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.675 at
FT                   residue 35"
FT   gene            complement(413382..413954)
FT                   /locus_tag="Htur_0386"
FT   CDS_pept        complement(413382..413954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59286"
FT                   /db_xref="GOA:D2RUZ3"
FT                   /db_xref="InterPro:IPR024464"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59286.1"
FT                   /translation="MSASEGQSDDPTLDDLYEQLEALEETVDTVDERTEVRRTRRLVNR
FT                   LSHNAMVGRVITRFTRKDKAEAFVGSVVIGMPMLVEDGVFEIGRFLAAHPPLFAVNVAL
FT                   AVALVVGILYVADFREIQIHNPYFGVIPRRPVWVCGIAFATAAVLMTLWGRIAWDEPWV
FT                   NLCQVSVVFTAMALGGSLGDILPGESE"
FT   gene            414211..415902
FT                   /locus_tag="Htur_0387"
FT   CDS_pept        414211..415902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0387"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="KEGG: gsu:GSU0910 aldehyde:ferredoxin
FT                   oxidoreductase, tungsten-containing; PFAM: aldehyde
FT                   ferredoxin oxidoreductase; Aldehyde ferredoxin
FT                   oxidoreductase; SMART: Aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59287"
FT                   /db_xref="GOA:D2RUZ4"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ4"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ADB59287.1"
FT                   /translation="MKHVQGPLCTIDVGERTMRTEEIDDLLESFLGGRALGTKLAHDRI
FT                   PFDVDPLGADNRLFFATGPLQHSTMSFTGRMSATGVSPLTDGLLSSNAGGFLSRNFTGT
FT                   GYSAVEVTGASDDLVIVHVTDEGVEFEDVPDLEQATVPETCEYIEAEHDLESEHTVVVG
FT                   PAGENGVRFASMMTSKERAFGRGGLGAVLGSKNVKAITFDGDSTNEVEIPPVQMEIHGE
FT                   AAQADHPMKESGTTSVTEYANMVEALPTRYFSELSFEGAEGIGGDAVAEKKYKKGTCSA
FT                   CAFACKLPTRDEESGLETEGPEYETVMAFGSNSGIDDVVDVMKSNKLCDEYGLDTISAG
FT                   DAVAAYLASEDEFGNADLIHETVEKIAYREGVGDTLAEGIDEFHDELGVENWTVKGMEF
FT                   PAHDGRTLNGQGLSFATSNRGADHMYAEFYPYEYPLVDADDAFDKSGLEGKPPKVIELE
FT                   NINAIKDSAVLCKFSRDFITEERFETLLDTDYEDLLELGGTVVSLERHFNNQRGFDRSD
FT                   DTLPYEIPDFEAGLEEYYDERGWEADGTVPAERFEGTDFGATPADD"
FT   gene            complement(416172..416555)
FT                   /locus_tag="Htur_0388"
FT   CDS_pept        complement(416172..416555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59288"
FT                   /db_xref="GOA:D2RUZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59288.1"
FT                   /translation="MSAPLLAVIVGIPLAWHLGLTAVTYWDAGRVGLEPPKKWAAITFC
FT                   IPLFGFFIYLFERSELSYEPDDDPYKGNNFNIHPSRADDAPLPSRGDDRLSVDEDSWDE
FT                   TDATDESRDRVERRDGDDGRDAR"
FT   gene            complement(416993..418129)
FT                   /locus_tag="Htur_0389"
FT   CDS_pept        complement(416993..418129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0389"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: maq:Maqu_1145 3-ketoacyl-CoA thiolase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59289"
FT                   /db_xref="GOA:D2RUZ6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ6"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADB59289.1"
FT                   /translation="MSQTPVVVEAVRTPQGKEDGVFADVRSEALSVPLIDEILAETGLS
FT                   GDEIDDLMWGCAQQRGEQDNNLARVIALLSELGESVPATTINRWCASSMQSVISASDAI
FT                   AAGNRDAIIAGGVESMSRVPMGGGFEHINPKLAELYDLGDLQMGMTAEKVAEEYGISRE
FT                   EQDEYAARSQQNAAEATESGRFDDEIVPIETEDGTVSEDEGIRPGTTKEKLAELPTVFK
FT                   DDGTVTPGNASQISDGASALLITSEAFAEEHDLEILAEVGQNNVAGVDPTVMGIGPVPA
FT                   TKGLLERNGRDIDEYDLVELNEAFASQSLYSRDELGIDPEIFNVNGGAIAIGHPLGASG
FT                   ARLPVTLINELQKRGGGLGLATLCVGFGQGAAIEFDVN"
FT   gene            418409..419059
FT                   /locus_tag="Htur_0390"
FT   CDS_pept        418409..419059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59290"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59290.1"
FT                   /translation="MDEDGLDASRFAADDESPSRADTDPESDASADDADGDGPMPNVPD
FT                   PDPQENDVPEDVQKYARFTKMNGAQYDRVNEFLRDRTYVTAREWAIARLCSDFRTETGV
FT                   EMTKIGENLPELVPFMTDTYTPQAVNQARASFEEKVRKAGATFLYGAMCDFFTAEELDD
FT                   VMYESTEVAKFLLEVEGVDLSVEEELEAEERISSVMREVREASEELREREDEE"
FT   gene            419400..420374
FT                   /locus_tag="Htur_0391"
FT   CDS_pept        419400..420374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA4287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59291"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59291.1"
FT                   /translation="MVTNTTDAANRADDNNGNRSAEKTTGASVTRRRALQMGGAVGAGS
FT                   LLGVVGLGADTAAADCDRPDNIVHLDYDDYDSWDEVYRMSNGDPDNLTLVSSPTASGES
FT                   ALQLRIREGDHWGLSTHYDFDDGLFELNGRVNFALNTDWAMTGRDAPTNCRLWNCAIAR
FT                   GEGSAGGGSPDGTNGWSNRMYVTTKDSDPEGPFHLLSNTYHMGTDGVGDHDYLVDGEEH
FT                   AVGSPEIKPGVWYEFEYYVRVNTITQGEANRDGVVRYRLDDDLIFERKDLQFTEDLDDN
FT                   IIDTTGPVGHYGGRYTAPQNLYAYYDDHSMALNGKLEFGFGGC"
FT   gene            complement(420423..420938)
FT                   /locus_tag="Htur_0392"
FT   CDS_pept        complement(420423..420938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59292"
FT                   /db_xref="UniProtKB/TrEMBL:D2RUZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59292.1"
FT                   /translation="MTTDDASRWTELLEDAAAIAEEFRDNGWDAVVLEPEVVAPVDRED
FT                   RAGLDVGVSGEEYALVESLIARGDVTVSAADVYYRPPESDDEARIALVVERDEDTETSV
FT                   FVPLRYDLEDEATRSMFEAALASKEVFVHVTPAEAAGATTDDEPGNWVSFSHDDPSLFL
FT                   EEADVRNW"
FT   gene            complement(421019..421750)
FT                   /locus_tag="Htur_0393"
FT   CDS_pept        complement(421019..421750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0393"
FT                   /product="Lipoate-protein ligase A-like protein"
FT                   /note="KEGG: pfl:PFL_5620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59293"
FT                   /db_xref="GOA:D2RV00"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV00"
FT                   /inference="protein motif:COG:COG0095"
FT                   /protein_id="ADB59293.1"
FT                   /translation="MRVLRGRAATIETDREASRRLLSTAADGEPAVRVWTPHRQIAFGR
FT                   RDRRLEGYDRARERARARGFPPVERDVGGRAVAYDGETTLAFARAEPVADFRRGTDDRY
FT                   ERATAAVEDALRSLAGGLEPVRGEPDDSFCPGTHSLSLAAGDGEEGGTERHRKVVGIAQ
FT                   RVRQDAAVVAGIVLVANRGRLATVLESVYGALEVPFDPDTVGSVADAGGPPDPSVVRAA
FT                   VEDALVGDASTVTVESVEASE"
FT   gene            421816..422805
FT                   /locus_tag="Htur_0394"
FT   CDS_pept        421816..422805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59294"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59294.1"
FT                   /translation="MAVTLPAELLSQYQRFSLYNSPYPAHDEGCAVDLYPGTLRDGRTS
FT                   AAPSPVSGTVRETRDVKAPPKPYAPEHDHLILIDCDGPGDLEGLTARILHVQPTVEAGD
FT                   RVERGDSLGELVRAGFFAPWVDNHLHVGLRRPDQNPHRASGSIPLEVGVELRPLEWDGT
FT                   GTVVATGATYAVLDAPAHPDPGEAFVGVRADDGGGPNGVDRKTQGVFRDDERAELSRTT
FT                   RRSSSERRSDGGVLDGGLPHYDGGGLLASETDGERVVSLNGDRLGVARGRTITWDDVVV
FT                   TVNDEPITGLSLFCARDADFGAKLICPDRPLEIGQRVRVRVRPSLERE"
FT   gene            complement(423062..424489)
FT                   /locus_tag="Htur_0395"
FT   CDS_pept        complement(423062..424489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0395"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /note="PFAM: proteinase inhibitor I4 serpin; SMART:
FT                   proteinase inhibitor I4 serpin; KEGG: scl:sce1266 serine
FT                   (or cysteine) proteinase inhibitor, clade B (ovalbumin),
FT                   member"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59295"
FT                   /db_xref="GOA:D2RV02"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV02"
FT                   /inference="protein motif:PFAM:PF00079"
FT                   /protein_id="ADB59295.1"
FT                   /translation="MTADRRRVLALTGALLAGAAGCLGDVSDAEDPENGDEPANGAEDG
FT                   ALFDDYDVPDFPRLDLTTDPDLESDRLAEQIRGNVAVSFDVLARLREETPGENLFFSPY
FT                   SISVALAMTYAGARGETAAEMADALRYDLEGEALHAAFGALEGEFEQRNEDGRDVETPA
FT                   WADEGGEGDGSEGDEDDLGFQLSSANAVWRDEGHDFDDAYVQLLEAYYEAGDHLADFSG
FT                   SPEAAREEINAWVEERTNDRIEDLLPEGSIDEWTRLVLTNAVYFLAAWEHDFDPAETEP
FT                   ATFTSLDGSETEVDLMHQSQELRYAEIDGHQLVELPYANGDTSMIVVLPAEGEFESFEA
FT                   SFGVDELAIMLEETSQPKVDLALPKFGIESKFSLVETMRELGMERAFDNDADFSGMVED
FT                   DDSDLYVDDIIHQSFVEVDEEGTEAAAATAVVMEDTAVADRVKMTVDRPFLFYVRDRPT
FT                   ETPLFVGRVVDGEQLQN"
FT   sig_peptide     complement(424415..424489)
FT                   /locus_tag="Htur_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.944 at
FT                   residue 25"
FT   gene            complement(424560..425009)
FT                   /locus_tag="Htur_0396"
FT   CDS_pept        complement(424560..425009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ses:SARI_00270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59296"
FT                   /db_xref="InterPro:IPR025494"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV03"
FT                   /inference="similar to AA sequence:KEGG:SARI_00270"
FT                   /protein_id="ADB59296.1"
FT                   /translation="MTDEPEYDIDFRERPAEYEIGRGEEGVFKVEPYKSELLPLWSYAD
FT                   EAAARESATAIYERYERYRADDDFPGMDMARKYLQMGYTRAMRYAKYPGGRKYDEDGEE
FT                   RRPQRWADREKRAAALAFERYWERVREDDAYRRAKESHRDRRRTA"
FT   gene            425169..425660
FT                   /locus_tag="Htur_0397"
FT   CDS_pept        425169..425660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0397"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dma:DMR_39900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59297"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV04"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADB59297.1"
FT                   /translation="MPDDMRTVMEQFDDLEEVLQYFIDEHQEFLSWIGTRVDNVGDGTM
FT                   TLSLPYDEKLSNTRPDTEPGERTDIHGGIAATLIDTAGGLVLRTKLDEPFGARIATINL
FT                   NVNYLRPATGDLSATADVIRVGRSVGVSEITVESTTLDGETKEVATGQGAYRIFRSETE
FT                   "
FT   gene            complement(425738..425899)
FT                   /locus_tag="Htur_0398"
FT   CDS_pept        complement(425738..425899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59298"
FT                   /db_xref="GOA:D2RV05"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59298.1"
FT                   /translation="MNARRLRSMYVLGILLNAVALIYAAMDGAILFAVTFGIVMLYLGV
FT                   RYWMVSTA"
FT   sig_peptide     complement(425822..425899)
FT                   /locus_tag="Htur_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.816) with cleavage site probability 0.337 at
FT                   residue 26"
FT   gene            complement(426050..426628)
FT                   /locus_tag="Htur_0399"
FT   CDS_pept        complement(426050..426628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0399"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   psp:PSPPH_2384 isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59299"
FT                   /db_xref="GOA:D2RV06"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV06"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADB59299.1"
FT                   /translation="MHLEPDNTAVVVVDMQNGFCHPDGSLYAPGSETVIEPIADLVERA
FT                   REAGAQVIFTRDVHPPEQFEDAHYYDEFDQWGEHVLEGSWEAEIVDELPVEDADHVVEK
FT                   HTYDAFHETELEGWLNARGIDDLVICGTLANVCVLHTGGSAGVRDFRPIMVEDCIGAIE
FT                   DEHKEYAIDHADWLFGEVREMDDLEFANT"
FT   gene            426752..428491
FT                   /locus_tag="Htur_0400"
FT   CDS_pept        426752..428491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59300"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59300.1"
FT                   /translation="MRTPPTRVAAALAVVAVLALVAVAAGAPPLFADESPDGADRADDP
FT                   TTAGTVGYVEGYWYDDELPVDEGDDAVVEDDELEAVVYRSMARVEKIRGLTFEDDVPVE
FT                   VISREEFRSQDSAFVDSNESQQRVRNVTYEALFMVDAETNATTELQSIYGGSVEGYYEP
FT                   STDRIVIVSNTPDRLELDEIVLGHELTHALQDQQFDLSNYERATIDQEAAENGLIEGDA
FT                   VSVETEYERRCGTDWECLPDDDSDGEAPSNWGLYLTLYQPYSDGPAYVDHVRESGDGWS
FT                   AVNDRYEDPPTSSSTVIHREDRDPVDVSVADRSNESWQPLEVGGEVATETVGEGAMVAM
FT                   FANGAFEPGQSSVLSREAVLGDDPTTFDYNQSYTDGWAGDELVTYASADADGNASADTG
FT                   YVWETEWRSADHAREFAGAYVELLENHGADPVEDRQDTYAIDDEGYPGAYFLERDGETV
FT                   RIVHAPSVAALDGLSAGAAPTGEDTIERVDGTDSAEEEDEDTAEADDSLPGFAVPGTGA
FT                   AVAIALLAARARARRLGAEREAGSDSSPRTAPVTDASPPSTPAEPDAGLEWADGGRSAR
FT                   GRA"
FT   sig_peptide     426752..426850
FT                   /locus_tag="Htur_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 33"
FT   gene            428531..430039
FT                   /locus_tag="Htur_0401"
FT   CDS_pept        428531..430039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59301"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV08"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59301.1"
FT                   /translation="MQRSRLAVLALVGLVLLSGCTVPGSPDRFDTSREPGYVGDYAHDD
FT                   TFAFDDEETLTESQLEAVKYRAMARIEVVRGLKFERDVDLEVISRSEYRDRRGDPSSAS
FT                   AFTNELWRGAFVVDGETDVNEEMDALYGTSVQGYYVNDRIVVVADDTDEIRINRETLVH
FT                   ELVHALQDQRFGLDRDGETIDERRAELGLIEGEANYVPHRYAERCGDEWQCLPVTPAPA
FT                   EVGADRPFNVGLFLSIYAPYAEGPSFVDHLRERGDWAAVDDAHDDYPASTSQVIHPDRY
FT                   PDDRPVDVDVPDRSSDEWEPITTGSEIRTETVGEATLFGALWANDVVERSITEGATELS
FT                   PYNYSHPATDGWAGDTFTAYRDADGERTGHVWRLAWESEADTQEFADAYRTLLESRGAE
FT                   SVDAGTDTYRIPDGDPFEGAYRVTVTDDVVTIVGAPTVDDLEGVHAPRVNASAAVAPLT
FT                   GPTAVTAPAAPNGPTATAAPPVPLRAGTATASTPATAATASADE"
FT   sig_peptide     428531..428590
FT                   /locus_tag="Htur_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.362 at
FT                   residue 20"
FT   gene            430070..431227
FT                   /locus_tag="Htur_0402"
FT   CDS_pept        430070..431227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0402"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   dma:DMR_20580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59302"
FT                   /db_xref="GOA:D2RV09"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV09"
FT                   /inference="protein motif:PFAM:PF01729"
FT                   /protein_id="ADB59302.1"
FT                   /translation="MSNPFGTVPAEAVLEGRATDAYFERTRATLEHAGKNPHVVAEVTA
FT                   DQFPTGSFDVFTGVKDVATLFEGRNVDVDALPDGQLFDGGPVLRIEGPYLEFAELETSL
FT                   LGFLSQPSGFATAALEARLAAPDSLVLSFGARHVHPSITATVERAALLAGLDGFSHVAA
FT                   GEILEREPGGTMPHALMFCFGEGNQDEAWTAFDEAVGEDVPRIALVDTFWDEKSESLLA
FT                   AETLGEDLDGVRIDTTSSRRGDFRHIIREVRWELDARGREDVDIFCSGGLTPETIRPLR
FT                   DIADGFGVGSHITGADSVDFSLDIVETEGEPISKRGKLSGVKEVYRTPDGGHHVALADR
FT                   EGPDDGEALLEPLVRGGEIVREFDLDEASDRCLADADAVGFDSSE"
FT   gene            complement(431238..432290)
FT                   /locus_tag="Htur_0403"
FT   CDS_pept        complement(431238..432290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0403"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: mxa:MXAN_5027 M48B
FT                   family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59303"
FT                   /db_xref="GOA:D2RV10"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV10"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADB59303.1"
FT                   /translation="MSEVPPRLSLGLRMIATTLVLAALTVAFLAVIWRIVSAIVSLFAL
FT                   PSIVAGVVALGLLAVFVAVQLGQISTVAVHADARPVPSDAYPTLDAAVTRAAAQLDVPA
FT                   PTIAVSDRSAPEALVVGFRPENVHLVLSRGTIDALEDAELEAVVAHELAHVANRDAMVM
FT                   TAAATPIVLARTLKSKAGRLAFARPDETESPAAFLRRSPGKFVGYTLMGIAAAPQRLLW
FT                   FLFGGISVVTLALATPAVAVFSRGRELAADRTAATATGSPAALASALRTLEDGIAETPA
FT                   EDLRAASSISSLSILPLDRPEADATAAATVGSAPRGDRAGRLQRWLFATHPSTERRLEV
FT                   LADLEATEAA"
FT   sig_peptide     complement(432222..432290)
FT                   /locus_tag="Htur_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.429 at
FT                   residue 23"
FT   gene            complement(432488..433387)
FT                   /locus_tag="Htur_0404"
FT   CDS_pept        complement(432488..433387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59304"
FT                   /db_xref="GOA:D2RV11"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV11"
FT                   /inference="similar to AA sequence:KEGG:ebA6266"
FT                   /protein_id="ADB59304.1"
FT                   /translation="MSSTLIARKDFEDAIRSKLVWAVMGVFLFLMALVAVSASTQDLSE
FT                   VEPTQLIVTVTNIGGLLFIPIVSLIVGYMAIVGERQSGSLRVLFGLSHSRWDVFVGKFV
FT                   SRLGVVFVATLLTVVLTVGMAVAMFDSVPLGTYLGYSALTILLGLAFAAIAVGVSAMAS
FT                   SRMQAMGGAIGSYVVFSLIWHPLVAGVHYLLEGSMPGLEAPEWYFFLLRLNPLDAYRQV
FT                   SSELADQFIWGIIGMENIVEDVPDAAFENPDTLLLSNRVSGELPFYLSDWFAAVVLLTW
FT                   IVVPLAIGYWRFDGADLN"
FT   sig_peptide     complement(433274..433387)
FT                   /locus_tag="Htur_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.455 at
FT                   residue 38"
FT   gene            complement(433384..434424)
FT                   /locus_tag="Htur_0405"
FT   CDS_pept        complement(433384..434424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0405"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rfr:Rfer_3201 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59305"
FT                   /db_xref="GOA:D2RV12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV12"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB59305.1"
FT                   /translation="MAAIETRNLTKRYGDEAALEGLELSVDEGEVFGFLGPNGAGKTTT
FT                   IDLLLDFIRPTDGSATVLGHDAQDETDAVRDRVGILPDGFDLWERSSGYRHLEFALASK
FT                   GGSESPEALLDRVGLDRADAERPVGDYSKGMAQRLAMAMALVGDPDLLILDEPSSGLDP
FT                   HGIRTFQEIIREEAADGTTVFFSSHILGQVSAVCDRVGILDDGDLVTDDTIAGLRERSG
FT                   VSSSLVVDVAEEPVVDLGEIDGITDVTVRQDGRLRVTYADPAAKALAIHRLVDSGATIV
FT                   DFDVEEPTLEDLFTAFTGTDADSVRTGESSDGSGRASHPTTDGGARIDSSGSDRATVDA
FT                   ETGVDR"
FT   gene            complement(434695..435504)
FT                   /locus_tag="Htur_0406"
FT   CDS_pept        complement(434695..435504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC1399 sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59306"
FT                   /db_xref="GOA:D2RV13"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59306.1"
FT                   /translation="MLDGRKESVVSHRSGRSPPGTARRAVQTAITSPFRPQTYLNLLYL
FT                   LLAFPLGLLYFVFLVTGVSLGVGLLVILVGAPILLAVLLASHVFAAFERASARYLLSVE
FT                   IDSPEYPFLDDEDATDGFRSLLLGRETYKAMGFLVAKFAIGTAAFSMLVMLFTTAITLL
FT                   LTPLYYHNPNVHVGFVNEGEPIQLTPSLQLPWNDLLIGAEFAVTITEWEVTSLPEALAV
FT                   SAVGLLALLLSLAICNGFAWLVGQFSRVLLGSSSRAALEDLQDGLAR"
FT   gene            435784..436140
FT                   /locus_tag="Htur_0407"
FT   CDS_pept        435784..436140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59307"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59307.1"
FT                   /translation="MTAGVDPETEELLTLLEDEYARTIIVETYREARSADALSDACDAD
FT                   PSTVYRRIDRLQERGLLQDQQRLDPNGHHYKVYVASLEHVGIDVTEDGFDVTVEYAEED
FT                   AADTFTRLYEEFSG"
FT   gene            436137..436595
FT                   /locus_tag="Htur_0408"
FT   CDS_pept        436137..436595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59308"
FT                   /db_xref="GOA:D2RV15"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59308.1"
FT                   /translation="MIGTTSATTGGLEAIRGATASVAFRRPTSGRVVSPLGDSPALESS
FT                   PTPDPVQVSVDSVGGSTPVVLAAIVTFFVATVLAVLVTYRFVEGYRRTKARPILWLAVG
FT                   MFLLAPSPMFLRLLAGNVAAIPLSAQLLLTTLSELCGLLVILYAVYTT"
FT   gene            436598..436885
FT                   /locus_tag="Htur_0409"
FT   CDS_pept        436598..436885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59309"
FT                   /db_xref="GOA:D2RV16"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV16"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59309.1"
FT                   /translation="MTLESITAVASALTAVVGLFVAYLAYRGYRRNDSRTMRALAFGIV
FT                   CIAVVPYVILYLADPSLGLTDAQGLLAITLSHTVGLAAIYRTFDRGSSDA"
FT   sig_peptide     436598..436675
FT                   /locus_tag="Htur_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.634) with cleavage site probability 0.404 at
FT                   residue 26"
FT   gene            complement(436997..437611)
FT                   /locus_tag="Htur_0410"
FT   CDS_pept        complement(436997..437611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0410"
FT                   /product="AMMECR1 domain protein"
FT                   /note="PFAM: AMMECR1 domain protein; KEGG: sat:SYN_00073
FT                   putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59310"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV17"
FT                   /inference="protein motif:PFAM:PF01871"
FT                   /protein_id="ADB59310.1"
FT                   /translation="MYICMSQRQGVELSYEDGARAVELAREAVESFVQHGQREQPGSMR
FT                   EAFYERTGAFVRLESTRGRGSLRGCAGGYRSGEQLGHVIVDSAIEAASEDSCGSEVTPS
FT                   ELPNLTVSVCAVRNVLLTDDPLADLELGTHGISIDGGGEGGWLYPTVPVENQWSAREYL
FT                   DRTCRKAGLPPTAWQDDDVVVTLFEGQVFREREADGSIEEL"
FT   gene            437794..438158
FT                   /locus_tag="Htur_R0005"
FT   ncRNA           437794..438158
FT                   /locus_tag="Htur_R0005"
FT                   /product="RNA component of RNaseP"
FT                   /note="Archaeal RNase P as predicted by Rfam (RF00373),scor
FT                   e 105.02"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(438381..439898)
FT                   /locus_tag="Htur_0411"
FT   CDS_pept        complement(438381..439898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH14973 gene product from transcript GH14973-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59311"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59311.1"
FT                   /translation="MADNHENQDGLKRRGYLKGIAATGFGAGALVTGTGRSHADSDGKR
FT                   DVDGDSVYLVFGADSSEADLDSWVEEHEDEIAAASQDSAAQVIQYQDVSQLNVTQQGNA
FT                   VSIAIDGGEATAAQQADQNNTNTQAGSAESVTVEEKTTDWTFTGVGQAYVVFAEEAECR
FT                   EFTGLVVGEDAYQSEQSAEATIDQSQEVDQYNYNSQNTAVAIAENGSRSRAYQRSSQTN
FT                   ENYQHADAVAANIGDGDRQEADASVEQSQTVSQLNVSEQGVAIAIAAGSGSVAEACQVS
FT                   SQGNLNEQVADAAAIDFDSKSLDEATASADMVGSVSEEKLTRSKAGADQSNAQTASADV
FT                   TQVQSVGQENINLQNAAIAVGVDDSQATARQESYQGNFNAQVASAEALNIDKSHRSASA
FT                   VVNGTDTNGDESWAVAYETGDGERSQQVAEVDIDQLQFVEQLNVNEQFGAVAYATDRGD
FT                   AVAEQLNYQVNENVQLTEARATNEGTGDDENGKKKKRKKNGGENQGC"
FT   gene            complement(440192..440584)
FT                   /locus_tag="Htur_0412"
FT   CDS_pept        complement(440192..440584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59312"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59312.1"
FT                   /translation="MERREILRGTGTLVAAVTGVGGASTAAGRHTRPTVQIIRTNEPVQ
FT                   GGQWLNVTARITNHGRLRLQGYARCIVGHDPTEVDNQYVSLASGRSTTVTLGYRTYPVQ
FT                   TTDVFPVRIECENGFDSRTVTVDPAP"
FT   sig_peptide     complement(440504..440584)
FT                   /locus_tag="Htur_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.778 at
FT                   residue 27"
FT   gene            440906..441712
FT                   /locus_tag="Htur_0413"
FT   CDS_pept        440906..441712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59313"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59313.1"
FT                   /translation="MEHELKETDAEPVAVVNFLTQSPVRIAILDRLDETDRLSKTELRD
FT                   EFDVSRVTVQRNLDALEDRDLIRSHVHEYEIRPLGELVADELDATIDTIAFAERIRPFL
FT                   RWFPETALEFDVRALADATVVVSDSTDPYAPVNRHIEAIERADRFRCLLPAIGLPALTV
FT                   AHERVVEHDQRQEIICSPALESTVRSEPEYRDLVADITSHDDCTMRVADSELTYYLGLF
FT                   EEVVQIGVEDDDGIPRALVETEASEIRTWATRTYDCYRERSEPTSL"
FT   gene            441837..441989
FT                   /locus_tag="Htur_0414"
FT   CDS_pept        441837..441989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59314"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59314.1"
FT                   /translation="MSVLTESNASRAGPKVPLETGGEAASDASERWARQDRTQKRVLNN
FT                   VKHSR"
FT   gene            complement(441995..442067)
FT                   /locus_tag="Htur_R0006"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(441995..442067)
FT                   /locus_tag="Htur_R0006"
FT                   /product="tRNA-Arg"
FT   gene            442413..443876
FT                   /locus_tag="Htur_0415"
FT   CDS_pept        442413..443876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0415"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold tRNA/helicase-
FT                   type; KEGG: tryptophan-rich antigen (Pv-fam-a)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59315"
FT                   /db_xref="GOA:D2RV22"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR031657"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV22"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ADB59315.1"
FT                   /translation="MSDIEGVYEDLEADVSLEEFREAVEAKVEQMGGLADEETAAMLVA
FT                   HEIGESEVGGIADIEPGMEEAKFVAKVLSIGDVRTFERDGEDEDGRVVNVEVADETGSV
