(data stored in ACNUC7421 zone)

EMBL: CP001867

ID   CP001867; SV 1; circular; genomic DNA; STD; PRO; 5322497 BP.
XX
AC   CP001867; ABTU01000000-ABTU01000039;
XX
PR   Project:PRJNA29547;
XX
DT   21-JAN-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Geodermatophilus obscurus DSM 43160, complete genome.
XX
KW   .
XX
OS   Geodermatophilus obscurus DSM 43160
OC   Bacteria; Actinobacteria; Geodermatophilales; Geodermatophilaceae;
OC   Geodermatophilus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5322497
RX   PUBMED; 21304698.
RA   Ivanova N., Sikorski J., Jando M., Munk C., Lapidus A., Glavina Del Rio T.,
RA   Copeland A., Tice H., Cheng J.-F., Lucas S., Chen F., Nolan M., Bruce D.,
RA   Goodwin L., Pitluck S., Mavromatis K., Mikhailova N., Pati A., Chen A.,
RA   Palaniappan K., Land M., Hauser L., Chang Y.-J., Jeffries C.D., Meincke L.,
RA   Brettin T., Detter J.C., Detter J.C., Rohde M., Goeker M., Bristow J.,
RA   Eisen J.A., Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.-P.;
RT   "Complete genome sequence of Geodermatophilus obscurus type strain (G-20)";
RL   Stand Genomic Sci 2(2):158-167(2010).
XX
RN   [2]
RP   1-5322497
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Munk A.C., Brettin T., Detter J.C., Han C., Larimer F., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Jando M.,
RA   Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Geodermatophilus obscurus DSM 43160";
RL   Unpublished.
XX
RN   [3]
RP   1-5322497
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Munk A.C., Brettin T., Detter J.C., Han C., Larimer F., Land M., Hauser L.,
RA   Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D., Jando M.,
RA   Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (11-JAN-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 87a12aa1594f1141513352014735b0c1.
DR   BioSample; SAMN00002612.
DR   CABRI; DSM 43160.
DR   EnsemblGenomes-Gn; EBG00001058639.
DR   EnsemblGenomes-Gn; EBG00001058640.
DR   EnsemblGenomes-Gn; EBG00001058641.
DR   EnsemblGenomes-Gn; EBG00001058642.
DR   EnsemblGenomes-Gn; EBG00001058643.
DR   EnsemblGenomes-Gn; EBG00001058644.
DR   EnsemblGenomes-Gn; EBG00001058645.
DR   EnsemblGenomes-Gn; EBG00001058646.
DR   EnsemblGenomes-Gn; EBG00001058647.
DR   EnsemblGenomes-Gn; EBG00001058648.
DR   EnsemblGenomes-Gn; EBG00001058649.
DR   EnsemblGenomes-Gn; EBG00001058650.
DR   EnsemblGenomes-Gn; EBG00001058651.
DR   EnsemblGenomes-Gn; EBG00001058652.
DR   EnsemblGenomes-Gn; EBG00001058653.
DR   EnsemblGenomes-Gn; EBG00001058654.
DR   EnsemblGenomes-Gn; EBG00001058655.
DR   EnsemblGenomes-Gn; EBG00001058656.
DR   EnsemblGenomes-Gn; EBG00001058657.
DR   EnsemblGenomes-Gn; EBG00001058658.
DR   EnsemblGenomes-Gn; EBG00001058659.
DR   EnsemblGenomes-Gn; EBG00001058660.
DR   EnsemblGenomes-Gn; EBG00001058662.
DR   EnsemblGenomes-Gn; EBG00001058663.
DR   EnsemblGenomes-Gn; EBG00001058664.
DR   EnsemblGenomes-Gn; EBG00001058665.
DR   EnsemblGenomes-Gn; EBG00001058666.
DR   EnsemblGenomes-Gn; EBG00001058667.
DR   EnsemblGenomes-Gn; EBG00001058668.
DR   EnsemblGenomes-Gn; EBG00001058669.
DR   EnsemblGenomes-Gn; EBG00001058670.
DR   EnsemblGenomes-Gn; EBG00001058671.
DR   EnsemblGenomes-Gn; EBG00001058672.
DR   EnsemblGenomes-Gn; EBG00001058673.
DR   EnsemblGenomes-Gn; EBG00001058674.
DR   EnsemblGenomes-Gn; EBG00001058676.
DR   EnsemblGenomes-Gn; EBG00001058677.
DR   EnsemblGenomes-Gn; EBG00001058678.
DR   EnsemblGenomes-Gn; EBG00001058679.
DR   EnsemblGenomes-Gn; EBG00001058680.
DR   EnsemblGenomes-Gn; EBG00001058681.
DR   EnsemblGenomes-Gn; EBG00001058682.
DR   EnsemblGenomes-Gn; EBG00001058683.
DR   EnsemblGenomes-Gn; EBG00001058685.
DR   EnsemblGenomes-Gn; EBG00001058686.
DR   EnsemblGenomes-Gn; EBG00001058688.
DR   EnsemblGenomes-Gn; EBG00001058689.
DR   EnsemblGenomes-Gn; EBG00001058690.
DR   EnsemblGenomes-Gn; EBG00001058691.
DR   EnsemblGenomes-Gn; EBG00001058692.
DR   EnsemblGenomes-Gn; EBG00001058693.
DR   EnsemblGenomes-Gn; EBG00001058694.
DR   EnsemblGenomes-Gn; EBG00001058695.
DR   EnsemblGenomes-Gn; EBG00001058696.
DR   EnsemblGenomes-Gn; EBG00001058697.
DR   EnsemblGenomes-Gn; EBG00001058698.
DR   EnsemblGenomes-Gn; EBG00001058699.
DR   EnsemblGenomes-Gn; EBG00001058700.
DR   EnsemblGenomes-Gn; EBG00001058701.
DR   EnsemblGenomes-Gn; EBG00001058702.
DR   EnsemblGenomes-Gn; EBG00001058703.
DR   EnsemblGenomes-Gn; EBG00001058704.
DR   EnsemblGenomes-Gn; EBG00001058705.
DR   EnsemblGenomes-Gn; EBG00001058706.
DR   EnsemblGenomes-Gn; Gobs_R0001.
DR   EnsemblGenomes-Gn; Gobs_R0002.
DR   EnsemblGenomes-Gn; Gobs_R0003.
DR   EnsemblGenomes-Gn; Gobs_R0004.
DR   EnsemblGenomes-Gn; Gobs_R0005.
DR   EnsemblGenomes-Gn; Gobs_R0006.
DR   EnsemblGenomes-Gn; Gobs_R0007.
DR   EnsemblGenomes-Gn; Gobs_R0008.
DR   EnsemblGenomes-Gn; Gobs_R0009.
DR   EnsemblGenomes-Gn; Gobs_R0010.
DR   EnsemblGenomes-Gn; Gobs_R0011.
DR   EnsemblGenomes-Gn; Gobs_R0012.
DR   EnsemblGenomes-Gn; Gobs_R0013.
DR   EnsemblGenomes-Gn; Gobs_R0014.
DR   EnsemblGenomes-Gn; Gobs_R0015.
DR   EnsemblGenomes-Gn; Gobs_R0016.
DR   EnsemblGenomes-Gn; Gobs_R0017.
DR   EnsemblGenomes-Gn; Gobs_R0018.
DR   EnsemblGenomes-Gn; Gobs_R0019.
DR   EnsemblGenomes-Gn; Gobs_R0020.
DR   EnsemblGenomes-Gn; Gobs_R0021.
DR   EnsemblGenomes-Gn; Gobs_R0022.
DR   EnsemblGenomes-Gn; Gobs_R0023.
DR   EnsemblGenomes-Gn; Gobs_R0024.
DR   EnsemblGenomes-Gn; Gobs_R0025.
DR   EnsemblGenomes-Gn; Gobs_R0026.
DR   EnsemblGenomes-Gn; Gobs_R0027.
DR   EnsemblGenomes-Gn; Gobs_R0028.
DR   EnsemblGenomes-Gn; Gobs_R0029.
DR   EnsemblGenomes-Gn; Gobs_R0030.
DR   EnsemblGenomes-Gn; Gobs_R0031.
DR   EnsemblGenomes-Gn; Gobs_R0032.
DR   EnsemblGenomes-Gn; Gobs_R0033.
DR   EnsemblGenomes-Gn; Gobs_R0034.
DR   EnsemblGenomes-Gn; Gobs_R0035.
DR   EnsemblGenomes-Gn; Gobs_R0036.
DR   EnsemblGenomes-Gn; Gobs_R0037.
DR   EnsemblGenomes-Gn; Gobs_R0038.
DR   EnsemblGenomes-Gn; Gobs_R0039.
DR   EnsemblGenomes-Gn; Gobs_R0040.
DR   EnsemblGenomes-Gn; Gobs_R0041.
DR   EnsemblGenomes-Gn; Gobs_R0042.
DR   EnsemblGenomes-Gn; Gobs_R0043.
DR   EnsemblGenomes-Gn; Gobs_R0044.
DR   EnsemblGenomes-Gn; Gobs_R0045.
DR   EnsemblGenomes-Gn; Gobs_R0046.
DR   EnsemblGenomes-Gn; Gobs_R0047.
DR   EnsemblGenomes-Gn; Gobs_R0048.
DR   EnsemblGenomes-Gn; Gobs_R0049.
DR   EnsemblGenomes-Gn; Gobs_R0050.
DR   EnsemblGenomes-Gn; Gobs_R0051.
DR   EnsemblGenomes-Gn; Gobs_R0052.
DR   EnsemblGenomes-Gn; Gobs_R0053.
DR   EnsemblGenomes-Gn; Gobs_R0054.
DR   EnsemblGenomes-Gn; Gobs_R0055.
DR   EnsemblGenomes-Gn; Gobs_R0056.
DR   EnsemblGenomes-Gn; Gobs_R0057.
DR   EnsemblGenomes-Gn; Gobs_R0058.
DR   EnsemblGenomes-Gn; Gobs_R0059.
DR   EnsemblGenomes-Tr; EBT00001661082.
DR   EnsemblGenomes-Tr; EBT00001661083.
DR   EnsemblGenomes-Tr; EBT00001661084.
DR   EnsemblGenomes-Tr; EBT00001661085.
DR   EnsemblGenomes-Tr; EBT00001661086.
DR   EnsemblGenomes-Tr; EBT00001661087.
DR   EnsemblGenomes-Tr; EBT00001661088.
DR   EnsemblGenomes-Tr; EBT00001661089.
DR   EnsemblGenomes-Tr; EBT00001661090.
DR   EnsemblGenomes-Tr; EBT00001661091.
DR   EnsemblGenomes-Tr; EBT00001661092.
DR   EnsemblGenomes-Tr; EBT00001661093.
DR   EnsemblGenomes-Tr; EBT00001661094.
DR   EnsemblGenomes-Tr; EBT00001661095.
DR   EnsemblGenomes-Tr; EBT00001661096.
DR   EnsemblGenomes-Tr; EBT00001661097.
DR   EnsemblGenomes-Tr; EBT00001661098.
DR   EnsemblGenomes-Tr; EBT00001661099.
DR   EnsemblGenomes-Tr; EBT00001661100.
DR   EnsemblGenomes-Tr; EBT00001661101.
DR   EnsemblGenomes-Tr; EBT00001661102.
DR   EnsemblGenomes-Tr; EBT00001661103.
DR   EnsemblGenomes-Tr; EBT00001661104.
DR   EnsemblGenomes-Tr; EBT00001661105.
DR   EnsemblGenomes-Tr; EBT00001661106.
DR   EnsemblGenomes-Tr; EBT00001661107.
DR   EnsemblGenomes-Tr; EBT00001661108.
DR   EnsemblGenomes-Tr; EBT00001661109.
DR   EnsemblGenomes-Tr; EBT00001661110.
DR   EnsemblGenomes-Tr; EBT00001661111.
DR   EnsemblGenomes-Tr; EBT00001661112.
DR   EnsemblGenomes-Tr; EBT00001661113.
DR   EnsemblGenomes-Tr; EBT00001661114.
DR   EnsemblGenomes-Tr; EBT00001661115.
DR   EnsemblGenomes-Tr; EBT00001661116.
DR   EnsemblGenomes-Tr; EBT00001661117.
DR   EnsemblGenomes-Tr; EBT00001661118.
DR   EnsemblGenomes-Tr; EBT00001661119.
DR   EnsemblGenomes-Tr; EBT00001661120.
DR   EnsemblGenomes-Tr; EBT00001661121.
DR   EnsemblGenomes-Tr; EBT00001661122.
DR   EnsemblGenomes-Tr; EBT00001661123.
DR   EnsemblGenomes-Tr; EBT00001661124.
DR   EnsemblGenomes-Tr; EBT00001661125.
DR   EnsemblGenomes-Tr; EBT00001661126.
DR   EnsemblGenomes-Tr; EBT00001661127.
DR   EnsemblGenomes-Tr; EBT00001661128.
DR   EnsemblGenomes-Tr; EBT00001661129.
DR   EnsemblGenomes-Tr; EBT00001661130.
DR   EnsemblGenomes-Tr; EBT00001661131.
DR   EnsemblGenomes-Tr; EBT00001661132.
DR   EnsemblGenomes-Tr; EBT00001661133.
DR   EnsemblGenomes-Tr; EBT00001661134.
DR   EnsemblGenomes-Tr; EBT00001661135.
DR   EnsemblGenomes-Tr; EBT00001661136.
DR   EnsemblGenomes-Tr; EBT00001661137.
DR   EnsemblGenomes-Tr; EBT00001661138.
DR   EnsemblGenomes-Tr; EBT00001661139.
DR   EnsemblGenomes-Tr; EBT00001661140.
DR   EnsemblGenomes-Tr; EBT00001661141.
DR   EnsemblGenomes-Tr; EBT00001661142.
DR   EnsemblGenomes-Tr; EBT00001661143.
DR   EnsemblGenomes-Tr; EBT00001661144.
DR   EnsemblGenomes-Tr; EBT00001661145.
DR   EnsemblGenomes-Tr; Gobs_R0001-1.
DR   EnsemblGenomes-Tr; Gobs_R0002-1.
DR   EnsemblGenomes-Tr; Gobs_R0003-1.
DR   EnsemblGenomes-Tr; Gobs_R0004-1.
DR   EnsemblGenomes-Tr; Gobs_R0005-1.
DR   EnsemblGenomes-Tr; Gobs_R0006-1.
DR   EnsemblGenomes-Tr; Gobs_R0007-1.
DR   EnsemblGenomes-Tr; Gobs_R0008-1.
DR   EnsemblGenomes-Tr; Gobs_R0009-1.
DR   EnsemblGenomes-Tr; Gobs_R0010-1.
DR   EnsemblGenomes-Tr; Gobs_R0011-1.
DR   EnsemblGenomes-Tr; Gobs_R0012-1.
DR   EnsemblGenomes-Tr; Gobs_R0013-1.
DR   EnsemblGenomes-Tr; Gobs_R0014-1.
DR   EnsemblGenomes-Tr; Gobs_R0015-1.
DR   EnsemblGenomes-Tr; Gobs_R0016-1.
DR   EnsemblGenomes-Tr; Gobs_R0017-1.
DR   EnsemblGenomes-Tr; Gobs_R0018-1.
DR   EnsemblGenomes-Tr; Gobs_R0019-1.
DR   EnsemblGenomes-Tr; Gobs_R0020-1.
DR   EnsemblGenomes-Tr; Gobs_R0021-1.
DR   EnsemblGenomes-Tr; Gobs_R0022-1.
DR   EnsemblGenomes-Tr; Gobs_R0023-1.
DR   EnsemblGenomes-Tr; Gobs_R0024-1.
DR   EnsemblGenomes-Tr; Gobs_R0025-1.
DR   EnsemblGenomes-Tr; Gobs_R0026-1.
DR   EnsemblGenomes-Tr; Gobs_R0027-1.
DR   EnsemblGenomes-Tr; Gobs_R0028-1.
DR   EnsemblGenomes-Tr; Gobs_R0029-1.
DR   EnsemblGenomes-Tr; Gobs_R0030-1.
DR   EnsemblGenomes-Tr; Gobs_R0031-1.
DR   EnsemblGenomes-Tr; Gobs_R0032-1.
DR   EnsemblGenomes-Tr; Gobs_R0033-1.
DR   EnsemblGenomes-Tr; Gobs_R0034-1.
DR   EnsemblGenomes-Tr; Gobs_R0035-1.
DR   EnsemblGenomes-Tr; Gobs_R0036-1.
DR   EnsemblGenomes-Tr; Gobs_R0037-1.
DR   EnsemblGenomes-Tr; Gobs_R0038-1.
DR   EnsemblGenomes-Tr; Gobs_R0039-1.
DR   EnsemblGenomes-Tr; Gobs_R0040-1.
DR   EnsemblGenomes-Tr; Gobs_R0041-1.
DR   EnsemblGenomes-Tr; Gobs_R0042-1.
DR   EnsemblGenomes-Tr; Gobs_R0043-1.
DR   EnsemblGenomes-Tr; Gobs_R0044-1.
DR   EnsemblGenomes-Tr; Gobs_R0045-1.
DR   EnsemblGenomes-Tr; Gobs_R0046-1.
DR   EnsemblGenomes-Tr; Gobs_R0047-1.
DR   EnsemblGenomes-Tr; Gobs_R0048-1.
DR   EnsemblGenomes-Tr; Gobs_R0049-1.
DR   EnsemblGenomes-Tr; Gobs_R0050-1.
DR   EnsemblGenomes-Tr; Gobs_R0051-1.
DR   EnsemblGenomes-Tr; Gobs_R0052-1.
DR   EnsemblGenomes-Tr; Gobs_R0053-1.
DR   EnsemblGenomes-Tr; Gobs_R0054-1.
DR   EnsemblGenomes-Tr; Gobs_R0055-1.
DR   EnsemblGenomes-Tr; Gobs_R0056-1.
DR   EnsemblGenomes-Tr; Gobs_R0057-1.
DR   EnsemblGenomes-Tr; Gobs_R0058-1.
DR   EnsemblGenomes-Tr; Gobs_R0059-1.
DR   EuropePMC; PMC6134474; 30203150.
DR   EuropePMC; PMC6624747; 31333602.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001867.
DR   SILVA-SSU; CP001867.