FT                   RAAFWDEHAEAATEELEEGQVLRIKGRPKEGFSGVEVSVDDVEPDPDTEIDVQVSDTHT
FT                   VEALSLGLSNVNLVGLVLDTDSVRTFDRDDGSEGKVSNLVLGDETGRIRVTLWDEQADL
FT                   ATEFDPGETVEVIDGYVKERDGNLELHVGNRGAVEEVDEEVEYVPESTPIEDLEIGQTV
FT                   DIAGVVRSADPKRTFDRDDGSEGQVRNIRVQDATGDIRVAMWGEKADLDVGPGDEVALG
FT                   DVEIQDGWQDDLEASAGWQSTITVLESDSGSSGGESAADDASNENAGLSAFGGDADGPA
FT                   EEESETSAASSDDARGTTGANADAETDEPTDGEELEFTGVVVQAGDPVVLDDGESTMSV
FT                   ATDADVGLGEEVTARGIVRDGRLEANDVF"
FT   gene            443943..444374
FT                   /locus_tag="Htur_0416"
FT   CDS_pept        443943..444374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0416"
FT                   /product="Transcription factor CBF/NF-Y/histone domain
FT                   protein"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/histone domain
FT                   protein; Histone core domain protein; KEGG: hypothetical
FT                   protein LOC100249348"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59316"
FT                   /db_xref="GOA:D2RV23"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV23"
FT                   /inference="protein motif:PFAM:PF00808"
FT                   /protein_id="ADB59316.1"
FT                   /translation="MNVELPFAPVDTIIRRNAGDLRVSADASKELATRIQEHGSELAID
FT                   AAEQATRDGRKTLMAQDFGVETVVDKDDLELPVAPVDRIARLEIDDRYRVSMDARVALA
FT                   DILEDYADNVARAAATLARHADRRTITEDDIETYFSLFE"
FT   gene            444376..445398
FT                   /locus_tag="Htur_0417"
FT   CDS_pept        444376..445398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0417"
FT                   /product="Histone deacetylase"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   mxa:MXAN_5908 histone deacetylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59317"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV24"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ADB59317.1"
FT                   /translation="MQFGYSETCLAHDPGSRHPESPDRLRAIRERLKKKHGVEYVEADP
FT                   CDLDRLAAVHEREYLESVREFCADGGGNWDPDTSAVEETWDAVCQSAGLACWAVEAALE
FT                   GATGRRTPFSIGRPPGHHAVYDDAMGFCFVNNVAVAAQYALDAYDVDRVAIVDWDVHHG
FT                   NGTQDIFYDRDDVFFVSIHEQGLYPGTGAVDETGEGAGEGTTMNIPMPAGTDDREYLAA
FT                   VEGPISHALTDYDPDLLLISAGFDAHRHDPISRIRLSTEAYALMTDRFRTLADETDAAF
FT                   AFILEGGYGLDVLADSVAIVHETFDGREPIEPDSEFGEKAESALDEVLEAHGLDIDLGD
FT                   "
FT   gene            complement(445455..446939)
FT                   /locus_tag="Htur_0418"
FT   CDS_pept        complement(445455..446939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0418"
FT                   /product="CCA-adding enzyme"
FT                   /EC_number="2.7.7.72"
FT                   /note="TIGRFAM: CCA-adding enzyme; PFAM: tRNA
FT                   nucleotidyltransferase, substrate binding domain protein;
FT                   DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59318"
FT                   /db_xref="GOA:D2RV25"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV25"
FT                   /inference="protein motif:TFAM:TIGR03671"
FT                   /protein_id="ADB59318.1"
FT                   /translation="MSEEDAESDERGTSGTVDERGSSIDDDRDDVESVVAAIREHIEPD
FT                   AEERDRLRTVADRLIERAEAAATERSPEADVMQVGSTARNTWISGDRDIDIFVRFPPEL
FT                   DRETLERYGLEVGHETLPEGHEEYAEHPYVKGTVEGFDVDVVPCFRLESAIEIRSAVDR
FT                   TPFHTSYLQARLDDELTADVRLAKQFLKGIGAYGSDLRTRGFSGYLTELLVVEYGGFRE
FT                   LLEAAAEWQPPVELDPEDHGREHETAKASRNAEVGDADLPFDDPLIVIDPTDPERNVAA
FT                   VCAAENVARLQHYARRFLEAPRTEVFEPDDPDPLDETALRAHLERRGTTPIAVQFEAPD
FT                   LVEDQLYPQLRKSLEGITTGLDDRGFDVFRATTVADDTAVILAELAVANRPAVERHDGP
FT                   PIHVRSHADGFYEAYADDPDAYGPFIDGDRYVTERPREFTTARGFLESDRLFDVGLGAH
FT                   VETALEDEYEVLVGDGIATLCEEFGRELARYFEPRP"
FT   gene            447035..447140
FT                   /locus_tag="Htur_R0007"
FT                   /note="tRNA-Asn1"
FT   tRNA            447035..447140
FT                   /locus_tag="Htur_R0007"
FT                   /product="tRNA-Asn"
FT   gene            447496..447963
FT                   /locus_tag="Htur_0419"
FT   CDS_pept        447496..447963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59319"
FT                   /db_xref="GOA:D2RV26"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR021671"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59319.1"
FT                   /translation="MSDRTTCYENLEQPQKRGHATEAIVRAAFAVRDIPVLVPTSDNEP
FT                   YDLVVEVGGRFHRIQCKTAYRKSEGTVAFETVVTRRRGDGYDREDYHGRAEYFAVYDPI
FT                   NDNRYLIPVSDAADGKMEIRFREPNNGQRVGINWAEDYLLEERLADLRRPR"
FT   gene            complement(447978..448460)
FT                   /locus_tag="Htur_0420"
FT   CDS_pept        complement(447978..448460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0420"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; NikR nickel binding; KEGG: dps:DP0092 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59320"
FT                   /db_xref="GOA:D2RV27"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV27"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADB59320.1"
FT                   /translation="MPIVSVSMPADLIDRLDTHAADHDYTGRSEVVRESARTLLAEFED
FT                   DRLEDRPLAGVVSVFYEFGSQRVERRVTELRHEYDDVVASTDHGHVGEGCGCPSCDTDR
FT                   DPESRSEPGYFVDLFVLEGDLEAMSTFVGTLRAIEAVDRVDYSLVPLDSIGQLRDG"
FT   gene            448570..449775
FT                   /locus_tag="Htur_0421"
FT   CDS_pept        448570..449775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0421"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: rpf:Rpic12D_3382
FT                   cobalamin synthesis protein P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59321"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV28"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADB59321.1"
FT                   /translation="MTDRIPVTVLSGPLGAGKTTVLNHVLTADHGFEAAVVVNDMGDVN
FT                   VDAEHVARQTDLGGDEEIIELSNGCICCRLRGDMLEEVGRLADRLEFDYLLVESSGISE
FT                   PIPVAQTFAMGFEDADFDPTDTYELDTMVTVVNAHSIWESFDAGTALTDQQLEGDAGRV
FT                   PEEVLLDQIEFCDALLLNKCDLVPDDALAEIEAVLERLQPRAEIVRTAFGDVDPTDILD
FT                   TDRFDFERAQASAGWKRELQHDHHHDPQAEHGVTSFAYKRDRPFHPERIAALLSELPAE
FT                   LVRAKGFFWSAGREDVAMGIDKAGTSVRAGPTGQWLATLPEEEREQFFAARPGLKDDWD
FT                   EEWGDRGTSLVFIGRDFDEEPLIDRLEDCLLTDAEMDDDWDAYPDPFGSEDRRELALAD
FT                   ET"
FT   gene            449772..451100
FT                   /locus_tag="Htur_0422"
FT   CDS_pept        449772..451100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0422"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: bch:Bcen2424_5332
FT                   cobalamin synthesis protein, P47K"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59322"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV29"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ADB59322.1"
FT                   /translation="MSVPVTVLCGELGAGKTTLLSALLESTDREIAVLVNDVGSVNVDA
FT                   DLVEARTDLRTGEEVVALENGCICCSLGGELSRSVIQLWKEHDFEYLVVEASGVGEPEP
FT                   IARQFVRGPAGGPYDLDAVVTVVDARRFHDRFAATGAIDDAGVAADDPPERQGPDETGS
FT                   RPLGDLLLEQVEFCDLLVVNKCDLVSETERERVVGILETLQPRAEIVTTEYGSLEPDAL
FT                   LESGRFDLEAAAESAGWKRAIEADADDREGSERDHDDDGHDHEHDHWDGGHESDDGANE
FT                   HDHSDHEHAHPPERYGIEVDTYHRRRPFHPERFEALLADLPAGLVRAKGLCWIAGRDRQ
FT                   AITMSYAGSATTLEVTGRWIASLSEERREQYRRAQDDLSWDEEWGDRETRLALIGRDLS
FT                   MDDLHARLDDCLLTDAEMDADWSTFENAAPTGMGESVTISSDE"
FT   gene            451212..451799
FT                   /locus_tag="Htur_0423"
FT   CDS_pept        451212..451799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0423"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   esa:ESA_02562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59323"
FT                   /db_xref="GOA:D2RV30"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV30"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADB59323.1"
FT                   /translation="MTTDRDDRRSTDDHGHDIIDPLYVGIVTVSSSRAQADEADPDDPG
FT                   GDTIQECFEDAGHEVQERLLVRDDYSAIRTAVRGLVARRDIDIVLTTGGTGVTADDVSP
FT                   EATASLFERDLPGFGELFRMLSWEEVGTRAMASRATAGIAVDTPVFCLPGSTSACETAC
FT                   EELIVPEAPHLAGLATRHRTGANDQTLADYGE"
FT   gene            451862..451990
FT                   /locus_tag="Htur_0424"
FT   CDS_pept        451862..451990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59324"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59324.1"
FT                   /translation="MCHHFESVTELDAEEREDVLESHDEAELEEELTSEELEALTA"
FT   gene            452059..452133
FT                   /locus_tag="Htur_R0008"
FT                   /note="tRNA-Met1"
FT   tRNA            452059..452133
FT                   /locus_tag="Htur_R0008"
FT                   /product="tRNA-Met"
FT   gene            complement(452299..453408)
FT                   /locus_tag="Htur_0425"
FT   CDS_pept        complement(452299..453408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0425"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: lch:Lcho_3206 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59325"
FT                   /db_xref="GOA:D2RV32"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV32"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADB59325.1"
FT                   /translation="MIGDGVGIGIVGLGGMGNLHARSVQELGATVVTGADPVVDQRSQF
FT                   ADEFGARTYETHEELVVDEAVDAVIVTTPNRFHEPIAVAALEAGCDVLVEKPLAHTLES
FT                   AERIAEAAAREDGICMVGFHNRHAASMAMFDKQHARGRFGDLTHVEANYVRRRGVPGPG
FT                   SWFTNPELAGGGALLDIGVHALDLALYALDFPEIVEVSGVTQTAFGTSEEYADPEGFGD
FT                   NWDAEAETYEVDDSVSAFIRCTDGQTISLEAAWATNREESMDFRVRGTQSGAQFTIGDT
FT                   NLQILEAGTAGCDHYADVNMSGDATVTGYVEQDERFLEAVATAGAPETNTVEEALTVQR
FT                   VIDAIYRSSESGRATQLAEPPIEQVAQLD"
FT   gene            complement(453720..453866)
FT                   /pseudo
FT                   /locus_tag="Htur_0426"
FT   gene            453871..454662
FT                   /pseudo
FT                   /locus_tag="Htur_0427"
FT   gene            455060..455347
FT                   /locus_tag="Htur_0428"
FT   CDS_pept        455060..455347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59326"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:D2RV33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59326.1"
FT                   /translation="MSTDNQTYQGCGNATFSPDEDRTLSEAVLGAIEAHQDIDLVEADF
FT                   TLYEIINPDALERLFRFNQNAATTVSFVIDGTHVSLRDVGDEIEIQVVDV"
FT   gene            complement(455510..455782)
FT                   /locus_tag="Htur_0429"
FT   CDS_pept        complement(455510..455782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0429"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59327"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVG3"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADB59327.1"
FT                   /translation="MDDLTGFQRDLLYVIAGADQPSGQEVKDEVEKYYNSEINHGRLYP
FT                   NLDTLVNKELVEKGQLDRRTNYYAISDKGQSSIEQRREWERQYID"
FT   gene            complement(456145..456339)
FT                   /locus_tag="Htur_0430"
FT   CDS_pept        complement(456145..456339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0430"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: dps:DP0960 cold-shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59328"
FT                   /db_xref="GOA:D2RVG4"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVG4"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADB59328.1"
FT                   /translation="MAKGNVDFFNDTGGYGFIDTEDADEDVFFHMEDVGGPDLEEGTEI
FT                   EFDIEQAPKGPRATNVTRL"
FT   gene            456669..457406
FT                   /locus_tag="Htur_0431"
FT   CDS_pept        456669..457406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: mxa:MXAN_6876
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59329"
FT                   /db_xref="GOA:D2RVG5"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVG5"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ADB59329.1"
FT                   /translation="MSHSRSQSRGPSGPTVAQVALIGLFVTALVTAQLTASKVLAFSLP
FT                   VSLPIAGAELALPGAAVAYALTFLASDCYAELYGRRATQVVVNVGFAMNFVVLALVWST
FT                   IAAPAADSSIDPGTFADVLGASTNIVLGSLLAYVVSQNWDVIVFHRIRDYTGREKLWLR
FT                   NIASTACSQAIDTVIFVAVGFAAAPALLGVGAVLRLETLLGLMIGQYLLKLAIAVLDTP
FT                   IVYAIVSFVRAREEDAADETTVA"
FT   gene            457455..458537
FT                   /locus_tag="Htur_0432"
FT   CDS_pept        457455..458537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0432"
FT                   /product="peptidase M29 aminopeptidase II"
FT                   /note="PFAM: peptidase M29 aminopeptidase II; KEGG:
FT                   ppd:Ppro_2115 peptidase M29, aminopeptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59330"
FT                   /db_xref="GOA:D2RVG6"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVG6"
FT                   /inference="protein motif:PFAM:PF02073"
FT                   /protein_id="ADB59330.1"
FT                   /translation="MDERVREHADVLVDWSARVEAGDDVVLSVGPDAHELAVAVAEKLG
FT                   ERGANLLSTYSSGEITRAYLRAHEGEFDEDPAHELALVENADVYLSLGGGRNTSATADV
FT                   PGERRRAYNNARTDIRETRLGTRWVSTVHPTQSLAQQANMAYEEYQEFAYDAILRDWES
FT                   LAEEMAQMKDLLDAGDEVRLVSSGTDLTMRIDDRTAVNSAASVAYDSHNLPSGEVFTAP
FT                   YATEGEVTFDVPMTLRGESVRDVRLEFEDGEVVDYDAAQGADVIGEIIATDDGARRLGE
FT                   LGIGMNRGIDRYTDNILFDEKMGDTIHLALGRAYDANLPDGESGNDSAVHVDLITDVSE
FT                   DSRLEIDGEVVQRNGRFRWE"
FT   gene            458988..459602
FT                   /locus_tag="Htur_0433"
FT   CDS_pept        458988..459602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0433"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   gur:Gura_0401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59331"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVG7"
FT                   /inference="protein motif:PFAM:PF03745"
FT                   /protein_id="ADB59331.1"
FT                   /translation="MRDQLRAGAAIYNAGYYHAAHDVWEDHWLDLEAGTDDERLLHGLI
FT                   QFTAAVVHARERNWEGAVGLAESAREYLAELPADYRDVRLPPVRSFLEALAADPELVER
FT                   RSPVRLVHEGTAPAPTDLAFEPTAIAAAVLADELGYDADPVDAARQYAERDLAAGDDGS
FT                   RFISLLFDFVREDDHRGIIHQRLTDHVGRREARESDVEGLF"
FT   gene            complement(459613..460584)
FT                   /locus_tag="Htur_0434"
FT   CDS_pept        complement(459613..460584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0434"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: scl:sce1969
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59332"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVG8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB59332.1"
FT                   /translation="MEYTTLGSTGMKVSRIGLGCMSFGSGREWMLDREEGLELIERAID
FT                   LGINFFDTANVYSTGESEEILGDALEGYDRDAQVIATKVFAEMDPDNPNASGLSRKAIE
FT                   QELEASLDRLGLETIDLYQTHRWDYDTPIDETLRALDDAVRRGKVRYVGTSSMWAHQFA
FT                   EAVQTSERLGLERFATMQNHYNLFYREEEREMLPLCEKEGIGVIPWSPLARGVGTRPHD
FT                   QIESTTRGQTDQYLAQIPYLEGGGEEINERVQELAAEKGVTMAQLSLAWLLHKDWVDAP
FT                   IVGTTSVEHLEEAVEALEVDLTASDIAYLEEPYEPLPIAGHE"
FT   gene            complement(460711..461460)
FT                   /locus_tag="Htur_0435"
FT   CDS_pept        complement(460711..461460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0435"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD; short-
FT                   chain dehydrogenase/reductase SDR; KEGG: vap:Vapar_5888
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59333"
FT                   /db_xref="GOA:D2RVG9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR032884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVG9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADB59333.1"
FT                   /translation="MAQSVLLTGAAGRVGAAILGGLADDYEWRLLDRDPPTEDYPGEFV
FT                   VANITEEEAIREAMEDIDVVLHLAGDPRKTAPWDSVLTNNIDGTQTIFEAAVDAGVEKV
FT                   AFASSNHAVGHYETEERTPELYRADDDYLLDGTEQPRPGNLYGVSKVAGEALGRYYHDE
FT                   YGISVVNVRIGNLTKNHPPIDYERGQAMWLSYRDCAHLFDRCIQADYDYEIVYGISDND
FT                   RKYYSIERAKEVLGYEPQDNSAAHTDD"
FT   gene            462155..462529
FT                   /locus_tag="Htur_0436"
FT   CDS_pept        462155..462529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0436"
FT                   /product="Protein of unknown function DUF381"
FT                   /note="PFAM: Protein of unknown function DUF381; Protein of
FT                   unknown function DUF372"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59334"
FT                   /db_xref="GOA:D2RVH0"
FT                   /db_xref="InterPro:IPR007179"
FT                   /db_xref="InterPro:IPR007181"
FT                   /db_xref="InterPro:IPR027508"
FT                   /db_xref="InterPro:IPR036839"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH0"
FT                   /inference="protein motif:PFAM:PF04038"
FT                   /protein_id="ADB59334.1"
FT                   /translation="MTTDSTRSDPTDAEAACFEAGIKFGTLYHQFAGTPVAPDSAASLE
FT                   TAMEEAIENQPHCTDVTVDVRTDELETELADSAADYTELTGRFLEVEIVVDYEDCEVVT
FT                   RMEMEDGYPLMRVESVRGRQ"
FT   gene            462689..462925
FT                   /locus_tag="Htur_0437"
FT   CDS_pept        462689..462925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59335"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59335.1"
FT                   /translation="MRLYWPSPNPPGEPKACLECETLVDGSETEGWWLERETCQNPNTY
FT                   HLFCLSCCVEKMNEWSNHPSVDDEEAAKKHLYG"
FT   gene            463163..463663
FT                   /locus_tag="Htur_0438"
FT   CDS_pept        463163..463663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59336"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH2"
FT                   /inference="similar to AA sequence:KEGG:BRAFLDRAFT_63902"
FT                   /protein_id="ADB59336.1"
FT                   /translation="MSQATFGDDEELFGEAANEMRADVESSLEDGWAALPDADDVWETD
FT                   ADNVLGVLNGLNSALNAGDAEEHLRDAKKWFTMGQRADAFEDADDLEAEIGDLEDAIAD
FT                   ISEAGEQVGELTSTIPALRGTLEDAGPDTDAEADDEAEDADDEEDEAEADDADEDESDE
FT                   DEE"
FT   gene            complement(463709..464449)
FT                   /locus_tag="Htur_0439"
FT   CDS_pept        complement(463709..464449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0439"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: bbt:BBta_7483 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59337"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH3"
FT                   /inference="protein motif:PFAM:PF02633"
FT                   /protein_id="ADB59337.1"
FT                   /translation="MDLRDATWTDVRDCETELAVVPVGSTEQHGPHAPLGTDVVAAEAV
FT                   ADAGVEHVDREVVRAPAIPVGIAEEHRQFPGTMWVSEDTFRDYVREAVESLAHHGFDRV
FT                   VIVNGHGGNVDALREVGGRITRGGDAYAVPFTWFEAVGEHSAEMGHGGPLETALLRHCA
FT                   PDLVREERIEDARDGHAEGWGDWLSYTNLAYDSAEFTENGVVGDPEDGDRQCGEELLEL
FT                   AGDALARLLEAVAERDVSRPERRE"
FT   gene            464606..464950
FT                   /locus_tag="Htur_0440"
FT   CDS_pept        464606..464950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59338"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH4"
FT                   /inference="similar to AA sequence:KEGG:THAPSDRAFT_1040"
FT                   /protein_id="ADB59338.1"
FT                   /translation="MTNDDRQLGVDLGELGDDLESADYPMSEDELMERYGDEEIEMEGN
FT                   TTTLEELIGPLNQEEYQDYGDIETAIMNMVGDEAIGRKNYSDRTPPASGEQRQDEGAPD
FT                   QGDQEGQESF"
FT   gene            complement(465135..467087)
FT                   /locus_tag="Htur_0441"
FT   CDS_pept        complement(465135..467087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0441"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: neu:NE0720
FT                   ABC transporter permease/ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59339"
FT                   /db_xref="GOA:D2RVH5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB59339.1"
FT                   /translation="MSGSGVDWEEDDPFEEQREEIENPMKRLFLEYGHNYAFQAVVGVF
FT                   ASTFARILDLLPPIMLAVALDAVFRGEAGYAESLPFGGDLVAPYVPATQEGQFFLTVGV
FT                   IAAAFFLGAAFHWLRNWGFNAFAQNIQHDIRTDTYDKMQRLNMDFFADKQTGEMMSILS
FT                   NDVNRLERFLNDGMNSLFRMAVMIVGIGVILFAYNWQLALVALLPVPLIAGFTYLFVKI
FT                   IQPKYAAVRSTVGKVNSRLENNLGGIQVIKSSTTEDYESERVEDVSQDYFDANWDAIET
FT                   RIKFFPGLRVLAGIGFVVTFLVGGLWVFQGPPGPFTGTLTEGEFVVFILYTQRFIWPMA
FT                   QFGQIINMYQRARASSARMFGLMDEPSRVAENPNATDLEVGEGRVTYDDVTFGYDDEET
FT                   IVEDIDFTVAGGETLALVGPTGAGKSTVLKLLLRMYDVDEGAITVDGQDIRNVTLESLR
FT                   ESIGYVSQDTFLFYGTVEENITYGTFGADREDVIEAAKMAEAHEFIENLPDGYDTEVGE
FT                   RGVKLSGGQRQRISIARAILKDPDILVLDEATSDVDTETEMLIQRSIDELAADRTTFAI
FT                   AHRLSTIKDADQILVLEGGEVVERGAHGDLLENGGLYSHLWGVQAGEIDELPQEFIERA
FT                   QRRQARTDVSTDDDD"
FT   gene            complement(467164..467658)
FT                   /locus_tag="Htur_0442"
FT   CDS_pept        complement(467164..467658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0442"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   bja:blr4411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59340"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH6"
FT                   /inference="protein motif:PFAM:PF02643"
FT                   /protein_id="ADB59340.1"
FT                   /translation="MALERVQKSLLAIVAVAVIAVLVLQMGLVEPPWTEDEGTVRVVDG
FT                   DTGAELATVEVEVADTLNERHTGLSNHESLDDGEGMLFVHDDEDERTYVMREMDFDIDI
FT                   VFVDADGEITAIEHARAPEPDEDGEDLQHSGEAKWVLEVPRGYANETGMEAGDEIEIEY
FT                   E"
FT   gene            467720..467793
FT                   /locus_tag="Htur_R0009"
FT                   /note="tRNA-Val1"
FT   tRNA            467720..467793
FT                   /locus_tag="Htur_R0009"
FT                   /product="tRNA-Val"
FT   gene            complement(467913..468263)
FT                   /locus_tag="Htur_0443"
FT   CDS_pept        complement(467913..468263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59341"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59341.1"
FT                   /translation="MVVDGPVPSPPLSVGHPRAVTDEGADGNLLEAEQFAYREAVAAVD
FT                   EQEFVAAADVDENRLGDAEQRAVAEFPLRAVALAREPLVSASISAQRSGMESLVVRLRQ
FT                   NGFPSAGARAGS"
FT   gene            complement(468378..468554)
FT                   /locus_tag="Htur_0444"
FT   CDS_pept        complement(468378..468554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59342"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59342.1"
FT                   /translation="MLESRDEDAFRPAPAEAEWEPQSMSGVVGVRIATREDDGPSSAEW
FT                   LWSSQWLDLVAKR"
FT   gene            complement(469743..469877)
FT                   /locus_tag="Htur_0445"
FT   CDS_pept        complement(469743..469877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59343"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59343.1"
FT                   /translation="MEENGAARATRRIRTVATESEPNRDVTIDSHLTVSLTETIPANR"
FT   gene            complement(470109..470555)
FT                   /locus_tag="Htur_0446"
FT   CDS_pept        complement(470109..470555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59344"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59344.1"
FT                   /translation="MEALTSSQEGRQLSADTILELLANRRRRYLLYALRGQEDPIELST
FT                   LAEQVAGWEHDVPPDEVAKNEYKSVYVSSVQCHVPKLADAGVVDHDEDNHTVVLGNNFD
FT                   QLEPYLRVVVKDEPENSTLHAALEHESGDGFLGRVRENVGWLKQ"
FT   gene            470778..470851
FT                   /locus_tag="Htur_R0010"
FT                   /note="tRNA-Phe1"
FT   tRNA            470778..470851
FT                   /locus_tag="Htur_R0010"
FT                   /product="tRNA-Phe"
FT   gene            complement(471361..471945)
FT                   /locus_tag="Htur_0447"
FT   CDS_pept        complement(471361..471945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59345"
FT                   /db_xref="GOA:D2RVI1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59345.1"
FT                   /translation="MSEDDPVDEPFGNGWSVDYPVEYDPEAVEEVLSTEWKRNLLVVDY
FT                   ESAGEDARNKETLLIQSFYVSLVLFGLLLDVGYRLAQQEEQLALFGLSTLGVVLFGLLA
FT                   NWSVRYRQGRDASWDRRSEIEDFVKLADPDVLRSNDSKFKRLSRTGDGTYRVDEQPWYE
FT                   AGSIATVVVYAELAIGLLWLAVAVWTGTSLL"
FT   gene            472167..472286
FT                   /locus_tag="Htur_0448"
FT   CDS_pept        472167..472286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59346"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59346.1"
FT                   /translation="MSVLEILTETIEGYLSGGAEEAISEGIEETAEEATGEDF"
FT   gene            472384..473286
FT                   /locus_tag="Htur_0449"
FT   CDS_pept        472384..473286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0449"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: xfa:XF1729
FT                   phenylacetaldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59347"
FT                   /db_xref="GOA:D2RVI3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI3"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB59347.1"
FT                   /translation="MAVANDYESAGGSTPVSETPQNESDTFEIGDRTVHRLGFGAMRLT
FT                   GDEIIGPPEDEEQAREVLERAVDIGVDLIDTADSYGPAVSERLIGEALGDRDDVLVATK
FT                   AGLLRNREGEWLAHGDPDYIRNQVLTSLDRLRTDTIDLYQFHRPDDDTPFEDSVAAFAE
FT                   LKDEGLVDEVGLSNVSPEHIDQAREQVEIATVQNRYNIGDRGAADALELCTEEGIGFIP
FT                   WAPINGDDVDEHGDLLDEIGDEHDATRRQVALAWLLERSEVILPIPGTSSPEHLESNVA
FT                   ASQLSLSDEEVQQLTDAAD"
FT   gene            473354..473740
FT                   /locus_tag="Htur_0450"
FT   CDS_pept        473354..473740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59348"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59348.1"
FT                   /translation="MGDRTALDDATEDDRAALEEIERGLEELRRAHGALVEFHHAVGRG
FT                   IDHFDEAEGRLDERDALAERLREEILPAGVTDDGKLTYQLVAEFEEGFLADVESIGDEA
FT                   LAELADGRRYPIERAERDELEESA"
FT   gene            complement(473802..475112)
FT                   /locus_tag="Htur_0451"
FT   CDS_pept        complement(473802..475112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2881 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59349"
FT                   /db_xref="GOA:D2RVI5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59349.1"
FT                   /translation="MADAGLGRTVDEPARNAALAWIVTLALVALAINHGLAESYRWFAF
FT                   TGFAVAIVLLPVAAFRDPLAMPPWELLALVAVPVVDATMFGQSPLTTVATYVAVAAVAL
FT                   VATVEIDRFTAVRMNHTFAIVLVVLTTLAVAGAWNVAQWLADVTVDTSYLLDGRSQDAA
FT                   NRALMIDFAYAALAGLLASVVFGRYFVYAPADADQTQPHSPVDSAPDEGDSDDDAPDEE
FT                   PDPVPSLIRDRLDVPDRTVAVLSRTMQVALAVLLLYGLVTRDLTTVSNSAIALGITFLP
FT                   AVFERDRRLPLEPGLVFWLTAAVFLHALGSAGLYALIGPWDSLTHTVSASIVAAAGYAV
FT                   VRAIDLHTDEIYFPPRMLIAFILVFVLAFGVLWELLEFALDWSAQRLGLSAVVAQHGLN
FT                   DTIVDLFYDVVGAAVAAIWGSFYLTELSHRIAGRLES"
FT   gene            complement(475246..475413)
FT                   /locus_tag="Htur_0452"
FT   CDS_pept        complement(475246..475413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59350"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59350.1"
FT                   /translation="MTATDGPFECDTCDADVRFEEARRTKTMGGLDPATWQTLCCPHCG
FT                   SRLQTVYVGD"
FT   gene            complement(475713..475784)
FT                   /locus_tag="Htur_R0011"
FT                   /note="tRNA-His1"
FT   tRNA            complement(475713..475784)
FT                   /locus_tag="Htur_R0011"
FT                   /product="tRNA-His"
FT   gene            475952..476407
FT                   /locus_tag="Htur_0453"
FT   CDS_pept        475952..476407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0453"
FT                   /product="Superfamily II helicase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59351"
FT                   /db_xref="GOA:D2RVI7"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI7"
FT                   /inference="protein motif:COG:COG1202"
FT                   /protein_id="ADB59351.1"
FT                   /translation="MAITDKIYVKNHRQLSSQLETNIPKGAFKGATLDMLFQGQGLEKL
FT                   DDATRDRVLDFTEDFLDCSCDNNPYCGCPERKFIQYLLELRAQGLGPDAIVDVMTDDYM
FT                   VYAYPGDVLSFLDNGVRTLEAAEGLARVDGQDKKRDEIRQAKQNLAR"
FT   gene            complement(476592..476999)
FT                   /locus_tag="Htur_0454"
FT   CDS_pept        complement(476592..476999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0454"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: similar to NAALADase II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59352"
FT                   /db_xref="GOA:D2RVI8"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI8"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADB59352.1"
FT                   /translation="MGNKNKTISFRVNEDAFEALQDIAEERDISLSAVFRDYVDQLVEH
FT                   DGQVEVVPEEELEAMGSGDDGEQTFPPSVEVPKSFIREHERLELEADHLREQLDEYKGY
FT                   VNDLQDRLEDEEDEILLLDDLDEEDESYQLR"
FT   gene            477110..478117
FT                   /locus_tag="Htur_0455"
FT   CDS_pept        477110..478117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0455"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bra:BRADO0864 putative
FT                   glyoxalase/bleomycin resistance protein/dioxygenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59353"
FT                   /db_xref="GOA:D2RVI9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVI9"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB59353.1"
FT                   /translation="MPSDTPGLHHVTGLVGDAQTAVDFYAGVLGLRLTTQTVNFEDILQ
FT                   HHLYFGDAAGTPGTVLTHFPDPHADPGRVGKPQVASVAFAVPAGSLEYWRDRLAEHDVA
FT                   VEGPIERFEERVLRFEDPAGTQLELVAGLPDAPDPSGVEPWTDGPVPDESAIRALYGVS
FT                   TLSVNPYATASMLETLGFEYEAERDDRVRYRASGERATVVDVLDREAEFGREGPGTLHH
FT                   VAVRVGSEDDLHEWRKLFDDRGYDVSRVKDRHFFHSLYVREPGGVLFELATESGGVAAS
FT                   GPEGGPGESLHLPDWFERDRELIESQLPELTVPETTARDGDTGAADSVDAGTDR"
FT   gene            478141..478797
FT                   /locus_tag="Htur_0456"
FT   CDS_pept        478141..478797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0456"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   cti:RALTA_A0417 putative phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59354"
FT                   /db_xref="GOA:D2RVJ0"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ0"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ADB59354.1"
FT                   /translation="MDSVSGPHAGQPLLTAGAPALAAEAALVVCHGRGATAQGVVNLFE
FT                   PVYRHGLAVFAPQAERSCWYSRPATAPRTENEPWLSSSVDCVGAACEAAAEIGIPSDRT
FT                   VLAGFSQGACVVAEYGRRNPDRYGGLAVLSATLPGSDADLEATEIDGSLAATPVLLGYG
FT                   AKDPHVDPSRVAATARIFERADAAVDERRYPETGHEVTDDEFAAIGELLEAALED"
FT   gene            complement(478822..479310)
FT                   /locus_tag="Htur_0457"
FT   CDS_pept        complement(478822..479310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0457"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: noc:Noc_2767
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59355"
FT                   /db_xref="GOA:D2RVJ1"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ1"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB59355.1"
FT                   /translation="MSDTDDTPESSSDRARLVGINHVALEVGDIDDALEFYGSLFEFDL
FT                   RSRSETTAFLDMGDQFVALAQTDAAGEKTDDARHFGLVVDDADRVAERLESLDIDRLDV
FT                   PGLEFHDPWGNRFQIVDYEEIQFTKADHVLEGMGLAGLEKTDDALRELDEKGLAPDSE"
FT   gene            complement(479424..480065)
FT                   /locus_tag="Htur_0458"
FT   CDS_pept        complement(479424..480065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0458"
FT                   /product="conserved hypothetical protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59356"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ2"
FT                   /inference="protein motif:COG:COG3390"
FT                   /protein_id="ADB59356.1"
FT                   /translation="MSQSELTREVARRVFASEFNDSTYTFKESDDERAPNYALLPTGDR
FT                   ANRVFIVGTLTETEDVGEDSEYWRGRVVDPTGTFFVYAGQYQPEAASVLRDTEPPAYVS
FT                   IVGKPRTYETDDGSVNVSLRPESIAIVDDATRDRWVVETAERTLDRIEAFEEWEAEQEA
FT                   PESGSTAPTNEYAQMARERYDSPVVNYRNDVIQALEQLEDVETDDAEAPA"
FT   gene            complement(480067..480999)
FT                   /locus_tag="Htur_0459"
FT   CDS_pept        complement(480067..480999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0459"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold tRNA/helicase-
FT                   type; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59357"
FT                   /db_xref="GOA:D2RVJ3"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ3"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ADB59357.1"
FT                   /translation="MSDVRQHADDIHDQFSDHIDVSVDDVEERLTTLVDEYKVPIDEAR
FT                   RSVTNHYLEEAGLEREDISRGGSEEVNVEDVDEPEQWIDLTAKVIELWDPRSDSVAQVG
FT                   LLGDPTGTIKFTKWAKSDLPSLEEGGVYDLRNVVTDEYQGRYSVKLNSTTVIEELDEDL
FT                   EVGDDTSEIEGALVDMQSGSGLIKRCPKEDCTRVLQNGRCNEHGEVEGEFDLRIKAVVD
FT                   DGIDAHEVIFDKEATEDLTGLSLEEAKDMAMDALDTTIVADEIHEDIVGTYYRIEGPTF
FT                   GRYVLADDVEELDDGPADAEQLLIRARSM"
FT   gene            complement(481116..482363)
FT                   /locus_tag="Htur_0460"
FT   CDS_pept        complement(481116..482363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0460"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: dac:Daci_0055
FT                   oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59358"
FT                   /db_xref="GOA:D2RVJ4"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ4"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ADB59358.1"
FT                   /translation="MSTEQSRESRREEIDAILERKDGGVRETRDEADKYTVVGAADRRT
FT                   YANWLTPVEEHFVCHRNDIPDADADSWTVSLTGRLDDEYSLSDLNDEFPTVAVAHTMEC
FT                   AGNGRGQHRPETGSVQWGFEAAGTAIWTGTPLSSILRGRLDDADGDAWLTAVGGDPSDG
FT                   DDVFARSIPLSKALEDCILATEMNGRPLPREHGFPVRLIVPGWYGVNCVKWVEELRLMD
FT                   TMVVDGSLDRPGDHAYWQQEAYRMHPADVDPEPNETVETVDTWGQLEAGEPDHPYTFDQ
FT                   TVMSVIGAPDGESTVTAPEDGTIELTGVAWAGDDGVERVEVSTDGGDTWADAELFGPDY
FT                   AGAWRLFRYDWDARPGTHVLCSRATDDQGRRQPMRISNPDAWRDALEADEFPWNEGGYA
FT                   ANAVLPNAVEIDVESA"
FT   gene            482516..482827
FT                   /locus_tag="Htur_0461"
FT   CDS_pept        482516..482827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59359"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59359.1"
FT                   /translation="MADRRRLERFLRSKLQEAGEQYEQVRGSTGEQLEEAREAYEVARN
FT                   ARSLPSDEAGRAKIVCRRYAEQRAAKLDDEFRPACYEAGHPDCEGCAEDVREGRIETW"
FT   gene            complement(483414..483629)
FT                   /locus_tag="Htur_0462"
FT   CDS_pept        complement(483414..483629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59360"
FT                   /db_xref="GOA:D2RVJ6"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59360.1"
FT                   /translation="MRISKAGLLVVTAIVIPIVVELRTALSWFGIELSILEGVALGVAV
FT                   VLAIVVWAVWPSDGNGSTETEPTGPE"
FT   gene            complement(483630..485381)
FT                   /locus_tag="Htur_0463"
FT   CDS_pept        complement(483630..485381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0463"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   mca:MCA2396 cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59361"
FT                   /db_xref="GOA:D2RVJ7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ7"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ADB59361.1"
FT                   /translation="MRNAYVDQFPAEAKVIKAAFWSSFLALAVGGVLGLVQALHRTDVV
FT                   RFIDSADYYTVLTAHGVLLAITFTIFFLVGIFTWAVTTSLERGVVDTRFTWSWYAMMVV
FT                   GTVLVGVTIFAGFLEDAPEILGAPLNADVLFTFYAPLQAHPFFYVGLVLFVVGSWLAGV
FT                   DWFRTWWAWRAENPDERIPLPTFMVLTTTLFWYICTFGVALSILVFLLPWSLGLVDSVN
FT                   PLLTRTLFWYFGHAVVYFWLMPTYIMWYVMLPKFAGGKLFSDPLARVVFVLFLLLSTPL
FT                   GIHHQYLDPGIAEGYKFIAMTNTMFLLLPSLLTAFTVVASMEHGARQRGGEGYLGWLRA
FT                   LPWRDPVFTGMALAGLMFAAAGFSGMINAGMNINYLVHNTWWVVGHFHLTVGTAVALTF
FT                   MAAAYWFIPQVTGKALWNRSVALGQVLLWFIGMTFMSNAMHRSGLFGMPRRTAEPQYEN
FT                   FAFEPAAGTVGEINAQVALGAVILTVSLALFLLNMVMTSFNGTSDAIPDNTYAGTLSGP
FT                   EDAPEILDNLKLWTAIAIVLVIFAYTLPLASIIENGGLFGPGIEGRQLTLVPDTAAALE
FT                   TVREVIP"
FT   gene            complement(485374..486174)
FT                   /locus_tag="Htur_0464"
FT   CDS_pept        complement(485374..486174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0464"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   mca:MCA2397 cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59362"
FT                   /db_xref="GOA:D2RVJ8"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034214"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ8"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ADB59362.1"
FT                   /translation="MNIHTYEKLWLAAAMVLIVGFIATITYGAVGPGVTMVNDDGGSID
FT                   PDAISDHERFGDTGVTHVGGDEYEVAVVAQAWSYSPGEIEVPAGSEVTFYVTSRDVTHS
FT                   FSVVGTNINTMVIPGEVSQMTVEFDEPGEYGILCNEYCGQGHHNMEGKLTVVPEDEFNM
FT                   TELSVEAPDEVEAGNETTINATVSDGMQTDLGTTVTLEIGDQQYEEDVAIEGAGSESVE
FT                   FAVDTDELGAGDHDWTVTAAGYEESGTLTVVDGEGGSDGGDGDA"
FT   sig_peptide     complement(486088..486174)
FT                   /locus_tag="Htur_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.958 at
FT                   residue 29"
FT   gene            complement(486171..486407)
FT                   /locus_tag="Htur_0465"
FT   CDS_pept        complement(486171..486407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59363"
FT                   /db_xref="GOA:D2RVJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59363.1"
FT                   /translation="MSSATEQRTTDRTAETDSGETGPVREIGHDEYDPIGTLILIAIYF
FT                   AILVLLWLFMYFVEFLGNGPTVVGALMTVVGLA"
FT   gene            486508..486723
FT                   /locus_tag="Htur_0466"
FT   CDS_pept        486508..486723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59364"
FT                   /db_xref="GOA:D2RVK0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59364.1"
FT                   /translation="MTLETVTPRYAAAVGLLAVVPVLVYGVTNSGVAGLVSAVNVAVII
FT                   GSLYLAMSPVEGAHGDHAATENGAAR"
FT   sig_peptide     486508..486588
FT                   /locus_tag="Htur_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.649 at
FT                   residue 27"
FT   gene            486752..487558
FT                   /locus_tag="Htur_0467"
FT   CDS_pept        486752..487558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59365"
FT                   /db_xref="GOA:D2RVK1"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK1"
FT                   /inference="similar to AA sequence:KEGG:MCA0800"
FT                   /protein_id="ADB59365.1"
FT                   /translation="MTLATLASAGPGLGLEHADLVVLFVVGLLAGAHCLGMCGPLVTAY
FT                   ADRIGAAGDKRRDDTLTGYEVRQHALFNLGRTASYAAIGGLFGLLGAATVASSEAVAAV
FT                   GDSVRGATGILVGIAIIASGLYYVRGRTAVPGHDLPVVGTLFRRLSTLLSSRIDRLATS
FT                   PGIAALGAVHGFMPCPIIYPAYLYAFAVSSPTRGALSLAVLGLGTIPTLFAYGTVLTAL
FT                   ESATRVRLHRGLGVAFVVLGYVPLSHGLMLYGIHLPHPPLPFAPPF"
FT   gene            487561..490023
FT                   /locus_tag="Htur_0468"
FT   CDS_pept        487561..490023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0468"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; Heavy
FT                   metal transport/detoxification protein; Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: gbm:Gbem_1231
FT                   heavy metal translocating P- type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59366"
FT                   /db_xref="GOA:D2RVK2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK2"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADB59366.1"
FT                   /translation="MCPDSRNPDSSERPHTPAPSSPAEGSDGCDLCDLPLPSVPITDPD
FT                   VDGTYCCRGCLEVARTLERRDDGPDEAAVRSRLDGADAAGGRDLDDLDGEDAFLAVDGM
FT                   HCSTCEAFLESVAEREAGVLGATASYATDTIRIVYDPDRLAADDLPEIVSGYGYTAADR
FT                   SGADGDAGSDDGLARLLLGGFFGMMVMVWYVLFLYPTYFDLEPVVAFGGYELAFLSANI
FT                   WAFTSFILFYTGYPILRGAYVSLRAGRPNMDLLVATAALGSYGYSAVAIVLGESHLYFD
FT                   VTVAVVLVVTAGTHYERAVKRRATGLLSELTERQVDEARLESGETVPLEAVEPGDRLLV
FT                   RPGERVPLDGEVLEGSAAVDESLVTGESLPVRKTPGDELRGGTVVTDAPIVLGVGDEAE
FT                   STLDRLVSLLWSIQSARPGVQRLADKLATVFVPLVVALAVSTAAVLLATGSSPSTALLI
FT                   GLTVVIVSCPCALGLATPLAIAAGVQAAAKRGIVVAAETIFEDAPDVDVVVLDKTGTLT
FT                   TGKMAVEGVHVVDGTDSDELLRRAGAVESLSEHPIAAAVVEAAPVAAADGIGDPATGTD
FT                   GSAVDSFERADRGVSGVVDGDRVVVGHPDFCRERGLSVPDSLESPIEDARAAGRVPVGV
FT                   GWDGRTRGVVAVGDSEREELDAALESLSSGREIVVLTGDEGPAAERFRAVDGVDEVFAG
FT                   VPPEAKAETVDRLRRRGTVAMVGDGSNDAPALAAADVGIAMGGGTQLATDAADAVIVGD
FT                   DLEAVGETLEITASTHRRIRQNLGWAFCYNAVAIPLAVAGLLNPLFAAVAMAASSLLVV
FT                   LNSSRSLR"
FT   gene            complement(490043..490315)
FT                   /locus_tag="Htur_0469"
FT   CDS_pept        complement(490043..490315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0469"
FT                   /product="Iron sulphur domain-containing, CDGSH-type"
FT                   /note="PFAM: Iron sulphur domain-containing, CDGSH-type;
FT                   SMART: zinc finger CDGSH-type domain protein; KEGG: similar
FT                   to CDGSH iron sulfur domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59367"
FT                   /db_xref="GOA:D2RVK3"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK3"
FT                   /inference="protein motif:PFAM:PF09360"
FT                   /protein_id="ADB59367.1"
FT                   /translation="MTRLVELEETGPRKLEPSDIDDEKGDVAVCRCGLSDSFPFCDGSH
FT                   RRTRDEDPDETYVYEDGERRVVERVVTEAEADGNGNDSGNGDGDE"
FT   gene            490463..490756
FT                   /locus_tag="Htur_0470"
FT   CDS_pept        490463..490756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59368"
FT                   /db_xref="GOA:D2RVK4"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59368.1"
FT                   /translation="MSFHDAGTSIAITLAVVKTLILLVGSFITFLAFKAYRRTRQRALW
FT                   LLAVGFGLVTLGLVLAGLLYEILGVSLMTGILLESLLMLVGFVVIAYSLYVT"
FT   gene            490801..491409
FT                   /locus_tag="Htur_0471"
FT   CDS_pept        490801..491409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0471"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Tellurite
FT                   resistance methyltransferase, TehB, core; Methyltransferase
FT                   type 12; KEGG: dol:Dole_0911 tellurite resistance protein
FT                   TehB"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59369"
FT                   /db_xref="GOA:D2RVK5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK5"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB59369.1"
FT                   /translation="MRVVTGNFDERSDAARSRGDAVGSDGLAPIVRSVVEGLSPGRALD
FT                   VATGTGRNALALAERGWTVDAVDLSSAKLSRARERATERGMAVNWILADVDSYCLPEER
FT                   YDLVTVSFFDARGRLPALIDALAPGGVLCYEHYLASAERDAGPGDRFRFDSNELLAACS
FT                   DLAILYYAERRVGDEPRVTLVARNETDVPRWRPQFPSPR"
FT   gene            complement(491426..492355)
FT                   /locus_tag="Htur_0472"
FT   CDS_pept        complement(491426..492355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0472"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; dTDP-4-dehydrorhamnose reductase; short-
FT                   chain dehydrogenase/reductase SDR; KEGG: bbt:BBta_1610
FT                   putative UDP-glucose 4- epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59370"
FT                   /db_xref="GOA:D2RVK6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK6"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADB59370.1"
FT                   /translation="MAETELSTPEFEYDIESAIVTGATGDVGSWVVDRLADRGVDVVGV
FT                   DFDRPDGVRANVDFRGVDLTEGVDTWETIAEVDPDAVVHLAALSDPLENPSTRLFENNV
FT                   TSAYNVLQAAGREGIDVVWSSSQATYGALFAESTWTPDYLPIDEAHDRRPEDAYGLSKV
FT                   CGEEIAKSMARRYEISVATIRPATIFSPTKERARPTEDGSDLSSEEPTGDFASYVDVRD
FT                   VARMIEAALAADLKGHEEFLCVADENYLGRPTAELVETVCGPIPGAVDLEGKESALSNA
FT                   KAADVLGWMPAHSWHEGPDEDVSGPTWL"
FT   gene            complement(492584..492655)
FT                   /locus_tag="Htur_R0012"
FT                   /note="tRNA-Thr4"
FT   tRNA            complement(492584..492655)
FT                   /locus_tag="Htur_R0012"
FT                   /product="tRNA-Thr"
FT   gene            complement(492747..493541)
FT                   /locus_tag="Htur_0473"
FT   CDS_pept        complement(492747..493541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bml:BMA10229_0446 putative polyketide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59371"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59371.1"
FT                   /translation="MDRADSCRRAAFEAVADVEPPALHDRIETALTEASMVPGVLTLES
FT                   AATTADGRAVAESERSAETDRGHAQRRGRDGDRDTDGLATQAAGVQLIYEGLRLTRSLA
FT                   HDEPWAADGNGDDESDLAILAADILVARGFYLLARTDAAGKAVRTVQKFGRDQTRRDAV
FT                   ADRSSGPTTDADGEPVPDDSEATTIDANLERDILELAVRTGAAAVGDAPSQRLLATAEA
FT                   LADTVGPSFPPAADCLADLEPMPGEQSLEDPTTDRATSATDP"
FT   gene            493603..494313
FT                   /locus_tag="Htur_0474"
FT   CDS_pept        493603..494313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0474"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   xac:XAC1584 3-hydroxybutyryl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59372"
FT                   /db_xref="GOA:D2RVK8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK8"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADB59372.1"
FT                   /translation="MIDVDSNADRSIRTVTIDRPDARNALTVAGLEALETAIADAEEPV
FT                   IYLRGRGGAFSAGADLEAVADLDGDSERAVEFARLGQRVARTIEDSPAVVVAGIDGPAR
FT                   GGGLELALACDVRVGTPDSTYGEPGVTFGLFGAWGGTVRLPRVLGEGDALEFALSGRAV
FT                   DADAALRMGLISRIDAEPRTVAEEIAENAPDALAVLKRRIRDDSERATQERREAQAFGD
FT                   LVATHADDIDAVLE"
FT   gene            494394..494933
FT                   /locus_tag="Htur_0475"
FT   CDS_pept        494394..494933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0475"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bbt:BBta_3804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59373"
FT                   /db_xref="GOA:D2RVK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVK9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB59373.1"
FT                   /translation="MPDSVFLSGDSVDLRPIEEDDLEFLRPAVNDRRIWRPIGRSRPVN
FT                   REQEREFFEDVVCNDDTVNLLIVTDSTPIGTVAFNGIDWEADRAEIGYWIAPDHHRQGY
FT                   ATDAVERFVTYGFDQLGLHKITARVFEFNEASQRLLESIGFTKEGIHRDEVFVDGDYQD
FT                   TYWYGLLEANWRSRVD"
FT   gene            complement(495025..495819)
FT                   /locus_tag="Htur_0476"
FT   CDS_pept        complement(495025..495819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0476"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="KEGG: gsu:GSU0652 NAD synthetase; TIGRFAM: NAD+
FT                   synthetase; PFAM: NAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59374"
FT                   /db_xref="GOA:D2RVL0"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL0"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADB59374.1"
FT                   /translation="MLDLRFSEAELERRREHITEFIRSQVDAADADGTVLGLSGGIDST
FT                   LTAHLAVEALGAENVHGLVLPARVSSEGNMSDAERVAQDLEISYDVIEVEPIVDALLEA
FT                   YPEAEGDREAVGNARARARAVLNYLVANHEERLVLGTGNRSEAAVGYFTKYGDGAVDCH
FT                   PIGNLYKAQVRQLARHVGVPEELAAKTATAELWADQTDEDEMGVSYETLDSILATHIDG
FT                   PLSVDATARLLEVEAETVEKVRGMYERSEHKRRAPPAPEPLD"
FT   gene            495988..496740
FT                   /locus_tag="Htur_0477"
FT   CDS_pept        495988..496740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0477"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   vcm:VCM66_A0305 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59375"
FT                   /db_xref="GOA:D2RVL1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB59375.1"
FT                   /translation="MQALEQRDFETDVQREVYDFVEQNGAVERQQLKAAFSFDADELEE
FT                   TLSTLEDDGFVETEDGLVRLSIDIGEEKTHTTDDLEYTIRPAEQSDLRGIVGVMRQVAE
FT                   ENDYLVAETIVDLLDHEEVVFRHNDITSRIFFVATVDDDVVGWVHLQAPNYEKLSHTAE
FT                   LTMGVLEEYRGHGIGSNLLERGLQWATENEYDKVYQSLPATNQDAIRFLENHRWETEAI
FT                   RKAHYKIDDQYVAEQMMAVMTGQSLLPS"
FT   gene            497022..497092
FT                   /locus_tag="Htur_R0013"
FT                   /note="tRNA-Gly1"
FT   tRNA            497022..497092
FT                   /locus_tag="Htur_R0013"
FT                   /product="tRNA-Gly"
FT   gene            complement(497198..498157)
FT                   /locus_tag="Htur_0478"
FT   CDS_pept        complement(497198..498157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0478"
FT                   /product="Transcription factor TFIIB cyclin-related
FT                   protein"
FT                   /note="PFAM: Transcription factor TFIIB cyclin-related;
FT                   Zinc finger TFIIB-type domain protein; SMART: Cyclin domain
FT                   protein; KEGG: GTF2B; general transcription factor IIB;
FT                   K03124 transcription initiation factor TFIIB"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59376"
FT                   /db_xref="GOA:D2RVL2"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR023484"
FT                   /db_xref="InterPro:IPR023486"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL2"
FT                   /inference="protein motif:PFAM:PF00382"
FT                   /protein_id="ADB59376.1"
FT                   /translation="MARPSRQRERESASTETTDQRERERACDECSDGTLVTSEDQGELV
FT                   CDQCGLVVEGSNIDHGPEWRAFNHSERQSKSRVGAPTTQTMHDKGLTTSIDWKNQDAYG
FT                   RSISADKRSQMRRLRKWQERIRTKDAGERNLQFALSEIDRMASSLGIPRSVREVACVIY
FT                   RRALDEDLIRGRSIEGVATSTLYAACRMEGIPRSLEEVAAVSRVERKEIGRTYRYVAQE
FT                   LSLEMEPVDPKQYTPRFCSELDLSEEVQAKATEIIDTTTEKGLLSGKSPTGYAAAAIYA
FT                   ASLLCNEKKTQREIAEVAQVTEVTIRNRYQEQIEAMGI"
FT   gene            complement(498256..499743)
FT                   /locus_tag="Htur_0479"
FT   CDS_pept        complement(498256..499743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: P. falciparum RESA-like protein with DnaJ
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59377"
FT                   /db_xref="GOA:D2RVL3"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59377.1"