DR   StrainInfo; 167956; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083050
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Geodermatophilus obscurus G-20, DSM 43160
CC   Culture Collection ID :: DSM 43160, ATCC 25078, CBS 237.69, IAM
CC                            14282, IFO 13315, JCM 3152
CC   GOLD Stamp ID         :: Gi02257
CC   Funding Program       :: DOE-GEBA 2007
CC   Gene Calling Method   :: GeneMark
CC   Isolation Site        :: Soil from the Amargosa desert in Nevada
CC   Isolation Country     :: USA
CC   Latitude              :: 36.48581
CC   Longitude             :: -116.507365
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Nonmotile
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 28C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5322497
FT                   /organism="Geodermatophilus obscurus DSM 43160"
FT                   /strain="DSM 43160"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:526225"
FT   gene            314..2068
FT                   /locus_tag="Gobs_0001"
FT   CDS_pept        314..2068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: tfu:Tfu_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72813"
FT                   /db_xref="GOA:D2SFL6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D2SFL6"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADB72813.1"
FT                   /translation="MADATVDLATVWDQIRERLATSLSPQQNAMLNLTRPVGVFEDTAV
FT                   LSAPNEFTQTVLESRMRRVLAEALSEHLGRDIRVAVQVEDSPAPPPAAPTPEVPTRRPW
FT                   SVVEAQRAQEDRETRDRTDDGRSAFGVRADVRPAWEDDGATTPDARPAERDVDEWAPTD
FT                   WSPPARRPAGRGTRAADRDWGGTDLDEDGVAVLPFDLDAGDAPEPPAPPSRGRRGGSRG
FT                   GGDAVPLFGDRRAPTGAQDPGLNPKYVFDSFVIGNSNRFAHAAAVAVAEAPARAYNPLF
FT                   IYGDSGLGKTHLLHAIGHYAARMFPNVRVRYVSTEEFTNEFINLVHSGRAEDFRRRYRD
FT                   IDFLLIDDIQFLERAERTQEEFFHTFNTLHNASKQIVITSDRAPKKLTTLEDRLRTRFE
FT                   WGLITDVQAPDLETRIAILRKKAYGERLQVPDPVLEFIASKVQTNIRELEGALIRVTAF
FT                   ASLNKQQVDLPLAELVLKDLISDEQGPQITAAIIMAATAEYFSVTMEELQGSNRSRTLV
FT                   NARQIAMYLCRELTELSLPRIGASFGGKDHTTVMHAVKKITNLMSERRATYTQVTELTA
FT                   RIKSRARS"
FT   gene            2787..3947
FT                   /locus_tag="Gobs_0002"
FT   CDS_pept        2787..3947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sco:SCO3878 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72814"
FT                   /db_xref="GOA:D2SFL7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D2SFL7"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADB72814.1"
FT                   /translation="MKFRVAREVLADAVAWTARSLPPRPSVPVLAGILLEVDGSQLSVS
FT                   GFDYEVSARAEVDVQATESGRVLVPGRLLAEITRALPPHPVDLTAEGPRLSISCGNARF
FT                   SLPTLPVEDYPSLPAMPSSAGVVDSDVFAEAVGQVAVAAGRDDTLPMLTGVRLEIEDDL
FT                   VTLAATDRYRLAVREFAWRPDTPGLTTAVLVPARTLADAAKTLTSGPEITLSLSSGSSG
FT                   EGILGLSGKDRQTTTRLLDAEFVKYRAIMPNESASNATLPVGLFTDAAKRVALVAERGT
FT                   PLRCEFTPGQVTLRAGGTDDEGQAEERCDVEFEGEPLTIGFNPTFLLDGLAAVHTPRAR
FT                   MDFTSPLKPAVLSGVPEPATDDEAASRPAERPGSYRYLIMPVRLPG"
FT   gene            4135..5067
FT                   /locus_tag="Gobs_0003"
FT   CDS_pept        4135..5067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; KEGG: sma:SAV_1771 6-phosphogluconate
FT                   dehydrogenase- like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72815"
FT                   /db_xref="GOA:D2SGD3"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGD3"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADB72815.1"
FT                   /translation="MQLGLIGLGKMGGNMAERLRRAGHEVVGYDHSPGKRDVESLPALI
FT                   EALTAPRVVWVMVPAGEPTRATVKELAEQLEPGDVIVDGGNSKYTDDQIHDVMCREKGI
FT                   GYVDAGVSGGVWGLENGYALMVGGSKDDVAKVQPVFDALKPPTPKDESGQEMPGAGFVH
FT                   AGPVGAGHFSKMVHNGIEYAMMQAYGEGYELLAAVDLIEDVPGVVKSWTQGTVIRSWLL
FT                   DLLVRALDEDPALEKISGYAEDSGEGRWTVEQAIENAVPMPAIAASLFARFSSRQEDSP
FT                   TMKAVAALRQQFGGHAVHAVREQEVERPA"
FT   gene            5185..6384
FT                   /locus_tag="Gobs_0004"
FT   CDS_pept        5185..6384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sen:SACE_0005 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72816"
FT                   /db_xref="GOA:D2SGD4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGD4"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADB72816.1"
FT                   /translation="MYLRHLQLGSFRNWDRVDLALRPGPTVFVGRNGEGKTNLVEAVGY
FT                   LATMGSHRVAGDAPLVRQGASQAVVRAALRREDRELLVEIEINPGRANRVRVNRAPLPR
FT                   PRELLGLVKSVLFAPEDLVLVRGDPAERRRFLDDLLVSRTPRLAGVRSDYDRVLKQRNA
FT                   LLKTARMARGDALATLDVWDGHLVDLGGQLLAARLRLVADLAPHVARAYAGVAGADAAV
FT                   AALGYASTVPLAGDGTPVAEGTPLPDAAELSAALRERVAERRGDEVDRGMTLVGPHRDD
FT                   LVISLGSTPAKGFASHGESWSLALALKLGCFELLRADGDEPILVLDDVFATLDADRRAA
FT                   LATVARSAEQSLVTAAVLDDVPAELRSTVVQVAGGQAVPLEGSSAEEDAEDGSLREEVR
FT                   "
FT   gene            6381..6881
FT                   /locus_tag="Gobs_0005"
FT   CDS_pept        6381..6881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   nfa:nfa40 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72817"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGD5"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADB72817.1"
FT                   /translation="MNEERPGRPSDIARAALEAARAASASRPRPTRRRIAGPKRTWSGP
FT                   RPGDDDPQPLARLVDSLVETQDWTEHTKVGAVFGRWSALVGPEIAAHCAPQTLTEGELL
FT                   VVAESTAWATQLRLLAPTILAKLHATVGGDVVRRLRVVGPTAPSWKKGPRSVRGRGPRD
FT                   TYG"
FT   gene            6940..7863
FT                   /locus_tag="Gobs_0006"
FT   CDS_pept        6940..7863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5061 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72818"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGD6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72818.1"
FT                   /translation="MSSPRDRDGFEQRPDEGSGWREPGHLGGDGDRSGAEQPPAGQPPA
FT                   EQSPADRPAQGDTGGSTAWQPPGWDLPPAEPDRPARSPAVDPQTVGEQPVGGGLLGGRR
FT                   PRQPGELEQVFAYQGDAVGAQGWAVQQGWAISDGTAPEDAVLAELVRTAPVRATKDHRP
FT                   AGVMRGRFGTLDLVAFDVLYASGRYAVPEYAVTAAPVLGTLPPLRLSPARFWKHRTGGL
FT                   VQVPSGDPAFDARWVLLAGEDGPAARALVGDATVRGLLLGTDDGDEFWTAAGHLAAIRP
FT                   DGHRPQLIEHHARLLTAIVGALAPAL"
FT   gene            7886..9652
FT                   /locus_tag="Gobs_0007"
FT   CDS_pept        7886..9652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0007"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: sco:SCO3235
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72819"
FT                   /db_xref="GOA:D2SGD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGD7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB72819.1"
FT                   /translation="MSTSAETAARATLRQLWPLVRPHRRPLTAAAVLSLVAAAGALAQP
FT                   ALVARVIEAVGAGRALLPVVGLLVVVLLASSALGAVQDYLLQRTAEGVVLSTRRTLADR
FT                   LLRLPVAEYDRRRTGDLMSRVGADTTLLRATVTSGVVEVAGSAVVAVGAVVAMALVDGW
FT                   LLLVTVGSVAVGLAVVVSVARGVQRLSRQAQEEVGAMTAAVERALSAVRTIRASGATAR
FT                   EVDVVAASAGRAYEAGVRVARLQALVSPAGSVAVQGAFLAVLGLGGYRVASGSIAVADL
FT                   VAFILYLFLLVMPLGRAIGAWTQLQSGLGALARVQEVLALEPEDDARPERGGAVVAVPA
FT                   SSPSAEVPLLELDDVSFRYPNGTDVLHGVSLSVPAGNRVALVGPSGAGKSTVLALVEGF
FT                   YPLTGGAVRWAGADVRDLPRAGLRARLGYVEQEAPVLAGSVRDNLLLAAPQATDPELWA
FT                   VLADVGLTDVVQRSPRGLDVPVGDDGVLLSGGERQRLAIARSLLARPALLLLDEPTASL
FT                   DARNEALLRETLAAAAADRALLVVAHRLSTVLDSDRIVVLDAGRVVAAGTHEELVETSP
FT                   LYRELAAAQLLV"
FT   gene            complement(9749..11281)
FT                   /locus_tag="Gobs_0008"
FT   CDS_pept        complement(9749..11281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0008"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: sco:SCO0841 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72820"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR021295"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGD8"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADB72820.1"
FT                   /translation="MAETDGTTSTPTAKTCLVTGATGYIGGRLVPVLLAAGHRVRVMTR
FT                   APERLRDHPWAGQVEIVRADAGDAEAVAAACAGADVVYYLIHALSTGGDFEETDRRTAR
FT                   VMARAAQEAGVGRLVYLGGLEPQGEVLSPHLRSRAEVAEILLGSGVPTAVLRAAVVLGS
FT                   GSASFEMLRYLTERLPVMVTPRWVHSRIQPIGIRDVLRYLVGCATLPREVHRCFDIGGP
FT                   DVMTYLEMMQRFAAVAGLSRRRILPVPVLSPGLSSHWVGLITPVPASIARPLVESLRNT
FT                   VVCTEHDIAEYVPDPPEGLLGFDEAVRLAVQRVKDATVATRWSSASTPGAPSDPLPTDP
FT                   DWAGGTLYLDEKTRETPASPEALWRVVEGIGGETGWYSFPLAWEVRGWLDRAVGGVGLR
FT                   RGRRSASDLYVGDALDFWRVEELEEGRLLRLRAEMRLPGLAWLEFHVEQQDGRTRLRQK
FT                   ATFKPSGLFGHLYWRVLVPFHGPIFGGMVRNICRAAEEGTAAAAGQRRVRAA"
FT   gene            11414..12838
FT                   /locus_tag="Gobs_0009"
FT   CDS_pept        11414..12838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0009"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   rop:ROP_66300 putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72821"
FT                   /db_xref="GOA:D2SGD9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGD9"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADB72821.1"
FT                   /translation="MADTTAATDRTSDGQPALKRVMGPGLLLLFIVGDVLGTGIYALTG
FT                   QVAAQVGGVVWLPFLVAFLVALVTAFSYLELVTKYPQAAGAALYTHKAFGIHFVTFLVA
FT                   FAVMSSGITSASTAARAFSANFVSVTGLGLGEGIGITLVGLAFMTLVALVNLRGVGESV
FT                   KANVVLTCVELTGLLIVIGVGVWALGGGGGDFSRVTEFDTGERSVVGGVIAATGLAFFA
FT                   MVGFEDSVNMAEECKEPRRIFPKVLLAGLAATGLIYVLVSISAIALVPAEQLSQGDTPL
FT                   LQVVEAGAPGFPLGLFGVITMFAVANSALINMLMASRLVYGLSRERVLPALLGRVHHRR
FT                   RTPTTAILFTTALAFGLITFVGAVPALGGTTALLLLIVFTVVNVAVLVLRRDRVDADHF
FT                   RTPTVLPVVGALACAFLATPWAGRPVEQYRIAGVLLAIGVVLWGVTVLVNRRTGAQVPR
FT                   FDPAHLTGEGPTGPHN"
FT   gene            13195..15237
FT                   /locus_tag="Gobs_0010"
FT   CDS_pept        13195..15237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0010"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: rha:RHA1_ro03674 DNA gyrase subunit B;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA topoisomerase
FT                   type IIA subunit B region 2 domain protein; DNA gyrase
FT                   subunit B domain protein; TOPRIM domain protein;
FT                   ATP-binding region ATPase domain protein; SMART: DNA
FT                   topoisomerase II; ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72822"
FT                   /db_xref="GOA:D2SGE0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE0"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADB72822.1"
FT                   /translation="MVARPKTDAQADAYSGSSITVLEGLEAVRKRPGMYIGSTGERGLH
FT                   HMVWEVVDNSVDEALAGHCDTVRVTLLPDGGVRVEDNGRGIPVDMHPVEKRPTVEVVMT
FT                   ILHAGGKFDGKSYAVSGGLHGVGVTVVNALSTELDVRIWRDGTEWHQHYTASEPGPLEK
FT                   VGRTTKRGTQITFWADPGIFETTTYSFDTISRRLQEMAFLNQGLRIVLRDERPGQGKAE
FT                   TGMAEEVSLAEAAPAPTSEEPAFEPTEITYLYEDGLRDFVAHINRTKTAIHRSVIGFSA
FT                   EGTGKNDMAMSVDIAMQWSEAYSESVHTFANTINTHEGGTHEEGFRAALTSIVNRYAED
FT                   KKLFKSKDEKLTGEDIREGLAAIVSVKLGDPQFEGQTKTKLGNTEVKGFVQRVCNEQIG
FT                   HWFEANPAEAKQIITKASSAARARRAAQQARQLARKNPLNSTGLPGKLADCRSTDPRNS
FT                   EVYIVEGDSAGGSAKSGRDSMFQAILPIRGKIINVEKARIDRVLKNTEVQSMITAFGTG
FT                   IHDEFDLSKLRYHKIVLMADADVDGQHIRTLLLTLLFRFMRPLVEAGHVYLAQPPLYKI
FT                   KWGGKVGDEYVYTDKEKEGALKLGAEAGRRIKDDAIQRFKGLGEMNATELWETTMNPET
FT                   RVLLQVTLEDAATADELFSVLMGEDVDARRSFITRNAKDVRFLDV"
FT   gene            15470..17938
FT                   /locus_tag="Gobs_0011"
FT   CDS_pept        15470..17938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0011"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: stp:Strop_0009 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72823"
FT                   /db_xref="GOA:D2SGE1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE1"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADB72823.1"
FT                   /translation="MTETPARDRIEPVDLQQEMQRSYIDYAMSVIVGRALPEVRDGLKP
FT                   VHRRVLYAMYDQGFRPDRSYVKCARVVGEVMGNYHPHGDSAIYDALVRLAQPWSMRYPL
FT                   IDGQGNFGSPGNDPAAAMRYTEARLTPLAMEMLANIDEETVDFQPNYDGKNQEPLVLPG
FT                   RIPNLLINGSAGIAVGMATNMPPHNLREVSDAVFWMLDHPEAEPEEALTACMERVKGPD
FT                   FPTHGLIVGREGIEEAYRTGRGSVRMRAVVTVEEDARGRVQLVVTELPYQVNPDNLAEA
FT                   IAEAVRDGRLQGISEIADESSDRVGRRLVITLRRDAVAKVVLNNLYKHTQLQTTFGCNM
FT                   LSIVDGVPRTLRLDELVRYYVLHQIEVIQRRTRYRLRKAEERAHILRGLAKALDQLDAV
FT                   IALIRSSASADAARSGLMDLLDIDEIQATAILDMQLRRLAALERQRILDELAELEDRIA
FT                   DLQAILDSPERQRQIIRDELAEIVEKYGDDRRTKFVANDGDVSMEDLIAEEEVVVTITR
FT                   TGYAKRTKSDLYRSQRRGGKGVMGAALKQDDIVDHFFVGSTHDWILFFTNKGRVYRAKA
FT                   YELPEANRTARGAHVANILAFQPDEKIAQVMQIKDYGVAPYLVLATANGQVKKTRLTDF
FT                   DSPRSGGVIAINLRESDELVGAALIDPDQDLLLVTRKAMSIRFKADDATLRPMGRATEG
FT                   VRGIALSPDDSLLSMIVVEEGVDVLVATERGFAKRTGIENYPAQGRGGKGVLTADPKSR
FT                   KGNLVGALSVRLGDELYAITSGGGVIRTPVNGVRHNKDRATMGVKLMNLPEDVSIVAIA
FT                   RTTDNDEPAA"
FT   gene            18107..18820
FT                   /locus_tag="Gobs_0012"
FT   CDS_pept        18107..18820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mul:MUL_0007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72824"
FT                   /db_xref="GOA:D2SGE2"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE2"
FT                   /inference="similar to AA sequence:KEGG:MUL_0007"
FT                   /protein_id="ADB72824.1"
FT                   /translation="MSDRTQGSVRTGSRTGESAPAQGTATGQQPATDGALPVGATQSIP
FT                   GANTARTQAQAAGSSDGGAPAAAGPASGTQTAVPPVTGAQPVPGAQSATGASPAAQAAD
FT                   GAAKASSGKAPRGPRRARLQLRHIDTFSALKISLVLSIAMFFIWMVAVGVLYGVLSGLG
FT                   VFETLNDLFGQLGSASGGDGGSEVITPGIVFGGAAVIGAINIVLMTALCTVAAFIYNMC
FT                   SDLVGGLEVTLSERD"
FT   gene            19118..19194
FT                   /locus_tag="Gobs_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            19118..19194
FT                   /locus_tag="Gobs_R0001"
FT                   /product="tRNA-Ile"
FT   gene            19285..19428
FT                   /locus_tag="Gobs_0013"
FT   CDS_pept        19285..19428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72825"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72825.1"
FT                   /translation="MLRKLVFAAAAAGALAAVRRRSGGRAEADLWAEATRGPQAVSTPT
FT                   AR"
FT   gene            19458..19530
FT                   /locus_tag="Gobs_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            19458..19530
FT                   /locus_tag="Gobs_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(19590..20693)
FT                   /locus_tag="Gobs_0014"
FT   CDS_pept        complement(19590..20693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0014"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: nfa:nfa7110
FT                   putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72826"
FT                   /db_xref="GOA:D2SGE4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADB72826.1"
FT                   /translation="MASIARRPDGTYRPRYRDEHGKEHARHFKRKVDAQRWLDEVTAAV
FT                   QTGTYVDPKRARTTVGELADVWLAGKINLKPTSRARYADVLKTHVRPRWGNVALIRVTH
FT                   GDVQAWLSELSDRGLAGASVRKAQGVLSGILGLAVRDRRLAVNPALGVALPPLQEKRRR
FT                   YLTAGQLEALADAAGTGRVAVLILGYCGLRWSELAALRVRHFDLLRRRVLVEEAVTEVD
FT                   GSRLVWGTPKTHGRRSVPLPRFLVDELARTVVTRPADELAFPSPQGAVLRNRNARSAWF
FT                   DAAARAIGEPGLTPHETPAHRGLAGDQGRCQRQGGAADARARLGGHDPGPLRRPVRRRP
FT                   GRPGRRGRPAGRPAGRIPRTSCGPFAD"
FT   gene            complement(20856..21083)
FT                   /locus_tag="Gobs_0015"
FT   CDS_pept        complement(20856..21083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0015"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: nca:Noca_1723
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72827"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE5"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADB72827.1"
FT                   /translation="MSDHPAPREPELLTITEAAELLRAPVATLRYWRHLGTGPRSFRLG
FT                   RRVLYRSDDLRSWIDAQHDDQGSPAAGARR"
FT   gene            complement(21245..24025)
FT                   /locus_tag="Gobs_0016"
FT   CDS_pept        complement(21245..24025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0016"
FT                   /product="TrwC relaxase"
FT                   /note="PFAM: TrwC relaxase; KEGG: nca:Noca_1102 exonuclease