FT                   /translation="MRRSLVIALALFVLALLFVGGPSLLFSPSTESVSPNETEVSPKMT
FT                   ELEDSDSRFWRYLSPEERFKQRSPINVIVRGDVDDIERVLTEASDGDWTEINETEAEAG
FT                   PETYTLTGDGNRSDDLEDNETAGNEPTVNESTINESTVDAPPANDTDNDSAAANESSGP
FT                   VPNLEWGDADGGTRYAYLDPGPNESGYWTTETHQLEDGDYYGQRYHIRLYESPNEDDQW
FT                   VIMQTHSEHFDWFTLRHRVHGSQDAQTKVENDFMKHPRVDVEEDVHRMYLNNRNSSDAD
FT                   GWATVVDLTGMILLPGAVGLVARRRSRVLRADTGSQIDSERISDRAPSAIDDHLTDVDR
FT                   RRIAAAYARIEIGHLLLVGTIVGLYFAVRFGGLALEHRAGFLTPHQIAGLLYPVLAVGI
FT                   PTATYLVAGMLTRRLDAALVAAGSLAAAIWLDYGYLGVDSLPVDVVLQRMLVVVALGLI
FT                   AGGAAKRATRESRFNDMLVAGVALWVLVLSGTLLGYF"
FT   sig_peptide     complement(499645..499743)
FT                   /locus_tag="Htur_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.460 at
FT                   residue 33"
FT   gene            complement(499798..500232)
FT                   /locus_tag="Htur_0480"
FT   CDS_pept        complement(499798..500232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0480"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: glo:Glov_3602 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59378"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADB59378.1"
FT                   /translation="MYETLLVPTDGSDQAAVAASHAIDIAATRSATVHVLSVVDDRAFL
FT                   VLDEDRVETVRDDLRANARDAIDDVATSAAAHDLTVETATDTGHPAECIVDYAADHDVD
FT                   MIVMGTSGDEYETNVVGSVSQRVVREAPAPVLTVGPDTEC"
FT   gene            complement(500340..500702)
FT                   /locus_tag="Htur_0481"
FT   CDS_pept        complement(500340..500702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0481"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_3572 peptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59379"
FT                   /db_xref="GOA:D2RVL5"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59379.1"
FT                   /translation="MAVIDSAVIFVLSLLVGTVAILAGARVILDRDASAFNAALTALIG
FT                   AAVWALTSYFVGWIPLLGVVVMLVVWVGVINWRYPGGWGTAAAIGIVAWVVAVAIVYAA
FT                   SMLGIVTPEALGIPGA"
FT   gene            complement(500713..500952)
FT                   /locus_tag="Htur_0482"
FT   CDS_pept        complement(500713..500952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59380"
FT                   /db_xref="InterPro:IPR027598"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59380.1"
FT                   /translation="MVQRTTADEKLPRSELAAYLATLAEEFDGDAEEINVGVGNKTVSL
FT                   NPAAEVDVSIDVVERSSMLRGNRETIEIELSWKS"
FT   gene            complement(501158..502246)
FT                   /locus_tag="Htur_0483"
FT   CDS_pept        complement(501158..502246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0483"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /EC_number="2.7.11.1"
FT                   /note="PFAM: Circadian clock protein KaiC central region;
FT                   KEGG: bra:BRADO3982 circadian clock protein KaiC"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59381"
FT                   /db_xref="GOA:D2RVL7"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL7"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ADB59381.1"
FT                   /translation="MTVSPVREVSDDWFERALEDAEESADDEAGDDSSGDATAEQFDAI
FT                   SSAETTGDRVESAEAASQRGTEAETANESREESGGELFDEDFGSALADVDVPTVRADET
FT                   GPKGFSELDFDLSTGDETDFDEAVDSDLPRLELGIEGLDRMIQGGVPERSLLVAMGSAG
FT                   TGKTTFGLQFLEHGLARGENAVFITLEESRRRVIDSATEKGYPFDEYLAEDRLAVVDVD
FT                   PIEMANSLQSITNELPTLIEEFDAARLVLDSVSLLEMMYEDRATRRNEIYDFTRSLKEA
FT                   GVTALLTSEASEESPYASRYGIVEYLTDAVFVLQYIRPDDFRETRLAVEIQKIRDANHS
FT                   REKKPYEITDDGISVYQQANLF"
FT   gene            502497..503348
FT                   /locus_tag="Htur_0484"
FT   CDS_pept        502497..503348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0484"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: csa:Csal_1307
FT                   inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59382"
FT                   /db_xref="GOA:D2RVL8"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL8"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ADB59382.1"
FT                   /translation="MDVAVGIVGQRGNERAQGLAASLAETLERRGRDGGEIAVVVDEAT
FT                   GEAIDVPACPVDEMGDRDLVVSIGGDGTLLFVAREVGPTPILGVNLGEVGFLNAVAPED
FT                   AVDVVTDLVADYRETGAFEGRELARLEATGEGADWTLEPALNEIVVHGPRRGPGGGATV
FT                   EIRVDGGQYAAGHADGVLVATPTGSTAYNLSEGGPLVHPAADALVVTQMAAADSMPPLV
FT                   VDPDTELSITISGPDIAYAISDGRNRQRLEPPATITVSVADEPIRLVGPRGDFVSSLDK
FT                   LD"
FT   gene            complement(503373..504023)
FT                   /locus_tag="Htur_0485"
FT   CDS_pept        complement(503373..504023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0485"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: prw:PsycPRwf_1148
FT                   DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59383"
FT                   /db_xref="GOA:D2RVL9"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVL9"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADB59383.1"
FT                   /translation="MSGTADSTDRLELYADYVCPFCYLGTRSLEQYREEREAPLEIDWQ
FT                   PFDLRSGKRNPDGSIDHEVDDGKDDQYYEQAKQNVRRLQEEYGVEMNQIMATEVDSLPA
FT                   QQASWYVKQEYPEQWAAFDEAIYQALWQDGRDIGDADVLADLAESVGLPIDEIRSAVED
FT                   DGLRTELEDRFQAAQRRGITGVPTFVYEDHAARGAVPPAQLERLVEGAEQAQR"
FT   gene            complement(504136..504915)
FT                   /locus_tag="Htur_0486"
FT   CDS_pept        complement(504136..504915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59384"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59384.1"
FT                   /translation="MRDDGAEPGPGPDEPAAVGDSPQLEYEDERRLENRPGSGSLSRAD
FT                   VQRDSTVRQWGVVTPSATVIGRAESSDGDLSESVRRLHDEQHAATPGYSERAHRLDRLR
FT                   TTQALCNALEVTPWQRDLALGVMDEIDLTEFGSQRAIEKVALVVIRHVVDVDRQQYFGL
FT                   DDIDAQALSADRMDDLFAQYRAHDITEDETFKRLAADYGLDTTSLNRLRRVLKEQLEDE
FT                   LPAYGRNPYRDPNLPDVTEANAGSEEGVAAGDGANGA"
FT   gene            complement(505842..506807)
FT                   /locus_tag="Htur_0487"
FT   CDS_pept        complement(505842..506807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0487"
FT                   /product="Nucleotidyltransferase, predicted"
FT                   /note="PFAM: Nucleotidyltransferase, predicted; KEGG:
FT                   pen:PSEEN0616 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59385"
FT                   /db_xref="GOA:D2RVM1"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM1"
FT                   /inference="protein motif:PFAM:PF10127"
FT                   /protein_id="ADB59385.1"
FT                   /translation="MSAVPESVFERVDDLLTDLERDRGIRVALAVARGSHAWGAASPES
FT                   DYDVGFVFVPDDLRRYAHLAGPPETIHEAVDTDDGDVELQGWDVRTFARLLADSNDGAI
FT                   DLLRSPIRYRVAYEPMKLAAYVERTYNPMDLYHAWRGIATSNYRKYISHHLVRTDDAIF
FT                   PILEAREDEYVVETRGEEEADELDVDDGTRTIPIDDERFTETQTKPTVKRNLTIYRAAM
FT                   SARYLKATGERDGHELPVIEFDRFLDEQAPSVFDDERIERARALLERKWAGDGSEPIGD
FT                   AVGREFAHPPHEIDPGRHAHSGPDPKRLDEFVDELIAAVR"
FT   gene            507002..507934
FT                   /locus_tag="Htur_0488"
FT   CDS_pept        507002..507934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0488"
FT                   /product="protein of unknown function DUF198"
FT                   /note="PFAM: protein of unknown function DUF198; KEGG:
FT                   azo:azo1197 putative GTP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59386"
FT                   /db_xref="GOA:D2RVM2"
FT                   /db_xref="InterPro:IPR003801"
FT                   /db_xref="InterPro:IPR022840"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM2"
FT                   /inference="protein motif:PFAM:PF02649"
FT                   /protein_id="ADB59386.1"
FT                   /translation="MSHQLPDVQATSPDVTVGLSQVGVTGVDKLVKIAREGKRPIVLTA
FT                   EFEVFVDLPAWRKGADMSRNMEVIDEILEEATREEAYRVEDVCGDAAERLLEKHDYTST
FT                   AKVSMEAEFMRREQTPASDRETQHTVDIIASATATEEGTREEIGAEVTGMTVCPCSQGM
FT                   SAARAKQTLEDLGVEEETITEFLEEVPQPGHSQRGHATLTVESNGDPAVDLNDVIDIAR
FT                   DAMSARIYNLAKRPDEDHMTYAAHADAKFVEDCVRALAEGVVDEFDHLADDAVITMKQS
FT                   NDESIHQHNAHAERKVEMGTLREEVAGDD"
FT   gene            508053..508799
FT                   /locus_tag="Htur_0489"
FT   CDS_pept        508053..508799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0489"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: sfu:Sfum_1697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59387"
FT                   /db_xref="GOA:D2RVM3"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM3"
FT                   /inference="protein motif:COG:COG2220"
FT                   /protein_id="ADB59387.1"
FT                   /translation="MTVRHDNVTVSWLGYATVRIESADGTVVYVDPGRYGTLTGEWDRD
FT                   VPHPPGRAYDERDGDLVLVTHDHHYDSDGVRRVASEDATVIAYEAVDAESIRAGGRDVE
FT                   DLEALPYDVQRVEYGEEATVEGVDLEVLPAFNHPDGPNAPDGDPIHPEGFGCGYRFAVG
FT                   GTSVCWTGDSDVLDDHTDLEVSLFLPPIGKNFTMNRTEAAELAAAIDPDLVCPIHYNTF
FT                   PDLDADSRAFAADVAAAGVPVVLDEE"
FT   gene            complement(508808..509611)
FT                   /locus_tag="Htur_0490"
FT   CDS_pept        complement(508808..509611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0490"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   bbr:BB3556 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59388"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM4"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADB59388.1"
FT                   /translation="MSSLRDLGLSEYEARAYRSLLNTGPTTAKELSRASDVPMGRIYDV
FT                   LNSIEQYNLVRSQTASRPKKYVAVEPSTALDRLLEDKKRELEEKADQYESIVDDLADEL
FT                   DAAEPVEDQFWTAAVGPEETVDLMLERLAAADDHIVMVSADPAPQWDLQTVSEAVNAQL
FT                   EDALDRGVSIDLLMTREMVASLSADVGRRYRTTLQQRDDFDVRTNDDISGSFNIIDGVE
FT                   ICIQVPNPLSSGDAFGMIDLKDPEFAANVHEEFVPRWEEAEPLEF"
FT   gene            complement(509698..511347)
FT                   /locus_tag="Htur_0491"
FT   CDS_pept        complement(509698..511347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0491"
FT                   /product="protein of unknown function DUF255"
FT                   /note="PFAM: protein of unknown function DUF255; KEGG:
FT                   reh:H16_A1279 highly conserved protein containing a
FT                   thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59389"
FT                   /db_xref="GOA:D2RVM5"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM5"
FT                   /inference="protein motif:PFAM:PF03190"
FT                   /protein_id="ADB59389.1"
FT                   /translation="MDDQTRVEWRDWGEDAFDEAAEADAPVLLSLTATWCDHCHEMDAK
FT                   TYAEPRIAANINDSFVPVRVDVDRHPRVRDRYNMGGFPSTVFLAPDGTVLTGAGYLGPD
FT                   GMRQVLDSVRTMWQTKGSGAGRVPRPLRENNPPAGRLTSDVESAMLGQLTEAYDEVAGG
FT                   WGGSPKFPLPDALEFALKRDREMALRSFDAVSANLLDEYDGGFYRFAAERDWAGLQHEK
FT                   LLDSNGALVRAFANAYLLTGKDEYRDPADRTVDYLTTTLWNDEADAFANSQAPGEDDAH
FT                   VIDATDRSMADEPPVDDGVFAGPNGLAIEGLLTYHAYTDDERARRYAERALETLREDLL
FT                   EDGVAVHALEGDAERDADGEPIPLLANQARVLSALTTTASVLETDALADATGVADATID
FT                   RLRDEESFLDGPASGAGLLDRPLRPLDSNVALADALLELAVLADEERYREVARETLEAF
FT                   AGASDRFGVQMARYATTVSRLLEGPLVIRVAADPGTDLHRAALRMADHEKVVVPAAADL
FT                   EAGLARVERGDQRSDTAETPAELSERVQSVLE"
FT   gene            511516..512124
FT                   /locus_tag="Htur_0492"
FT   CDS_pept        511516..512124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0492"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   slo:Shew_3264 FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59390"
FT                   /db_xref="GOA:D2RVM6"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM6"
FT                   /inference="protein motif:PFAM:PF04186"
FT                   /protein_id="ADB59390.1"
FT                   /translation="MLRWILALLLIPFLDAVLLGVLVTQFGAFTWVGMVLLVVLTGLVG
FT                   MLLVRAEGRRTIGKMQRTLAEGKPPTNELLDGGLLIAAGAFLLTPGLVTDAIGFLLAVP
FT                   LTRIPIRAALKRFVIIPYADKKTGGFASGNVWTFGFPDEGPARSGDSGSGSTDGGTYDL
FT                   GAGDYTVDDSDDGDSYTIDFGDERTSDSGDDLDDDPSAR"
FT   gene            512194..512267
FT                   /locus_tag="Htur_R0014"
FT                   /note="tRNA-Ile1"
FT   tRNA            512194..512267
FT                   /locus_tag="Htur_R0014"
FT                   /product="tRNA-Ile"
FT   gene            513463..514937
FT                   /locus_tag="Htur_R0015"
FT   rRNA            513463..514937
FT                   /locus_tag="Htur_R0015"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            515092..515163
FT                   /locus_tag="Htur_R0016"
FT                   /note="tRNA-Ala1"
FT   tRNA            515092..515163
FT                   /locus_tag="Htur_R0016"
FT                   /product="tRNA-Ala"
FT   gene            515397..518307
FT                   /locus_tag="Htur_R0017"
FT   rRNA            515397..518307
FT                   /locus_tag="Htur_R0017"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            518435..518552
FT                   /locus_tag="Htur_R0018"
FT   rRNA            518435..518552
FT                   /locus_tag="Htur_R0018"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(519431..519943)
FT                   /locus_tag="Htur_0493"
FT   CDS_pept        complement(519431..519943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59391"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59391.1"
FT                   /translation="MSDARRQSAEPAVITGEPRERADLTVIEPTVTRENVDSTGRVGAV
FT                   AYPFRVYDAVATIERPLLSNRDVEYVVSVDRSRRLAVRADVFPDTIGKTVDDVLVVPSE
FT                   LPDALVREKAEDAVFTWTLRKVAVGSAPEISFEQSVDAHKLFWIASRPDGDVIVDSVRG
FT                   TESPLTD"
FT   gene            complement(519944..521632)
FT                   /locus_tag="Htur_0494"
FT   CDS_pept        complement(519944..521632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0494"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: she:Shewmr4_1398
FT                   sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59392"
FT                   /db_xref="GOA:D2RVM8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM8"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ADB59392.1"
FT                   /translation="MASNGLAGSAGIWVLGTFAVYLLVLLGIGLYSSRLMDTVDDYVIG
FT                   GRSVGPVVTGFSERASEMSGWLTLGVPSDAFGTGVMAFYNGLGMIPADLFAWAGIAKRL
FT                   RKYTEIVKAVTLPTFFETRLQDDTGYVKGTSAIVLMIFEGGYVGAQIVAAGTLLEVLTG
FT                   VSSLVGILVGGVIVVGYTMLGGYFAVAWSDYVQGAIILIAFIILPIIAFTNYGLPFSEL
FT                   ESVGSSYTSVTAGMTGWAALFGIISYAAIGLGIPGNPHVMVRFMGIDEVENIRLAALVA
FT                   QLFMFVAYIGAGFVGLYALVVFGQGGIEDPNNVMPLLTLEFFPGAIAGIILAAALAAMM
FT                   SSADSQLLVATSAIVEDVYHGYINPDASQETLVRYSQYVTLGLGAASVAFAFLAQNTPI
FT                   YTLVLDYAWGGLGAAIGPTLIASLWWKRITAKGSVASMIVGTLTMIVWIQLSSLLEALG
FT                   LMGVVEGSAFLTGLIGVYGLVPAFILSTLTLIVVSLVTEPPEGVDDHFESFNKPLSALS
FT                   SSDDPTGTPDYVTDGGQDVDPKAVTETDNIRAHVTASDYWETGDE"
FT   gene            complement(521622..521768)
FT                   /locus_tag="Htur_0495"
FT   CDS_pept        complement(521622..521768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59393"
FT                   /db_xref="GOA:D2RVM9"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59393.1"
FT                   /translation="MLESGSVDLLWLFGPFVVYLVMLGVYYVWEGKREEQLRQRYEEAE
FT                   HGQ"
FT   gene            complement(521919..522758)
FT                   /locus_tag="Htur_0496"
FT   CDS_pept        complement(521919..522758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0496"
FT                   /product="Proline dehydrogenase"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: mxa:MXAN_7405
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59394"
FT                   /db_xref="GOA:D2RVN0"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN0"
FT                   /inference="protein motif:PFAM:PF01619"
FT                   /protein_id="ADB59394.1"
FT                   /translation="MIPPIASRFVAGTSASGALDHVSDCNQDGMGGILNLLGEHYHEPE
FT                   PAAEDADEYCHLASQLAERDLNGTISVKPSQIGIDVGPDVFTANFERIVEAAAAEDVFV
FT                   WCDMEDHTTTDTTLDAVESTARDHPNGVGVAIQANLTRTRDDLERLADVPAAVRLVKGA
FT                   YDEPSSVALDSKAAVDEAYEDHLEFLFREFDQGIAVGSHDTKMLKTAVDLHKEYGTPFE
FT                   IQMLMGVREDAQRELAEKGYEVNQYIPYGDKWMQYFYRRVRERKENALFALRAVVGV"
FT   gene            complement(522847..523578)
FT                   /locus_tag="Htur_0497"
FT   CDS_pept        complement(522847..523578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0497"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /note="PFAM: Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59395"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN1"
FT                   /inference="protein motif:PFAM:PF04967"
FT                   /protein_id="ADB59395.1"
FT                   /translation="MSSTSPTTTTTGSPDGTRLTLEIWHPDCWGLQATEAVDAGLLVHT
FT                   VHRTVEDAVKGHFTVYADTTNQLDEFVAFADESPLTHSTVELGQRPTSTAPNPGNATRE
FT                   LFVEYEPEHSISDALVSHGFIHDASVRVEGGVEHWPVFVAGGRDEIRNRLEAIRNETDA
FT                   EISISRVATPDGGPSETADRADRLTPRQREAFELACEQNYYAWPREISTRELADELGVS
FT                   KTTLLEHLRKAEAKLLNPDDA"
FT   gene            523792..525327
FT                   /locus_tag="Htur_0498"
FT   CDS_pept        523792..525327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0498"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pca:Pcar_1496
FT                   NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59396"
FT                   /db_xref="GOA:D2RVN2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN2"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADB59396.1"
FT                   /translation="MSQQTTAQPDQHYINGEWTDGEGEETFESENPATGETLRTFRRGT
FT                   AADVDAALEAAEEAQDEWRELSHIDRAEYLWDIYHELRQRTDELGEIVTKECGKEISEG
FT                   KADVVEAAHMVEWAAGNARHPHGDVVPSEIGSKDAYMRRKPRGVIGCITPWNFPVAIPF
FT                   WHMAVSLVEGNTVVWKPAEQTPWCAQIVAEMFEDSGIPDGVFNMIQGFGDAGEAIVEDE
FT                   RVDTVLFTGSAEVGQEVARSVAEQPGKLAACEMGGKNAVVITDEADLDTAVHSAVMSSF
FT                   KTTGQRCVSAERLIVHEDVYDEFKERFVDVAENVAVGDPLAEDTFMGPLVEGEHKEKVL
FT                   EYNELAREEDVDVLVDRDELGDDEIPDGHEDGHWVGPFVYEADHEADLRCTQEEVFGPH
FT                   VALMEYSGDIEDAVEVHNDTEYGLAGAIISEDYRDINYYRDNAEVGLAYGNLPCIGAEV
FT                   HLPFGGVKKSGNGYPSGREVIEAVTERTAWTLNNSKDIEMAQGLSADITTDDD"
FT   gene            525852..526628
FT                   /locus_tag="Htur_0499"
FT   CDS_pept        525852..526628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0499"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; regulatory protein MarR; regulatory protein
FT                   ArsR; SMART: regulatory protein IclR; KEGG: aeh:Mlg_1318
FT                   IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59397"
FT                   /db_xref="GOA:D2RVN3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN3"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADB59397.1"
FT                   /translation="MTDEGPRPVKTTKTSLAVVRAVRDNDGATLSELADRLKLAKSTVH
FT                   NHLHTLVEEGFLVREGDTYHVGLQFLPFGEHARDRNPLYAAARRRVYSLAEKAGNEADF
FT                   IVEENGRAYSLEYAIGESTPRGLSESGPFRAGNRFYMHNCASGKAILASMPEARVREII
FT                   DRWGLPATTEETITDETALFDELEATRRRGYATNNEELIEGYRSIGASITSPDGEVVGA
FT                   FSIGGPTYRMAVDESTTDEIGHLLVDEIDALEAELF"
FT   gene            complement(526799..527257)
FT                   /locus_tag="Htur_0500"
FT   CDS_pept        complement(526799..527257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59398"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59398.1"
FT                   /translation="MSTRQHSTRRTVLRTIGSLGLAPVATAATAGAADNDEGNGDDGPS
FT                   LPANGARSQSAAAGCGSADVDRYIGTVDRIVDGRHVVLLLESDGELVDQHVAPRSTLES
FT                   VEEGDILSVIFKDGDLLVAQQLPKRPGRSASEPSPQERFDSLASDNPT"
FT   sig_peptide     complement(527159..527257)
FT                   /locus_tag="Htur_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 33"
FT   gene            complement(527387..528151)
FT                   /locus_tag="Htur_0501"
FT   CDS_pept        complement(527387..528151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0501"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; regulatory protein ArsR; Helix-turn-helix
FT                   type 11 domain protein; SMART: regulatory protein IclR;
FT                   KEGG: esa:ESA_01422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59399"
FT                   /db_xref="GOA:D2RVN5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN5"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ADB59399.1"
FT                   /translation="MDTTEGDGTDAGVSTTRKTFAILEALTETDGLTITELTRQTGLSK
FT                   STVYRHLATLTDMGYVVERDGEHYIGFRLLEISEQARNRETGYAAAKRTVFELGQETGE
FT                   RAVFTVEERGEAVYVHRYGSRSNTFIGKRRPLHTLASGKAILAEWDDDAVSRFVDETGL
FT                   EAVTDNTITDLDELSADLERIRERGYAVNDQEHMDGLRGVAVPVYTPDDELLGALGVFG
FT                   PTSRFKDEAVHEELPTLLRDKADEIRVTLAYG"
FT   gene            complement(528404..529567)
FT                   /locus_tag="Htur_0502"
FT   CDS_pept        complement(528404..529567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0502"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: gme:Gmet_2075
FT                   acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59400"
FT                   /db_xref="GOA:D2RVN6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN6"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB59400.1"
FT                   /translation="MLDFVDLEADLDQEERMIRDTAREFVTEHVTPDIGEHFENGTFPK
FT                   EIIPKMGELGFYAPNLEGYSSPNVSETAYGLLMQELEACDSGLRSMASVQGALVMYPIH
FT                   AYGSEEQKEEWLPALGRGEAVGCFGLTEPEHGSNPSAMETRAERDGDGYILNGSKTWIT
FT                   NSPISDVAVVWARDQSDPDTPVRGFLVETDRDGVSTNKITEKLSLRASITGEIGLNDVH
FT                   VPEENVLPGVSGMKGPLSCLTQARYGIAWGAVGAARDCFEEARQYAKDRDQFGGPIGRF
FT                   QLQQRKLAEMGTQITLAQLLAYRLAELKERGEMRPQHVSMAKRNNVRTARDQARIAREM
FT                   LGGNGITTDYSPMRHMANMETVYTYEGTHDIHTLVLGEEFTGIPAYE"
FT   gene            529869..531008
FT                   /locus_tag="Htur_0503"
FT   CDS_pept        529869..531008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0503"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: dal:Dalk_3317
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59401"
FT                   /db_xref="GOA:D2RVN7"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN7"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADB59401.1"
FT                   /translation="MAFTLSDEHEAIREAVREFGENEIKPVAEEHDQEGKYPEDLRRKA
FT                   AKYDFVAPSIPLEYGGAGMDKIASTIVTEELWRADPGIGSAIGSAGFGSSMIMEFGDEW
FT                   MKEEWLPKIADGEIASVSMISEPAHGSNVAGIETVAEKDGDEYVANGNKMWITNGTVAD
FT                   IGVLMAKTSPGEGHKGITAFLVEMDWDGITTDKIDNKLGIRASDLAEVVIDDVRIPEEN
FT                   VIGEVDKGFYQLMEFFAAGRANVAAQAVGAAQGALDAAVEYANQREQFDQKIKEFQAIQ
FT                   HKIAEMATKVEAARSLTYRAATQVEQENQDIAAQYSSMAKLFASEISVEVADEGIQVHG
FT                   GSGYVTDYPAERYYRDARITKIYEGTSEIQKNIIADQIF"
FT   gene            531155..532042
FT                   /locus_tag="Htur_0504"
FT   CDS_pept        531155..532042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0504"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   KEGG: scl:sce7905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59402"
FT                   /db_xref="GOA:D2RVN8"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN8"
FT                   /inference="protein motif:PRIAM:1.1.1.35"
FT                   /protein_id="ADB59402.1"
FT                   /translation="MQIAVLGAGSMGHGIAQVSAMAGHDVVLRDIEASLVEDGLEGIRT
FT                   NLQGGVDRDKLTESEMEETLERIDGTTDLEAAVDDADLVVEAVPEEMDLKQEVFADVEA
FT                   ATGEETVIASNTSSLSVTEMASALEHPERAVGLHFFNPPHIMDLVEIVIAEQTDERTEA
FT                   FAVDYVQGIEKEDVVVRDTAGFATSRLGVALGLEAIRMVEQGVASPADIDAGMELGYGH
FT                   PMGPIELTDHVGLDVRLHIAEHLREELGERFKPPQSLRRKVRAGKLGKKTGEGYYVWEN
FT                   GERVGTSGDWGTDE"
FT   gene            532432..532557
FT                   /locus_tag="Htur_0505"
FT   CDS_pept        532432..532557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59403"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59403.1"
FT                   /translation="MKKRSRTVFEPEPNRSAGCDRRRHEGIEAFLESREPEFTGE"
FT   gene            533292..535043
FT                   /locus_tag="Htur_0506"
FT   CDS_pept        533292..535043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0506"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: pla:Plav_2996
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59404"
FT                   /db_xref="GOA:D2RVP0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP0"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADB59404.1"
FT                   /translation="MKRSITSGFLSIVSIKFLLIGLDFLSSPLLTRFLGEGYGDYAFLM
FT                   SIFAIYMIFVSSGVGDGVRKYVAEERDRAHWDEHVVGFYLRMAILLAAIGCLGLALAAQ
FT                   TGIVTSRLGTSYRTYFYLLSLLVLSSQFREYTRRTLMGFGLERYSEPLLFLDKILFIVV
FT                   GVGLAFRGHGVQGVLIGHMTGAVTTSIVGLALINRTVSLRTAIARIPPKDFPRRELFTF
FT                   NALSIVLILCLTSLYQLDVMMLGVLGTTQETAYYKISLTIAEFLWIVPLALQNVLLHST
FT                   SNIWSNRNHERINSLAARVTRYTLLFTLLLAIGIGTLAPVALPIVYPAEYIASYGPILL
FT                   LLPGCVGFALARPILAIGQGKGDLHVLIASTGAAAVGNIALNALLIPRYGMYGAAVATS
FT                   ISYGTMFVFHVWSAREIGFDPVTGARIPRVIFAGGVAALPIGLLVRFLGDSIFSLVIVP
FT                   PMGAAIFLVAAVVVGALDVEEIITLLEAAPDPIGSFGSTLRAKFDGVDDDHGADDHEVP
FT                   DDDASPVGERQQPEDRSTAAESNAVSSSDARERLNTIETRIERQNERIESQRQTIEQLI
FT                   DELRRGR"
FT   gene            complement(535112..536209)
FT                   /locus_tag="Htur_0507"
FT   CDS_pept        complement(535112..536209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59405"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59405.1"
FT                   /translation="MTNSDPYEIRQYEPADRDAFLDLFADVLGGRMGNDWFTWKYERNP
FT                   YVNHVPILVAQRDDELVGARAFFPLRLAAGDDEFSAFQPCDSMVRPEHQRRGLFTRLTE
FT                   RAIDRYDDADLFFNFPNHRSLPGNLKLGWRVASERETYYRIQNPTAWLPQLEPVEPIVR
FT                   SLASGYVSIRDRFADPTDAVELSRYDRVPSSLLATLASSETVPEFHVVRDETFYEWRFA
FT                   NPLWTYRTIVATRDGAPVAAVVYGRRDRTSGPTVVRILDVLPLAAGTSSSPSRQATLAA
FT                   LLDAVLRETGDADVIAAPGSVVPRSVLRSRGFHSDQRAPLKWGTSSSTHVVRPAGTPPL
FT                   DWTRSGTRLADGANWRLAFCEVDSG"
FT   gene            complement(536219..537166)
FT                   /locus_tag="Htur_0508"
FT   CDS_pept        complement(536219..537166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0508"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   csa:Csal_1720 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59406"
FT                   /db_xref="GOA:D2RVP2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP2"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADB59406.1"
FT                   /translation="MGSVVISLDAEVGWGFHHDESVSETFLRNTRQNWRRLRELFDAFE
FT                   IPATWAVTGHLFLRSCTDRHRNHPAGERCCQKSIEDLPATDIWCGAELVDEIATADIDH
FT                   EIAGHGFTHVHFDHDRMDEAFATREIENCVRAASRRGHDLSSFIFPVNRIRHRDALAAH
FT                   GFDCYRGTNPLRDSQSTLTRQMTKLSSAAVGKPAPPIVDPYVDDRGLVNVPASIYLFNF
FT                   EAKYRKLFSAFGEDPVVRQVKSGIDRVARTDGVLHMWLHPHNLRTPAHYRRLQSIAGYI
FT                   DRRRSTDGLRVETMAEVADRVRNESRPETTFENS"
FT   gene            537708..540782
FT                   /locus_tag="Htur_0509"
FT   CDS_pept        537708..540782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0509"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; KEGG: acp:A2cp1_0862 FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59407"
FT                   /db_xref="GOA:D2RVP3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP3"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ADB59407.1"
FT                   /translation="MSLESSADPAADGRANYDYRSDEVDRPALVDDLERLVGCDVRGDS
FT                   YSRELYATDASPYEVTPIAVAFPESTADVVGIVEYCAEREIPVLPRGGGTSLAGQTVNR
FT                   AVVLDFTRHMNDILEIDPDGRTATVQPGTILGTLNEALAPHDLKFAPDPAWGDKSAIGG
FT                   AIGNNSTGSHSLKYGKTDAYIEECEAVLADGTVTTFGEVTLEEVADRVDPEGGLEERIY
FT                   AEVERIIEDEADLIEETYPDLKRNVSGYNLDRLVAEARGSTLPGGEETGEPGTVNLARL
FT                   LAGSEGTLAIVTEATVSLESVPETKAVTLLCYPDLHEAMRDVEPILAHDPAAIEVLDDV
FT                   LIDLARDTAEFGPVTEMLPEGTNAVLLVEFYAEDADHGEELVAGLLADRLPSATPAGKP
FT                   ASDAPRSDAETLALEALEAYEKEERAQLWKLRKSGLPILLSRTTDEKHISFIEDTAIPP
FT                   AELPEFVERFEAILEEHDTYASFYAHAGPGVLHVRPLVNTKTELGLEQLHGIADDVTDL
FT                   VVELGGSVSGEHGDGRARTQWNHKLYGDELWQTFQDLKTAFDPNWLLNPGQVVFREDNP
FT                   TDLREHLRFDPDYEFEAGFEPALEWDTDNGMQGMVELCHGCGGCRGEQETTGGVMCPTY
FT                   RASREEITATRGRANALRQAMSGNLEPDEAVSDEFVEEVMGLCIGCKGCAIDCPSEVDM
FT                   AKLKAEVTHEYHQRNGATLRDRLFANVATLSKWGSQLAPLSNALPKLPGARSVLESTVG
FT                   IASDRPLPTFRATTFRNWFDQRGGARVSEQAADRSVVLYPDTYTNYSHPDAGKAAVRVL
FT                   EAANVHVTVPDELGDTGRPAFSKGFLEKARETARENVSKLAPLVEEGRDVVVIEPSDAV
FT                   MFQLDYLDLLSDERAERVAAATYGVCEYVDSFRLDEEIAFDENAAAESLTYHGHCHQKA
FT                   VAKDHHAVGVLRRAGYAVDPLDSGCCGMAGSFGYEAEHASMSDGIGEILYEQVDASEGD
FT                   RVVAPGASCRTQLEHRPGTDESPPTPIELVANALE"
FT   gene            541500..542753
FT                   /locus_tag="Htur_0510"
FT   CDS_pept        541500..542753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0510"
FT                   /product="orc1/cdc6 family replication initiation protein"
FT                   /note="KEGG: hypothetical protein; K02213 cell division
FT                   control protein 6; TIGRFAM: orc1/cdc6 family replication
FT                   initiation protein; PFAM: CDC6 domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59408"
FT                   /db_xref="GOA:D2RVP4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP4"
FT                   /inference="protein motif:TFAM:TIGR02928"
FT                   /protein_id="ADB59408.1"
FT                   /translation="MDDGSGHEDGSLEDFWATEDPIFSRKELLDIDLVPNEDRIIGRDS
FT                   EIQNVASSIHPAVKGQSPRNTLIYGKTGTGKSLVAKHVTRSAQQYSVENGTEMGRAYID
FT                   CTQTKTETRVVINLAQELNDPEETGISIPVTGLSTDVYYERFWSILDQLYDVAIIILDE
FT                   IDKLQDNEILMQLSRAGEAGKLDACKVGIIAISNKISFKESLDERILSSLQDREFVFPP
FT                   YDANQLREIMYNREDAFREGVLSDDVIPLSAAFAAQEHGDARKALDILRNAGELAKDED
FT                   ADEVTEIHVRNAREKADIDRFSQLLEGQPTQIKASVYALSILADRHSDREEFATREIYE
FT                   MYKSITSDSALGIETLSQRRMSDKLDEQVFLDILGRTERVGRGYSSGVTNYYYLLEDPS
FT                   VVQAVIHDDDRFSELERQ"
FT   gene            complement(543687..544727)
FT                   /locus_tag="Htur_0511"
FT   CDS_pept        complement(543687..544727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0511"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="SMART: Transcription regulator, AsnC-type; KEGG:
FT                   tbd:Tbd_0074 AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59409"
FT                   /db_xref="GOA:D2RVP5"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP5"
FT                   /inference="protein motif:SMART:SM00344"
FT                   /protein_id="ADB59409.1"
FT                   /translation="MSTLSGDWREGIDDVDAAIIDGYQSGVPVEERPFRSIGAALGIGE
FT                   DEALERVTRLHESGIVRRFGAVLNPPVIGSSTLAAVQAPADRFDEIAAVINEYRQVNHN
FT                   YARDHEWNMWFVVTAGSRARRDEILAEIEARTGCPVLNLPMLTDYYIDLEFPVVNADRF
FT                   ARESLEERLDSSATRISEEATGDLSALEAELLLAIQDGFPLSATPYRDIAGEIGYAVGD
FT                   VLEGVERLVASGCIKRIGCVVNHVVTGFDANCMVVWDVPDDRLDEWGERAGGLPYVTLC
FT                   YHRPRRPDREWSYNLFTMIHGRDSDAVDAKIDDLATEYLPVEHERLYSTETLKQTGARY
FT                   EELVGR"
FT   gene            544870..545631
FT                   /locus_tag="Htur_0512"
FT   CDS_pept        544870..545631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0512"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ara:Arad_2878 acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59410"
FT                   /db_xref="GOA:D2RVP6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB59410.1"
FT                   /translation="MALTEPIAIEGDEREQIYAYVETHGAVDRDRAREALFPEDPPGDP
FT                   QYTRAFRHNVAILKRDGYLEEDDDGTLRIAIDVEDEREEFLTEDVDVTIRPARQEDLSG
FT                   IVGAMRRLVEGMTYIEAETVADELDHENVLLRHNEFESRMFFVATVDEEVVGWAHLHVP
FT                   NLEKLSHTAELTVGVLEEYRGMGIGNELLDRALEWVRSQGHEKVYQSVPSTNEAAIEFF
FT                   EDRGWVVEAVREDHYKLEDEYIDEVMMAIEL"
FT   gene            545771..546838
FT                   /locus_tag="Htur_0513"
FT   CDS_pept        545771..546838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0513"
FT                   /product="Anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="PFAM: glycosyl transferase family 3; KEGG:
FT                   tcx:Tcr_0268 anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59411"
FT                   /db_xref="GOA:D2RVP7"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP7"
FT                   /inference="protein motif:PRIAM:2.4.2.18"
FT                   /protein_id="ADB59411.1"
FT                   /translation="MAQASQEFGEWPLKRLMTEVVGSGPKSADDMSREQAREAFQRILA
FT                   GKPDATTLGAFWLANRWKRNNPEELAGYTDVMREESVVTAEPEADPVDCGANYDGKHSS
FT                   AVLGVGAGLVAAAAGTPVVVHSGDRVPTQKATAYKHVLDELGIRTDLEPEESADMVDET
FT                   GFGFYYQPAFNPGVHDLYDRRDQMGVRTFVNTIETVGNPANADVHLGSFYHLAFAKKLT
FT                   DLIRESDHLDYSRAIFFQGMEGYDDIRPGYTKVAEWNEGEELEDYEIETAEYGMEMENE
FT                   DLEVDDVTADSASITEAVLAGERDDHFADAIALNGAFRMYAREDVDTLEAGLEQARDVI
FT                   ADGSAEAVLEDLRAF"
FT   gene            547088..547846
FT                   /locus_tag="Htur_0514"
FT   CDS_pept        547088..547846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0514"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: similar to (R)-2-octanol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59412"
FT                   /db_xref="GOA:D2RVP8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB59412.1"
FT                   /translation="MRLEDKTVVITGAGAGIGRETALRCADEGARVIVTDVDVEGGEET
FT                   VELIAEAGGEAEFAELDVTDSDRFHDVVDTVAEDYGLDVMINNAGTGHPGGPLEDLDEE
FT                   VRDFVVDININGVWNGCSAALPHMKDQGHGAIVNVGSLASILGLPHQAAYATTKAAVLN
FT                   LTRTVAAEAGPYGVRANAVCPGFTETQLLDEYLDQQSDPERAREAMVEEYPLKRLGEPE
FT                   EIADAILFLASDEASFVTGHGLVVDGGYSA"
FT   gene            547947..548447
FT                   /locus_tag="Htur_0515"
FT   CDS_pept        547947..548447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_3078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59413"
FT                   /db_xref="GOA:D2RVP9"
FT                   /db_xref="InterPro:IPR009577"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVP9"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_3078"
FT                   /protein_id="ADB59413.1"
FT                   /translation="MTLAPALVDVGSALEEATGAGRYLLVFVLAMIPAVEPFIVIPVAI
FT                   GLGFDPTATGAAAFAGSATAVGAIVIAHERLTAWWTRRRGGDDLDSSDRYGRARRLWKR
FT                   YGIVGLSFAGPILAGIHLTALLAVVVGEDTRLTVGWLTAGLAAWTVALVGGSIAGISLL
FT                   GLR"
FT   gene            complement(548469..549452)
FT                   /locus_tag="Htur_0516"
FT   CDS_pept        complement(548469..549452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0516"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: sbp:Sbal223_2953
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59414"
FT                   /db_xref="GOA:D2RVQ0"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ0"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ADB59414.1"
FT                   /translation="MSQHTGTHTVEEVTLARLPSGVELTTTFHTYRGAEDGPTLYVQAA
FT                   QHGREINGTETLRRFHERLPLEELSGTIVAVPVANPLTFDLVSYITPEEFDSVNPNMNR
FT                   IWPGDVNGSLHQQMAARLWTEVSRADAIVDLHTGSPDMYPHVVYREGDERSRALAEAFG
FT                   TDLLLSEEADEDANEEWHRRGFAGKLRVVAAGEGIPSITPELAHNKQILEDAVEEGVEG
FT                   LLGVCRYMGLLPGDVPERNQTVARNHLGQVTADGSGLFRPEPGLEVGQDIAEGTPLGTV
FT                   YDPRTYEPRHEAVADRDGILYALTREATVTAGDQLASVALVRGETG"
FT   gene            549662..550129
FT                   /locus_tag="Htur_0517"
FT   CDS_pept        549662..550129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0517"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: noc:Noc_1704 response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59415"
FT                   /db_xref="GOA:D2RVQ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB59415.1"
FT                   /translation="MTDSCATPHSGYSQTLLLVEDNPGDARLIKEAFSPALADRLRVVS
FT                   TGDEALDFVNQRGEYVDAQRPDLILLDWHLPGIDGGNVLAELNSDSNHRRIPVIVLTGS
FT                   QSAQEVRDAYTKNANACISKTAEPDELEETLRVLENFWLTAVRLPSPANEV"
FT   gene            550324..550842
FT                   /locus_tag="Htur_0518"
FT   CDS_pept        550324..550842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0518"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mxa:MXAN_1176 peptidylprolyl
FT                   cis-trans isomerase, cyclophilin-type"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59416"
FT                   /db_xref="GOA:D2RVQ2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ2"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADB59416.1"
FT                   /translation="MGDVTATLHTNRGDIEVELYDERAPRTVDNFVGLATGGKTWEDPE
FT                   TGEEVEGEPLYDDVAFHRVIEDFMIQGGDPTETGRGGPGYQFDDEFHDELRHDDEGILS
FT                   MANSGPDTNGSQFFITLDAQPHLDDRHSVFGKVIDGMDVVHEIGNVDTDPNDQPREEVV
FT                   LESVSVDYE"
FT   gene            550973..555571
FT                   /locus_tag="Htur_0519"
FT   CDS_pept        550973..555571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0519"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: geo:Geob_3565 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold-3 domain
FT                   protein; GAF domain protein; PAS fold domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; GAF domain
FT                   protein; histidine kinase A domain protein; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59417"
FT                   /db_xref="GOA:D2RVQ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB59417.1"
FT                   /translation="MGSSSTDADHRAQLHRQEVVADLSQQALETGDLDGVLADAALAIT
FT                   ETLDIEYCSVFELRPDRTAAVLRAGAGWPTDRLGSTTVSVERTSWTGDAVREAEPVVAD
FT                   DLDAESRFSIPEALTDRDVASGVAVRIGPAEQPWGVLGAYATESHAFLEADVDFLERVA
FT                   DVLGSAVEHARTRRDLERTERRFEAIFEDPNILVGLLDPDGTVRDINGTAMEYIDADLE
FT                   DVTGELFWETPWWGEGSDARDDVKRWTERAAAGEYVEFEADLTRPDGEWYTLNGAFRPV
FT                   TNEEGEVVSVIVSDRDVTERKARERELEESEQRYRTLVDHFPNGAVALVDEDLTYRTVG
FT                   GSPTDTADATADEIEGEPVAEAVPPSLADELVPRYEAALEGESTAFETTVNGRVYDFQL
FT                   VPVRDDDGEVFAALGMSQDVTERRKRERQLEESEQRYRTLMEYFPNGIVTLFDLDLRYE
FT                   LAAGRGFDRIPVDPADFEGSHVREVWDDEAADTLQPVFEAALDGEEQSVELEYNDRVWI
FT                   VRVVPITDERGDVFAGMTMAQDITERKRHEQYLRETTAQLEAATEAGAVGTWEWRVPED
FT                   EIVAGETFAETFDVDPQAAREGVSSERFLESIHEDDRARVEAKIEAAFESCGEYEAEYR
FT                   VRTADGDLRWVVARGHVECDEDGDPVRFPGALTDITERKHAELELQRNNEQLETLFDVL
FT                   PVGVVVADADGRIRQANDTAREIWGGDVFNTDTVAEYERYPVWSADSGERISPEEMTLA
FT                   RVLDGEEVTEPDIYEIEADDGERRIVRVEGMPVRNERGEVARGVVTLTDITDRRESQRR
FT                   LEESEQRYRTLIDHFPNGGVGLFDENLEYQITGGEAFDEIGASADDIVGQTLWERYPSE
FT                   MAERLEPKFRAALEGEVSSFEMAFHDRDWMAYTVPVMDDDDEIFGGMVMVQEITERKER
FT                   ERKLRERERRLEQYKEYIDEILDAIDDVFYVIGEDGSLQRWNRSVTDVTGYSDEEIAAM
FT                   EPTDLFIDDDVEDALAAIRAGFETGSVNVELTVRTNDGDAVPFEFNASRLEDPWGNTVL
FT                   AGIGRDITDRLEREKHLERYETIVETVNDGVYVVDEDGRFTMVNETYASMVGYEPDELV
FT                   GEHVSMVVDDDVSAQVPKLMAEQTDRPTLEATVRTADGDRIPAEATFAMLPEDDSRWHR
FT                   VGVVRDISERKERERRLEESERRYRTLVENFPGGAVGLYDEDLEYIVVGGEAFDDLGIE
FT                   EDEVAGATVDERFSDELVAEIRPYFRAVFEGESNTFEYQAHGRDVWAHTLPLRNEDDEI
FT                   FAGMVMAQDVTERKEYQRKLEESNERLERFAYAASHDLQEPLRMVTSYLTLLENRYADA
FT                   FDEDGREFLEFAVDGADRMREMIDGLLEYSRVETRGDPFEPMDLDDIVDDVLEDLQFRI
FT                   EETDAELTVEDLPRVEGDASQLRQVFQNLLSNALTYSGDEPPRIHVGAERRDDEWVISV
FT                   ADEGIGIDPEDQDRVFTIFDRLHSRSEYDGTGIGLALCERIVERHGGEIWVDSEPGEGS
FT                   TFSVALPASRDS"
FT   gene            555643..556596
FT                   /locus_tag="Htur_0520"
FT   CDS_pept        555643..556596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0520"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bpm:BURPS1710b_A2134 short chain dehydrogenase/reductase
FT                   family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59418"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB59418.1"
FT                   /translation="MSWTAADIPDQQGRTVVITGANSGIGLEATRELARNGATVIMACR
FT                   SAARGAEAVSDIRSDVPDADLRVEECDLADLESVRSFADRLDGEDLDVLINNAGVMAIP
FT                   RSETEDGFETQFGVNHLGHFALTGLLLENLGLNEDGDSRIVTVSSGVHESGAIDFDDLQ
FT                   GEASYDEWDAYAQSKLANVLFAYELERRLLTADANVKSNAVHPGYANTRLQFRGPEQRG
FT                   SRIRKAAMKVMNTVLAQSAEMGALPTLYAATAPEAEGGAYYGPGGLMNMRGTPERQASS
FT                   ERSYDEETARRLWDVSSDLTGVTYDRLPEPAQPVER"
FT   gene            556731..557315
FT                   /locus_tag="Htur_0521"
FT   CDS_pept        556731..557315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59419"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59419.1"
FT                   /translation="MRNDNDRSLVSRTIEGVETLVSTESGEIFVDVPAANARYVRVEEG
FT                   DTIQEGDIRSRSADELASESLRKWRVESIGPETIIGTDRETDERREWDREELEQKLAIG
FT                   SLSTSLSGFERATVSGTADASNGEPVTVTVYGNDSRKFTQTYRPVDDTDRDERRLELAT
FT                   ADERVEAFDDDLRERFDSTVALALRNEGYAV"
FT   gene            557421..557759
FT                   /locus_tag="Htur_0522"
FT   CDS_pept        557421..557759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59420"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59420.1"
FT                   /translation="MSDDGIQRASDVGSSDAPPVEEKPYKIVFEANKCFGAGKCAEVSD
FT                   NWEMSLASGMAQPNEYFFGEEDLEHNVRAAEICPAKKDDGCIHVVDRRTDEEIAPDPHG
FT                   DGTLSVDW"
FT   gene            557864..557947
FT                   /locus_tag="Htur_R0019"
FT                   /note="tRNA-Leu1"
FT   tRNA            557864..557947
FT                   /locus_tag="Htur_R0019"
FT                   /product="tRNA-Leu"
FT   gene            558330..558689
FT                   /locus_tag="Htur_0523"
FT   CDS_pept        558330..558689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59421"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59421.1"
FT                   /translation="MKQTEAFRVLASADRQLVLHELLEHDGAADIDEISQQVAARRHRL
FT                   SSGKIDDGMIERAHVRLVHAHFPHLQARNLIDIDWDDEAVVLTDDECVDQLLKAAEELE
FT                   SWPPTDLLERPSRSR"
FT   gene            558774..559241
FT                   /locus_tag="Htur_0524"
FT   CDS_pept        558774..559241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0524"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: mmb:Mmol_0127 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59422"
FT                   /db_xref="GOA:D2RVQ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB59422.1"
FT                   /translation="MASVDEADETDLGEAIDILLVEPNPGDTRLFEENFRDAKLMNAVH
FT                   AVTDGKEALDFLHQRGAYGDAPQPDLILLEPQLPGTSGMEVLSELKNEPPLDEIRVIVL
FT                   TSSEMGEEIVRSHGLEADEYIRKPVETEEFIDFVREVEDFWFAIVKNESDD"
FT   gene            complement(559256..560728)
FT                   /locus_tag="Htur_0525"
FT   CDS_pept        complement(559256..560728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0525"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: pcr:Pcryo_1015
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59423"
FT                   /db_xref="GOA:D2RVQ9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVQ9"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADB59423.1"
FT                   /translation="MTDLPLAPDDGWNALYLAGEWTDGGDRNAMSVENPYTREEIGTVP
FT                   AGTEDDVDRAYEAAAAAQESWAQQPPQARAGVIEAAIQFVGDNREEIADLLAVESGSTR
FT                   VKCEAEIQTARGMMQQAASYPFRMSGQQMDSITPGKENVAERRPVGVVGVISPWNFPLH
FT                   LSMRAVAPALAAGNGVVLKPASSTPITGGLLLARIFEAAGVPEGLLSVVPGRGSEIGDA
FT                   ISDHETPRVLAFTGSTEIGQRVAANAAQNCALPALELGGNNVHVVTDGADVERAVDGGV
FT                   FGSFLHQGQACISINRHLVHESVYDDYVGMLTDRASNLPTGDPRDDDTIIGPIIDESQR
FT                   DQILEYVETSVDEGATLETGGEADGLVVEPTVLSDADNDMAAAANEHFGPVAPVIPYSS
FT                   DEEAIELANDTIHGLSGSVHSEDLEQARTIADGIDTGMIHINDQPINDEPHVPFGGMKQ
FT                   SGMGRYNGEAILEELTTTKVVSVQRERREYPF"
FT   gene            complement(560858..561295)
FT                   /locus_tag="Htur_0526"
FT   CDS_pept        complement(560858..561295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59424"
FT                   /db_xref="GOA:D2RVR0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59424.1"
FT                   /translation="MEPARETESNPFGDGPLTPTRIGAAAGMMDIIAFTVMGYITFDNI
FT                   TIGAIAGLLVGLGVFCFPPVFMQSGEGGDLEELEPADDAAPLRGFHRVAAGFALSAAGI
FT                   VVFATGFVELDTLVGIPAALVAAVGIYLVAGFAMPNAQLRT"
FT   gene            complement(561511..562188)
FT                   /locus_tag="Htur_0527"
FT   CDS_pept        complement(561511..562188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0527"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   atc:AGR_L_2490 probable RNA 2'- phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59425"
FT                   /db_xref="GOA:D2RVR1"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR1"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ADB59425.1"
FT                   /translation="MTEPIRTCAAHGPYSSTDGRCPVCDARGALLLSGERRRRLSKFVS
FT                   GALRHFPEDVGLELDAHGWTDYEALAGAVEAKYDWAEPCHVAAVIATDPKGRFERTDAS
FT                   GTDDGAGNGLVRASYGHSVDVDLGPTDEPVPDELYHGTAPATLASIREDGLRPMSRQQV
FT                   HLSGSREAARRVGQRHANDPVVLVVDATAMLADDQRITKRGRETYTTDAVAPEYIDFPA
FT                   MES"
FT   gene            complement(562238..563050)
FT                   /locus_tag="Htur_0528"
FT   CDS_pept        complement(562238..563050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0528"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: dps:DP1795 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59426"
FT                   /db_xref="GOA:D2RVR2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR2"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADB59426.1"
FT                   /translation="MITNAQVERWLREDVGHHDVTNQVPGETTGRLVAKESGVAAGLEA
FT                   AAAVFEYLGVAVNEALEDGTAIDSGDELLRVEGGAREVLRGERVAVNLAGHASGIATRT
FT                   NEVVERARTESDDVRVAATRKTTPGLRGVEKRAVGAGGGDTHRLDLSHMVMVKDNHVAE
FT                   MGLEGAIEHFQARTSFATKLDVEVEAVEDAPRAADAGADIVLLDNMSPAETREAVDLLA
FT                   DYAALAEASGGITLETVADYAATGVDVISMGSLTHSAPSLDLSFRTGD"
FT   gene            complement(563057..564655)
FT                   /locus_tag="Htur_0529"
FT   CDS_pept        complement(563057..564655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0529"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; FAD dependent
FT                   oxidoreductase; KEGG: dvl:Dvul_1351 L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59427"
FT                   /db_xref="GOA:D2RVR3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR3"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ADB59427.1"
FT                   /translation="MTDTPNSTQDATPETADVLVVGSGIAGCAAALAAAREGAEVLLLT
FT                   KAEKPDGASTDWAQGGISTTRGDPESLKRDILEASDGTADPDAIDVLVEHADDAVEDVL
FT                   LETLGIEFDETSEGEFDYTREAAHSNHRILHVDAATGTHILRPFLNYVDDHDRIEVRQD
FT                   TAALDLITHEGRVHGVLTDEEPDGHPVFAGTTVLATGGIGALYTRSTNPDDATGDGIAM
FT                   AALAGAEVEDMEYVQFHPTAYDCEAQRASRRSGDAAERDDPFLLSEALRGEGAVLRNGH
FT                   GERFMDDYHPDAELAPRDIVARAVETEREETGEVVLDVSTLEGEFAEEYPAIAEKCRDR
FT                   GIEGDEIPVAPCEHFLCGGIAVDENGRTSLDRLYAVGECVRTGVHGANRLASTSLLEGL
FT                   VWGLRAGEDAADSGAEPEVVEAPDLRNSDPDLPERFAAEKSVRLKRTMDEYLGLERDPE
FT                   EIARASAVLRRLKGEVDAYIRTRTARDLYELRNACVVTLLIARAAGENDESVGCHYVVS
FT                   DGDEATAEPESPADD"
FT   gene            complement(564665..565798)
FT                   /locus_tag="Htur_0530"
FT   CDS_pept        complement(564665..565798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0530"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: nmu:Nmul_A0605
FT                   quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59428"
FT                   /db_xref="GOA:D2RVR4"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR4"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ADB59428.1"
FT                   /translation="MVKMETAELETDLSLFKYDNLEQLPPRYRDLEEDERTERIEAALE
FT                   ALGDDVVILGHNYQRREIVEHADFIGDSYQLSKEAANADAEYVIFGGVTFMAESADIIT
FT                   DDEQTVILPSMEASCPMAGMAEALQVDSAWAEITAAAPDADIVPITYMNSYADLKAFCA
FT                   SQGGLVCTSSNAHKAFEYAFERGDKVLFLPDKHLGENTAHRLDMEDEIAEWDPWDPEGK
FT                   DADEVAESDIILWDGYCQVHERFREDHIAEIRAEHPEAKVIVHPECRREVVEAADKAGS
FT                   TATICETVENADPDETWAIGTEIHLTEHLQRWHPEVNVLPLCGDACMDCNAMRQIDPNY
FT                   LTWVLEELVEGRERNVIEVAPEEKELAGVALERMLEI"
FT   gene            566003..567073
FT                   /locus_tag="Htur_0531"
FT   CDS_pept        566003..567073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0531"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: tbd:Tbd_2258 putative glucose-fructose
FT                   oxidoreductase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59429"
FT                   /db_xref="GOA:D2RVR5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR008354"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR5"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADB59429.1"
FT                   /translation="MALEEVFSHFTRRDWEEESPEGTVRLAVVGVGGFARKRALPAIAE
FT                   GRYCETTALVSGSPDRTRTVAESFDVPHVLGYDAFLAGDHAETYDAVYVATPNATHGEY
FT                   AVAAAERGKHVVCEKPLETTRERAAGIVDACESAGVTLMTAYRLQTEPTIRRARELVRS
FT                   GVIGDIVQVHGGFSHPLLEGADPDTWRLDPDLAGGGALVDLGVYPLNTIRFVLEDDPAD
FT                   VYATTHSSGPPFDAVDEHVAFQLEFASGATASCTASFDAHASSQLDLIGTEGKIHVESP
FT                   FGGVVPQEMVVESGDVCMEYTGPRVDEVCEEFDYFGYCVLTGTAPEPDGQDGLADLEAI
FT                   EAAYESAETGCQVELE"
FT   gene            complement(567555..568535)
FT                   /locus_tag="Htur_0532"
FT   CDS_pept        complement(567555..568535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0532"
FT                   /product="Luciferase-like, subgroup"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: dac:Daci_5748
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59430"
FT                   /db_xref="GOA:D2RVR6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR6"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADB59430.1"