FT                   V subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72828"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE6"
FT                   /inference="protein motif:PFAM:PF08751"
FT                   /protein_id="ADB72828.1"
FT                   /translation="MRGGMKVYAGSPAAARAYLEADRGRADDYYLTEGTGLARRFVARD
FT                   GRVAERAPLTGETYETWVAGRDPDTGDPRGRLRTDERAVRFVEVVVNGPKSWSLAAAMH
FT                   GDVAQAYDAAQDRAAAQIIGWLAAHATTRVGPRGGQVQVPVEMLEAVTVRHYTSRAGDP
FT                   HRHLHLQIGARVFADEQWRGLHTVGVRDFLAALNGIGHAAVACDPQFRAALAAHGYSLA
FT                   STGEIQELAAYVGPLSARAAQIGHNLDRYERDWIAAHPGEQPGPAQRRAWDARAWAEGR
FT                   PDKVIPRSGADLVARWRAQLGSLGYRDPAHPVSPAPTPVGALDREAAVDTVLTRLAAGR
FT                   SAWNAADVRGEVERLIAAEGVIADPAVRLELAEDLTARALGRCVALVDREGVPEHVRSW
FT                   TSRPVLDVEADLRTRFAARADQPAMAGPRPELLPVGLVRHLDVGQAAAVAVLAGERRLV
FT                   VVEGAAGAGKTAALAAARDLLERQGRRLVVVTPTLKAAQVARAEVGTTTGSAASLVFAH
FT                   GWRWTEHGEWTRLALGEADPVTGRIHTGPAEGSRLRPDDMLIVDEAGMVDQDTARALLA
FT                   VADEAGARLALLGDRHQLAAIGRGGVLDLAVSQVDAAACLTLESVHRFTRTNSTGQSVP
FT                   DGEYAELTLAMRRGDTPGAVFDALLARGRIHLHPDHAALQDALAATVAHDTRAADVAVV
FT                   ADTREQVNELNAAIRNRLVTDGRVDDVRVVTTRAGQRIGAGDRIATRRNDRDLEVANRD
FT                   TWTVTAVGGRGGLLVTAGPATGDVSRGDVTPAGARVRVLPADYVTEHVELAYASTAHGV
FT                   QGDTVPAAHVVIGDQTGAASAYVGMTRGRSSNIAHLVAADVAEARAQWIAVFGRDRADL
FT                   GPGHAAALAAREATRDRTAAAPPRPVAPVPSVPRPEAERRGPSLTRGGAAPGIGR"
FT   gene            complement(24536..25210)
FT                   /locus_tag="Gobs_0017"
FT   CDS_pept        complement(24536..25210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0017"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Tetracyclin repressor domain protein;
FT                   regulatory protein TetR; KEGG: rha:RHA1_ro02950 TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72829"
FT                   /db_xref="GOA:D2SGE7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE7"
FT                   /inference="protein motif:PFAM:PF02909"
FT                   /protein_id="ADB72829.1"
FT                   /translation="MSAREQRQVASDRGLSKQRVVVEAVRLADREGVDGLSMRRLAGAL
FT                   GTGAMSLYHYVASKEELLDAMIDVVFEEIELPPEETDWQSAMRRRTVSVRQVLARHPWA
FT                   NGLMVSRTSPGPANLRHHEAVTACLRRAGFSVLMATHANWLLDSYVYGFALQEASLPFD
FT                   TADELADMAEDVFLPQLPPDQFPYLNESAAALVAAGYDPADAFIFGLDLLLAALESLRA
FT                   SA"
FT   gene            25327..26091
FT                   /locus_tag="Gobs_0018"
FT   CDS_pept        25327..26091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nca:Noca_4894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72830"
FT                   /db_xref="GOA:D2SGE8"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72830.1"
FT                   /translation="MRTEQRPNEKLRTSAAAATMGTTPTRALRERIVGATAIALAASVV
FT                   IQNAVVVGAPVFGDPIEVVLAWHAENRVRVAIAVGLEALNLPLLLGFVTGLHGLVGRRG
FT                   GGGADWSRLAVAAGATLSAVFALSAVLWIGVVLSAGELAEPSPVFELAWQLHAAAFALA
FT                   LPALGTTFIGAALAAHASRLTPPWQRLLGVAGGGLLLAAGAASLAIADGSALLFVGLPG
FT                   FAAWLVWLLATGVRLVRARTAVRPDNASTYDE"
FT   gene            26379..27347
FT                   /locus_tag="Gobs_0019"
FT   CDS_pept        26379..27347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0019"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   rha:RHA1_ro02951 oxidoreductase, Zn-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72831"
FT                   /db_xref="GOA:D2SGE9"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGE9"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ADB72831.1"
FT                   /translation="MRAAVQHRYGPPSVLESSEVGLPLPGQGDVLVQVGAASVHPGDYF
FT                   VMTGEPYVVRLVFGLRRPRHGIPGRDLAGVVAAVGKDVTALRPGDEVFGWSTAGTLAEY
FT                   ACVPADNLVAVPANLSVGDAAAVPTSALTALQALRDIANVRPGQTVLVTGASGGVGSFA
FT                   VQIAKAFGAEVTGVCSTRNVDLVRSLGADHVVDYTRTDFTRTEKRYDVILDNVEAQPLA
FT                   AVRRALTPTGTLIPNSGRGGRWLGPLARIIRARVLSGFTRQQLKPFLSVEKRQDLLTLA
FT                   DLLATGQVTPVIDRTYPLDEAADALRYVAAGHTRGKVVIAV"
FT   gene            27444..27944
FT                   /locus_tag="Gobs_0020"
FT   CDS_pept        27444..27944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_5238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72832"
FT                   /db_xref="GOA:D2SGF0"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72832.1"
FT                   /translation="MTIRTTTPNLLDNPPIPVQAKIAAAWTSLMFLILYIDYFHLYQPG
FT                   EIDSIRGGVIFEFDISGTLMSIFFVVIAIPTLMIMLSMTLPARVNRATNLVVASLYIPA
FT                   CVFNAAGATWDYAFYYALTIGVEVLILAFILRSAWTWPGRTASPATLAASLDSEPLRTP
FT                   QLA"
FT   gene            28061..29005
FT                   /locus_tag="Gobs_0021"
FT   CDS_pept        28061..29005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0021"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcv:Bcav_1052 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72833"
FT                   /db_xref="GOA:D2SGF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB72833.1"
FT                   /translation="MIEARELTKRYGDTTAVHSLSFTIVPGTVTGFLGPNGAGKSTTMR
FT                   IVMGLDRPTSGTVTVNGKPYRQHRAPLREVGALLEASAVHPGRSARSHLRAMAATHNIK
FT                   ASRVREVIEMTGLAGVATKRVGGFSLGMGQRLGIAAALLGDPRTLLLDEPVNGLDPEGV
FT                   QWVRQLVRALAAEGRTVFLSSHLMSEMSQTADQLLVIGRGRIIAAGPVQQVIDSVAGGA
FT                   VRVRSPRAGELAAALAADGATVTSPGAGTLEVSGTTAEHVGEVAFRNGLLLHELSARRA
FT                   SLEEAYLSLTQDAVEYRAHTTTTTSRTAKAQNR"
FT   gene            29002..29859
FT                   /locus_tag="Gobs_0022"
FT   CDS_pept        29002..29859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0022"
FT                   /product="putative integral membrane transport protein"
FT                   /note="KEGG: bcv:Bcav_1051 putative integral membrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72834"
FT                   /db_xref="GOA:D2SGF2"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF2"
FT                   /inference="similar to AA sequence:KEGG:Bcav_1051"
FT                   /protein_id="ADB72834.1"
FT                   /translation="MSTLTADPPTTSHAATPPAAAQVQPTFAGVVRGEWIKLLSLRSTW
FT                   WALTSTGALMTLASVAYAMSLNAMAEDPVTAPGIKQMHGAEIVASGFPFGMLIIAVLGA
FT                   LLITGEYATGLIRSTFAAVPTRLPVLAAKALTLVVLTAAVALVSVTLSYFVTMPQLSQY
FT                   DLVPALDDPGTWRVFGGALYSLIAAALFSLGIGTLLRSTAASVTAALTVLLLLPGILSF
FT                   IHLDWVETIVSYLPLPASSALLTTGAVETQGVYLSAQASLIVLAAYAVVPIAAAAVTLH
FT                   RRDA"
FT   gene            29897..30460
FT                   /locus_tag="Gobs_0023"
FT   CDS_pept        29897..30460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0023"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ana:alr7095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72835"
FT                   /db_xref="GOA:D2SGF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB72835.1"
FT                   /translation="MAGKNIAVTEHLVLRPMASGDAPALAAYRSDPVQARYQSWETPYP
FT                   VDSAQALIAEMREVRFGQPGSWLQVAIETAGRLIGDVAVRVDGDDPRQAEVGFTLAADV
FT                   QGRGFATEALRAVISLLFTEHGIHRIFADCDARNVRSVALLERVGMRREAHHRKSTWWK
FT                   GEWTDEYVYAVLAEERRDEKRGGH"
FT   gene            30640..30852
FT                   /locus_tag="Gobs_0024"
FT   CDS_pept        30640..30852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72836"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72836.1"
FT                   /translation="MSIAESSASVEVSELTPEEAAEAFDRVARTALDLSGEEFLAALDE
FT                   GTYDDVDPDNRPGLLDVLMALPLVR"
FT   gene            30859..31938
FT                   /locus_tag="Gobs_0025"
FT   CDS_pept        30859..31938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpr:GBP346_A1212 cell divisionftsk/spoiiie"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72837"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72837.1"
FT                   /translation="MPGASPYQAVEAFLAPLERAVACLGAGKILVSPGGRATTGKTHVW
FT                   SLNGGDGLVLRGDAAGCRFLASMHYRIIPTDPEKYDIQEGRWRVTTSAYLYEFRAPDNA
FT                   KVWAMHWHPAGKSHATFPHLHLYTVRPDGHFPTPRQTLESAVHCASRWERSRRTPSGAP
FT                   CWLSPRGSTSCTDPGPRTRHRRQVAGEAAPYRVEAGCGRSAGSSPSFPTTSSPPTAPRW
FT                   GKGGPQAHPAGTRSALPAAGAVREALADVGAGAVVRAVSEATAAVAPVRTQSADGPQNG
FT                   QNRPNDSREQPSVNALVNRRLKSQPTAPNHPSVDFARRGLGVRFPSSPPPRRVDGPAIP
FT                   HREAGPRRTTEPVPSTLSA"
FT   gene            32247..33500
FT                   /locus_tag="Gobs_0026"
FT   CDS_pept        32247..33500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0026"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: tel:tlr1610 protease
FT                   IV-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72838"
FT                   /db_xref="GOA:D2SGF6"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF6"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ADB72838.1"
FT                   /translation="MSTQPPTSDAPLPAGRPEQAGPPAGRPEQAGPPSWQPAQGPPPSW
FT                   QPAQGPQLRQPGSFRHGFALGLGVTLGAGVVLAVVALGLTVVMVLALVGLTAGGDTAPS
FT                   GPPTETVWGAADAPARLIAVPVTGVILGSESDGVTFGGATYGYDVADTIDALETEDADG
FT                   LILELNTPGGTIHGSRAIADAVERYQKRTGNQVLAHVQGMSASGGMYAMAGADQIVADH
FT                   GSLVGSIGVIMGPFQRFRDVTGIPGSLLEPGVTTDGGVTEEYLTRGRGKDFGNPYRDMT
FT                   EEERAVLGRGLDREYEAFVSWVSQARGIPPQTIVDELGAFVFDSYTAVDRGLVDRVLGR
FT                   EEAYRHAAEINGADPDDTRVDRVVAPGLVESLLAANGPLGGIGAAAVEGDPGRSTVCAG
FT                   APIVLAYHGELSAACTPR"
FT   gene            33619..34113
FT                   /locus_tag="Gobs_0027"
FT   CDS_pept        33619..34113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72839"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF7"
FT                   /inference="similar to AA sequence:KEGG:SACE_0308"
FT                   /protein_id="ADB72839.1"
FT                   /translation="MARKSLDCRTIPSERTCAVQISGEEDEVLELAVAHAVTAHGHTDG
FT                   PELREGLRAGLRDEEELLAEPGSFLQLIEFHARDLDGFSRIVEDWRERMGRETTARWGV
FT                   VAADHDRADTYVEIVAFPDHASAMRNSEHPVTSDFAKRMQEVTEGEASFRNLDVQRVLR
FT                   M"
FT   gene            34224..34757
FT                   /locus_tag="Gobs_0028"
FT   CDS_pept        34224..34757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0028"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: sgr:SGR_3716 putative
FT                   peptidyl-prolyl cis- trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72840"
FT                   /db_xref="GOA:D2SGF8"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF8"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADB72840.1"
FT                   /translation="MTEATPARRAVLHTNHGDITVDLFPDHAPKTVANFADLAEGRREW
FT                   THPQTRAKTTDRLYDGTVFHRIIDGFMIQGGDPLGQGIGGPGYQFGDEIHPDLAFTKPY
FT                   LLAMANAGPGTNGSQFFITVAPTTWLTGKHTIFGEVADQAGRDVVDRIAKVKTGRGDRP
FT                   VEDVVIQSVEVQRS"
FT   gene            34817..35653
FT                   /pseudo
FT                   /locus_tag="Gobs_0029"
FT   gene            complement(35780..36187)
FT                   /locus_tag="Gobs_0030"
FT   CDS_pept        complement(35780..36187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0012c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72841"
FT                   /db_xref="GOA:D2SGF9"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGF9"
FT                   /inference="similar to AA sequence:KEGG:MAP0012c"
FT                   /protein_id="ADB72841.1"
FT                   /translation="MEWSPRPGESAVLAVTGLLLGLAAVVLDPLGRVLVGAAAVLLLAL
FT                   AARDRLLRPRLAAGPAGVVVRRLGGTTELPWGRLQVRVRDTRRWGLRSRLLELDTAAGP
FT                   DDDGDLVLLGRRDLGADPGDVARVLRDLRPG"
FT   gene            36388..37548
FT                   /locus_tag="Gobs_0031"
FT   CDS_pept        36388..37548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0031"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: fre:Franean1_3657 acetyl-CoA
FT                   acetyltransferase; TIGRFAM: acetyl-CoA acetyltransferase;
FT                   PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72842"
FT                   /db_xref="GOA:D2SGG0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADB72842.1"
FT                   /translation="MRDAVICAAVRTPVGKRGGGLSGVHAVDLSATVLDALVERTGIDP
FT                   AVVEDVFWGCVSQVGEQTFNIGRNAVLAAGWPESVPGTTIDRQCGSSQQTVAFAAATVI
FT                   SGQADVVVAGGVESMSRVPMGAARADGSAGKPLGPRFLERYGGVFPNQGIGAEMIAERW
FT                   GFSRTQLDEFSLASHEKAAKAQADGAFEEEIVPVTTPDGTVVSADEGIRPGGTLEKLGS
FT                   LKTPFKEDGVISAGNASQISDGSAALLVTTSERARELGLRPLVRIHTTVMAGDDPVIML
FT                   TAPIPATHKLLQRSGLSVGDIGVFEVNEAFAPVPLAWQAETGADVDRLNPRGGAIALGH
FT                   PLGASGARIMTTLVHTMQATGTRYGLQTMCEGGGMANATILELVTD"
FT   gene            complement(38078..38350)
FT                   /locus_tag="Gobs_0032"
FT   CDS_pept        complement(38078..38350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0032"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   nfa:nfa760 putative septation inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72843"
FT                   /db_xref="GOA:D2SGG1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG1"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADB72843.1"
FT                   /translation="MPKSKVRKKSAYTPPQGTLQSGTASARAVQPSPRWYAPLMVALML
FT                   LGLLWIVVFYVAGESIPFMSGLNAWNFAIGFGLMVAGLVMSMRWR"
FT   gene            38419..39186
FT                   /locus_tag="Gobs_0033"
FT   CDS_pept        38419..39186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0033"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   saq:Sare_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72844"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG2"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADB72844.1"
FT                   /translation="MATARTLRPRMTRGGAAWAALVPVVALAAGLLFATSSQTAQGTDL
FT                   RGGEATELSALIPARGDVVAAQEDQLTALQAQVQALTDQAASRNGDVAAARDAGQAGAL
FT                   SAGLVALTGPGVEITLDDAPRRPDGSLPIGARPDDVVIHQSDVQAVVNAVWASGADAVA
FT                   IMDQRLIATSAVRCVGNVLLLQGRTYSPPFVVTAIGDAGAIRAQLAASPQVQVFRQAVE
FT                   DYGLGFAVEDRAEITLPAYDSPPAMEYATAADG"
FT   gene            39198..39869
FT                   /locus_tag="Gobs_0034"
FT   CDS_pept        39198..39869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0034"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   fal:FRAAL6756 para-aminobenzoate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72845"
FT                   /db_xref="GOA:D2SGG3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG3"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADB72845.1"
FT                   /translation="MYTRTVSRPVLVVDNFDSFVYNLVQYLGQLGVQCVVRRNDAVTVD
FT                   ELPDLDVAGVLLSPGPGTPAGAGVTVPMVRAAAEAGTPVLGVCLGHQAIGAAFGAEVVR
FT                   APELLHGKTSHVVHDGVGVLAGLPSPFTATRYHSLAVDRDTVPAELEVTGTTPSGIVMA
FT                   LRHRELPIEGVQFHPESVLTEGGHRMLATWLEACGLTPDPAAVEAASAAAHRLTTVATT
FT                   A"
FT   gene            complement(39984..41927)
FT                   /locus_tag="Gobs_0035"
FT   CDS_pept        complement(39984..41927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0035"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   PASTA domain containing protein; SMART: serine/threonine
FT                   protein kinase; tyrosine protein kinase; PASTA domain
FT                   containing protein; KEGG: rha:RHA1_ro03696 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72846"
FT                   /db_xref="GOA:D2SGG4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB72846.1"
FT                   /translation="MTTPQVLGERYEIGGVLGRGGMAEVHRGRDLRLGREVAVKVLRSD
FT                   LARDPSFQVRFRREAQAAASLNHPAIVAVYDTGEDRSSSGATPYIVMEYVEGETLRDVL
FT                   RREGVLSPARAMDFAADICAALDFSHRNGIVHRDVKPGNVMVTPQGTVKVMDFGIARAV
FT                   SDSAATMTSTAAVIGTAQYLSPEQARGESVDARSDVYSVGCLLYELATGAPPFTGDSPV
FT                   SVAYQHVREDPRLPSSVNPAIPPELDAILLKALSKNPANRYQSAADMRSDLLRAMAGQP
FT                   VEATPVMGDAAKTAIIGAPPGGYGDVDWDDEDDDAARKRRRNRIIAAVIAGVLVLGGVI
FT                   AVALLIGSDGEEAPAATPTAPQVSVPNVAGQDQATATQNLQAAGLTVGTVTTQVTSDES
FT                   QVDTVLGTDPSSGTQVDQGSTVDLVVGVGPDTVEVPAVIGLDVDRAETTLANAGFDDVQ
FT                   TEEVDSLSPADQVVDVTPGEGQSVDPSTTVTLQVSDGTTEVPDVTGQQQAAATQALRSA
FT                   GFTNVTAEQVESGQPEGTVVATDPSGGQQASADEPITLQVSAGEEQIPVPNVVGQSEAQ
FT                   ARAALQRAGFTNVTVTRTTSDDVQQSQVVSTTPAAGTQAAASDPITLLIADPAPDAGTG
FT                   TDPDTGETPAGG"
FT   gene            complement(42055..43899)
FT                   /locus_tag="Gobs_0036"
FT   CDS_pept        complement(42055..43899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0036"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: art:Arth_0021
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72847"
FT                   /db_xref="GOA:D2SGG5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB72847.1"
FT                   /translation="MPLSTGTILAGRYEITAPIATGGMGEVWRARDRVLDRVVAAKVLR
FT                   SEFTGDPSFVARFRNEARHTAALSHPNIASVYDYGETEDERGSQLAFLVMELVEGKPLV
FT                   TILHEEGKLPVDWTLHVLGQSADGLSAAHHAGVVHRDIKPGNLIVRPDGVVKLTDFGIA
FT                   RARDATPLTRTGMVVGTAQYLSPEQAQGFEVTAASDVYSLGVVGYECLTGGRPFDGTSQ
FT                   VAVALAHINRPPPPLPANVPPAVRHLIERALAKDPADRFADGAAFAAAIRSVASGNGLA
FT                   AAAPGTTPPYPLGAAPTAQTEVVDDLADSRTQVLGAASAGGAAATGARTSAGAMPPLRR
FT                   TEDDDEDDRYAARPTRDDGRRRNRWLWLVAGLVLLGLLGGGLWALLGPDSADSPATDAA
FT                   PSTSAPAASAPSAAGTVFVDSTGYIGDPVDDVEQRLIDLGLQVTTEEASAAQLAELGQA
FT                   LDEGDVVTTDPFNANVAPDSTVTLFYAPADYTPDTGDQDTGDQDQAPADPTTAAPTRTT
FT                   AAPAPSTSSGQGNQDGGSGQGGGRGNGQGGGQDTNQDTGPGTGAGDGGGAGGDGATTPT
FT                   ESALPGNTPTATVPADPADPQADNAPGQQLPPQAGPGA"
FT   gene            complement(43899..45341)
FT                   /locus_tag="Gobs_0037"
FT   CDS_pept        complement(43899..45341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0037"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: ace:Acel_0020 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72848"
FT                   /db_xref="GOA:D2SGG6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG6"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADB72848.1"
FT                   /translation="MNAPLRRVAISVLVLFTLLIVNVNVIQVVRSEELRSDGRNTRVLA
FT                   EEYDRERGSIVVAGTEIANSVPTDDRLTYLRQYANGPVWAPVTGYYSLVYGNVQMERAA
FT                   NEVLSGTDDRLFVRRLADLFTGRDPSGGDVVLTMDPAVQETAMAGLEGVTGAVVALDPA
FT                   TGAVLGMASTPTYDPNQLSSHEPAAIRAYSDQLDSLEIDPRLNRAIDARYSPGSIFKVV
FT                   VSAAALSSGEYTSDTVIPAPRELVLPGTSTPLENFGGSACDPSGEQSLLDALTVSCNTA
FT                   FAQLGIDLGEDRVREMAEAFGITGEGFDIPLTVEGSTLGDIENDAQLGVSSIGQQDVQL
FT                   TPLQAAMIASAVANDGTLMSPYLVDQVRAPDLSVIDQTDPDELGEPFSADVAGQLTEMM
FT                   TSVVENGSGRRARIPGVTVAGKTGTAENAGPDHNWFIGFAPADDPQIAVAVFVANGGGT
FT                   GGDVSAPIARDVMQAYLDGQGG"
FT   gene            complement(45338..46759)
FT                   /locus_tag="Gobs_0038"
FT   CDS_pept        complement(45338..46759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0038"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: nfa:nfa830 putative
FT                   cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72849"
FT                   /db_xref="GOA:D2SGG7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADB72849.1"
FT                   /translation="MTSGPPTDPRAAAAGTATPPKRRGTELALLGFAVLITLVAQAIVD
FT                   LTVTGSLTTELATFGLWFTALWTVAHLVVRRWAPYADPLLLPAVALLIGLGLSFIHRLD
FT                   LAAQQAGSTVSREDAPVQLVWATLGLVLFVGVLLVLRDHRLLSRFAYTLALIGLVLLAI
FT                   PALLPASLSEVNGAKIWIRVAGFSIQPGEFAKICLTVFFAAYLVDKRDVLALASRRVMG
FT                   LELPRGRDLGPVLVAWGLSILVLVFERDLGSSLLLFGIFVVMLYVATERASWLVIGLGL
FT                   FAGGALIAYQLFGHVQQRVDSWLDPFEYYDGSGFQVAQALFGLGTGGLFGAGLGGGRPD
FT                   QVPVAKSDFIAAAVGEELGLFGLVAVIIVYLVLVERGLRTSLIVRDAFGKLLAAGLAFA
FT                   IAWQVFVVLGGVTGLLPLTGLTTPFLAYGGSSLVANFVLVAVLVRISDAARRPAAPTGP
FT                   PKPALGDAPTEVVQT"
FT   gene            complement(46833..48251)
FT                   /locus_tag="Gobs_0039"
FT   CDS_pept        complement(46833..48251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0039"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: sen:SACE_0048 protein serine/threonine
FT                   phosphatases; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72850"
FT                   /db_xref="GOA:D2SGG8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG8"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADB72850.1"
FT                   /translation="MTLALRYAARSDRGLVRGNNQDSVYAGPRLLAVADGMGGHAAGDV
FT                   ASKVVIAALEHLDDDAPSGDMLQALREAVFDGSEHLREVIRESPHLEGMGTTLTAVLFA
FT                   GGRLALCHVGDSRAYLLRDGVLQQITHDDTFVQTLIDDGRITPEEANHHPQRSLLLRAL
FT                   NGQDVDPDLSMREARAGDRYLLCSDGLSGVVSEETLAEALQDPDPQSTADRLVELALRS
FT                   GGPDNITVIVADVVEDDGEGTYPVEPVVDGAAGDNVGQRAVDPRSAAGRAALADPRPEP
FT                   PAAGSGASAGGAAAPPPRRRRRRVLAALAAVVLLGAAAVGAYLWVLSNWFVGVQPTDAG
FT                   ERVTVFRGLDTSLLGVDLNQVSGVTDLPVVDLTPVAASKVQRGIDATDAEHAERIVSML
FT                   REQRLPLCPAVEDDPAPSAAAPTTTPPASPPPAPDGAAPTDAAPTDAAPSTPAPTSQRA
FT                   TATLEPGVDCREAQ"
FT   gene            complement(48280..48744)
FT                   /locus_tag="Gobs_0040"
FT   CDS_pept        complement(48280..48744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0040"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: sen:SACE_0049 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72851"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGG9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB72851.1"
FT                   /translation="MTAEIVLQIFRFGFLLLLWLFIFAAFRVVRADLFGGRAGRVASVP
FT                   PRAAAPGKKKARGGPKTLVVTAGPLTGTKITLSDQPILIGRADDSTLVLTDDFASSRHA
FT                   RLTNRGGQWYVEDLGSTNGTYLDQQRVQGPLLVGPGQPIRIGQTALELRS"
FT   gene            complement(48758..49570)
FT                   /locus_tag="Gobs_0041"
FT   CDS_pept        complement(48758..49570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0041"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: stp:Strop_0042 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72852"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH0"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB72852.1"
FT                   /translation="MGVLQRFERRLEGMVGLAFARIFKGKVHPAEIAKALTREADEQRS
FT                   VMGEGRVLAPNIYDVRLGSTDYEHLAEWSEQLATQLADMVTEHIEGEGYQVFDAVQVRL
FT                   ERDEELPTGVFEVSSHVADPSAKPGPRLDEPVGPRSGAVPPLPPLQGGRMATDTGRQSP
FT                   STVVGRAGSRPGATHVLLVDGPGTRHELTTGRNVIGRGTDADIRLPDTGVSRKHVDVVL
FT                   DNGTAIAEDLGSTNGTLVNGRRITRQPLADGDVIRIGHSVLVYRQDGA"
FT   gene            49747..49829
FT                   /locus_tag="Gobs_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            49747..49829
FT                   /locus_tag="Gobs_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(49979..50365)
FT                   /locus_tag="Gobs_0042"
FT   CDS_pept        complement(49979..50365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0042"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   gvi:glr2060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72853"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH1"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ADB72853.1"
FT                   /translation="MHSMTERFTDALHRIDSDRDVQPMVDLTGDDAELVKLDEHHQTTG
FT                   KDGAKTFWEDYRNVFGDLETTFTHSVVGEDSAALEWTSTGTLRSGKPFRYRGVTVIEGD
FT                   EDRLTGVRTYYDSAAFLQERAGTA"
FT   gene            complement(50437..50895)
FT                   /locus_tag="Gobs_0043"
FT   CDS_pept        complement(50437..50895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0043"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707; KEGG:
FT                   nfa:nfa41690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72854"
FT                   /db_xref="GOA:D2SGH2"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH2"
FT                   /inference="protein motif:PFAM:PF08044"
FT                   /protein_id="ADB72854.1"
FT                   /translation="MPEPHLRAADADRAAVAAQLGEQMSAGRLTVAEYDERLARAYAAR
FT                   TYGELEELTADLPRPAAQPPAPAPVRPQPAAHGWHHGGWSGGPSREAAWRNWAVTAVIV
FT                   LAVWTATVIGSGELRYFWPIWVIGPWGAVLLAQTLGRGRGDDDRRRLT"
FT   gene            51019..51954
FT                   /locus_tag="Gobs_0044"
FT   CDS_pept        51019..51954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0044"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: saq:Sare_0514 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72855"
FT                   /db_xref="GOA:D2SGH3"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH3"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ADB72855.1"
FT                   /translation="MWWGEAMSAAWPATEPTEVAIAAGDARLVVDLRGGAMRTLTVGDR
FT                   ELLDGYAAGTVPGASRGRVLLPWPNRIRDGRWSWGGRDLQLELAGPDKPVAMHGLVGWQ
FT                   SWAVLEQSDGAVTVGTVVEARSGYPFRLAAAIDHVLEPGRLTVTMRVRNAGAEPAPFGA
FT                   GFHPYLAVGAQEDGAIADAELELPARTELVVDDGGLPTGERRPLEEAVGRIGDRAFDTP
FT                   VTDLDRDADGWARVRLRSAALGTLELAVDGSWPWLQVFTGDTLRPGQRRRSVAVEPMTC
FT                   PPNALADSVDLVVLEPGADWTGTWTLGWGA"
FT   gene            51956..52669
FT                   /locus_tag="Gobs_0045"
FT   CDS_pept        51956..52669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0045"
FT                   /product="MOSC domain protein beta barrel domain protein"
FT                   /note="PFAM: MOSC domain protein beta barrel domain
FT                   protein; MOSC domain containing protein; KEGG:
FT                   tgr:Tgr7_2591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72856"
FT                   /db_xref="GOA:D2SGH4"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH4"
FT                   /inference="protein motif:PFAM:PF03476"
FT                   /protein_id="ADB72856.1"
FT                   /translation="MRVAELWRYPVKSLQGERLTTVHVGPEGLAGDRQWALFDAPTGYG
FT                   LTARRVPDLLFLSGRLRADGHVEVVLPDGTVTSDDAVLSDWLGRSVALRAAADAPGERL
FT                   YENPNEVSAAGEYDWDAFPGARGAFHDSSRTRVSLVSTGTLGTWDRRRFRANVVLDGAG
FT                   EDALIGQQVRLGGAELDVVKPVDRCVMVTRPQPGGIGRDNGVLKTIHRERDGCLAIGAL
FT                   VARTGTVAVGDELTA"
FT   gene            52666..52890
FT                   /locus_tag="Gobs_0046"
FT   CDS_pept        52666..52890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_35520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72857"
FT                   /db_xref="GOA:D2SGH5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH5"
FT                   /inference="protein motif:COG:COG2501"
FT                   /protein_id="ADB72857.1"
FT                   /translation="MSRVRTVELRPGEESIRLGQLLKLVDAVPTGAQVKDVLLTGTVRV
FT                   NGEPEERRGRQLRKGDVVSVEGMEDVRVA"
FT   gene            52915..54102
FT                   /locus_tag="Gobs_0047"
FT   CDS_pept        52915..54102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0047"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   saq:Sare_4251 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72858"
FT                   /db_xref="GOA:D2SGH6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADB72858.1"
FT                   /translation="MTRAPYLSSRLQGFGTTVFAEMSALAVATGSINLGQGFPDYPGPP
FT                   EVLDVARAAIGTAHDQYPPGPGIPELRSAVAEHVHRFGGHAYDPDAEILVTAGATEALT
FT                   AALLALLEPGDEVVLFEPMYDSYAAGIAMAGGVARPVPLRPPASGTGPWTFDPAELRAA
FT                   VTPRARLLLLNTPHNPTGKVFTRAELGTLAALAMEHELLVLTDEVYEHLVFTGSRHATL
FT                   ATVPGMRERTLVVGSAGKTFNVTGWKVGWICGPAPLVSAVRTAKQFLTYVNGGPFQPAV
FT                   AAGLRLPGEYFAGIARDLEHRRDVLVEGLTAAGLPVVCPEATYFATVDVRPVQPDGDGL
FT                   AFCRALPERAGVVAVPTVVFYSSEHAHLGRHLVRFAFCKSDAVLAEAVERLGRMG"
FT   gene            54102..54884
FT                   /locus_tag="Gobs_0048"
FT   CDS_pept        54102..54884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0048"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pfs:PFLU5051 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72859"
FT                   /db_xref="GOA:D2SGH7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH7"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ADB72859.1"
FT                   /translation="MRFAVVQHDIVWEDRAANFARLAPQVACAAGAGAEFVLLSETFST
FT                   GFSMTPGIGEPEGGPSARFLQEQAAEHGVWVAGSCPEVAPDTGGVGGGDAALPYNSFVL
FT                   AGPDGTVHRYRKLHPFTHGGEHERFRAGEKPVTVEVGDLRVTPFICYDLRFADVFWSAA
FT                   LDTDVYLVTANWPAARRLHWQTLLQARAIENQAYVVGCNRVGTAGDGTEHTGDSRIVSP
FT                   MGELLVTAAGVETVLVADVDPAEVAATRQRLQFIADRR"
FT   gene            complement(55048..55440)
FT                   /locus_tag="Gobs_0049"
FT   CDS_pept        complement(55048..55440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0049"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: rop:ROP_19820 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72860"
FT                   /db_xref="GOA:D2SGH8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB72860.1"
FT                   /translation="MTAQLFAYVSYRDARAALDWLAALGFSEVRRQEGSDGVVTHAEVR
FT                   WGDVVLMVSGDTADHLVPPLVGDSTGRGLYLRVEDVDGAFERAVAAGARPVVAPENTIW
FT                   HSRRARVLDPGGQEWSFGTYEPGVAW"
FT   gene            complement(55451..56356)
FT                   /locus_tag="Gobs_0050"
FT   CDS_pept        complement(55451..56356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0050"
FT                   /product="Domain of unknown function DUF2382-like protein"
FT                   /note="PFAM: Domain of unknown function DUF2382-like; KEGG:
FT                   aau:AAur_3970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72861"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR019060"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGH9"
FT                   /inference="protein motif:PFAM:PF09557"
FT                   /protein_id="ADB72861.1"
FT                   /translation="MLSERELSAAIGSAAYGPDGEKIGTVEHFFTDDRTGAPTWVAVST
FT                   GLFGTRHSVVPATDATFTEGSVRLPVTKDAVRTAPSVSDQHLDPETEALLRQHYGLDAG
FT                   TTPAGTTAGTTTAGTTTAPVGDDTTTRDLSQLPGDHRAGGTEQDTVSIDREAARDQTVP
FT                   VAAVPTPPTTDGAMTRSEEQLRVTMERYAAKRVRVVKYVVTEEVQVTVPIRREEIRIEE
FT                   IPLGDGAPATAGALDAAGTGGLPETIVLHTERPVVGTEVVPVERVRLRTEWVQEHVQVR
FT                   DQVRRERVDVDQDHLGQERL"
FT   gene            56500..58083
FT                   /locus_tag="Gobs_0051"
FT   CDS_pept        56500..58083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0051"
FT                   /product="CHAD domain containing protein"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: nca:Noca_2705 CHAD domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72862"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI0"
FT                   /inference="protein motif:PFAM:PF05235"
FT                   /protein_id="ADB72862.1"
FT                   /translation="MTSEHIEVERKFEAGEGFSLPDLTGVGEVAAVGDPEEQSLQATYY
FT                   DTPDLRLLRSRVTLRRRTGGADAGWHVKLPAAAGARRELHQPLGRAARTAPRAVVAPVL
FT                   GLLGTAAAEPVATVSTRRVVHRLLDEGGRVLAEVADDAVVGTAFATDPGEPATVTTWRE
FT                   LEVELVDGDEALLEAVTERLVAAGARPSAVPSKLGRVLDGRLPAPTSAAPEAATDGGTA
FT                   GKGKKGRKKTPVRTAGEVVLGAVAGQLQALRDADLAVRTEQPEGVHDLRVACRRLRSIL
FT                   ASFRPVLDREHTDPLREELRWVGAQLSGARDTEVALSHLRELVAAQPVELVLGPVAARL
FT                   QQTEIKDHHAGARRVIRTLTDRRYLRLIDALDALLADPPVTQLAAAPAPAQLADAVRRT
FT                   GKRLRRVVDAAREAEGDDRHHLLHEVRKATKRVRYTAEVAEAEFGAPATALVDCTKQVQ
FT                   DLLGAAQDTVVTRDVAVRVGRAAFAAGENAWTYGRLHGLEEARAEAAETGFWSLERGLR
FT                   RAVKAVASLG"
FT   gene            58159..59484
FT                   /locus_tag="Gobs_0052"
FT   CDS_pept        58159..59484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0052"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mgi:Mflv_4868
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72863"
FT                   /db_xref="GOA:D2SGI1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADB72863.1"
FT                   /translation="MAGPGTLQGGRERSRPDAERPHEHEEPVLSLIGLLGFATVVLLAV
FT                   LLLHGYLWWRLVRSTTPPGRTRRLLTLGLVVLAVLPVGAVLLRRQDSLLSTVVQWVGFS
FT                   WLGVAFYLFLTLLALEPVRLLLRRRFRSAPAAEPVAVPVGAVPAPEETPVPEDLGVADP
FT                   TRRLLLARGLAVTAGAVALGTAGTGAYLANSAPVVRRVPVTLAGLDPALDGLRIVTFSD
FT                   GHLSAMSSTRRFERLVDIVNAQQPDVVAIVGDLVDGELGELREEVAPLADLVSEQGVYF
FT                   VTGNHEYFVDTTAWLRHLPTLGVQVLRNERVPIVRGGASVDLAGIDDRTAISSGVPGHG
FT                   ADLDTALDGRDDAVPVVLMAHQPVQVEQAAAAGVGLQLSGHTHGGQLWPFDYAVRLDQP
FT                   AVQGLSRVGDTQLYVTTGAGYWGPPMRIGARPEVAVVELRAP"
FT   gene            complement(59488..60054)
FT                   /locus_tag="Gobs_0053"
FT   CDS_pept        complement(59488..60054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0053"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO7809
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72864"
FT                   /db_xref="GOA:D2SGI2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB72864.1"
FT                   /translation="MAQDHRARQYASTHQRIYDTAMELFRESGYEDVPISRLAAAAGVS
FT                   VQTFYAHYPSKDDLIMAPPDRAEVTALLASVPADLPLGERVRGVLRQFLHGLQGERRSD
FT                   ALARWQLIAATPRLRYRAAEYERATAQMFLDALCDGEPGHPASTVVVTAHLSAYTQALL
FT                   RWAESAGELSLEHVMEEALSALRQL"
FT   gene            60297..61025
FT                   /locus_tag="Gobs_0054"
FT   CDS_pept        60297..61025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0054"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: aau:AAur_2055 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72865"