FT                   /translation="MDVGLMVTSFGDLDLADIAVRAEQLAYDAVWVGELWGESGVVQLT
FT                   EMACRTDEIELGSAILNVYSRSPAVLAMTAASLQRASDGRFTLGVGTSTPKAVEDLHGM
FT                   AFDRPVRRAHETIELVRAYTAGDGRVDYDGEVLAAADFPSLETSVPIYHAGLGPANRRV
FT                   VGRLCDGWIPHNIPFSHLEEAFEEVADAARERDRDPSEIAIAPYVPSAVSEDPDEARET
FT                   LRRHIAYYVGSGEGYRRAVATAYPERADRIADAWRSGEKGEAADAVTDAMLADLGVAGT
FT                   PDDAREQLRTLVAETGIDHPIVVVPEPASRDVVETTIDELAPDRL"
FT   gene            complement(568573..568914)
FT                   /locus_tag="Htur_0533"
FT   CDS_pept        complement(568573..568914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59431"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59431.1"
FT                   /translation="MNGLLSDHEDSPAHRVHFDPTDSSQLSSAVVRAVSTVADRSPRDI
FT                   DPLWETIDPEALERLLEHAAARGDAASFGLEFGVDEFDVVVTAGGEIVVYDDGSDPGSD
FT                   DGLGFSFDG"
FT   gene            complement(568978..569637)
FT                   /locus_tag="Htur_0534"
FT   CDS_pept        complement(568978..569637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0534"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /note="PFAM: Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59432"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="InterPro:IPR031803"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR8"
FT                   /inference="protein motif:PFAM:PF04967"
FT                   /protein_id="ADB59432.1"
FT                   /translation="MSEARVIAEITLVHPELVLTPTIQALPEMTTELEYQTIAGPGEYY
FT                   LFFETYGGDFDAFDRVVADDPTVSEPTVVIDGGEFRVYRMRLTSAERLVLPRAAELGMR
FT                   VLHASSGHGGWIATLEVPELDRLQEFRDHCRSKDVAFTVDRLYHAEDGDRNLGQGYGLT
FT                   PVQQETLVTAYERGYFEDPRESSVEDLAAALGVSSSAVSGRLRRGLKALIENSVIR"
FT   gene            complement(569735..571354)
FT                   /locus_tag="Htur_0535"
FT   CDS_pept        complement(569735..571354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0535"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; amidohydrolase; KEGG:
FT                   mxa:MXAN_0659 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59433"
FT                   /db_xref="GOA:D2RVR9"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVR9"
FT                   /inference="protein motif:PFAM:PF07969"
FT                   /protein_id="ADB59433.1"
FT                   /translation="MTDAADRLLVNAAVHTLDEPDVVHEAVAVRDGEIVRLGDSDEVSF
FT                   LAGVETDVIDCEGRTVLPGFVDAHTHMEQLGQHLVHADLSAATSLEDCLETLSAHADTE
FT                   PDREWVLGFGYDESEWAESRTRPLTSAELDRVSEDRPVVAMRVDLHTASLNSIALERLA
FT                   DDLPASDLRRSGGEPTGVAVEDAAEAVRRKLTAGREKMREVLAAATERAVELGVTGVHD
FT                   KVRGSVAPRVYRDMAADGDLPLRVRIDYWSDHLEALEEVGLATNAGGDRVRTGAIKSFS
FT                   DGSFGSRTARLREPYVDASTGEADVSANEADGADTARETEEGDDRGQWVVDPEDLAGLI
FT                   ERADGAGYQVCVHAIGDAAIEETLSALESTADPGGRRHRIEHAELATDDQIERMAEAGI
FT                   VASMQPNFHRWADEGGLYDRRLGRERRDRTNRFRRVLEAGVPLAFGSDCMPLNPLLGIH
FT                   YAVNAPTEAQRLSVTDALRAYTRGAAYAGFDEDRLGTVEVGKRADLVVLEASPWEQSDW
FT                   IDEIDVAMTMVDGDIVFDGFDC"
FT   gene            571787..572185
FT                   /locus_tag="Htur_0536"
FT   CDS_pept        571787..572185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59434"
FT                   /db_xref="GOA:D2RVS0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59434.1"
FT                   /translation="MIDRDGRIVFGSLLALVLVLTVSIVVEEQFGVGLREYPVLSFLVF
FT                   AGLALAAPQLYLAATDDETADDDPTRSRVQFAAVATAVFALAFADDTSGISYLVIAGIG
FT                   SCAVLALVCYEALRWHRGSSEGSLSQAR"
FT   gene            572243..573469
FT                   /locus_tag="Htur_0537"
FT   CDS_pept        572243..573469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0537"
FT                   /product="3-hydroxy-3-methylglutaryl Coenzyme A reductase"
FT                   /EC_number="1.1.1.34"
FT                   /note="KEGG: hmgA; hmg CoA reductase A; K00021 3-hydroxy-
FT                   3-methylglutaryl-CoA reductase; TIGRFAM:
FT                   3-hydroxy-3-methylglutaryl Coenzyme A reductase; PFAM:
FT                   hydroxymethylglutaryl-coenzyme A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59435"
FT                   /db_xref="GOA:D2RVS1"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS1"
FT                   /inference="protein motif:TFAM:TIGR00533"
FT                   /protein_id="ADB59435.1"
FT                   /translation="MTDPEDLVERVREGELRLHELEDHADHDTAAEARRLFLERETATE
FT                   LEAIGDYAFPAEAAEPNIENMIGAAQVPMGVVGPVPVDGGAATGDHYLPLATTEGALLA
FT                   SVNRGLGVIRSAGGADARVTKNGMTRAPVFRVAGVAEAAETVEWVNENTEALAEAAEST
FT                   TSHGELIDVEPYVVGDSVYLRFAYDTKDAMGMNMATIATGEACEIVERETPADLVALSG
FT                   NLCSDKKPAAINAVEGRGRSVTADAVIPGELVEDRLHTTPEAIAEANTRKNLTGSAKAG
FT                   SLGFNAHAANVVAAAFLATGQDEAQVVEAANAITTMDAREREDGTTDLYASVSLASLEV
FT                   GTVGGGTKLPTQSEALEVLGLRGGGDPPGSNADALAEIIAVGALAGELSLLGALSSRHL
FT                   ASAHEDLGR"
FT   gene            complement(573530..573904)
FT                   /locus_tag="Htur_0538"
FT   CDS_pept        complement(573530..573904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59436"
FT                   /db_xref="GOA:D2RVS2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59436.1"
FT                   /translation="MDETVDVQEQAIGAGSIAALALVAYGRFIDETLFGVDATTLGLGA
FT                   FAATFAAVALLHGAYGRRDFAVSHAVSAVGLGLVVLASSVLPMLVGLVLLIGAGSYTAR
FT                   TTIRARNEATEEREAAPENA"
FT   gene            complement(573957..574481)
FT                   /locus_tag="Htur_0539"
FT   CDS_pept        complement(573957..574481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59437"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59437.1"
FT                   /translation="MYAVVGCSECSNLWIIEGRSETTQCPRCGARKAYEKRKKFVETDD
FT                   AGHARDVRASMLANRQGEGEAFAELDSFNALEDEVADGVVDDDEYLEESGLDVEEVSAA
FT                   GERDPRGPTRSGSKKEIVERALEDLERPTEDEIIDYAGERGVSAEYAQDALEKLVGRGE
FT                   VSESRGRYRRL"
FT   gene            574694..575035
FT                   /locus_tag="Htur_0540"
FT   CDS_pept        574694..575035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0540"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   ppd:Ppro_0731 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59438"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS4"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB59438.1"
FT                   /translation="MERVSIDDCEPSEAADGVHLALLAGTDSMNVQHFEIEPGATVDEH
FT                   SHPHDQTGYIVQGELTFLTDGEEIVCGSGDSYAIPGDQPHAAENRGDETVRGVDIFSPP
FT                   RENPSWQED"
FT   gene            575392..576765
FT                   /locus_tag="Htur_0541"
FT   CDS_pept        575392..576765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0541"
FT                   /product="Mn2+/Fe2+ transporter"
FT                   /note="KEGG: dps:DP2260 Mn2+/Fe2+ transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59439"
FT                   /db_xref="GOA:D2RVS5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS5"
FT                   /inference="similar to AA sequence:KEGG:DP2260"
FT                   /protein_id="ADB59439.1"
FT                   /translation="MATESKSSNSRGIGRIGAYLGRLGPTWLAGAIAAGPATMGSLLVA
FT                   GASFEYALLWVVVLSAILGTVGQYLAMRLGLLTEAGIVSVAERHLGSFWAWVLVIDAVL
FT                   AAGLAQIVIMKTLASVSATIAAEAGVGVAALTDPRLWGIAWAVLLALGLAGGGYRFAEV
FT                   GAKVLVSIVVVAFLAAAFVAPIDPAAAAGGLVPGIPAGVDGALVAAGILGGAVHITLLT
FT                   MQSYTMRARGWTVRDADTALVDIASSMLLAFGAFSLAVFLVAASVLPSAGVDPATIDGV
FT                   GAAQTLGPVAGEYATWVFLAGLLGAAVSTLGGNTIVPPYLLADKLGWERSTDDGRYRAA
FT                   IAGFALVSAVGAFLGGTFFQLLVLTLAFGLVGTPFAIAVLLVLLNDPDVVPETNSLPAN
FT                   VGGIALFAVAAVLAGEFVQGELETITEPASAFVVVFAVAMALAIVGLAGKYGRERLAA"
FT   gene            576829..577563
FT                   /locus_tag="Htur_0542"
FT   CDS_pept        576829..577563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0542"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pca:Pcar_1438
FT                   3-oxoacyl-(acyl-carrier- protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59440"
FT                   /db_xref="GOA:D2RVS6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB59440.1"
FT                   /translation="MPALADDVIVVTGASRGLGRAMVERFSDEGARVVLTARDEERMDE
FT                   IATDLPGESLVVPADVRDADAVERVVARTIEEFDRVDTLVNNAGVSLLGMYDGRNRLEE
FT                   ISEEDWDTVLEVNLKGVFLFTRAVLPHMYERESGNIVNVSSGLGRHAIAGAGPYVSSKW
FT                   GLEGLTRTTALEAEDRGVNANAVDPGGRVDTAIWDHLPDDEREEILDPDVMNDAAVLLA
FT                   AQGPDGVSGESMPAEEWEQRLG"
FT   gene            577642..578307
FT                   /locus_tag="Htur_0543"
FT   CDS_pept        577642..578307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0543"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: dal:Dalk_2318 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59441"
FT                   /db_xref="GOA:D2RVS7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS7"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ADB59441.1"
FT                   /translation="MSRELDALARELSIPYYEAALPAHDSFHANRVRDMALRLANECEE
FT                   TVDRDVLSAAAWLHDIGRPAERTGEIDDHDEWGAGEAAKLLAAEDVSAGRIAAIEHCIR
FT                   THSIRSSSPEPETLEATLLFDADKLDATGAVGIVRLACIVGERSGRTGEKHAVIDDPSV
FT                   QRAATADGPDVALLREWARERLDELYTDPARRLGASRWEFMESFFARFADELGVEGER"
FT   gene            complement(578329..578769)
FT                   /locus_tag="Htur_0544"
FT   CDS_pept        complement(578329..578769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0544"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ade:Adeh_4202 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59442"
FT                   /db_xref="GOA:D2RVS8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB59442.1"
FT                   /translation="MTEVRVADAERAREDAFAVRQTVFVEEQGVDEELEYDAHDETATH
FT                   FVAYDGDEPVGAARLREYEDGVGKVERVAVLESHREDGVGRAVMDAVEVRAREEGLESL
FT                   KLHSQTRAAGFYRSLGYERHGEEFEEAGIPHVKMRKLLGESE"
FT   gene            complement(578943..579458)
FT                   /locus_tag="Htur_0545"
FT   CDS_pept        complement(578943..579458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59443"
FT                   /db_xref="GOA:D2RVS9"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59443.1"
FT                   /translation="MSPTLEPESLCERDDVDVQTETQTLTRTEFETARDLEDHLTLGVA
FT                   NDAGEVLLVADGVRGWTLPGAPVGPDDNWDTIARRSLESLTGVDAGIAEPVRVRRVEFE
FT                   RDDDADQQRTTYDVLVRTASVPGRPIADEPTVTGEDVTDVIWLDRVPEDASGAIAADIE
FT                   AVLERSVE"
FT   gene            579640..581376
FT                   /locus_tag="Htur_0546"
FT   CDS_pept        579640..581376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0546"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000700 probable two-component sensor
FT                   histidine kinase/response regulator hybrid protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59444"
FT                   /db_xref="GOA:D2RVT0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVT0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB59444.1"
FT                   /translation="MSAEPHADVSDRSTGESERGSSAPFRLGPRQFRWAWIVAGLFVLA
FT                   SAGWLRFSIGGTRGTLLYSNVVLTASAAAAAVALGLLARRSEPPDALGWGLVAVGTGLF
FT                   AAGEFAWMYYELWLGGVPFPGVPDLFYLSDYLFLAAGLLVIAVSQHRLGSLLRIILDGL
FT                   LVALALLAISWQFVLEPILASGAAGGATLWVSAAYPSLDIVLAAVAFVVAAHARGPRRV
FT                   PITLLAAGNVVWAFGDSAFAYLSITGGYVYGEFDAIWLAGNLIVALAALHPSAATPPLE
FT                   GDRRRYAFRETVAPYAPFLLAMAVTGYAASTGTLGPVELALGALVLLALVARQTYVFFD
FT                   AAALSRCLERNEETLSRRNEELLLLNRIVRHDIRNDMAVVLGWGEELNDRLDDDDERAM
FT                   LERMLDTTQHTIELTETLQAFTELWDDDGDRATNPVSLEAMLAETLERRREAYADVEFV
FT                   VDGSIPAVTVSAGPLLSTVFRNLLNNAVQHNDAADPRVVIAADTGPETATVRIADNGPG
FT                   VPADRRDAVFGRGEMGLESEGSGVGLYLVDTLVSQYGGDVWIESSELGGAAVVVELQRY
FT                   RE"
FT   gene            complement(581593..582870)
FT                   /locus_tag="Htur_0547"
FT   CDS_pept        complement(581593..582870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0547"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: eta:ETA_19490 isocitrate dehydrogenase;
FT                   TIGRFAM: isocitrate dehydrogenase, NADP-dependent; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59445"
FT                   /db_xref="GOA:D2RVT1"
FT                   /db_xref="InterPro:IPR004439"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVT1"
FT                   /inference="protein motif:TFAM:TIGR00183"
FT                   /protein_id="ADB59445.1"
FT                   /translation="MSYDKIEVPDAGEKITLKEGSEDEIEVPDNPIIPIIHGDGIGKDV
FT                   GPAAQKVLEAAAEATGRDISWMRVYAGESAREEYGEDVNLPDETVDAIREHRVAIKGPL
FT                   TTPVGAGFRSLNVALRQTLDLYANVRPTYYLDGVPSPMKAPEEMDMVTFRENTEDVYAG
FT                   IEWEAGTDEVEQVREFVEDEMGFDETMHDGPIGIGLKPITEKGSKRLVREAIDYALEHD
FT                   RDKVTLVHKGNIMKFTEGQFGDWGMEVADEEYPDDEVFAAPDSLWETQDEVDIPEDAVM
FT                   VEERLADAMLQWMQLRTDEFDILAMPNLNGDYLSDAAGAQIGGLGIAPGGNFGKGRMLA
FT                   EPVHGSAPKRAGQDMANPTAMILSGRLMFDYLGWDDAADLIRDAVEETISSGKVTYDLE
FT                   RQLEDAEKLGTSEYTDEIVDTIEKLS"
FT   gene            583496..583609
FT                   /locus_tag="Htur_0548"
FT   CDS_pept        583496..583609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59446"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59446.1"
FT                   /translation="MLETPHYAARHCPHCATTLSNVQGVAACPECQWIDSD"
FT   gene            583715..584617
FT                   /locus_tag="Htur_0549"
FT   CDS_pept        583715..584617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0549"
FT                   /product="methionine aminopeptidase, type II"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: methionine aminopeptidase; K01265 methionyl
FT                   aminopeptidase; TIGRFAM: methionine aminopeptidase, type
FT                   II; PFAM: peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59447"
FT                   /db_xref="GOA:D2RVT3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVT3"
FT                   /inference="protein motif:TFAM:TIGR00501"
FT                   /protein_id="ADB59447.1"
FT                   /translation="MAESEVDLESEKYEKHREAGEILAQVREEAAERVEVGTSHLKIAE
FT                   FAEDRIRELGGEPAFPVNISIDEEAAHATPSIDDDTTFGEEMVNLDIGVHVDGWLADTA
FT                   ITVDLSGNPELAEASEQALEAALDIIEPGVDTGDIGAEIEDVIDGYGYNPVVNLTGHGL
FT                   GHWEQHTSPNIPNRAVSQGTTLEVGDVVAIEPFATDGGGKVSEGASEEIFALEREGSVR
FT                   NRQAREALEQITEEFRTLPFATRWLETDRPEMALRRLKRNDIVHGYPVLKEDDGYLVSQ
FT                   KEHTIIITEDGCEVTTASD"
FT   gene            complement(584749..584949)
FT                   /locus_tag="Htur_0550"
FT   CDS_pept        complement(584749..584949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59448"
FT                   /db_xref="UniProtKB/TrEMBL:D2RVT4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59448.1"
FT                   /translation="MATTDDSFNGMTEHCPDCDLETLHEVSVQIRTESLKKENAQFSRE
FT                   PYRVAECQRCGNRSSQRMNNA"
FT   gene            585201..585746
FT                   /locus_tag="Htur_0551"
FT   CDS_pept        585201..585746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0551"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   afw:Anae109_2290 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59449"
FT                   /db_xref="GOA:D2RW60"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW60"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADB59449.1"
FT                   /translation="MDQVFAPWRIDWIKRDEGNPDVEDCVFCELPALETDRENLIVARS
FT                   EHAFVMFNNYPYNPGHAMVIPHTHTGDYTELDGEQLLDHARLKQRTFDALEVGLEPDGF
FT                   NAGLNLGDGAGGSIDDHLHTHVVPRWEGDTNFMPVISDTTVIVEALEETYERVREAFAE
FT                   QAGATAPDEDSAVVFEFE"
FT   gene            585827..586717
FT                   /locus_tag="Htur_0552"
FT   CDS_pept        585827..586717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0552"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mca:MCA2608 mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59450"
FT                   /db_xref="GOA:D2RW61"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW61"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADB59450.1"
FT                   /translation="MYVLARLEELIAAYLSLLDNVATFLLTFALVYAFGRVVVRPLVSA
FT                   ALDYRDTERTLQRGLERVVAFGVITAAIVVGLSIAGLSFVLDRAAILVAALTVALGFAA
FT                   QNVVGNFVSGAFIVTDPSFNIGDWIRWSDQEGIIEDISFRSTRVRTLDNETITVPNSEL
FT                   TANAVTNAVLNDRLRLTFPIAVSYDDDLDAVTRILTDAAVDHPDILADPQPTARIAALD
FT                   DAVQVVASFWIADPDSSTYARVRSEYAREIVDRLEREGIDLAAATPQALEQSVAAGPRS
FT                   AIHARTDDIGSGTDE"
FT   gene            586778..587188
FT                   /locus_tag="Htur_0553"
FT   CDS_pept        586778..587188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0553"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bra:BRADO2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59451"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW62"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB59451.1"
FT                   /translation="MEYEVIHTDDVPMTDLSENDEIPPDLRIRALDEVLGTDHVHLKLW
FT                   YFDPGEEIRYHAHAEQEELYYVLEGEFSLKLGRSGEEEYVEAGPGTFWIAKPEIGHGHR
FT                   NVGDEEGVVLAIGAPAVEDPGLDPHGLDEGDG"
FT   gene            complement(587210..587446)
FT                   /locus_tag="Htur_0554"
FT   CDS_pept        complement(587210..587446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0554"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; glutaredoxin 2; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59452"
FT                   /db_xref="GOA:D2RW63"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW63"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="ADB59452.1"
FT                   /translation="MVTLYQLEGCPYCELVADRLDELDIDYDSVWVEGLHSKRDEVKRI
FT                   SGQRQVPVIVDDEYGVTMAESERIVDYLEQTYA"
FT   gene            587574..588053
FT                   /locus_tag="Htur_0555"
FT   CDS_pept        587574..588053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0555"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   sun:SUN_0752 AhpC/TSA family peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59453"
FT                   /db_xref="GOA:D2RW64"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW64"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADB59453.1"
FT                   /translation="MPPTEGDELPDFEALLCDGETFRSTALSAALGERGGVVICTGFAF
FT                   SAIAQNWWKQFVRAGWGAFEDVAVLGVSRDGPYAQNEFLRWLDEPAFRFFADVNGEVSE
FT                   SLDLLADRDHMANVSTPWRSAFVADADREVRYAFVADDWISPLPLEEIEDAVATL"
FT   gene            complement(588076..588456)
FT                   /locus_tag="Htur_0556"
FT   CDS_pept        complement(588076..588456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59454"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59454.1"
FT                   /translation="MSDTTTETTACARAERDGPLGCTPRRIVELLTDDDARAIYRYLDE
FT                   PAPVREVSEALDLPLSTTYRKVEALCDAGLLTELEGQTGGDVPAHYVRALEHVSVTYGD
FT                   PLRIECAKNGTTLYCEPEALTR"
FT   gene            complement(588576..589829)
FT                   /locus_tag="Htur_0557"
FT   CDS_pept        complement(588576..589829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0557"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: radical SAM domain-containing protein / TRAM
FT                   domain-containing protein; TIGRFAM: MiaB-like tRNA
FT                   modifying enzyme; RNA modification enzyme, MiaB family;
FT                   PFAM: Radical SAM domain protein; Protein of unknown
FT                   function UPF0004; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59455"
FT                   /db_xref="GOA:D2RW66"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW66"
FT                   /inference="protein motif:TFAM:TIGR01578"
FT                   /protein_id="ADB59455.1"
FT                   /translation="MARYHIETYGCTSNRGESREIERRLRDAGHYRVDGPDEADVAILN
FT                   TCTVVEKTERNMLRRAEELSEETADLFITGCMALAQGEEFRAADVDGQVLHWDEVPEAV
FT                   TNGECPTTTPDAEPILDGVVGILPIARGCMSDCSYCITKQATGKIDSPPIEENVEKARA
FT                   LIHAGAKEIRITGQDTGVYGWDEGERKLHRLLSEICAIEGDFRVRVGMANPKGVHGIRE
FT                   ELAAVFAENEELYDFLHAPVQSGSNDVLGDMRRQHQVDEYVEVVETFDDALDYWTLSTD
FT                   FIVGFPTETDRDHAQSMALLRETRPEKINVTRFSKRPGTDAAEMKGLGGTVKKERSKEM
FT                   SEVKREIVREAYADMVGEVREDCLVVEEGTADSVKCRDSAYRQVIVQNASEYGIEPGDF
FT                   VDLEVAAHETMYAFGEPV"
FT   gene            complement(589994..590131)
FT                   /locus_tag="Htur_0558"
FT   CDS_pept        complement(589994..590131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59456"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59456.1"
FT                   /translation="MDATEPRDPITNVRLEDPDLPVYLPGTPTVSFTEYVELAIDSLRR
FT                   "
FT   gene            complement(590245..590565)
FT                   /locus_tag="Htur_0559"
FT   CDS_pept        complement(590245..590565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59457"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW68"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59457.1"
FT                   /translation="MRVRTYIYDSAAPADHVDRVRERLATRDEEFESLDVASADDRSDA
FT                   VREAMFAIRESVRIGTTPDELYDDSGEPDFSAGVLITAESTGRRTIHVGREALEALAED
FT                   EP"
FT   gene            complement(590675..591694)
FT                   /locus_tag="Htur_0560"
FT   CDS_pept        complement(590675..591694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0560"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   dma:DMR_19840 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59458"
FT                   /db_xref="GOA:D2RW69"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW69"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADB59458.1"
FT                   /translation="MNISKGFLLALVAVLAFLSWLLIAPFLQYALIAVLLAYVLRPVQR
FT                   RLERRTSSMIAAMALVLLTITGFVIPLAIILTVVIQDATRIVENLDADSVSVTEVESLI
FT                   QEQTGMSVDLMSSLTDAARQGGQLVLEQSTAWLSAFTHALIGFGLALFMLYYLLKDGDK
FT                   LIGWIRKRTPLPDDVQDDLYTELDEVMHAVLIGHVLIALVQGLLAGIGLIVTGIPNAAF
FT                   WTVIMVVLALIPIIGTFLVWGPAVVFLLATGEPLFAVGLFVYSTVIVGLSDDYLRPLVV
FT                   DRYAELNPAVIIVGVLGGAYAFGFMGLFFGPVILGALRATLTVFHDNYDRLEREKFGG"
FT   sig_peptide     complement(591602..591694)
FT                   /locus_tag="Htur_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.823 at
FT                   residue 31"
FT   gene            591884..592621
FT                   /locus_tag="Htur_0561"
FT   CDS_pept        591884..592621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0561"
FT                   /product="protein of unknown function DUF547"
FT                   /note="PFAM: protein of unknown function DUF547; KEGG:
FT                   similar to guanine nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59459"
FT                   /db_xref="InterPro:IPR006869"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW70"
FT                   /inference="protein motif:PFAM:PF04784"
FT                   /protein_id="ADB59459.1"
FT                   /translation="MSTQLDPLSLSADLLYAVKTEGDTDWLRDHLATLERSRLDRALER
FT                   RTAKLAFWLNCYNAYTQLLLEDGSELDGEAGRLERWKFVSRDRIPISGVRLSLADIEHG
FT                   MLRRSKHPWGFGYVPRPLPSSFERRYRLPECDPRIHFAISHCADPSPPITTYSPPDVDT
FT                   ELDVAVEWFIEETVTYDADAGVATVPRLFHRYRGDFGGKRGVISFLRTYDAIPSGHRPS
FT                   LEYESMTRTPDVDFDADIAEFHP"
FT   gene            complement(592646..593281)
FT                   /locus_tag="Htur_0562"
FT   CDS_pept        complement(592646..593281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0562"
FT                   /product="protein of unknown function DUF1508"
FT                   /note="PFAM: protein of unknown function DUF1508; KEGG:
FT                   bcs:BCAN_A0989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59460"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR027598"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW71"
FT                   /inference="protein motif:PFAM:PF07411"
FT                   /protein_id="ADB59460.1"
FT                   /translation="MDDSPTEVEFELERAYDREELAAVFREFGDALAGDRPLKIDDGER
FT                   TATVSIPERVVAEFEAEREDDEPPVAELELELEWDDPGGSTIRLGDSERGTPGVVGAEA
FT                   ESAAETGTGSGTAATGDPETDSETATMPPEAVPGGPKADESTTEGGRTSRFEVYEDRGG
FT                   EWRWRLVHWNGNIIADSGEGYTSRSNAKRAARSVMRSAPTASIENRED"
FT   gene            593381..594226
FT                   /locus_tag="Htur_0563"
FT   CDS_pept        593381..594226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0563"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59461"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59461.1"
FT                   /translation="MTSRDWQADRRAVFDRDDHACRHCEESGDAADPTALRTYPVGAVP
FT                   LEGTVHESSLATVCTDCFETLQSASDSPASSAESVSSEALFRLVRETTRVQGGAIADVA
FT                   SFASLATSLPTTLADARAEADAAADSDSTFDAAVDETAAAYRDGRREALLALDVADARL
FT                   ERVRSVDGAAFDADVRSSLSTVTETATDLQSTLREAVARSEIVPVCLERCHGCFEPLEG
FT                   DACSTCGLEVLETADWRGEEGVAFERLFSSINDSLQGASTTTETLTERTMTLATQLTES
FT                   "
FT   gene            complement(594228..594983)
FT                   /locus_tag="Htur_0564"
FT   CDS_pept        complement(594228..594983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0564"