FT                   /db_xref="GOA:D2SGI3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI3"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADB72865.1"
FT                   /translation="MSGPKYLSVRENLRRRVSALPEHTLLPPEPVLCEEYGVSRITLRR
FT                   AVDGLVADGHLVREQGRGTYVTRPAIRHEYRESFVHRIAGWSSVMTEQGAQVGTTVLTQ
FT                   RIVPVQPPVATELGLEPATDVVELVRLRSVDGAPNHVAHSFLPAATYPEAAEVDLSEGS
FT                   LYEFLRREYAADLATARIVVDVGTAAPEEADLLQVVAGSPLLVVRTTVRDSAGQPLVHS
FT                   FSRLRPDVSQVEFEVSVSGR"
FT   gene            61082..61567
FT                   /locus_tag="Gobs_0055"
FT   CDS_pept        61082..61567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72866"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72866.1"
FT                   /translation="MPQPVTVTGSREVPHERRQVWEALAVLEPYCAVCDVSYVVDGRSA
FT                   PGRGTRFVAVPGRLDDGVQPPAGSPQGEIVEWVPQERVTTRLQLTPETWTTTIELADAG
FT                   PGTTRVTITVSHEPHTAGRLHQRLTQRLMRGGVREMVQRTVDGELDRLPAHVEQLQG"
FT   gene            61689..61961
FT                   /locus_tag="Gobs_0056"
FT   CDS_pept        61689..61961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0056"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: nca:Noca_1471 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72867"
FT                   /db_xref="GOA:D2SGI5"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI5"
FT                   /inference="similar to AA sequence:KEGG:Noca_1471"
FT                   /protein_id="ADB72867.1"
FT                   /translation="MEIIGLIIAGLIIGLLGKFVAPGARDNTPLWLTLLCGIGGVLIGY
FT                   YVSGALGVAATPGIDWMRWIISIIVAAVLVVAASTLTGRNKRAVR"
FT   gene            62062..62331
FT                   /locus_tag="Gobs_0057"
FT   CDS_pept        62062..62331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nca:Noca_1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72868"
FT                   /db_xref="GOA:D2SGI6"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI6"
FT                   /inference="similar to AA sequence:KEGG:Noca_1872"
FT                   /protein_id="ADB72868.1"
FT                   /translation="MQILGLIAVGLVIGALARLIQPGRQRMSILATMLLGVVGAVIGGL
FT                   IADWLDVGSITELNFWGFVFALLAAVLLVGIAEGVTAGRNRAVR"
FT   gene            complement(62349..62987)
FT                   /locus_tag="Gobs_0058"
FT   CDS_pept        complement(62349..62987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72869"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI7"
FT                   /inference="similar to AA sequence:KEGG:SCO7708"
FT                   /protein_id="ADB72869.1"
FT                   /translation="MELTKHGHSCVVLSEDDRRLVIDPGAFTDPSALDGAGAVLVTHEH
FT                   ADHFAPDVLRAAMDADPALEVWTNGSVAGRLDGAAGRVHVVGDGDALTIAGFDVTVHGE
FT                   LHAVIHPEVPRVGNIGFLVGGEVFHPGDAFTVPSEPVATLLLPVHAPWSKTAEVIDYVR
FT                   AVDADQAYAIHDGLLNDAGLGIVSSLLGERGPGTPTPFSRLAPGDSVEL"
FT   gene            63116..63340
FT                   /locus_tag="Gobs_0059"
FT   CDS_pept        63116..63340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72870"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72870.1"
FT                   /translation="MSAPTVAATVVAARSRAHGPTTALWHAVSLHRPTAEVDGACELTL
FT                   CGSLARIDVDQPWPTPARDVCPACVVLTP"
FT   gene            complement(63414..64190)
FT                   /locus_tag="Gobs_0060"
FT   CDS_pept        complement(63414..64190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0060"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   nfa:nfa21600 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72871"
FT                   /db_xref="GOA:D2SGI9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGI9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADB72871.1"
FT                   /translation="MPETVTREDAGGVATITMLRPGLTHQSRRELLDVVREVAADGSVR
FT                   AVVLTGTGRAFCVGQDLGQHVEALRGDAATSLSVVEEEYNPLVLALAGLRVPVVVAVNG
FT                   ACAGAGLGIALAGDLRVAAAGAKFTTAFAGIGLSSDSALASRLVHCVGGSRAAELLLLP
FT                   EPFLAESAAAWGLVHRVVPPEQVLAEAQALAARLAAGPTAALRAIKTVLATAATDSLED
FT                   TLALEARLQTDLGRTADHREAVEAFLEKRAPRFTGH"
FT   gene            64597..66285
FT                   /locus_tag="Gobs_0061"
FT   CDS_pept        64597..66285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0061"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: nfa:nfa810 putative serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72872"
FT                   /db_xref="GOA:D2SGJ0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB72872.1"
FT                   /translation="MVEPGRRNLGERYELAELIAAGGMGQVWRGTDVLLGRPVAVKVLR
FT                   SEYTGDPTFRARFRAEAQHAAGLSHPNIAAVFDYGETEATDGSGETLAYLVMELVEGEP
FT                   LSAVLQREGRLSAAVALSLLEQTASALAEAHRVGLVHRDVKPGNILVRDDGSVKITDFG
FT                   IAWSAGSVPLTRTGQVIGTPQYLAPEVAEGHHATPASDVYALGLVGYECLTGHPAFDGD
FT                   NAVTIALKQVRDDPEPLPDDLPGDVRKLIRRALAKDPAARMPDGAAFVAAVEDVRAGRP
FT                   LPEPPPTRTMAAVPGLPPVAGPAAGPAVRTVGPPARRHRGLAAVLVPVVTLLLGAGAAA
FT                   GVFVAVSSDEGDGGPTVVAAQTEDARIALAAEDYVGRQVDEAALALSALGLLVQREEEV
FT                   TDDAAPGLVTAVDPVGAQLRPGDVVRVRYAVAPEPAPRQQRSSPATRVSEDTPDRQRPV
FT                   AQPTPTEPEPTPTATPEELPASAAPTETSTLPATTSATESGTTSAPDSTSGTSTPPPDP
FT                   SDGDGDGGGNGNGNGNGNGNGNGNGNGNSNGGDSNGDGDWDRSER"
FT   gene            66298..67944
FT                   /locus_tag="Gobs_0062"
FT   CDS_pept        66298..67944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0062"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: nfa:nfa810 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72873"
FT                   /db_xref="GOA:D2SGJ1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ1"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB72873.1"
FT                   /translation="MDLPFRGFETGSEWHPGDPSGTAPRGYGQGERVAEPGVRTLGDRY
FT                   ELLSLVATGGMGQVWRAHDALLDRPVAVKLLRSEYTGDPTFLARFRAEAQHTARLVHPN
FT                   IAALHDYGEVVASDGSGETLAYLVMELVEGEPLSALLTRCGRLDPHRTLDIVRQTAAAL
FT                   AVAHAAGVVHRDVKPGNVLVGWDGVVKITDFGIAWSASNVPLTRTGQVVGTAHYLSPEQ
FT                   AGGGKAGPASDVYALGAITYECLAGRRAFDGEGPVQIALAQIRDEPEPLPDDVPEPLRT
FT                   LVARALVKDPALRFPDGAAFRAAIDAVRAGRPLAPLPPTTAALPAARDRRRLLVPAATL
FT                   LLGVGLGVGALQVVGSEGAATSAAVAGAAAPTTAAVAPVAALVVTAADHLGRPADEVEA
FT                   ELAALGLRVQRETVERSDVPAGQVVELGPVGALAPGELVTLTVAVAPPAPAPAPVVPAP
FT                   APAPVVPAPAPEPVVPAPAPEPVVPAPAPQPVVPEVVTVPIPPAAERGPEPAPVPVWDG
FT                   ADAAEDDAAPGNGKGKGKEKPDSSGKGNGRG"
FT   gene            complement(67953..68651)
FT                   /locus_tag="Gobs_0063"
FT   CDS_pept        complement(67953..68651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72874"
FT                   /db_xref="GOA:D2SGJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72874.1"
FT                   /translation="MTHPSPTPEPPTPRDPAYTGTHEVGVGATAATVAGTHQVPRVDAA
FT                   PVSGGVQPTGPVGGLPGLPGVASPPPADTSDHPSGLPRTAERPRTARTPRTPRIPRAPR
FT                   TPPAPRSAQERTVRIGAGLTALSFLLLQFGLTLDFGETSLWSAVTLWAVFATLATLLGG
FT                   LPFAGRFLPAARLRPDAAWKVAAGGLTGVAVFWVLVVLPRIDSDRGFVLTGALAALGAA
FT                   LWVAPSRSRG"
FT   gene            68744..70048
FT                   /locus_tag="Gobs_0064"
FT   CDS_pept        68744..70048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0064"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; molybdopterin binding
FT                   domain; KEGG: mjl:Mjls_2737 competence damage-inducible
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72875"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008135"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ3"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ADB72875.1"
FT                   /translation="MGGQLTRVGRVAVRAGIVVTGTEVLTGRVSDRNGPWLAEELRRLG
FT                   VDVGAVLVVGDRPEDLRNALRFLAGEDVVITTGGLGPTADDLTAEVVAGVQGRPSSLDP
FT                   ELERHVAGIVEGLMDGRGWRADPAATAAGVRKQALVPEGATVLPPVGTAPGLVVPPAEG
FT                   RDGPVVVVLPGPPSELQGMWPAALDAEPVQRVLAGRSELRQETLRLWGTLESQLAATLR
FT                   ESEFPGLEVTTCLRDGELEIVTRYGPDAQPEYDRLVGAVREAHGPQLFSTGPTVDDLVA
FT                   SAFADRRLTVATAESCTSGLLVARLTERAGSSAWVLGGVASYANSAKEALVGVPSELLA
FT                   SYGAVSTQVAAALAEGARSRFGADVGVGITGIAGPGGGSAEKPVGTVHLCAVGPSSEGL
FT                   SRSVVLPGSRSAVRHRSVSLAMHMVRQLLLGGPPA"
FT   gene            70048..70476
FT                   /locus_tag="Gobs_0065"
FT   CDS_pept        70048..70476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbe:BBR47_04260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72876"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72876.1"
FT                   /translation="MELLTLPARQLSSFGSSGAELLRAALVQESQDGFAADVVRVAPGG
FT                   VIGRHPIPLWQLFPVVSGSGWVTGASGDRRTLRPGEAALWSPGEDHASGSDGGLTAVVV
FT                   QVPCPSAARGGVVTELARLRMGAAPLGTGPTSASEEVP"
FT   gene            70473..70868
FT                   /locus_tag="Gobs_0066"
FT   CDS_pept        70473..70868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlu:Mlut_22710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72877"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ5"
FT                   /inference="similar to AA sequence:KEGG:Mlut_22710"
FT                   /protein_id="ADB72877.1"
FT                   /translation="MTTLTLHATGPVGPGEVWERYAVPARWPEWAPQITGVEVPVARLA
FT                   AGVRGRVRAPLGVVLPFVVETVDEAARRWSWTVSVGPVRMHLLHWVTEGPDGGSTTGLR
FT                   ISGPAPLVVGYAPPARLAIGRLVRPLH"
FT   gene            complement(70931..71089)
FT                   /locus_tag="Gobs_0067"
FT   CDS_pept        complement(70931..71089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72878"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72878.1"
FT                   /translation="MVELGPVGVAAVLEQSGEIVVAVVVAGRDPTAVGGLGGVQLTELV
FT                   GVEVPER"
FT   gene            complement(71163..71663)
FT                   /locus_tag="Gobs_0068"
FT   CDS_pept        complement(71163..71663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0068"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   spe:Spro_1487 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72879"
FT                   /db_xref="GOA:D2SGJ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB72879.1"
FT                   /translation="MHLETGRLLMPPLSGQHTEALTELYANPDVTRFIGGAALDAEGTA
FT                   ARVLRFEAVWHTCGFGQSALPDRGTGVLLGCAGLHPWPQSDEVELGYVLARHAQGRGLA
FT                   GEAARACLDVASIQLGLDRLTAVIRPDNAPSRALTTRLGFRIHREDVTPSGVRVLVHER
FT                   LAS"
FT   gene            71814..73055
FT                   /locus_tag="Gobs_0069"
FT   CDS_pept        71814..73055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0069"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: fal:FRAAL3457
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72880"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ8"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ADB72880.1"
FT                   /translation="MEQLLAALDALAAEDLAPLFGPALLDRLRPLLVAQNRLAAEIART
FT                   VREAEVSGAAEVDGLKTMASWLRGHAHLSASEAARVVRAGRGLAQLPVMAAACAAGQLT
FT                   GEQAAVIGRVAEPEHLARAAEQRVDLGVVDTVLTDIARERPHADTATAVHHYLDRLDAD
FT                   GPEPDPTERRRLVIARHADGSISGRFDLDAVGGEKLQTALEAVVQAGRCAADERTRAQQ
FT                   LADALVQLCDNQLASGQLPTLRGHKPQVIVKIGIEDLVDPAVGRGAAELGFGATISAAR
FT                   ARWLACDGAVTRIVMGPDGLPLEHGRTVRLVPPHVRRAAEVRDGGCVFTGCGAPTHWCD
FT                   VHHLLEWANGGQTSLANSALLCERHHTKVHHGFRVKRQPDGRWRTWRPDGTEIRTGPGR
FT                   TGPPLPGPPLPAAA"
FT   gene            73226..74130
FT                   /pseudo
FT                   /locus_tag="Gobs_0070"
FT   gene            74165..76258
FT                   /locus_tag="Gobs_0071"
FT   CDS_pept        74165..76258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0071"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: ddr:Deide_1p00099 putative diguanylate-
FT                   cyclase; TIGRFAM: diguanylate cyclase; PAS sensor protein;
FT                   PFAM: EAL domain protein; GGDEF domain containing protein;
FT                   PAS fold domain protein; PAS fold-4 domain protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72881"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGJ9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB72881.1"
FT                   /translation="MHGHVPAGHVAPADPLSSVTDAVYRIDRRWRFTYVNAAAQRLLGR
FT                   RADEMIGRYAFECFPETLGTVIEDEYRAVLLDGRVREFEYFYPPLDRWFEIRAFADAGG
FT                   LTAFLRDVDDQRRTEQRRLAELRQLSAVLEALPPATVLLAGDGRIEMVNRAWTANGEAL
FT                   ERTGDRPARVGEHYLEAMARYVDAEHHADIAAGLRSLADSGAPQSTFTFDYPHQVGPEP
FT                   AWFRLQAARVDASDRVIVTHTDITERVRDQQALAWQASHDDLTGLPNRARLLELIGEAL
FT                   EPGRGPAALLFLDLDGFKTVNDSLGHHVGDELLRRVGGRLAEQVRPGDAVGRLGADQFL
FT                   VLARDCDTAEAASLAFRLQSSFSRPFHAEGISVPLSASIGVAVAQPGADRAHQLLSDAD
FT                   TAAFAAKGAGRDRVHVFSPGLREAARWRLEVANRLRDGAVDEFVVHYQPVVRVDTGEVE
FT                   GVEALLRWQHPERGLLAPDAFLSVAEETGQLIPITRWLLCETTRQAAEWAAQGLPLRMS
FT                   VNISARHFSAETLVRDVRVALHDSGLAPENLVLELTETSVAEDPTRAEDQLSILQTSGV
FT                   SVAIDDFGTGWSSLAQLLALPVGTLKIDRSLLTAAARLASNGTGPVLAAIVSLARTLGI
FT                   RSVAEGVETAEHLQMVREAGCDLAQGYLLAHPMPASEVLHWASRVRAAGGDSCALALQA
FT                   SRR"
FT   gene            76267..77073
FT                   /locus_tag="Gobs_0072"
FT   CDS_pept        76267..77073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_1483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72882"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72882.1"
FT                   /translation="MRARRLRRRTPRRATAPAGPPRSTGAPSPVGVPAGQTAPVTDLDE
FT                   AVETAPDTDALDGRARSALDLLIWDAPNIDMTLSTVIGARPTAASRPRFDAIAAWFVEA
FT                   AGDPGAPDAPEVEACVFANIPPVVGSLQRWVEALRGFGFAVFARPKQQPDDDIDQAMLD
FT                   HIDVRRHSHRLRRLVVFSGDGRNFAEPLEELARTGTQVTVVAFSEVAGYAIGSDLLEFI
FT                   DIEDVPGAFAVPLDRVRLDALPPEGAWLRPTRSLRDFVSSYVRRNG"
FT   gene            77079..78593
FT                   /locus_tag="Gobs_0073"
FT   CDS_pept        77079..78593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0073"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG:
FT                   rsk:RSKD131_1430 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72883"
FT                   /db_xref="GOA:D2SGK1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADB72883.1"
FT                   /translation="MFDEDTGPVATEELLVPGETCWRIERADRYAVFVDAADYFAVLRE
FT                   AVLNARRRVLFIGWDFDPRIRMDPRGARRRRVGGRRPDKLGRVLEEAVRTNPELEIGVL
FT                   VWDYGVVGALGRGLVPVVLLDRRTPDRLTMTVDTHHPVGGAHHQKIVVIDDCLAFAGGI
FT                   DVTTDRWDTSEHLDRNQLRRRPSSHRLTGPWHDVTSLVSGPAARAIGDLARERWESGTG
FT                   RALEPVEDVEVCWPDVEPLLTDVDVAISRTRPEHGGTSLVHEIELLWLAVIAAARRSVY
FT                   IESQYFANRRIAEAIAERLREPDGPEFVVLNPETAEGWLQEKAMGTARAKLLALVREAD
FT                   VHGRFQLYVPVTEGRRPIYVHAKVTVVDDRLLRIGSSNLNNRSMGMDTECDVSIEVRPG
FT                   DPRAEEKAAAVTGLRDRLLGEHLGVPPSAVADAIEACGGSLLQAVESLRRPVGRSLVPF
FT                   APPDLGPVEQALADTELLDAERTPNRWTRVRRSFRPRLHGGSARRR"
FT   gene            complement(78655..79512)
FT                   /locus_tag="Gobs_0074"
FT   CDS_pept        complement(78655..79512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0074"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   cby:CLM_1107 formate/nitrite transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72884"
FT                   /db_xref="GOA:D2SGK2"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK2"
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /protein_id="ADB72884.1"
FT                   /translation="MPRTVPEAAAELTEQAAAKAAAATGPAGYLRSSVLAGVYVGIAVV
FT                   LLVSVSAPLAAAGSPVTRLVQGAVFGLALTLVVFAGAELFTGNVMVMAHGISRRSAGWR
FT                   SAGTVGALSLVGNAIGSLALAGAVHLSGVLSAGPGPTGSSPAVALLDSMVDVKTAATGP
FT                   QLFWRAVLCNALVCLAVWMATRAATDGAKLMVLWWGLLAFIGSGFEHSIANMTTFSLAA
FT                   LEGVAGWADLAGNLVWTIPGNVVGGLLVAAAYAGRAGRVSGSPALLPPGAVREAAVPGL
FT                   RQAA"
FT   gene            complement(79512..80174)
FT                   /locus_tag="Gobs_0075"
FT   CDS_pept        complement(79512..80174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0075"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: sen:SACE_7205 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72885"
FT                   /db_xref="GOA:D2SGK3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK3"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADB72885.1"
FT                   /translation="MPGSIGEHLLQERYGTTARARGFYNHQMLDHLNDHMREFVARMEM
FT                   VFVATSDGAGEADCSFRAGPPGFVCVLDDKTLAYPEYRGNGVMASLGNIAENGHIGLLF
FT                   IDFCGDAIGLHVNGRASVLENDQLLARPDLPDSVLDGLLQDGGRRPERWVAVDVVEAYI
FT                   HCSKHIPQMVKRSEVRQAWGTDDVVRKGGDYFKAKHSTRPWVDGVPAGGAAAEQAAH"
FT   gene            complement(80219..82915)