FT                   /product="putative transcriptional regulator, AsnC family"
FT                   /note="PFAM: TrkA-C domain protein; SMART: Transcription
FT                   regulator, AsnC-type; KEGG: dma:DMR_43700 AsnC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59462"
FT                   /db_xref="GOA:D2RW73"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW73"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ADB59462.1"
FT                   /translation="MDHRLDEIDRRIIYALMDDARNTSAPTIAADVSVSPGTIRNRIEQ
FT                   LEERGIITGYHANVDFERAAGHLANLFMCNAPVSERESMAQRAQVIPGVTNVRELLTGR
FT                   RNLHVLAVGEDTADLRRIARALSDLGIEIEDEVLVQNEIGCPYAPFGPTDETHEAMLTD
FT                   FISLSGDAEVAEVTVDRDARIAGMSLQEAAQREVLDDDSLVVAIERDDAVVTPHGDTVI
FT                   RPDDIVTLFSRDGVTDETIDVFRTDDAAE"
FT   gene            595244..595678
FT                   /locus_tag="Htur_0565"
FT   CDS_pept        595244..595678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0565"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dds:Ddes_1517 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59463"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW74"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADB59463.1"
FT                   /translation="MTDALLETMLVPIASEDDAKRTCEAILSELNDRATVHVVHVIEKA
FT                   GGAPDKAGVAQREERAERIFEIVESTLAGTNTALETEILYGTDVAATILEHARDLEATA
FT                   IVFTPRGASRWMRLLTGDVAQKLLTNTDRPLVILPRSDHE"
FT   gene            595671..597965
FT                   /locus_tag="Htur_0566"
FT   CDS_pept        595671..597965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0566"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; UspA
FT                   domain protein; KEGG: bpy:Bphyt_6715 amino acid
FT                   permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59464"
FT                   /db_xref="GOA:D2RW75"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW75"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADB59464.1"
FT                   /translation="MSDEELAKDLGLLSALAIGMGTMIGAGIFVLPGVAAQEAGPIVVV
FT                   SFVVGGMIAMVNALAVSELGTAMPKAGGGYYYINRGLGPLFGSISGMGDWMGLAFASAF
FT                   YCIGFGGYLTDLLAGTMLALPTLELGLVALSDIQLGALIAGLLFVGVNYMGAKETGGVQ
FT                   TVIVTVLLGILTVFAASGFFHFDWATLTTDGLAPTDRGYGAILPGTALVFVSFLGYAKI
FT                   ATVAEELQNPGRNLPIAVIGSVAVVTAIYAILVATMVGIVPWHSLDDSVPVSQVAEITF
FT                   AGVPVLDAVGVTLISLAAMLATASSANASILSSARINFAMGRDKIVTDKLNEIHPRYAT
FT                   PYRSILLTGGVIIVFIAALGQDLEILAKAASVLHLIVYGLMNLALIAFREADVPEYDPD
FT                   FRVPFYPVTPILGALLSFGLVAFMDTIEIALSLAFVAVAVLWYAFYARAKTPRQGVLGE
FT                   YILDRSEELPDVAVSAASAARPDGSGQYRVMVPLANPRTERHLIELASTLAAENDGVVH
FT                   AVHIVQVPDQTPLDRGAEHIERIDAESEALLELAREHAEDRGAEIETTTIVSHRSFEEV
FT                   FDAARQHDVDQVVMGWGDDRPWSAGRAERPLDELAADLPCDFLVLKDRGYDPSRILLPT
FT                   AGGPDSDLSAEVAKTLRSATGSTIQLLHVVDDERERESGEQFLANWAAEHGFGDAVLTV
FT                   DDSGDVEGAIAREAEDRTLVVIGATERGLLSRLVRGSLVFDVVDEVDCSVLLAERPAER
FT                   SLRERLFGRSE"
FT   gene            complement(597989..598717)
FT                   /locus_tag="Htur_0567"
FT   CDS_pept        complement(597989..598717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0567"
FT                   /product="Purine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   vcj:VCD_003308 uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59465"
FT                   /db_xref="GOA:D2RW76"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW76"
FT                   /inference="protein motif:PRIAM:2.4.2.1"
FT                   /protein_id="ADB59465.1"
FT                   /translation="MATQPHLLVDDGDLTDRVLVPGDPGRVDRIADHCDESETVAQNRE
FT                   YKVVNATYEGQELTICSTGIGCPSAAIAVEELANVGVETIIRVGTTGALQSGIEIGDMV
FT                   VATGAAKEEGTSKRYEAAEYPAVPDYDVLSALVDSAEANGEDVHVGPIVSDDAYYAETD
FT                   EHVVDWEAAGLLAVEMEAAAIFSLARRKGLRAGAICTVDGNLVEGTQKGTDTEDDELPE
FT                   KAKNNVGRAIDISLEAATRL"
FT   gene            complement(598863..599165)
FT                   /locus_tag="Htur_0568"
FT   CDS_pept        complement(598863..599165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59466"
FT                   /db_xref="InterPro:IPR040624"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59466.1"
FT                   /translation="MTERRIRESSGCEFKRRIQYERDANEPPSIATATALAQYFDDDIG
FT                   STNTRLYDYINPDALDSLFADTHRGASRADGTVEFSVENATVTVTPERVEVSPDC"
FT   gene            complement(599287..600174)
FT                   /locus_tag="Htur_0569"
FT   CDS_pept        complement(599287..600174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0569"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: vpa:VPA1083
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59467"
FT                   /db_xref="GOA:D2RW78"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW78"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADB59467.1"
FT                   /translation="MPPTVLTAGHVNWDVTLRVDRLPAADGEATIRSQRQSGGGSAANV
FT                   AAALAGLEVDAGLIGSVGDDDNGLLARRGLEEAGVSLSGIRVVEGAETAVKYLLVDDDG
FT                   AVSILGNDGVNEAVRPADIDADRVRAADHVHLTSQRPETAARIASIAAAADVTVSFDPG
FT                   RRFGDRTYDETVAAADILFVTEHEAAALVDAAGVDSEPTDRIVAITSGGDGAEIRTPDD
FT                   SYAHPGFDVDSVDTAGAGDSFAAGFLTSRLEGASIEDALEYANACGALTASREGARSAP
FT                   TASEVERFLEERAG"
FT   gene            complement(600213..601034)
FT                   /locus_tag="Htur_0570"
FT   CDS_pept        complement(600213..601034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0570"
FT                   /product="Protein of unknown function DUF63"
FT                   /note="PFAM: Protein of unknown function DUF63"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59468"
FT                   /db_xref="GOA:D2RW79"
FT                   /db_xref="InterPro:IPR002749"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW79"
FT                   /inference="protein motif:PFAM:PF01889"
FT                   /protein_id="ADB59468.1"
FT                   /translation="MVLPEGFVLPPWYLLVPLLVILAGIVALLWVLEPPVTDRTVLAFA
FT                   PWMMFGSALHVLYQLGAYPENVETLFATPTVYLVAAAVAGAAWIVAIFLYAGGLQPTIP
FT                   RFFGIAGTAFFAVFASIILNVSWAEETFNLFWPVIAVIAAGIVTAIAWVALSLWFTDVA
FT                   KTTSYTGALVVFGHTLDGVSTAIGYDVIGVEESVPLSALLLEAGGSLPIAEYVGAGWLF
FT                   VLVKAALALVILGLFKEYVEDAPQQARIVLSGIAAVGLGPGVHNVLLFIAT"
FT   gene            complement(601155..602138)
FT                   /locus_tag="Htur_0571"
FT   CDS_pept        complement(601155..602138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0571"
FT                   /product="translation initiation factor, aIF-2BII family"
FT                   /EC_number="5.3.1.23"
FT                   /note="KEGG: scl:sce1574 translation initiation factor IF-
FT                   2B alpha subunit; TIGRFAM: translation initiation factor,
FT                   aIF-2BII family; eIF-2B alpha/beta/delta-related
FT                   uncharacterized protein; PFAM: initiation factor 2B
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59469"
FT                   /db_xref="GOA:D2RW80"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005250"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW80"
FT                   /inference="protein motif:TFAM:TIGR00511"
FT                   /protein_id="ADB59469.1"
FT                   /translation="MDDRGPDVAPAVVTTADEIAAMEIRGAATIADAAAEALAIQAERS
FT                   DAERPDAFERQLRAAAKTLYETRPTAVSLPNALRYVLAGMDGETVAELRASTIARAEEF
FT                   QRDLAQAQSKLGSVGANRLRDGDVVMTHCHSTDALACLEAAVEDGTEIEAIVKETRPRL
FT                   QGHITARQLREWDVPVTVIVDGAARRYLDQADHVLVGADSIAADGSVINKIGTSGLAVI
FT                   ARERGVPVTVAAQTIKLHPDTMTGHTVEIERRDEREVLDDDERAAITDTADGADDGLTV
FT                   ENPAFDVTPPRYVDAIVTEHGQFPPETVVTLMRELFGETVDEPWEL"
FT   gene            602212..602847
FT                   /locus_tag="Htur_0572"
FT   CDS_pept        602212..602847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0572"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: dps:DP1973 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59470"
FT                   /db_xref="GOA:D2RW81"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW81"
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /protein_id="ADB59470.1"
FT                   /translation="MDRSELAPLIDHTVLGPETSIADVRRVLDEAREYGMNACVPPYAV
FT                   ETAADYAPEVTLATVVGFPHGQHAAAAKRREGVLAWKAGADELDVVLNVGRLKAGEDDV
FT                   VRAELAEITAAVPIPVKVIIETALLTDEEKHRACEAADAADAAMVKTSTGFSEAGATVA
FT                   DVELMREYLPVKASGGVGSYDEAMAMLAAGAERIGASSGVEILEGAPE"
FT   gene            602939..604339
FT                   /locus_tag="Htur_0573"
FT   CDS_pept        602939..604339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0573"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: abo:ABO_0074 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59471"
FT                   /db_xref="GOA:D2RW82"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW82"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADB59471.1"
FT                   /translation="MLESVLARLRATRRRLRRLERRELDAFVRWIEHTGNLIHLSVLLF
FT                   VPLLIAAVTWLANATAVVSFLLFPPLASGTYTLFADPEGRYSTPTKFVGGMTAGALCGW
FT                   LAIALVDAAGIGGVAGVSATGAALGIFLTGAVTWALDLEEPTAFSTALLVLVSGNAQVV
FT                   YVLGIVVSSSFVAAVFVVWRDRFYERRAQYLYRTTDGDDHVLVPLDEDWAEDPGDGETA
FT                   PVARFAAELASAHDAGKLVLFDTVDDGDEIAETEPGPAARRLESFAADLSAEYGIPCEV
FT                   VVAAGDRTSALALRTAREHNCDLIVTPYAEREGGGLSPFIVGLFDSEIDVIAFRSAENR
FT                   QRWEHALVPVRGAGDTARAMVDFAQRITGSWHPTSVCTCIDRESERRDAETTVADLVDA
FT                   FEGRFETHVVTEPVESYLERLSPRYDVIFVGSSTDRSAASRFVSPPTFERLSDLETDVA
FT                   IVHRGRHR"
FT   gene            complement(604369..604689)
FT                   /locus_tag="Htur_0574"
FT   CDS_pept        complement(604369..604689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0574"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   atc:AGR_C_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59472"
FT                   /db_xref="GOA:D2RW83"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW83"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ADB59472.1"
FT                   /translation="MSSSAATALDPTTVGVVLAMAVVTYTTKAGGLWLVGRLELTDRAE
FT                   TALEVLPGVIVVSLVAGELAEGGPAAWLGAAAVAVVVRKTESLPLALLAGIGTVVLVRG
FT                   RI"
FT   gene            complement(604686..605399)
FT                   /locus_tag="Htur_0575"
FT   CDS_pept        complement(604686..605399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0575"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: gbm:Gbem_1389 AzlC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59473"
FT                   /db_xref="GOA:D2RW84"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW84"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ADB59473.1"
FT                   /translation="MLRGFRDCLPVAVGVAGYGVAFGVLASQAGLSAAEATLMSATVLA
FT                   GAAQLLAVDLWAASASVATIVLATAAVNLRYLLLGATLRPWFADRSVLETYGSAFFTAD
FT                   ENWALTMRAFADGGDAVGNGSESADAAYLLGSGLAIWVLWVAATVVGALVGDGVTDPAR
FT                   YGLDAAFLIVFVAVAVDLWDGRTDLPPWTAAFVAALATAVAVPGRWYLLAGALVGCSVG
FT                   VRHADVEADSSGVGG"
FT   sig_peptide     complement(605319..605399)
FT                   /locus_tag="Htur_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.550 at
FT                   residue 27"
FT   gene            complement(605617..605958)
FT                   /locus_tag="Htur_0576"
FT   CDS_pept        complement(605617..605958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0576"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59474"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59474.1"
FT                   /translation="MAIPTWTWGERTGAQTPAGPDGGEATGDRETAADLSRTADEFELL
FT                   ASPIRLEILSALADRETPLRYTDLRAATSIDDNGKLNYHLRRLEAVVSNRDEGYELTPR
FT                   GRRLVERLP"
FT   gene            complement(606005..607192)
FT                   /locus_tag="Htur_0577"
FT   CDS_pept        complement(606005..607192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0577"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein; KEGG: efe:EFER_1184 voltage-gated potassium
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59475"
FT                   /db_xref="GOA:D2RW86"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW86"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADB59475.1"
FT                   /translation="MADDRSLRSRLPDNWHRVLSMRAAVALALIVAGLSVATAIVNIGT
FT                   NAVGGPLSDYVPEAIQSAAAFTGALTGFLMVGSALALRRGLRVGWWATLLLLPLTAAQG
FT                   LLQSSPYSVPLVVLSLLSIPMLLVSHKRFDKSLSLSTTQIAAGFALLGVQAYGTFGAYA
FT                   LREDFEGINTILDAFYFTLITSSTVGYGDVTPDQGSTQAMLFTMSVLVLGVASFGIAIG
FT                   ALVGPAIQARITKTLGKMTDSQLELLEDHVLVLGYGELTEPIVDELATNNREFVVVTGD
FT                   REAAETLTDRGLAVIRGDPSDEEPLQRAKIDRASAILVATNHDAEDALSILTARQLAPE
FT                   TRIVSAATDRENTRKLEHAGADAVISPSVLGGHLLVQSALGADESELIEYIMDGD"
FT   sig_peptide     complement(607079..607192)
FT                   /locus_tag="Htur_0577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.334 at
FT                   residue 38"
FT   gene            607440..608684
FT                   /locus_tag="Htur_0578"
FT   CDS_pept        607440..608684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_3367 RND family efflux transporter
FT                   MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59476"
FT                   /db_xref="GOA:D2RW87"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59476.1"
FT                   /translation="MALPVEVLLGIYLGLLTGIVPAFVAGSLGFLVRYFTGVTLPGFGV
FT                   VVLALSIASVQGGLLGLVEPTIAQSPRLLVAVLVVLMLALYAHNQGDKLGAELPRRLSL
FT                   TSIRQRTLSADVVELVGNVGQVTVRPTGEIHDMEGYPPLSPDLRRSLKNGSWRLPADLP
FT                   LSELESRLEERLRTDHDLADVTVTIDERARATITAAPPSGGLSKRIPDGRRAVSIATLV
FT                   PTGLARGDEVSIRAGERTVAGTVLGARTEIDDEHAAAADEPSAGDETAVPDGGDSAVDA
FT                   APAPKPNAASAGGVGRVTVAVARRDVKALLETETPRLVVRSRGTSREFEAFALVRRAGH
FT                   AIRRFTVGPSADADVRAAADVTVLAARRQGSETGGRRSGWVFAPGIERSLEPGDEVFVA
FT                   GPEAATDEFVEAVAR"
FT   gene            608681..609937
FT                   /locus_tag="Htur_0579"
FT   CDS_pept        608681..609937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0579"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59477"
FT                   /db_xref="GOA:D2RW88"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW88"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ADB59477.1"
FT                   /translation="MTAAAGLEPILAQAVSTEVLLDALVEILGFSLLAGGTAAAVAFVF
FT                   RWYSADGIPDGVAILLGVSMVAIWLNTKSALQQAIIGDTGMLELETAVYTVVAFVASAI
FT                   AADGGRRLGDHLATDVFSLATPRTITEVGQLVRSAGRVVAVELPDEIEDVDGYDPVEES
FT                   TKTELAGHTLLFPRRLSVDELRERLTDRLERDYGIGHVDVEFGADRTIDYLALGSRPAG
FT                   IGSTLAPGTVAVAVRGDPAPDASPGDAVRIWRRDGDSLRRVTGGELRGVADDVATVAVD
FT                   ADDADSLSTEEEYRLVTLPRDPGAERDLVSLLRAVDETVTTLPVDAGDPLEGAVVGSLP
FT                   VFVLAVDRDAAADPLALPSGETRLEAGDVAYVLGRPDALRRIGDLERPGEGLLEGAKSD
FT                   ASEGTSEPADAPADPAQER"
FT   gene            609969..610250
FT                   /locus_tag="Htur_0580"
FT   CDS_pept        609969..610250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0580"
FT                   /product="MoaD family protein"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: thiamineS
FT                   protein; KEGG: aeh:Mlg_1160 molybdopterin biosynthesis
FT                   protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59478"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW89"
FT                   /inference="protein motif:TFAM:TIGR01687"
FT                   /protein_id="ADB59478.1"
FT                   /translation="MATEWKLFADLAERAGDKHVTVDADAGDTVGDALEQLVTDRPALE
FT                   ERVLEDGDLRSQINVLRNGTNVLVEEEGLETVLEEGDELALFPPVSGG"
FT   gene            complement(610258..610602)
FT                   /locus_tag="Htur_0581"
FT   CDS_pept        complement(610258..610602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59479"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59479.1"
FT                   /translation="MYHPPYESGEIVDDGDLAFIDDGLETPERYVGFEDTLVVVAPDVR
FT                   RHVTPADAVTGDTSLLECYPVAADWFQEPYCDDDTVLIHPEGAAVAHRYRVVDERRDPI
FT                   ERDRRTPSSA"
FT   gene            complement(610677..611669)
FT                   /locus_tag="Htur_0582"
FT   CDS_pept        complement(610677..611669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0582"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59480"
FT                   /db_xref="GOA:D2RW91"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW91"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB59480.1"
FT                   /translation="MVLDSVSDFGLEIRRATHDDYAAVADFTGDIWPDRGGDYIPRVYH
FT                   EWLEDEPGQGKKTFLAEVDGEPAGIVQGVMLTDDEAWFQSLRVAADYRRRGVSRRLNEA
FT                   TFEWAREQGATVGRVMIFSWNAPSLGAARANGFEPITEFRFAHPDPDPDAVANLEADGD
FT                   DSYRVSSDPTAAWRYWTHSDAREHLDGLAMAPEESWAVRELTRTDLERLADETAVFAVT
FT                   GPDGLAGMAYRSRTYEREVDGDSSEDENETESETERETWAEYGVGAWDDVDAARALFAA
FT                   IARDAADRGADETRVLIPETPRHVTDAPYAGAGISEEPDFVLGIDLRGE"
FT   gene            complement(611795..612004)
FT                   /locus_tag="Htur_0583"
FT   CDS_pept        complement(611795..612004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59481"
FT                   /db_xref="GOA:D2RW92"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59481.1"
FT                   /translation="MANERTDDPMLDSFQQWQLGLALLFVLSLAGTVGAMTLQMLEVPY
FT                   GGGIGTVGGALLGFLAISYWYYGR"
FT   gene            complement(612086..613360)
FT                   /locus_tag="Htur_0584"
FT   CDS_pept        complement(612086..613360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0584"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, subunit D"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase,
FT                   subunit D; L-asparaginase, type I; PFAM:
FT                   Asparaginase/glutaminase; KEGG: mxa:MXAN_5198
FT                   L-asparaginase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59482"
FT                   /db_xref="GOA:D2RW93"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW93"
FT                   /inference="protein motif:TFAM:TIGR02153"
FT                   /protein_id="ADB59482.1"
FT                   /translation="MNPGDRVRVDRADRTYEGVLLPSSTDDHLVVKLEGGYNVGVDRAE
FT                   AEIETLEEDVYEIDGTDATGPEDDDASDEGADSEIEFDDDLPTISLLSTGGTIASTVDY
FT                   RTGAVTAQFDAEDVLRAVPDLAGRANYRGRVVANILSENMEPPLWQDLARAVAEEIEAG
FT                   ADGVVVMHGTDTMQYSASALSFMLETPVPIVFTGSQRSADRPSSDNVMNAVSAVEAAKS
FT                   DCAEVMVCMHGSESDDVCALHRGTRVRKNHTSRRDAFETVGAEPLGEIDYDTEEIEFRR
FT                   DYQQRGEADLELREGLADDVELLKFTPGMDPAFLDVVEGSEGLILEGTGLGHVHTDLIP
FT                   RIEELIEDGTTVVMTSQCLEGRVCDRVYDTGRDLLEAGVVEAGDTLPGTAKVKLMWALE
FT                   NSEDVEEAMGTSLAGEIQERSVPWE"
FT   gene            complement(613532..613729)
FT                   /locus_tag="Htur_0585"
FT   CDS_pept        complement(613532..613729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59483"
FT                   /db_xref="GOA:D2RW94"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59483.1"
FT                   /translation="MSTELVAFGVSALALGIGVLMAGRRLYPRLDVPEDAESTLQLLTA
FT                   MIAGVLLLTGLGLVLVGLFT"
FT   sig_peptide     complement(613661..613729)
FT                   /locus_tag="Htur_0585"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.880 at
FT                   residue 23"
FT   gene            complement(613829..614038)
FT                   /locus_tag="Htur_0586"
FT   CDS_pept        complement(613829..614038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59484"
FT                   /db_xref="GOA:D2RW95"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59484.1"
FT                   /translation="MSWLAPATFGLIAAGGGVFCYVLVANIEPQPEYPELMTDLARLLG
FT                   LGIALCGLAIGAIFLRAAASAYIA"
FT   gene            614152..614790
FT                   /locus_tag="Htur_0587"
FT   CDS_pept        614152..614790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59485"
FT                   /db_xref="GOA:D2RW96"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59485.1"
FT                   /translation="MSDRSDEVTESRDTDDLLEETESLLSGSDVEADSGAGTASTPEDR
FT                   PGTGGGVGTIDDPLESGTLRSSDEPAPSTAQPAESSRSRLGRLRARLTPGRSPGDYFSP
FT                   RAFLTLVLLVGAGLVGGGMAIPIAGRMLGMFGVAFAIGLLTSKRRYLEMGAAGTAVGGV
FT                   SAVLSNAVLAIAGSTQAVLAVGVTVGLVGCLLGYYFGRDLRNGLTQDIK"
FT   gene            complement(614835..615491)
FT                   /locus_tag="Htur_0588"
FT   CDS_pept        complement(614835..615491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0588"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein ArsR; regulatory protein
FT                   MarR; transcriptional regulator PadR family protein; SMART:
FT                   regulatory protein ArsR; KEGG: bpt:Bpet3500 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59486"
FT                   /db_xref="GOA:D2RW97"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW97"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADB59486.1"
FT                   /translation="MDSAALLDLLGNENRRRILRLLARKPCYVTEISDYLGVSPKAVIE
FT                   HLRKLEEAGLIESRVDDQRRKYFHIARNVRLEVNVSPYGFASKSAYPASSSFDITTCRH
FT                   LSLDVAWEDADELDDLLRALEDLEQLENELSLAQRWVQGRLCDVLDGISETVGTGPESR
FT                   IYADLLASIRTEPKSVGELSEDVDAPREVVADLLESMADEGVVRRTERGWELTTS"
FT   gene            complement(615594..616436)
FT                   /locus_tag="Htur_0589"
FT   CDS_pept        complement(615594..616436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59487"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59487.1"
FT                   /translation="MTSRSVALLALVALLGLTIGPIASGAVVTPFAADENGAESNSTAS
FT                   VSTHMQSSAADTENTVDAELFTKRYETADNESREALVRDRTDELVERLETLKAEREDLR
FT                   ERQDELDRGAYQARMAKFAVEIRSLENEIDRTERRANETGVDADRLDELRTNAETLNGP
FT                   EVAETVRQLGGPDTVPGRGQSDDRPGNGQPDDRPNSGQPAEGDAEKPGNGQGQGDEQAP
FT                   DRAERGPSNDADSDSGPPGESGAPNDDRSGNAGDGSGTDADQPGDGTGSDADTGPESA"
FT   sig_peptide     complement(616359..616436)
FT                   /locus_tag="Htur_0589"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.534 at
FT                   residue 26"
FT   gene            616866..617255
FT                   /locus_tag="Htur_0590"
FT   CDS_pept        616866..617255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59488"
FT                   /db_xref="UniProtKB/TrEMBL:D2RW99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59488.1"
FT                   /translation="MFEVFSRSYYLGRLYVTPTDGDRALMHSEQHERINEEVYATGDGL
FT                   ERLDAPLVMKLESSHFPVHGDDAVPTNTLAVPEPMLEDTDVRNPPSLREVLLARRERAE
FT                   QLLSWTGGWPGSDAGSGDDYPAAGT"
FT   gene            617290..618243
FT                   /locus_tag="Htur_0591"
FT   CDS_pept        617290..618243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Axoneme-associated protein GASP-180"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59489"
FT                   /db_xref="InterPro:IPR040783"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59489.1"
FT                   /translation="MLDALLGRASLKERIDELEEENERLRNRYEAESERRSEAATARQD
FT                   AEERVNRLEDRIAQLEGELEQLEGDEAGLSVRRRDRLRGSRLEAVVDRLTSFRTDPEGA
FT                   LTAILREDEGSETLAEAFDVDLETPLGDRAALVDEAAPCVLCLDDAGLIAAALEPPAMP
FT                   DRALADDSRIAWDDRFRLEREWFLPTGRYALALVRTDLFALGTYADGDRVDYRGFESDV
FT                   KGNHSKGGFSQARFERIRDDQIDDHLERCREALAERVGDDIDRLYLVGQRGVVETLAED
FT                   ASLEPAGTAAVDATGDPKSALEDAHRSFWTAEFRAF"
FT   gene            618328..618447
FT                   /locus_tag="Htur_0592"
FT   CDS_pept        618328..618447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59490"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59490.1"
FT                   /translation="MSAFETVSCSGCGDDFKAYPDSNAAQRGFCSPACALEEH"
FT   gene            618785..619807
FT                   /locus_tag="Htur_0593"
FT   CDS_pept        618785..619807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0593"
FT                   /product="protein of unknown function DUF1611"
FT                   /note="PFAM: protein of unknown function DUF1611; KEGG:
FT                   bvi:Bcep1808_4935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59491"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA2"
FT                   /inference="protein motif:PFAM:PF07755"
FT                   /protein_id="ADB59491.1"
FT                   /translation="MRVAILAHEKFPAGAKTALGVLRYADYEAAAVLDRESAGRRVNDF
FT                   VPDVQDAPIVKGMADLEADAVDTLLIGISPIGGEFDESWRDDVRTALESGCDVVSGLHY
FT                   FLAEDEEFARLAAENDCELRDVRKPPEDLSVAEGVAGEVDAEVVLTVGTDCSVGKMTTT
FT                   MELARAAEEAGHDAAVIPTGQTGIMIEGWGNPIDRVVSDFTAGAVEEMIVEKGDDHDYL
FT                   FVEGQGCIVHPAYSAVTCGILHGSMPDKLVLCHNAGQEAIHGYESFALPDRRTYVDLYE
FT                   SLSAPVSGGEIVAGALNTSDLETDADARAAVEEYATEIDAPATDVIRFGAEDVLEAIVE
FT                   "
FT   gene            619814..620851
FT                   /locus_tag="Htur_0594"
FT   CDS_pept        619814..620851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0594"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: dda:Dd703_0148 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59492"
FT                   /db_xref="GOA:D2RWA3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA3"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ADB59492.1"
FT                   /translation="MALETDFERHAMPLEYPFGIARGTTTERDVVTVRIEDDDAVGVGG
FT                   AAPASHYGETVETVTAVLPDLLAVVEETGDPHRLERIEREMRETVRRNPAARCAVSIAL
FT                   HDLAAKRLDVPLYRYWGLDPGETLETSYTIGLDDTETMREKTETALERDYGTLKVKLGT
FT                   DRDLEIVEAIRSVAPDVRLFVDANEAWAPKEAVRKIERLAEYDLAFVEQPVPAENPEGL
FT                   RYVSERSPLPIAADESCVTLEDIPRIADRCDIANLKLMKCGGLLEAKRMIHAARAHGLE
FT                   VMLGCMTESNASIAAACHLAPLLDYADLDGSLLLADDPYDGVPMPGGRIDLAGLERPGT
FT                   GAVRE"
FT   gene            620940..621848
FT                   /locus_tag="Htur_0595"
FT   CDS_pept        620940..621848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59493"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59493.1"
FT                   /translation="MYDGDDDVTVSRRTLLRASAGTAAFSTIGAGSAEASGSDAGTPWL
FT                   DDRCPDATLEPNMGHCVEDGMEGCADDHPATVELRSGVQAALEERYPDVGALIDAGYQP
FT                   YFDTLEREDDSYSHWINPEYVGDDAVLDPERPASVLVDDESWRSIGVMFVATRNGEEID
FT                   PPAVYGGEASDTEPADDAPIGATADPETPCSPWHYHSGLPGRFAWWYYKQAYEHDFADG
FT                   DIDLPCRTPCMLHVWAIDHPESVYAHHAPPAESREQEPAAEAGFETDAEPGTDELGWDV
FT                   LPDDLQPEQRPEDLAALVPGL"
FT   gene            complement(621891..622556)
FT                   /locus_tag="Htur_0596"
FT   CDS_pept        complement(621891..622556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59494"
FT                   /db_xref="GOA:D2RWA5"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59494.1"
FT                   /translation="MFRRLASLRESKPLRSIVGTAALIAVLGLSGMTLGEIAPVFVIFA
FT                   SSTVHEVADDIYDLPAGTNRLIYGTGLAAAGGCLAFLSSASLGAVVVLAGLWFVLDGAV
FT                   TVRYGPARTRHEYVSDLEDDAGETMLRIQTANVVSQALRDASGPRTVAALATEVDLTES
FT                   RVESTLEYLAHKGHVERVGDRYRAIPHRWGRLTPVVRFLGWLPRRVGRPFRRLAASAS"
FT   sig_peptide     complement(622449..622556)
FT                   /locus_tag="Htur_0596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.988 at
FT                   residue 36"
FT   gene            complement(622655..623134)
FT                   /locus_tag="Htur_0597"
FT   CDS_pept        complement(622655..623134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0597"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59495"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59495.1"
FT                   /translation="MILVVCGPPGAGKTTIAEALRQRLEVRDEPIAVRLHHSDDFSSRT
FT                   YEQLFERVRDDPREAITIVDGTFYEREWQTQFRTLGFREAIRFVRVTASLETCLERNRT
FT                   RADPIAEQGVHVIFREFDAPEDALEIDTDETSVGDAVDRIVGALETWGWLTDRAE"
FT   gene            complement(623227..625332)
FT                   /locus_tag="Htur_0598"
FT   CDS_pept        complement(623227..625332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59496"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59496.1"
FT                   /translation="MTDDATGVDRRTVLGALAGASGVAVAGCSALTRERDGQTSRLDDE
FT                   AAEELAREFAPTLYFDVHEPWFPTDPRPYTSERDGEPVVDGFDALDGYHERYGAGDPPD
FT                   PTVFYRAVEYEESPLAAVQFWFYSAFDQFTTNFHWHDWEVLHVFVDTETDEPQLYVASS
FT                   HSRKAPNNEFLDPEPEAVPRILSELGSHSSALSVNDVPDRFQRVALEDLLADVTNATID
FT                   GVADLADVELPIAYGLPRDEGSRLPYVVPEYEGGPLYDHERLPSVTRESLIDDELTIRS
FT                   YDALTSPPTDLPTRETGLVFRHREREGDADIEYELVPTGEIEHIAAFTGPQLSFEFDVP
FT                   DAVEDAVAGHITATETPWDQSRYENPAADITAPNHRAALADRYEAIGEPAPINTVVSRI
FT                   TEAVTADDAPEDEGLMTTETAVESVALLESDPEAVPTFGGVAVLRDVPAGDHRLTVNGA
FT                   GRAPHSERVTVSDDGTTAAGVDGEIPLVARNRATKLEIGDGTGEADLSAVAVEDDFAGR
FT                   LYESAVDGGDAVYVHTGGAYTTEVRDSDDAIGAYRINPSPDTASAIRIERPETGTASLS
FT                   TFVADLAEETREAVSTHRDGDSDANDDDDTTTDDDDRGSENAVAGLERALEAVVDAARR
FT                   AADEARAGERETADRRLETVTERLQRVETRLSEASGELPEPLSKAARNRLEQAERRTEQ
FT                   ARTAETL"
FT   gene            626224..626568
FT                   /locus_tag="Htur_0599"
FT   CDS_pept        626224..626568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0599"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59497"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA8"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB59497.1"
FT                   /translation="MGYDTASKTDPESIIDDESGDMWFLKGELDSDHVGISVLELEPDG
FT                   EGMEHDEADRGQEEIYYVVSGTAEVELTDRDETVTLEEDDAIRLDPEETRQIFNRSDER
FT                   VKLVLVGAPL"
FT   gene            complement(626620..626925)
FT                   /locus_tag="Htur_0600"
FT   CDS_pept        complement(626620..626925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59498"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59498.1"
FT                   /translation="MAQTDTDAGAGGDDAVRVWLVERTYSDDEQNLIILTYATPDGERY
FT                   FRKERALTSFTDVRDTTAAVDVDDGNLGTVDDPDMREQYAAEAERMAEVHDPDDVI"
FT   gene            complement(626999..628036)
FT                   /locus_tag="Htur_0601"
FT   CDS_pept        complement(626999..628036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59499"
FT                   /db_xref="GOA:D2RWB0"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59499.1"
FT                   /translation="MSGDGSQPSDTMAERSESPTLKHTLLLNANRWLITAGLMLFVFVG
FT                   LLVVARASPVSLRALMGSADPVETLFQALTTALITGVTLVVTINSLVLSQELGAVEDQR
FT                   ERLDGALEFRTDVESSIDAPISPPEPASFAQAIIAASEDRATDFREAVSESQDEELKER
FT                   VDNFVDNVTTHADSIRDDLEDADFGTYEVVKAALDYNYSWKIFRARRIKNSHADSFTDE
FT                   ANEAYDDLLESLKLFGLAREHFKTLYFQWELINLSRAMMYVAVPALVVTMAMLLFFDAD
FT                   AVVGTYLGVDALVWIVAAASTVAVTPFLLLIAFILRIATMAKRTLAIGPFILRDSSRGE
FT                   DIDWE"
FT   gene            complement(628118..629146)
FT                   /locus_tag="Htur_0602"
FT   CDS_pept        complement(628118..629146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59500"
FT                   /db_xref="GOA:D2RWB1"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59500.1"
FT                   /translation="MSDSDSSGVLGQRAGVGGPRLWVLLRLNRWLFTAAVLVTVFAILV
FT                   GASLFGLAPHRVLVEQHNATFWIFSGFIGAIITGTSIVVTINQLVLSQELGAVGDQRER
FT                   MQEAMDFRHDIEDSLEHEDVSPPEPAAFLYELVDGVEEEANDLERTVSEDHGDEIQEKV
FT                   ADYVDDAVENAQVVKEDLEDAQFGTFDVIWNALNFNYSRKIYDARKLRADHGDDLSEEA
FT                   DDELDEMIQLLKFFGPAREHFKTLYFQWELINLSRALLYVSVPALTAMALLMMYIDGTA
FT                   LLGTFLGIDNLVWLTSAGFVIGIAPFVVFIVYILRIATVAKRTLAMGPFILRESERDED
FT                   LG"
FT   gene            629294..630346
FT                   /locus_tag="Htur_0603"
FT   CDS_pept        629294..630346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59501"
FT                   /db_xref="GOA:D2RWB2"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59501.1"
FT                   /translation="MSESGESASEETSNTMVDRVHGGRPMLWFLVEGNRVLVAALMLAV
FT                   SYTILVVLGTFGPGSISKLFDPAPIASTFTPTIIGIIMGVTLVLTFNQFVLAEELGPVG
FT                   DQRERMVGAMEFRRDTEDAVDRTTSPPEPSAFLRGLVEATGNRAAELIDALESDPDLDE
FT                   AVREDVREYAEGIAADAERVAADLEGKQFGRFEVVKAALEYNYSWKIYIGNRVRNRHEE
FT                   ALPDTIDERLEELLEVLGFFGPAREHFKTLYFRWEIITLSRSLAYLALPALAVSAYMIL
FT                   VFEVGDVAGVIAGFDQGLLFVGLAFAVGVMPFAIFLSYILRVVTVAKWTLAIGPFILRE
FT                   TDRGEDIGWE"
FT   gene            complement(630347..631435)
FT                   /locus_tag="Htur_0604"
FT   CDS_pept        complement(630347..631435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59502"
FT                   /db_xref="GOA:D2RWB3"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59502.1"
FT                   /translation="MQALIVGSVERVAMSPSETDETLESFGANVGEQSSVLAGFREWFV
FT                   VEGDRVAVAVLLSGVILALLVVLRWLGIISFTNPNSVTRVASGMIAGTFSLVTLVVSVN
FT                   QLILSQEFSAAGRARDRLEGVIDFRRKVATTAMVPASPATPTRILELLVESIRHDAADL
FT                   ADAVENSDDEVREPITRYTNAVQKRTGRVDEVLEEGEFGSFTAISAAINYDEAWHLHVG
FT                   THLRGEYGDELSPTASERLDELIDSLKLFGVAREQLKTTYLQRELTRFSQLTIYWGVPS
FT                   ILSAILIGLLYGDFAGPSVSVAVLPFITTGLIIVGLSPLSLLVSYILRTATVTRRTASV
FT                   GPMVPQKDPDEGPFHVEYGEDS"
FT   gene            631647..632156
FT                   /locus_tag="Htur_0605"
FT   CDS_pept        631647..632156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59503"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59503.1"
FT                   /translation="MTRPESTSRRRLLAAVGAGVSAAVAGCTGSGGLGGEPSYEDGNGV
FT                   EINASNVSNRTTSEMSTAAALANQQPSQSVTPLDPLSVTDHQFVVEGGYLGSTVQGTVE
FT                   NTGSDRIQIVEVRTRIYDDAGNLLGRYLATTGDLDGGETWEFQVIVLEAPSDVAAYDIA
FT                   VLGTPS"
FT   sig_peptide     631647..631727
FT                   /locus_tag="Htur_0605"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.611 at
FT                   residue 27"
FT   gene            complement(632193..632552)
FT                   /locus_tag="Htur_0606"
FT   CDS_pept        complement(632193..632552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59504"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59504.1"
FT                   /translation="MGTDTETNMDAFDEISLTNQVVLLGVAELHRRGETPVQTHELRRV
FT                   CRTQLEGVDVGVIGTLTEADVMRSLYRLEDEGFVEEVETEETSPTGKGRPAYALDIAFE
FT                   LVTEGVADELLEESG"
FT   gene            complement(632671..633510)
FT                   /locus_tag="Htur_0607"
FT   CDS_pept        complement(632671..633510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0607"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: afr:AFE_2017
FT                   PspA/IM30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59505"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB6"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADB59505.1"
FT                   /translation="MGILSRTSYIIRSKLNSVLNRAEDPTETLDYSYEQMRDQLQQVKR
FT                   GIADLTTQKKRLEMQKRRLEENVDKHNDQARTAVQQGREDLARRALEKKKTKMNQIEDL
FT                   ERQISDLQQQQDKLIEQKNTLQSRIEEFRTKKETMKARHEAAKASSQVSEAVTATGEEF
FT                   EDVGRAIERAEEKTEDMEARAAAMDELQESGAFEDVLSDKDDIDRELEQLETDSGVEAE
FT                   LETLKSEMGEGGGETDAEPAGDVESEAVEEDIEDMEAEVDDSEVEAELAELQDEENA"
FT   gene            634115..634750
FT                   /locus_tag="Htur_0608"
FT   CDS_pept        634115..634750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0608"
FT                   /product="hydrolase of the alpha/beta superfamily-like
FT                   protein"
FT                   /note="KEGG: mpt:Mpe_A0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59506"
FT                   /db_xref="GOA:D2RWB7"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB7"
FT                   /inference="protein motif:COG:COG2945"
FT                   /protein_id="ADB59506.1"
FT                   /translation="MSDVLIPGGRDVRGTLAEPIDDPDAIVVAAPPHPQHSGSRSDPRL
FT                   TAVAESLRESDIACLRFDYGAWDEGYGEREDVRNAVRWAREEYGRGDGTADGDDRPVGV
FT                   FGYSFGASLALLAAADVDPDAVAALAPTARLADDLDAVDALESLELPVCVLYGERDETV
FT                   DWEPVVDRARERGDAVTALAGDHFFLGTHGDIGDEVAGFFEKALLESA"
FT   gene            635259..636158
FT                   /locus_tag="Htur_0609"
FT   CDS_pept        635259..636158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0609"
FT                   /product="FRG domain protein"
FT                   /note="PFAM: FRG domain protein; KEGG: ppd:Ppro_2571
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59507"
FT                   /db_xref="InterPro:IPR014966"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB8"
FT                   /inference="protein motif:PFAM:PF08867"
FT                   /protein_id="ADB59507.1"
FT                   /translation="MTDETVSQSTVRAESWAELQELVTAEMWMPDIARHRSPFVFRGVP
FT                   FRDHTLETSIKRFVGDSGEWKLESLLLRNFHQYAVNEIEEFESVWHLLSIAEHYGLPTR
FT                   LLDWSFSPLVATYFAVRDGDTAHDGAVWSVDYRQLHDTLPEHYNRVLERTETDMLDVHL
FT                   LSNATLESDAETADAADGAMRDLNDVSRLDDLWSERWGVDADEAVDDQYVVFFRPPAID
FT                   DRIANQSAVFSFQSDPRLALDRWLEERPDCYRKIVIPGERKLEFRDKLDQMNVNHRTLF
FT                   PDLEGLTTWLKQYYQPQE"
FT   gene            636393..637451
FT                   /locus_tag="Htur_0610"
FT   CDS_pept        636393..637451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0610"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: sat:SYN_00196
FT                   SCP/PR1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59508"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWB9"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ADB59508.1"
FT                   /translation="MKLQSITAVVVVALLSLSMVGAGAAAPAASPVEDTSTETDTDTIS
FT                   QSDVVTQSDVTTISSVTSGSDGTVEVNTDGVDGVESLVGDLDSGQAGDATSVLESLFSG
FT                   GITDNIDDEDTPGDADDGTDETNDDTGDGADETDGDESSSDNETDETDDNETDETDSDD
FT                   ETDETDSDETDGNETNETAGDETDDTADDETDDGSSDEIDRAALERYVHEAVNEERTAR
FT                   GLEPLEFDTELRDIARAHSEDMAERGYFAHVDPEGNDVTDRYEQAGYECNANGYTGGEN
FT                   LAQTWYDTPVVNDDGETVRYETEQELADGIVTQWMNSPDHRENLLATQWENEGIGVYVT
FT                   DDNRVFVTQNFC"
FT   sig_peptide     636393..636467
FT                   /locus_tag="Htur_0610"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.634 at
FT                   residue 25"
FT   gene            complement(637485..639341)
FT                   /locus_tag="Htur_0611"
FT   CDS_pept        complement(637485..639341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0611"
FT                   /product="ATPase-like protein"
FT                   /note="KEGG: spl:Spea_1871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59509"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC0"
FT                   /inference="protein motif:COG:COG0433"
FT                   /protein_id="ADB59509.1"
FT                   /translation="MTDLGDFGDFNAESDADSGGRDDAAAGSDGTRTEPSSAGGSTGTD
FT                   GGTTDDFEPTPVEPRGEDVGIGAICVSQGLRVAEDGDETTLRAYVTRGNRSSIRIGSYL
FT                   LAPYPDGETLFCRITGLEYAQQYHADDATEIHARRAMRTDGVDEADYKFVAELEPVAVL
FT                   YDDDGELKRRMTDRVPKPQTVIRQADDTEEIKTGLKMPEDGVFLGHLSVGGEKVRTAAT
FT                   PPTIDYRLKDDYDAGDPLVFRHTLIAGGTGSGKTHGAKNILRQYLAEDRAYPMDDGREV
FT                   HPAVVQFDPQDEYAQMHDDNPDLDDEFGRRLEREGIAYGGHEDTTAFVPKVGSASYAAG
FT                   HHRARQVEFTIPFSMVYDNPWLVAGSGLNDNQYGALVSVLLPRFRKQYGDDGTYEEFTT
FT                   FLDDPALREELDESGRVHEATFDAVRRRVLGFGHVFDQDARPITDLVHEFVRPGGLTVV
FT                   PTYHINDSRATETIVLAVSSLLIDQKLSNDPYYDRIKETPLVLGMDEAHNFLTDADSVQ
FT                   AGKVITKFTEAAKQGRKERLGLFLITQDPQDIHDAVFKQINTTVVLNLGDEDAIKSVNI
FT                   PSNLESKVPYMEKGQMVVYSPDNSEPVELIGLPKCLTRHGRD"
FT   gene            complement(639524..640189)
FT                   /locus_tag="Htur_0612"
FT   CDS_pept        complement(639524..640189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0612"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59510"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59510.1"
FT                   /translation="MGLTPFHQCLLVMSSKASIGGDSERGPLTDVPEECYDVLRHPRRI
FT                   RILATLGAHRTRLSLMELTTAIVENEDLDVPTGKARHDVRISLVHNHLPRLAEYGLVEF
FT                   DAETGAELVDEPPVHPADLARLLELCEGPEGEQLLEAIVHPVRMRVLAMLSGAERTVSV
FT                   ERLASELAASDVGADDRERAKISLYHAHLPVLADVDALKFDTDANLVTQGERTTSVLH"
FT   gene            640470..640811
FT                   /locus_tag="Htur_0613"
FT   CDS_pept        640470..640811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0613"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59511"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59511.1"
FT                   /translation="MILIRGRAGGTELTGTLYERGERAPSFRGAPDEDAAYVWVCDEFY
FT                   EVDSGGSTQLVDGREVNLAFESPMPRGFDTREQALEGAKEHVRTQFARIGVDPSDVDLE
FT                   VEKNGETDE"
FT   gene            complement(640822..641685)
FT                   /locus_tag="Htur_0614"
FT   CDS_pept        complement(640822..641685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0614"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59512"
FT                   /db_xref="GOA:D2RWC3"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59512.1"
FT                   /translation="MRATTERRTVAAGRGLLLGAVLLALLLVPLLGFAAETAAASDRTA
FT                   AILPSTQTVAADPGEEVTVDVVMQSDGGYGGEGIESVSLVAQYNPEYLEITDVERGPWL
FT                   EQGAETDVYAERGLAHDSGTAVLEQRRDPPADGATGNARIATLTVAVAEDAPPSEATIT
FT                   FEESRAELLRETPIPVFDTDATVAIDGGGDEAPAFDHPDPDGLETTPVDAEATDAEPGA
FT                   EPESTRDDDAVAETDDENGGNETEADREDAVPGLPTPVAAGIIVGTVLVGHRLHDATGV
FT                   RAGADR"
FT   sig_peptide     complement(641581..641685)
FT                   /locus_tag="Htur_0614"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 35"
FT   gene            complement(641779..643881)
FT                   /locus_tag="Htur_0615"
FT   CDS_pept        complement(641779..643881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0615"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein; KEGG: GH11735
FT                   gene product from transcript GH11735- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59513"
FT                   /db_xref="GOA:D2RWC4"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC4"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ADB59513.1"
FT                   /translation="MAAGASAAAVLPTTGSVGANSRDETVTIVHDTHFHGRFADAEAAE
FT                   LSLASYYAVVEEHLESAANSLFVGNGDDLAPSMLGLEYEGEHVIEALNETAIDVDGVGN
FT                   HEYDFGADVATARFEESEFPWVVANLLDDAGDPVPGTERWTAFEKGELTVGVFGLVSTN
FT                   FHSLTDYPAEWQVLGYVEGAQEAVDALREEGADVVVCASHVSTGVHYTLAEDVDGLDAI
FT                   VGSHSNIVFEEPEVVDGTIISEFGDEFDHVGSLTLDADGTLVDWRRTDLLAPDADPASA
FT                   VDEYEEIEVRYADEIPEDETLATLAEEWTDELEAELEQTAFETEVELNATFDNYAIETN
FT                   WGNLMTDAMRTVGEIGDIEVDIAAQNAGGIRSGSTYGPGPVTGADVMNILPFPNEIEVV
FT                   ELTGEDVVAYLEEAIRPHPSENYGAQPAIQVSRLSYEWWGHGGESQVENVFVGGEPIDP
FT                   DETYYLAHNDYSIENSDVLSEVAVVLASGQFQGPYVLDRLEERDTVAPERENRMLRVDE
FT                   TVGEASVAVGDGETTLTVDVPDGAAAIRSDTFRAVIRTGADLEANAATVDGDSVDVTFD
FT                   TDELRALVADVDEPALRLFGGYDPDQAYWDYGFEVPTSSGYEHFKLRADVSAAALEDPD
FT                   DGDSDGNESDDDGANDGADDGMPGFGPLGALAGGSAGGYLYSRRRVADDESAETTASAT
FT                   GDDGDD"
FT   sig_peptide     complement(643822..643881)
FT                   /locus_tag="Htur_0615"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.518 at
FT                   residue 20"
FT   gene            complement(644051..645325)
FT                   /locus_tag="Htur_0616"
FT   CDS_pept        complement(644051..645325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0616"
FT                   /product="NurA domain protein"
FT                   /note="PFAM: NurA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59514"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC5"
FT                   /inference="protein motif:PFAM:PF09376"
FT                   /protein_id="ADB59514.1"
FT                   /translation="MTLDPVHFDGIAQLARRIDHGADERDRRAFAETVWAEFLDPLVDD
FT                   GRTILEPIDERHRRHVDCEDVALCDRPFASEHGLDAGTINPTTFKNGLVIDIAQAAMAA
FT                   TPSDLDLHRSRTTVMTVHSNDETMTVDETWGKFDEGYSRSRAVKIPPLPRFAEGVVHAL
FT                   ALYLAESKHALENADAVDDLLVLDGPIYPRGLLRWADQHPDLADFLLEDPRPTTVLENY
FT                   VRLVERFVERDVPLVGFVKNPATRVITRTLKQKRNVDVATPWNDDSALFTRLLERGEYV
FT                   DDIDGQRWERDTEALTYTNWFRSRGGVDRPLSVEGDALGVERDLSLEAYEVTFFVVYDP
FT                   RDDLIYRIEAPYAFTRAPERRRAVTMQVLQDIAVAHGPPTIVEKADELARISRSEKASL
FT                   RETLETQFDTSQDRTYDDHRWEEEH"
FT   gene            645462..645722
FT                   /locus_tag="Htur_0617"
FT   CDS_pept        645462..645722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59515"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59515.1"
FT                   /translation="MSKRGLEAVDTDEDPINWRQDGADVTLYDETNRDAWIQVTFEAGV
FT                   PPERRLFMICDDCGAVFAQRTKPGRSTVCGDCGATFDHRRD"
FT   gene            645939..646163
FT                   /locus_tag="Htur_0618"
FT   CDS_pept        645939..646163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59516"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59516.1"
FT                   /translation="MATDSGPSDPDVTAAFERDLEALVTTAFGRGAVIDGVWDVSSPVS
FT                   AAPAWTVTIERREPDPDSDPAFEPEFLED"
FT   gene            646314..646667
FT                   /locus_tag="Htur_0619"
FT   CDS_pept        646314..646667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59517"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB59517.1"
FT                   /translation="MTPKTRNSQGAEIDDADVSSTRLFRAFAETRRQYALGYLAQKPAA
FT                   IHLGDLAEYIALKEATPTYDRYQRILVDLHHQHLPHLCDAGLVQYDEATERLELAVDRD
FT                   MIAPYLDLAEAGQ"
FT   gene            complement(646710..647126)
FT                   /locus_tag="Htur_0620"
FT   CDS_pept        complement(646710..647126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0620"
FT                   /product="putative thiol-disulphide oxidoreductase DCC"
FT                   /note="PFAM: putative thiol-disulphide oxidoreductase DCC;
FT                   KEGG: swp:swp_4717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59518"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWC9"
FT                   /inference="protein motif:PFAM:PF04134"
FT                   /protein_id="ADB59518.1"
FT                   /translation="MATDVPREDPIVLFDGVCNLCHGFVQFLVPRDTEGRFHFASLQSD
FT                   IGQQLLAEYGLADHDLDSVVLLEGDEAYVKSDAVIRIGRLLGGGYRLLGPCRFLPRRLR
FT                   DWAYDLVARHRYRLFGQKEQCMLPTGNVRDRFLE"
FT   gene            complement(647183..648799)
FT                   /locus_tag="Htur_0621"
FT   CDS_pept        complement(647183..648799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0621"
FT                   /product="HTTM domain protein"
FT                   /note="SMART: HTTM domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59519"
FT                   /db_xref="GOA:D2RWD0"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWD0"
FT                   /inference="protein motif:SMART:SM00752"
FT                   /protein_id="ADB59519.1"
FT                   /translation="MWRSYRVAATTASHRSIMTGRLSLATLPDRARLRDALDRRFGIDA
FT                   RALAAFRIILGCTLLFDILHRSRELVAFYADAGAYPRALRLAVGNSRGEYSLHMLSGEP
FT                   WAQALLFGLAALLALALIVGYRTRLVTFLSLVLLVSVHFRNPLVLNGADRLLREVLLLA
FT                   LFLPLGRRWAVDALGDDREDGDDQSREPGSETRTGTGSENWVVTPATAAVLVYVVGFFA
FT                   NNGQHKRLGDTWTTGEALGYALRQDHMTILVGDHVVDYPLLLEVGTYGWLALVVGAPLL
FT                   LVLTGWLRTAYVGAFLGATAGLGLSMAVGLFPAVLTAVLVLFLPSFVWDRLEATVAACC
FT                   ERVGPLERLRSRTGALTSRIGPPRSLGSVLPSQIRNRRHRLRSVLLGGVLLVVVLWTVG
FT                   LLGYADAFESVDAVDPDDNQWTMYAPNPSTSYGWYVVEAELESGEEMDVLRNEALREGP
FT                   PPDASETLPSFRWRKFMNSLDDDEARADRFGTYMCDRAADQFDSPVERIEVTYHYRSIE
FT                   PDGDDPTTGTATRVETTCAAT"
FT   gene            648966..650489
FT                   /locus_tag="Htur_0622"
FT   CDS_pept        648966..650489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0622"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="TIGRFAM: phosphoglycerate mutase, 2,3-
FT                   bisphosphoglycerate-independent; PFAM: BPG-independent PGAM
FT                   domain protein; metalloenzyme domain protein; KEGG:
FT                   ppd:Ppro_3611 phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59520"
FT                   /db_xref="GOA:D2RWD1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWD1"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ADB59520.1"
FT                   /translation="MDAALIILDGWGLGDGTSRDAVAAAETPNFDRLADAGAYGTLEVA
FT                   GRRVGLPDGQMGNSEVGHLNIGAGRVVHQEYTRISDSIADGSFRENDAINTAFDNARAN
FT                   DGKVHFVGLVSDGGVHSDHEHLHALIELAGDRDVEAVTHAITDGRDTSPTGGRDYLSTL
FT                   EDVVAEHGTGDVATVTGRYYAMDRDQNWERTKRAYDAMVHREADHEADSAVEAVEQSYD
FT                   RDVTDEFVEPTVIADGPALEDGDSVVWFNFRSDRARQLTRMLADIRPEDWADQFETSPP
FT                   DAEVVMLTQYDKTFDLPIAYPPNQPEQVLGEVLADAGRTQLRIAESEKYAHVTYFLNGG
FT                   REIEFDGEIRKIVESPDVPTYDLQPEMSAPEVTDTAVDVIESDDPDVLVLNYANPDMVG
FT                   HTGDYEAAIEAVEAVDAQLGRLTDALEDAGAHVLVTADHGNADDMGTEEDPHTAHTYNL
FT                   VPLVYVADDGTAGGRTVRAGGTLADIAPTILELIDLAQPPEMTGESLLE"
FT   gene            complement(650511..652034)
FT                   /locus_tag="Htur_0623"
FT   CDS_pept        complement(650511..652034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Htur_0623"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); UbiA
FT                   prenyltransferase; NADPH-dependent FMN reductase; KEGG:
FT                   tcx:Tcr_1013 NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Htur_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADB59521"
FT                   /db_xref="GOA:D2RWD2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2RWD2"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ADB59521.1"
FT                   /translation="MNVLIVLGHPRTDSLCGALADAYRDGALEAGLEVRKLVVADCEFD
FT                   PDVREVSPTDQPLEPDLRAAQDSIEWADHLVFVYPNWWGTMPARLKGFFDRVFTPGFAF
FT                   VEYDEGEGAGHEGLLDDKTAELIVTMDMPPWVYRWIYRQPGNNAVKRATLGYAGIRTTR
FT                   VTNLGPVEESTPEEREEWLEKATRLGERLASGPDSRSTRVRRRATAWLKALRLQFYPMA
FT                   WVAYTIGALAAVGSSGVLSSTTYWLGFAFLFFLEAATVLSNEYVDYPTDRENAFAGPFT
FT                   GGSQVLVDGTLEFDDLRRGIGVALALTVAFGGAALAVGPGSLVAGTAVMAALGVLALGY
FT                   TVPPLELSYRTLGELDVAVTHSTGVLLVGYVLLGGRATDPFPWLLSVPFLLSVLPSITL
FT                   AGVPDREADRAADKETIAVRFGVDGAARVAVATAGLACLTALVWVAFDVAGGAYDPLVL
FT                   LSVPHALGLCWLLRDRLWDRTTPGRIDGLMAAALSFLGWFGVVPLLNLL"
FT   gene            652224..652634
FT                   /locus_tag="Htur_0624"
FT   CDS_pept        652224..652634
FT