FT                   /locus_tag="Gobs_0076"
FT   CDS_pept        complement(80219..82915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0076"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: rxy:Rxyl_2783 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: diguanylate cyclase; PAS sensor protein; PFAM: EAL
FT                   domain protein; GGDEF domain containing protein; GAF domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; GAF domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72886"
FT                   /db_xref="GOA:D2SGK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB72886.1"
FT                   /translation="MTSKLRPWRRDRGAAGTAVPPTLADRLLAVTDQGVYAVDMAGRCV
FT                   LANEAAARLLGTVRPLLLGAHVHEEHHGRPAGEPAEDCPLCAPLHSGRPARGTATLTAV
FT                   GHSSLTVDYVSSLVTHEDEPVAVFWFQDVAPRNQTESALHQLEMKYRAVTESASDAIVS
FT                   ADARGLIVSWNRGGEAMFGYAAEDVIGKPLTILMPERYRDAHERGMGRFLLTGEPRVIG
FT                   SGAVEVHAQRADGTEFPVELSLSHWAEGEGRFFTGILRDITERKRAEAALARETGFIRL
FT                   LQRVSVASNETSSGREALETGLRMIAEHTGWPVGHIYLVDDDGETLRSSNIWVRPDDDR
FT                   LLPFLQATTATPFRAGTGLPGRVLASKQPSWICDVTTDDNFPRRAAARDSGLAAAFAFP
FT                   VLVGSEVTAVLEFFTSEPLQPDDALCEVMGQIGTQLGRVVERELAQGRLTHHALHDPLT
FT                   GLPNRVLLLDRLEVALAQRSRGGVAVAFVDLDHFKLINDSLGHAAGDTVITAAATRLRA
FT                   VVRPGDTVARFGGDEFVVLAESVVDERDVEGLAERLAGALAEPFDLAGDEVFVTASIGI
FT                   AVSSGTGGDAHGLLRDADAAMYRAKEAGRARHEVFDSVMRAGAIRRLEIVNDLHRALER
FT                   NQFVLHFQPQIDLRTNSLIGVEALLRWVHPERGLIPPLEFIPVAEETGLINDLGRWVLR
FT                   AACQQGRTWLDRFPDREPLVMSVNLSGRQLHQPRLAEEVAAALEDSGFPADQLVLEITE
FT                   SVLMNDTAATIHTLEALKELGVRLAIDDFGTGYSSLTYLQRFPIDILKIDKSFVDGLGS
FT                   ANIEESAVTRTIVALAKTLRLETVAEGVERSEHVRELQSLHCDIGQGYFFARPLDAGAL
FT                   TTLMAQPDTPVAALGSLADVDRLLGSR"
FT   gene            83117..83752
FT                   /locus_tag="Gobs_0077"
FT   CDS_pept        83117..83752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0077"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   nca:Noca_1824 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72887"
FT                   /db_xref="GOA:D2SGK5"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK5"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADB72887.1"
FT                   /translation="MNTPGVDHPHRDGEVEVVLLGHRVSVSARVEAADAATVVVRPSVG
FT                   EFAGQQVVRIGEEVQLVWHDAPDVRMVTAEVATVQHGAVPRWHLGVTAPAQPVQRREAV
FT                   RGRLPLRLTVTVDRVDLEGDVLDLSEAGVRAAVDAYGAPPLPGAAVAVVLELEDGALRT
FT                   SAEVVWYQVRGRRWMLSLRFPDLPEKEQDRLRRRVFQAMREQRARAAT"
FT   gene            83909..84544
FT                   /locus_tag="Gobs_0078"
FT   CDS_pept        83909..84544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0078"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   ace:Acel_0863 type IV pilus assembly PilZ"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72888"
FT                   /db_xref="GOA:D2SGK6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK6"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADB72888.1"
FT                   /translation="MSIAGVDWPEPGGAAEVIPLARGVALPSSVEVSDGTALLVRLVLA
FT                   DYAEKLKVQPGHRVEVLWGGPTGGRSLPAEVTEIRSDPELRWILQITGPAEASQRRQSV
FT                   RARVELPVVARCGTVIITGQTVDLSEAGARVWFDGWGLQPPPGTPIDATLELGDGSFTA
FT                   AGEVVRVEPRGPRWLISMKFPELTEQEQDRLRRRVFEALRLERLRQAD"
FT   gene            84574..86271
FT                   /locus_tag="Gobs_0079"
FT   CDS_pept        84574..86271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0079"
FT                   /product="putative ABC transporter"
FT                   /note="KEGG: mkm:Mkms_1572 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72889"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK7"
FT                   /inference="similar to AA sequence:KEGG:Mkms_1572"
FT                   /protein_id="ADB72889.1"
FT                   /translation="MTAPARLPEALTALRDAVAAAPLGLATPGSEAARRAARGVVEQVD
FT                   DYLLPRLRDLDAPLLTVVGGSTGAGKSTLVNSLVGAPVTTAGVLRPTTRAPVLVCARTD
FT                   VTAFEGDRVLPGLARVTGGAGGPGTLQLVPRDDVPPGLALLDAPDVDSVVESNRELAAQ
FT                   LLAAADLWVFVTTAARYADAVPWDVLRTAQERGTALAVVLDRVPPGAADEIAPDLAGML
FT                   DRAGLTGVRLFVVEERPLVDGFLPADQVAPLRGWLHALAADQEQRAAVVRQTLTGALAS
FT                   LEDRVAGIAAAVEEQALAATALREAAAAAYTAAYEGIDEGVRSGSLLRGEVLARWQEFV
FT                   GTGEWMRSLQSSIGRMRDRVTAALTGRPSPAAELQGALETSVETLLRAEADRAAERTVT
FT                   TWRALPGGSPLLATADEDLDRVSPDFPEAAAAQVRDWQGYVLDLVRDQGADKRTRARVL
FT                   SWGVNGAGAVVMVAVFAHTGGLTGGEVAVAGGTTALGQRLLEAVFGDAAVRSLAARARE
FT                   DLQARADGLLRYEQGRFDALVDEAGPTPDAAVELRAAAAALTAARDRA"
FT   gene            86268..87866
FT                   /locus_tag="Gobs_0080"
FT   CDS_pept        86268..87866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0080"
FT                   /product="GTP-binding protein HSR1-related protein"
FT                   /note="KEGG: bcv:Bcav_2640 GTP-binding protein HSR1-
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72890"
FT                   /db_xref="GOA:D2SGK8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK8"
FT                   /inference="similar to AA sequence:KEGG:Bcav_2640"
FT                   /protein_id="ADB72890.1"
FT                   /translation="MRGRTPPLADRLAALREAVEVADGRLEVPELGSARTLLAKAGARE
FT                   ALGDATVVALAGATGSGKSTLFNALSGSEVSTPGVRRPTTGVAHATVWGADDATDRLLD
FT                   WLQVPRRHRHPPEPALDGLVLLDLPDHDSVRLEHRLEVDRLVQLVDVLVWVLDPEKYAD
FT                   AAVHERYLLPLAGHAGVLLVVLNQVDRLDAVAARACLTDLRGLLDREGLADTPLLPVSA
FT                   RTGTGLGELRADLAKRVTARRAATDRLTADVRGVATALAAHCAPDGGGGVGRGEHEQLT
FT                   DALAEAAGVPAVTAAVERSVRRSGTAATGWPLVRWTRKLRPDPLERLHLGQGTGDDGAV
FT                   VARTSLPAAGAVQRAGVTRAVRAAREAAGEGLPQAWRDELRRTVEVSEEQLADRLDRAV
FT                   AGTDLGPQRTPLWQRAVGGLQWLLALVALAGALWLLALVVLGFFQLDDVVPLPRVEGLP
FT                   LPTLLLVGGLLAGALLALVARPLVGLRARRRARRAEQRLYAAVDVVAQEEVLAPMAEVR
FT                   EDHDRYCTAVTRAGR"
FT   gene            complement(87918..88370)
FT                   /locus_tag="Gobs_0081"
FT   CDS_pept        complement(87918..88370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0081"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: nca:Noca_1263 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72891"
FT                   /db_xref="GOA:D2SGK9"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGK9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB72891.1"
FT                   /translation="MWHWQLEAMHVVSRVRADLRARIAHPSVCSTSTDDARDGLLLVFE
FT                   ELASNALRHGGGAVRALVVAGTDGWLLDLSDEAPDRPPVPAVDRDPALGGMGLHLVAQL
FT                   STGYGWESRPGRKHVWALLPNGLHPLEPVQDRVPEPRAPEVPRSTD"
FT   gene            88461..89273
FT                   /locus_tag="Gobs_0082"
FT   CDS_pept        88461..89273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0082"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; GAF domain protein;
FT                   SMART: GAF domain protein; KEGG: kra:Krad_4213 putative GAF
FT                   sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72892"
FT                   /db_xref="GOA:D2SGL0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL0"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADB72892.1"
FT                   /translation="MDPRPTVSSILTERAVSCSGGPRSPVRPPDGAGRGHTGRVQDLWR
FT                   DLSQVVWADRPLDDVLGEVTGIAARTVPGAESTSITLLRGDRAFTAAHTGEMALVADEM
FT                   QYARGYGPCMDAGRAGVVIRIDDMRTEQRYADYTARVVDVGVRSSLSMPLPYQGSTIGA
FT                   LNVYSSQQSAFATPESVEVATAVAEAVAVAVANADAHDRLADHARNMRLAMESRAVIEQ
FT                   AKGVLMAQRHVDAEAAFEILREASQRYNRKLREIAQAIVDGTSEGRVR"
FT   gene            complement(89345..90286)
FT                   /locus_tag="Gobs_0083"
FT   CDS_pept        complement(89345..90286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0083"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: sbo:SBO_0514 ribonucleoside hydrolase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72893"
FT                   /db_xref="GOA:D2SGL1"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL1"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ADB72893.1"
FT                   /translation="MATPLVIDTDPGIDDALAILLALASPEVDLRLVTTVHGNVELAQT
FT                   TDNALRVLHLAGRSDVPVAAGARDSLVYRQPERAGHVHGETGLGGVLLPASPAAPDPRP
FT                   AVVALAEVLLAAEAPVTVAAIGPWTNIALLLATYPEAAERIGRLVLMGGSAARGGNVTA
FT                   AAEFNVWADPEAAQRVLGSAVPTVLVGLDVTLPTVLDVDGIARFAAAGPVGETAAAILQ
FT                   QYVDHARTSYGTSGVVLHDALALTEAIVPGTLGTVRRDVVVDTTLGAGRGQTLVDRRAV
FT                   SDSPTAVEVAETVDSAAAVEFLVGRMEALARR"
FT   gene            complement(90301..91650)
FT                   /locus_tag="Gobs_0084"
FT   CDS_pept        complement(90301..91650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0084"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mkm:Mkms_5270 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72894"
FT                   /db_xref="GOA:D2SGL2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL2"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ADB72894.1"
FT                   /translation="MTDQAALPGDRTDTRLRRAVTGPLLFLFILGDVLGAGVYALAGRV
FT                   AAEVGGAIWVPLLVALLLALLTAASYAELATKYPRAGGSAVYAERAFRQPLVAFLVGFC
FT                   MLAAGVTSAAGLALAFAGDYLGVFLDVPATPAALVFLLLVALLNARGIRESLRANLVMT
FT                   LVEVSGLVLVVVLAALVLGRGDGDLGRTVEFPPGVAPASAVLAAALLAYYSFVGFETSA
FT                   NLAEEVRDVRRVYPRALFGALLTAGVVYVLVGLAASVVLPPEELAASTGPLLEVVRAAD
FT                   AGIPDQLFSAVALVAVANGALLTMIMASRMAYGMAEQRLLPAVLGRVLPDRRTPWVAIA
FT                   VTTLVAMALTLVGDLSTLANTVVLLLLFVFLSTNTAVLVLRRDRVAAEHFHAPTVLPVL
FT                   GTASCLLLLWQQEAQVWGLAALLIAGGVVLYAVTRLAGRRPSAAGGARRG"
FT   gene            91968..92648
FT                   /locus_tag="Gobs_0085"
FT   CDS_pept        91968..92648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0085"
FT                   /product="Gm3773; predicted gene 3773"
FT                   /note="KEGG: Gm3773; predicted gene 3773"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72895"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL3"
FT                   /inference="similar to AA sequence:KEGG:100042292"
FT                   /protein_id="ADB72895.1"
FT                   /translation="MAIDRAPSPRSSRTADDLTLGGLLDVLDRAEPLPGRSGPRPRRAA
FT                   VHRTGGARRSAAVRPVPVPAVRPRPVPPEPAPAAPVRSAPAPAPAPRPGLRARLRGLVR
FT                   RLVLWGAGPDGAHLAWGRPASTAPAPRPDGPVVLTELPNTPTIRPAAPSPAAALRPARY
FT                   PWPAGSPRIPVVAPLARHVPAPRPVPAPRTAQGSSPPGAARASAPARARGDPRPPPARG
FT                   QPPG"
FT   gene            93357..95414
FT                   /locus_tag="Gobs_0086"
FT   CDS_pept        93357..95414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0086"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: kra:Krad_0098 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: Stage II sporulation E
FT                   family protein; PAS fold-3 domain protein; GAF domain
FT                   protein; PAS fold domain protein; PAS fold-4 domain
FT                   protein; SMART: protein phosphatase 2C domain protein; PAC
FT                   repeat-containing protein; GAF domain protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72896"
FT                   /db_xref="GOA:D2SGL4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB72896.1"
FT                   /translation="MNLDRTPAETGDPDPEAAATRLRFELAIDAAGIGSFDWDLQTGRL
FT                   EWDDRLLDIFGYDRAGWPGTIDAFAERLHPDDAARTLEALQGAIDTQGEYDAEFRVVRP
FT                   TGETRWVQGRGRALADEAGTSVRLLGVGYDTTEHRQADARVARVLESMNAAFFALDRDW
FT                   RFTYVNGEAERVLGRSRGDLLGGDIWELFPAAVGSDFEVHYRGAAATGHERVFEAYYPA
FT                   PLDAWYEVRAWPGPDGLSVYFLDVTERRAAEERARVSAARLALIAEVGAVTGETLGSGA
FT                   GEDAAMQRLAEAVVPVLGDWVIVSLTGEDGRMRDVGSWHTDPALRTTAARYAELRLAAL
FT                   QSDAPILRALASGRTLTVPDVGAAVGRTLPPGEVSDVFWALDPRTAVTLPLAARGRTLG
FT                   ALSVYRSAGRLAADEDDVATAQEVAARVALALDNARLYEQQRRLAEGLQRSLLSAPPAP
FT                   DAAEIVVRYRPAMEVAQVGGDWYDAFVQPAGTTMLVIGDVVGHDTEAAASMGQLRGLLR
FT                   GIAYREGVGPAQVLSDLDRAVQGLGMATMATAAVARVEQTPEQRDAGLTTLRWSNAGHP
FT                   PPLVLHTDGRVQALGAERPDLMLGVDPAARRTESVVTVRRGATLLLYTDGLVEGRDLPL
FT                   DEGIGRLRAALAELGDQPLERLCDAVIERLRPERLQDDIALVAIRLHPQG"
FT   gene            95639..97003
FT                   /locus_tag="Gobs_0087"
FT   CDS_pept        95639..97003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0087"
FT                   /product="pyrrolo-quinoline quinone"
FT                   /note="KEGG: bcv:Bcav_0090 pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72897"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL5"
FT                   /inference="similar to AA sequence:KEGG:Bcav_0090"
FT                   /protein_id="ADB72897.1"
FT                   /translation="MIIVLATVAGVLITSRKEWAGSGPPVPTMPRTRTPARPLAAAGLA
FT                   LPLLLTACGTGGSAASGPSPSAPAEPTPASDVREVAASTPRLALTHDGGVRILDATTLE
FT                   TVADLPLAGFNRLNAAGDGRHLLVSTQGGFRVLDAGTWTEPHGDHSHHYTSAPRLTDVL
FT                   HPAEEPGHVVAHDGHTALFDDGTGEVVVLDSDRVAAGADGARRLTTPSPHHGVAVALED
FT                   GTLVVSEGDEDERTGIRVLDAAGAEVASSVGCPGVHGEAVAADDAVVIGCEDGALVYAG
FT                   GQVREVQSPDAYGRIGNQAGSESSAVVLGDYKTDPDAELERPTRVALVDTRTAQLRLVD
FT                   LPASYSFRSLASGEDGEALVLGTDGALHVIDPESGTLERSVPVVAPWEEPLEWQQPRPT
FT                   LHVLDGTAYVTEPATGQVHAVDVLTGEVWRSADVGVIPNELAGVDGGDTGSGHED"
FT   gene            97051..97977
FT                   /locus_tag="Gobs_0088"
FT   CDS_pept        97051..97977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0088"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   bcv:Bcav_1775 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72898"
FT                   /db_xref="GOA:D2SGL6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL6"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADB72898.1"
FT                   /translation="MPTRPDPVLGRWVAVCCAALAAAACSEGAGGGGGRVEVVATTYPL
FT                   QYVVERVGGEHVAVEGPVGTGGDGHRVELTPRRVGRLGEADLVVHVSGLQASTDAALEQ
FT                   HGSGHVVDAADVAGLAGAPGRPPGEEGSAALDPHFWLDPVRLAAVADQVADELTQVDPG
FT                   HADDHAAASDALQADLGALDAAYREGLAGCRGRTLVTSHEAFGYLAERYGLVQVGIAGL
FT                   DPAVEPSPARLRDVVEVVEGRNVRTVFFEVSTGPGLTRALADDLGLRTGVLDPVERVPA
FT                   SGGDYLSTMRANLRALQEGLDCVPAGG"
FT   gene            complement(98053..100386)
FT                   /locus_tag="Gobs_0089"
FT   CDS_pept        complement(98053..100386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0089"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: mva:Mvan_5750 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72899"
FT                   /db_xref="GOA:D2SGL7"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL7"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADB72899.1"
FT                   /translation="MTAPILDVDPWLVREPRVDPGTLPVAESLFSLSNGYLGVRGTLDE
FT                   VEPFGMRGTYLSGVYETHPLSYPEGGYGQPEEGQAMLTVADGTPLRLLVDGVPLDLREF
FT                   ELDVHERTLDLRAGTLDRRVRWTTPSGTSVEVCSRRLVSLVERSVCAVRYEVRVLNRPA
FT                   HVVVRSDLAAGEVTPAGVDNDDPRVAECLDEAFEPRAQIGNANGGALVERTRRSGITVA
FT                   TAVGHEVDGGRVSTHVDEQHVVTTVAADLRPGEGLTVVKVVGYSWSHDAGSDSVLAEAS
FT                   AAVSSAFDLGWEGLLAGQRAALDELWATADVEVDGDPELQQALRYTVFQLISSASCISG
FT                   APVGAKGLTGIGYSGHTFWDVEGFVVPALTLLRPDAAARLLRWRAATLDLARERAGTLG
FT                   LAGACFAWRTISGREVSAYWPASTAAMHVNADIARAFWLYQNVTDRDLDSLGGLAVLVE
FT                   TARSWLSAGHEDAAGAWHLYGMTGPDEYTGVVDDNVFTNLMARRNLRWAADACERLPER
FT                   ASELGVDSAEASAWRSAADAVHVPWDERLRVHPMNDNFTTYREWPFEDERDHYPVQEHH
FT                   HYADFYRRQVLKQADLVQALWWCRDEFTAEEVARDLDYYEARTVRDSSLSAAVQAVVCA
FT                   QAQHPDLALRYLREAALVDLRDVRGDTPNGLHLAAVGGTWLAFVAGLGGLREDHEDLEL
FT                   APLLPSSLSRTAYSVTWRGSLLRVETTREGTTVTLVRGEEPVTVVVDGAPLSVTPAAPV
FT                   HAPLRDPTPLLDEPRQPVGREPRT"
FT   gene            complement(100680..101099)
FT                   /pseudo
FT                   /locus_tag="Gobs_0090"
FT   gene            complement(101353..101952)
FT                   /locus_tag="Gobs_0091"
FT   CDS_pept        complement(101353..101952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0091"
FT                   /product="thiamine monophosphate synthase"
FT                   /note="PFAM: thiamine monophosphate synthase; KEGG:
FT                   stp:Strop_3885 thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72900"
FT                   /db_xref="GOA:D2SGL8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL8"
FT                   /inference="protein motif:PFAM:PF02581"
FT                   /protein_id="ADB72900.1"
FT                   /translation="MSELASSTDDTARLPRLLVVTDRTQAAGPLADVVAAAVDAGARAV
FT                   LLRDRDLPDDERAALAAELRTVLTPVGGLLVTAGVGGDGAVHLAAAEPFPDPRPALVGR
FT                   SCHSAAELLQARAEGCDWAFLSPVHPTASKPGYGPALGVEGFARLRPLGPPTYALGGVG
FT                   PDDVPALLTAGAHGVAVMGPVMRDPAVVRDYLAALA"
FT   gene            complement(101949..102794)
FT                   /locus_tag="Gobs_0092"
FT   CDS_pept        complement(101949..102794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0092"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   stp:Strop_3886 thiazole biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72901"
FT                   /db_xref="GOA:D2SGL9"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGL9"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ADB72901.1"
FT                   /translation="MLKDPLAPHRSQARSGPLHGDLREEAADPFVIAGETFTSRLLLGT
FT                   GGVPSLETLEAAVRASGTQLVTVALRRVEASSSASMLEVLDRCGVRLLPNTAGCRTARE
FT                   AVLTARLARDAFGTPWVKLEVIGDEHTLLPDAVELLDAAEQLVADGFTVLAYTTDDPIL
FT                   GRRLADAGCAAVMPLGSPIGSGLGIRNPHNIALLREGVEVPVVLDAGIGTASDAALAME
FT                   LGCDAVLLASAVTRARDPERMALAMRQAVEGGRQALLAGRIPRRWHAEASTSFEGLPEL
FT                   "
FT   gene            complement(102797..102997)
FT                   /locus_tag="Gobs_0093"
FT   CDS_pept        complement(102797..102997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0093"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: sde:Sde_1455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72902"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM0"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ADB72902.1"
FT                   /translation="MQITVNGEDTALAEDATVADLVAARSGGHDRVAVALNGDVVPRSS
FT                   WPATRLSPGDTLEVLAPTAGG"
FT   gene            complement(103003..104109)
FT                   /locus_tag="Gobs_0094"
FT   CDS_pept        complement(103003..104109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0094"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: sgr:SGR_5394 putative glycine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72903"
FT                   /db_xref="GOA:D2SGM1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM1"
FT                   /inference="protein motif:TFAM:TIGR02352"
FT                   /protein_id="ADB72903.1"
FT                   /translation="MSDVAVAGGGLIGLATAWRAAQRGLSVTVVDDSPGTGASAAAAGM
FT                   LAPVTEAGYREEALLRLGLASVERWPAFAADVERAGGTPVGLRTAGTLVVGFDEDDVRE
FT                   LTALHAYQRELGLDAERLTPREARRREPSLTPRVRGGLLVAGDHSVDGRALHAALLQAA
FT                   QVAGVRLIRDRVTALRVDGGRAAGLETAGGTIAAGTVVLALGAHSGRLPGVPPLPVRPV
FT                   KGQILRLAGATDLLEGTVRALVRGRQVYLVPYAGDRLIVGATTEDRGFDPTVTAGGVHD
FT                   LLHDAIDVVPAISELELVETLARWRPGTPDNAPLLGPGPLPGLVLATGHHRNGVLLTPV
FT                   TAEVTAELLATGVLPEVAAPFTTDRFGR"
FT   gene            complement(104106..105452)
FT                   /locus_tag="Gobs_0095"
FT   CDS_pept        complement(104106..105452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0095"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: rrs:RoseRS_2771 putative
FT                   hydroxymethylpyrimidine transporter CytX"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72904"
FT                   /db_xref="GOA:D2SGM2"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM2"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADB72904.1"
FT                   /translation="MSTSDDVRTSTSTGDAPLTLTEAPAATLGLRDAFGLWANLGVSLL
FT                   LPVAAVFVVLPGRPLSTTIGAIVVGAAIGAVLLGLAAAAGARERVPTMVLLRGLLGRRA
FT                   SALPTALNLVQCVGWATFEIVIIAEAASRVLDAPRWPFVLVAGVLATAMALRPLGVARV
FT                   LARYAIWAALAAVVYLFVEVLAEPLPLLTEGAATSFWTAADIVIALPVSWFPLVADYTR
FT                   HVRSGRAAFTGAAAGYGLATVAMFTLGVVALAAYGSAGFDVIDALLAVPLGAVAVLVLV
FT                   SVELDEAFANVYSTAVSAQNIVARADRRLLAVCVGAVATVLALTFDIAAYEPFLFLIGA
FT                   VFVPLAGVLAVAYFATPRGAWDTSDTAPARPLLLLPWLAGFLAYQLTLPTYFAGPGAGW
FT                   TAWWAARQADLGITPANGWSASLVGLAVAVSLTALVILPGRLCRRRIPA"
FT   misc_binding    complement(105442..105554)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 49.95"
FT   gene            105624..106220
FT                   /locus_tag="Gobs_0096"
FT   CDS_pept        105624..106220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0096"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: rxy:Rxyl_2792
FT                   TenA family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72905"
FT                   /db_xref="GOA:D2SGM3"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM3"
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /protein_id="ADB72905.1"
FT                   /translation="MPVADLLSHHPDPWRGATRHPFLDAVRDGTIPVAAFDTWLVQDAR
FT                   FVADLLRFQARLLARAPRPAQAVLAGGLVALVDELAWFEEQAAVRGLDLAVPALPATAA
FT                   YAQLLERLDAADVGTALTALWVVERTYLDAWSGASPGAPEYRPFVEHWTLPGFADYVAG
FT                   LETAADGVPAPDADAVFTEVVAAETAFWAMAVEAR"
FT   gene            106217..106834
FT                   /locus_tag="Gobs_0097"
FT   CDS_pept        106217..106834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0097"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG:
FT                   npu:Npun_R3311 TenA family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72906"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM4"
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /protein_id="ADB72906.1"
FT                   /translation="MSLAAELWTANADLAAEALAHPFVTGVGDGTLPQAVFSGYVAQDA
FT                   FFLESFARAYAVGIAHSPDRATLDTFADLLAGVREELALHAGYAARWGIDLVRVEPLPA
FT                   TLAYTDFLLSTAFLGGITLTAAAMTPCVRLYAHLGRSLSAETAGDYAEWVTTYADPGFE
FT                   ELAVTLERLLDQHASDVPAVRTAYRRAMQLEVGFFEAAWRGA"
FT   gene            107131..107301
FT                   /locus_tag="Gobs_0098"
FT   CDS_pept        107131..107301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72907"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM5"
FT                   /inference="similar to AA sequence:KEGG:Francci3_4323"
FT                   /protein_id="ADB72907.1"
FT                   /translation="MVAPIPEPDPSIDPTEPVPDDPGELLPDAPEPLPPPPIEATPDDP
FT                   GGDPGGVPEPA"
FT   gene            complement(107394..108689)
FT                   /locus_tag="Gobs_0099"
FT   CDS_pept        complement(107394..108689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0099"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   rxy:Rxyl_0654 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72908"
FT                   /db_xref="GOA:D2SGM6"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM6"
FT                   /inference="protein motif:TFAM:TIGR01197"
FT                   /protein_id="ADB72908.1"
FT                   /translation="MYLSKTEAAVLPTTLVGTPRTPPPPATGRRRIWPLLGPAFVAAVA
FT                   YVDPGNFATNFSGGAAFGYTLLWVIVAANLMAMLIQSLTAKLGLATGRDLATNCREQLA
FT                   KPVTRGLWLQAEAVAIATDLAEIVGGAVALNLLFGVPLPVGGLITAVVAFVLLAAQSRG
FT                   HRPFERVITGLLLVIGLGFGYTLVGSGVDMGGLAGGLVPSFAGPDSLVLAAGILGATVM
FT                   PHVIYVHSALTPGRYGDVVTAGRTHEGRRRLLRAQRLDVLLAMGLAGLVNASMLIIAAQ
FT                   LFTGGGDAGSLEGVHAGLGDQLGAGASLAFALALLASGFASSSVGTHAGQVVMAGFLRR
FT                   HVPVLVRRLITLAPALLVLVLGGDPTTALVWSQVVLSFGIPFALVPLLWLTSRRDLMGG
FT                   WVNRRVTTVAGAVVAALIIGLNGHLLVGFVLG"
FT   gene            complement(108842..109549)
FT                   /locus_tag="Gobs_0100"
FT   CDS_pept        complement(108842..109549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0100"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   sen:SACE_5199 putative zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72909"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM7"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ADB72909.1"
FT                   /translation="MTVLVRLDPDLRWLLAPRFRAAGERPLGHDPDATVAHLVQAAGVP
FT                   LTEVGRVRVDGEPVPLSARTRSGAVLEVDPVPRPQPAAAGGFLLDVGLGTLARRLRLLG
FT                   LDAAWSNDADDANLAARAAAEDRVLLTQDRGLLMRRSVPGALVRGSRPDDQLADVLDRF
FT                   APSLAPLTRCTACGAPLEPVPKAEVADRLPPGTRRTFDDFSRCPVCGRVYWHGAHARRI
FT                   EELVERATRQVGG"
FT   gene            109764..110276
FT                   /locus_tag="Gobs_0101"
FT   CDS_pept        109764..110276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0101"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: ace:Acel_1455
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72910"
FT                   /db_xref="GOA:D2SGM8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB72910.1"
FT                   /translation="MPVQRLNHAVLYVRDVERSLAFYRDVLGFRVKTEIPGAAVFLQAE
FT                   GSTNDHDLGLFRVGAAAGASEAGRRTVGLYHLAWEVDTLAELARVRDALLRAGALVGAS
FT                   DHVTTKALYAQDPDGLEFEVSWLVPAALITPELTEGAPMTAPLDLDREIARYGADTRGG
FT                   VGVSVPA"
FT   gene            110410..110958
FT                   /locus_tag="Gobs_0102"
FT   CDS_pept        110410..110958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0102"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   saq:Sare_1733 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72911"
FT                   /db_xref="GOA:D2SGM9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGM9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADB72911.1"
FT                   /translation="MEPVELAAGELRLRPWREDDADEVLVVQQDPEIRLWAGGVSSRDE
FT                   AVALLRRLRGQEGRVSWAVTDTSSGALLGSVSVHSIRPAQGNAQIGYWTVPAARGRAVA
FT                   ARAVDAACRWAFATVPLERVELCHAVENAASGRVAGKAGFTLEGRLRRSYRYGDGVRHD
FT                   ELLWARLADDPAPDLGSRR"
FT   gene            complement(111176..111868)
FT                   /locus_tag="Gobs_0103"
FT   CDS_pept        complement(111176..111868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsa:RSal33209_2919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72912"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN0"
FT                   /inference="similar to AA sequence:KEGG:RSal33209_2919"
FT                   /protein_id="ADB72912.1"
FT                   /translation="MTTGGGRPGLEHQPAAGPTRALAVFCHGGTVASVQPPKERALSLA
FT                   RMRAIEQFVRSSAAERGVGTYLLRYRVAGWNGVAADAHADVRWALDQVRERHGDDVPVV
FT                   LVGHSMGGRAVLRAGDDRSVRAVCALAPWTPPGEPVEHLRGQTVAVLHGRGDRWVPAAL
FT                   SADFAVRAQRAGTHIARFTIAGGHSMVRRAPVWHAFVRDVVLAGTGLAPWRPDLRAALD
FT                   SRELAVPL"
FT   gene            complement(111865..112068)
FT                   /locus_tag="Gobs_0104"
FT   CDS_pept        complement(111865..112068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72913"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72913.1"
FT                   /translation="MWLFLTSRLRTWLLLTVVVPLATGLLRRAAQVLERRTGSTQVTRA
FT                   LYKAGDLGDRARATLRGGRRRR"
FT   gene            complement(112105..113119)
FT                   /pseudo
FT                   /locus_tag="Gobs_0105"
FT   gene            113210..113863
FT                   /locus_tag="Gobs_0106"
FT   CDS_pept        113210..113863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0106"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: rha:RHA1_ro04011 protein-methionine-S-oxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72914"
FT                   /db_xref="GOA:D2SGN2"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN2"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADB72914.1"
FT                   /translation="MFFSRFKTQPVAPADALPGRSTPLPSVPELHAVNGNRIRPPFPEG
FT                   MQTAVFGAGCFWGVEKVFWEQPGVYSTAAGYAGGYTPNPTYEEVCSAQTGHTEVVLVVF
FT                   DPAVTSYEQLLKVFWEDHDPTQGMRQGNDVGTQYRSAIYVQGPEQEAAARASREAFQQR
FT                   LTAAGYGEITTEIAPLGDFYYAEDYHQQYLYKVPNGYCPINSTGVACPVGLSGV"
FT   gene            113956..115080
FT                   /locus_tag="Gobs_0107"
FT   CDS_pept        113956..115080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0107"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; Methyltransferase type 12; putative RNA methylase;
FT                   KEGG: nfa:nfa48380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72915"
FT                   /db_xref="GOA:D2SGN3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN3"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADB72915.1"
FT                   /translation="MADLGLLEQLRREPDVEAPDLVAVDATDRLLLDEAAGLLAATGPG
FT                   EVAVVDDSYGALTLGAAATGARDVRVHQDLLVGELALARNAERTGLTGTHRSLPLGPGL
FT                   ADGVRLVLAKAPKSLDALRELTEVVAASAAPDVTLLVGGRVKHMTHAMNDVLGAGFTEV
FT                   HATLARQKSRVLVARGPRPGVASTFPRRQEHPDLGLVVCAHGAAFAGTRVDAGTRALLA
FT                   ALRRMTPDARTALDLGCGTGVLATSLALARPGLTVLAGDQSAAAVASAAETAAANGVAD
FT                   RVRVVRDDAASSVPDTSVDLVVCNPPFHLGAAVVTGAADRLFAAAGRVLRPGGELWCVY
FT                   NNRLPHRAALRRLIGPTQVASSDRRFTVTVSTRR"
FT   gene            115142..116233
FT                   /locus_tag="Gobs_0108"
FT   CDS_pept        115142..116233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0108"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; methyltransferase
FT                   small; O-methyltransferase family 2; Methyltransferase type
FT                   12; KEGG: rop:ROP_19900 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72916"
FT                   /db_xref="GOA:D2SGN4"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB72916.1"
FT                   /translation="MTTTETPPVDATTALAERLFDGVIATLELAAVHLGSELGWYRALA
FT                   EAPATAPELAERTGTAPRYAREWLEQQAVAGFLTVDDETADPDERRYTLPEAHRPVLVD
FT                   RDDLAYMPPFAHVAMAFVRNVPRLLEAYRTGGGLSWAEMGDARDAQAAANRAYFLGPMA
FT                   SQDLASVPEIDAALRAGGRVADVGCGMGWSAIGIARAYPRARVDGYDIDEPSVEQARRN
FT                   AEEAGVADRVRFTTVDAAAAGEQGSYDLVAAFECVHDLADPVSVLAAMRRMARPGGTVL
FT                   VVDERVAERFTVPGDAIERVMYGYSVTCCLPDGLSTRPSAGTGTVMRPATLERYAREAG
FT                   FAGVDVLPVDNDFFRFYRLRAEA"
FT   gene            116366..117952
FT                   /locus_tag="Gobs_0109"
FT   CDS_pept        116366..117952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0109"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: nca:Noca_1974 chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72917"
FT                   /db_xref="GOA:D2SGN5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN5"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADB72917.1"
FT                   /translation="MARNLWSDRPLGVKLGTLVAVGAVVLAVFALIAIRALQSTETTAG
FT                   ELLASAEVTGDVLTADMMHDAVRGDVLQALVSGGQGDLYRGAVADLAEHDQVLRDLLTE
FT                   ITADDLSPEIVTAVEEVTPTVDAYLLAAQQIVTTAGRDPVAAQAAYPAFGQAFSALEDE
FT                   LPVLGDAVAAFADDAVAHADAQRGTAITLALAVAGAGVVVLALLGWVVTRSVVRPLQRV
FT                   GAVLAAMADGDLRGVTGVTSRDEVGRMAAALEASMGNVRAVLTTIGETTGTLASATEEL
FT                   SATAQDMTRLADESSVQSGIVADAAGQVSSNVQTVAAGSEEMGVSIREIAQNASEVARV
FT                   AAQAVDVAGTTNATVAKLGESSLEIASVVKTITAIAEQTNLLALNATIEAARAGEAGKG
FT                   FAVVANEVKELAQETAKATQDITARVEAIQGDTEGAVRAIGEIAQIIAHINDSQGTIAA
FT                   AVEEQTATTTEMNRNVAEAAQSAGQIADNITAVAGAATATTRAMTDARTAMDEVARMAS
FT                   ALSAAVQRFRY"
FT   gene            complement(118066..118552)
FT                   /pseudo
FT                   /locus_tag="Gobs_0110"
FT   gene            118617..119120
FT                   /locus_tag="Gobs_0111"
FT   CDS_pept        118617..119120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72918"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72918.1"
FT                   /translation="MRTPSTLPPAVRRVLPWLLRWWAVQAVLAVAGRLVARRKDEGDES
FT                   TAGIRRVVALGGVELRPVNPELSRVRLDLLMAGARLDLTGIPHVPGGVDLTVRALVGGV
FT                   GLTVPAGWRVWWDCRGVGGVGFAQDDGLVHTDDERGADLRVHAVVLLAGIGIEGAPQDD
FT                   SWGR"
FT   gene            complement(119166..119415)
FT                   /pseudo
FT                   /locus_tag="Gobs_0112"
FT   gene            complement(119514..119831)
FT                   /locus_tag="Gobs_0113"
FT   CDS_pept        complement(119514..119831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0113"
FT                   /product="hydroxyisourate hydrolase"
FT                   /note="TIGRFAM: hydroxyisourate hydrolase; PFAM:
FT                   Transthyretin; KEGG: nfa:nfa52430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72919"
FT                   /db_xref="GOA:D2SGN7"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN7"
FT                   /inference="protein motif:TFAM:TIGR02962"
FT                   /protein_id="ADB72919.1"
FT                   /translation="MSVSTHVLDSVLGRPAAGMTVRLFAGEEMVAEGVTDADGRCRLAE
FT                   GTTAPCAHRLVFATGPWFAGQGRDTFYPEVVLSFDVREPAEHHHVPLLLAPFAYSTYRG
FT                   S"
FT   gene            complement(119828..120409)
FT                   /locus_tag="Gobs_0114"
FT   CDS_pept        complement(119828..120409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0114"
FT                   /product="OHCU decarboxylase"
FT                   /note="TIGRFAM: OHCU decarboxylase; PFAM:
FT                   Oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline decarboxylase;
FT                   KEGG: aau:AAur_3522 putative OHCU decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72920"
FT                   /db_xref="InterPro:IPR017595"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN8"
FT                   /inference="protein motif:TFAM:TIGR03180"
FT                   /protein_id="ADB72920.1"
FT                   /translation="MAALDDFNAEPADRAVQALRACNAAPRFAAEVVAGRPYPDVDALV
FT                   ARVEDVVRGLPWDEVELAIAVHPRIGDRPEGSSPEAEASRREQSAVGSADDATRTALAE
FT                   GNREYEERFDRVFLVRAAGRSPEELLAELCRRLGNDEETERAEVTGQLAEITALRVREL
FT                   VSANVTDERTSQRAPASEERNEPGTEPLQS"
FT   gene            120477..120851
FT                   /locus_tag="Gobs_0115"
FT   CDS_pept        120477..120851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72921"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72921.1"
FT                   /translation="MPLPEDVCAELDRRLAPVDGARAASAGERTARQPVHTCRVPADSV
FT                   VPGLAAARGAEALAALDVHTAKALATVVLRGLDRGALDDGEVRTAIGVERPEPARLARR
FT                   SARTDTSATGRGGPPPTIPS"
FT   gene            120848..125983
FT                   /locus_tag="Gobs_0116"
FT   CDS_pept        120848..125983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0116"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: mva:Mvan_1931 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM: Stage
FT                   II sporulation E family protein; ATP- binding region ATPase
FT                   domain protein; GAF domain protein; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; PAS fold
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; response
FT                   regulator receiver; SMART: response regulator receiver;
FT                   protein phosphatase 2C domain protein; PAC
FT                   repeat-containing protein; histidine kinase A domain
FT                   protein; GAF domain protein; PAS domain containing protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72922"
FT                   /db_xref="GOA:D2SGP0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADB72922.1"
FT                   /translation="MSDQDLGTSLFAGGGEVGRAMAGIDWSQTPLGPPEQWPSGLRHTV
FT                   RILLTSRFAMWAGWGPELAFFYNDAYRHDTLQTKHPWALGRPASEVWAEIWPDIAPRTS
FT                   AVLHDGTATWDEDLLLFLERSGYREETYHTFSYSPLPDDDGGTGGLLCVVTETTQQVVG
FT                   ERRMATLRDLAAALGAARSEEAVLTAAGEQLARNDVDLPFSAVYLLDDDGTARLGSTAG
FT                   VEPGSAALPRVLTADDEAVWPVARLLAGEDVVTEDLDRRFPGLPTGAWEVPPVQAAALP
FT                   IASSSQDRGPVAGFLVVGLNPHRRWDDDYRGFLGLVANQVSAALTNAGSYEAERRRAEA
FT                   LAELDRAKTDFFSNVSHEFRTPLTLIAGPVAELRASPVAASDPRVREELEVIERNAQRL
FT                   GRLVNTLLDFSRIQAGRIDARFEPVDLAATTAELASVFRSAVARAGLEFTVDCAPLDGP
FT                   VHIDRDMWEKVVLNLLSNALKFTFTGGIAVRLRQEDGSARLSVTDTGTGIPADELPRLF
FT                   ERFHRVADARGRSGEGSGIGLAMVRELVGLHGGTIDVDSAPDTGTTFTVTLPMGAAHLP
FT                   VDRLAEPVPDAPAVSPAAVPFVTEALRWLPDGDAAAEPASAGPDPAAVSGRVLVADDNA
FT                   DMRGYLLRLLGPHYDVRAVADGRQALDAALADPPDLVVSDVMMPGLDGMGLLAALRAEP
FT                   RTARVPVVLLSARAGEEAAVEGLAAGADDYLVKPFSAQELLARVRAHLELGRARRAAEE
FT                   QFTAMADLAPALIWVTDPDGRRVFVNRGWTEFTGRPAREEVGDGWEQGLHPEDRDRYAQ
FT                   VVAAAIARREGWEVDVRLRRADGTYHWLLERAVPIGRQPIGTGETSAGYVGSCTDINAR
FT                   TRETARQTLLAEVGTALDRETTVDGQLGALARLLVDRRLADLCTARVLDDDGRLRFAGI
FT                   AGLHGAAEAAVAALDPDSGLGPEVVRTGRTVLRAQLPQVAPDRPEVAEVLAVGSGMAVP
FT                   LSVRGRVLAVLGLARRPDAPPYDDDDRVLVEEVAGRAALAVDNAVLLADERAAARRLAL
FT                   LQRATAELSAATTPLEVAQVAGGHVRALTGPDSRVAVYEVDPSHRALSALAIDGGSPAG
FT                   LEMWRTLPMSAPLAATTAVTERRPVWVEDVAAQPPAGRELAPELAASAAEFGLAAVAAL
FT                   PLSAAGRVVGVLSIAWPEVQRFSATDRAMLLAVAEQCAQALDRARLYRAERGIAETLQL
FT                   SLLPAQLPALERLALAAHYLPGAEGTQAGGDWYDVVELADHRLAIAVGDVVGQGPAAAA
FT                   VMGQLRSALSTAVLQGCGPAEALELLDRFAARLPGALASTAACLVVDGTAGTVRWARAG
FT                   HPPALLVTPDGAQLLDGAGSGAVLGAPGRRPYTEGTVQITPGATLLLYTDGLVERRGEV
FT                   LDDGLERVRAAAARHAAADPVGLTGRLLAEVLADADQPDDVALIAARLLPAPLSARLPA
FT                   DPRSLSAVRRAVAAWTAAAGLPDDTAEDLQLALGEALANAVEHAYAAAADEGECSYRVA
FT                   READGSLRAEVRDSGLWRPPPADRGYRGRGLELISALATDVEVVHVPEVAGTTVRFRMA
FT                   PAVPGAPELRPQRGTAGPPLDGGAVLTVHDEPGGPRLEVHGEVDLATAGRVRRQLLTRL
FT                   EQLAPGSVATLDLGPTGYLASAGVGLVLEAVARARRAGVELRVQTRPGTPPARILALAG
FT                   VGEPAVEAPTAPLA"
FT   gene            126085..127080
FT                   /locus_tag="Gobs_0117"
FT   CDS_pept        126085..127080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0117"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: nfa:nfa18850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72923"
FT                   /db_xref="GOA:D2SGP1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR025847"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP1"
FT                   /inference="similar to AA sequence:KEGG:nfa18850"
FT                   /protein_id="ADB72923.1"
FT                   /translation="MDPAVGEYAPHPRPSNGTGASVGSRHAAAVVRGEAELLAVALPFL
FT                   DAGLRAGDVVALSCPPEVAALLCDELGERAGQVRNDRRLSLLGARAPDALAHARRTAER
FT                   APSGQLRVLSLVDFGPVPVGWREGLRFESASNRVMQGVPVDALCVYDRRRLPAVVVEAA
FT                   AATHPFLVHDGAWAPSPAYRDPADYLPALPWPREPLEDTAPVLVLDDAPSLVALRHEIG
FT                   AALAARVPDRDQREDLHLAAAEVAANAFRHGVRPVSARMWTDGERLVCAVTDSGHSFGD
FT                   PLAGFRPAHGADFSRGGMGLWLARKLWDSVDLIPGPEGLTVRLSTRLNPA"
FT   gene            127113..127607
FT                   /locus_tag="Gobs_0118"
FT   CDS_pept        127113..127607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0118"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; transcriptional
FT                   regulator PadR family protein; SMART: regulatory protein
FT                   MarR; KEGG: ara:Arad_4437 transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72924"
FT                   /db_xref="GOA:D2SGP2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB72924.1"
FT                   /translation="MGDAVDQILAQWARERPDLDCSPMGVVGRISQLQREVFLAQRATF
FT                   ARHGLDVPSFDVLAALRRAGAPYQLTPTALMRTALVTSGAITQRLDRLEEKGLITRERS
FT                   EADGRAVVVTLTEAGRAALDAALPDHLETERRLLAGLSDDDLDALAGLLRRLLVALGRV
FT                   P"
FT   gene            complement(127740..128753)
FT                   /locus_tag="Gobs_0119"
FT   CDS_pept        complement(127740..128753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0119"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: ach:Achl_4500
FT                   ATP dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72925"
FT                   /db_xref="GOA:D2SGP3"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP3"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ADB72925.1"
FT                   /translation="MPLSVPGLPDVPTELAGPVAVELAKPVRDLPRADALPGGVLYEPK
FT                   WDGYRLVVVRTGGTTRVWSRQGRDLSSRFPDVVAAAVAQVPAGTVLDGEVVVWNGSRLD
FT                   FGLLQQRMVATAGRIGALVAAAPASYVAFDLLALGGADLRGRRLRERRAALEDLAARWA
FT                   PPMQLSPVTADPAEARQWSADFRPAGVEGLVAKGAGTRYAPGRREWLKVKSWETTEVLA
FT                   GGVIGPLERPSQLVAGRYRDGELVVVGRTSPLSPAQSAELADVLTPAGPDHPWPERIGT
FT                   GAFGGGRLSVPLTRVRPDVVVEVSADAALQAGVFRHPLRFVRVRPDLTPEDVPAVP"
FT   gene            128917..129405
FT                   /locus_tag="Gobs_0120"
FT   CDS_pept        128917..129405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0120"
FT                   /product="DnaJ-like, subfamily C, member 28, conserved
FT                   domain protein"
FT                   /note="PFAM: DnaJ homologue, subfamily C, member 28,
FT                   conserved domain; KEGG: kra:Krad_0960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72926"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP4"
FT                   /inference="protein motif:PFAM:PF09350"
FT                   /protein_id="ADB72926.1"
FT                   /translation="MTERKPPGMSFETWIDHQITQAQARGAFDGLEGSGRPLPPRAREQ
FT                   TSYEWALEWARRQQADPKDLLPPGMALRREREDLALRVPQLPSEAAVRATVAEFNARVE
FT                   QHWRRPQDGPDAVPGLADEDALVRLWQATRPPPPLPEPVAPPAPPRSRWWRRRRSPRA"
FT   gene            129468..129662
FT                   /locus_tag="Gobs_0121"
FT   CDS_pept        129468..129662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72927"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72927.1"
FT                   /translation="MTEVPGTDRDEARENVLHETPLVPEDVDDTDDDPRHTDHPTNRGD
FT                   EGQDGESAKPPAGSTELGT"
FT   gene            129751..129921
FT                   /locus_tag="Gobs_0122"
FT   CDS_pept        129751..129921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72928"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72928.1"
FT                   /translation="MTESTGAGGAGADEVTATPSGAAAGDEGEDLHGTAREVYEANQEG
FT                   GADGAAKTPGA"
FT   gene            complement(130252..132123)
FT                   /locus_tag="Gobs_0123"
FT   CDS_pept        complement(130252..132123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0123"
FT                   /product="Hydantoinase B/oxoprolinase"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG:
FT                   rer:RER_58720 hydantoinase B"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72929"
FT                   /db_xref="GOA:D2SGP7"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP7"
FT                   /inference="protein motif:PFAM:PF02538"
FT                   /protein_id="ADB72929.1"
FT                   /translation="MGLPDADPVLVEIVAGTLAAIEREVETSIGRTSRSPMIRDAHDFR
FT                   AGIHDRKLRKLTGRSYSALVHPVVRDHPIGTMNIGDVYFHNDVYLSEGGIGHLPDLCVT
FT                   VPVFAEVDGPAGPKAEVVAFVQAFGHHDDIGGAVPGSMPSAATSVYEEGLMVPPIKLWD
FT                   RGVRNEAALAIMTRNSRMPDSLAADLDAECSACLAGARRLGELFERYGVAAVEACFEAI
FT                   LANSTEVYRREVLSQIPDGTYVWEDYAEHDGVEPPKLHRQRITLTMDSAADVPLVIDFT
FT                   GTGPQAKGPINHCGDYADGNFLKKWLAPILRNLAETPERMAELDVNEGVVPLIEMRFPE
FT                   KGTLLTPVFPAPTNARTFVILRLLGVLAGVLAKATGGRMPADQETIRYTGVYGLDEAGE
FT                   PYLMREVLGGGSGGRYYADGEDTIHVVPDSRNLPTEFTESRFPLRVERLGLALDSGGPG
FT                   RYRGGCGYEKHIRVLRDAHFMSIADRSILSCWGVAGGRAGQPFRITVDPSGPDEHDVDA
FT                   LADAEPLAAGTVVRIRTTGGGGWGDPLDRPVEEVLRDVAWRKVSPAGARVDYGVVVGDD
FT                   GTCDEAATDRLRREMRDARTGDEPFFDRGPGYARLSGGAAFNEFDLL"
FT   gene            complement(132123..134195)
FT                   /locus_tag="Gobs_0124"
FT   CDS_pept        complement(132123..134195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0124"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   rha:RHA1_ro03487 hydantoin utilization protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72930"
FT                   /db_xref="GOA:D2SGP8"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP8"
FT                   /inference="protein motif:PRIAM:3.5.2.9"
FT                   /protein_id="ADB72930.1"
FT                   /translation="MEPRRVRIGIDTGGTFTDVVAVDEATGRTTTTKTPSTPADPAEGF
FT                   LTGVRKVLDLLGLDGSAVTAVSHGTTVATNQLLQGELDRIGFLTTEGYESVLEIARQSV
FT                   PDGYGNSYFWVKPPRIVPADLVRTVRGRLDHRGTEVRPLDEEDARAAARFFRDAGVGTI
FT                   GVCLLHSYADDAHERRVLEVLREEHPGAVVSASSQVLREYREYERSVTTLVDAAVKPRV
FT                   GAYVTAIRERLDGIAPGVPFYVMKSNGGVLSGEEVVHQPITTVLSGPAAGALGAALVAG
FT                   AAGFDRVLTCDGGGTSTDVTVVVDGEPAVTTEGSVGAYPSKIPMIDVVTVGAGGGSIAW
FT                   LSPEGTLKVGPRSAGADPGPICYPSGGSEPTVTDAHVVLGRIPPHLLGGEIPLSVGAAR
FT                   AGLELLGEELDLDLERTATGILEISAWNQANALRQVTVARGLDVRDFTLTTFGGSGSLL
FT                   ACRLMDVLGLPRTLVPPDPGNLSAFGLLTVDVRNDHVQTAISRHADLDLDRVRSVFASL
FT                   EDDARAALDGEGFPRDRQRVQRSADLRYVGQAFEVRVPVADGDLDAAAVDQACQGFHAA
FT                   HRMLYGYDFAEDPRQAVEWVNLRVSGIGPIRRPDLVELSPADGPVTDRAVTGSRPVFFD
FT                   DDWVETPTYDRPRLAPGDVVPGPAVIEEFGSTVPVHPGFRATVDRHGNLLIERDA"
FT   gene            complement(134236..134589)
FT                   /locus_tag="Gobs_0125"
FT   CDS_pept        complement(134236..134589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72931"
FT                   /db_xref="GOA:D2SGP9"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72931.1"
FT                   /translation="MTAHPPSAAVRTALGASLAVVLFLATLGSVGAGFGVMTDCTNTHD
FT                   CTSTGCAPCRAANAWLTAGWLVQVGLLLAGVVLVVLAARRHRLRAVRLGALLLGPSSVA
FT                   LFVVTTALAVAAV"
FT   gene            complement(134654..134854)
FT                   /locus_tag="Gobs_0126"
FT   CDS_pept        complement(134654..134854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72932"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72932.1"
FT                   /translation="MTGPDDAFLAPDDALRGFDDDSDVESGTGDGERPGADDVERPNPA
FT                   GAAVEDAGRSAGSLQDGTEER"
FT   gene            complement(134940..136307)
FT                   /locus_tag="Gobs_0127"
FT   CDS_pept        complement(134940..136307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0127"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sen:SACE_3870 putative glycolate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72933"
FT                   /db_xref="GOA:D2SGQ1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ADB72933.1"
FT                   /translation="MTASMQELAAQLPEGVLVTDEATTEAYRFDSASSCPAGRPLGVVR
FT                   PTTTEQVQAVLRWATRHRVPVVPQGARTGLSGAANAVDGALLLSLVRMDRILAVDEVDQ
FT                   VAVVQPGVVNADLSRAVADVGLFYPPDPSSWEMSTIGGNLATNAGGLCCVKYGVTADFV
FT                   RGLEVVLADGEVVRTGRRTAKGVAGYDLTRLVVGSEGTLGVITEATLALRPAPEPALTM
FT                   AAVFDRTTDAMTAVTRIMASGLRPSLMEFLDRASLRAIQAYRDMGLPVDAEAMLITQSD
FT                   RGPLAASDVAAMGAICAEFGAAEVAVAEDAAESAMLLQARRLVGPAVEELGVTLVDDVA
FT                   VPRARLVDLLLGMEKITADTGVLVVCPGHIGDGNMHPTVVFERGNEGAAARAQEAFDAI
FT                   MRLALDLGGTITGEHGVGVLKRAWLREELGETSYGLQRQIKEVFDPLGILNPGKVL"
FT   gene            136545..137444
FT                   /locus_tag="Gobs_0128"
FT   CDS_pept        136545..137444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0128"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bcv:Bcav_0314 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72934"
FT                   /db_xref="GOA:D2SGQ2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ2"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADB72934.1"
FT                   /translation="MAGAVTHLVRHLADGVPQVGVRSDDVVRPVPGVGSMAELLGQSLA
FT                   AARDRVLAAAGEPGVPVADVRLLPPVDGLTEVWASGVTYERSMDARVEESRTQDVYSRV
FT                   YAADRPELFFKSVAWRVVTDGEPIAVRPDCSVTVPEPELAVVVTATGEVLGYTVCDDVS
FT                   SRDIEGENPLYLPQAKVYAGSCALATGIRPAWEVPDWSRLDVSVAVLRDGATVFEGTTS
FT                   TARMRRTVDELVECLFRAQDFPAGAVLSTGTGLVPGLEFTLRPGDVVDVVVEEIGTLSN
FT                   PVTTVAEVRGRAAPRVSR"
FT   gene            complement(137434..138528)
FT                   /locus_tag="Gobs_0129"
FT   CDS_pept        complement(137434..138528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72935"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL4146"
FT                   /protein_id="ADB72935.1"
FT                   /translation="MPATLTRRQVLDLRVHVQQLDRASGDLADTAVLDLGVQDTGTDGG
FT                   RWALALRGVDVAALRGDELATVWTIRGAPHLYRRADLPGVAAATAPFSDADAGKRIFDA
FT                   AKPLKAAGISNLEGLDVVAATMRSVVTAPMVKGEMSGRLTELLPEPYLRFCRPCDATHV
FT                   HEMPFRLAALRAGLELEPGTSPPVLRPVPGLAPVDTVPQRLDVVRGYLRLLGPATPKLV
FT                   AGYLDAPVRDVQARWPEDAVEVPVGGERRWLLAEDASRVADVPPATGVILLGPFDLFLQ
FT                   ARDRPLLVDDPARAKALWPVLGRPGAVLADGEVAGTWRPRKAGSSLTVAVELWTPLTRE
FT                   AVTEAAERLAAFRGVALKAVQVSD"
FT   gene            complement(138533..138961)
FT                   /locus_tag="Gobs_0130"
FT   CDS_pept        complement(138533..138961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0130"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707; KEGG:
FT                   nfa:nfa41690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72936"
FT                   /db_xref="GOA:D2SGQ4"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ4"
FT                   /inference="protein motif:PFAM:PF08044"
FT                   /protein_id="ADB72936.1"
FT                   /translation="MIEPVHPDELRVSDPERAAVQERLRRAVAAGQLDLHEFDTRVQSA
FT                   WAARTRGELSRITRDLPEPPPEPPSPPPLGRWFSDDDGTAMRVLMIVWASIAAVNLVVW
FT                   GLVTVTSEGDTYPWWIWLSVPGAALLVLYVVGIGRPRR"
FT   gene            complement(139090..139506)
FT                   /locus_tag="Gobs_0131"
FT   CDS_pept        complement(139090..139506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0131"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bcv:Bcav_0776 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72937"
FT                   /db_xref="GOA:D2SGQ5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB72937.1"
FT                   /translation="MPEDDDEALGELLVRAARGQRRRWRDTLAPWDLSPHHARALRVVT
FT                   DRAGMRLSDLAEALHIAPRSATEVADALQARGLVERTPDPTDRRAVVLTPTAGGRLVQQ
FT                   EIAAARAADNRDLFARLDAADRATLARILRTLAD"
FT   gene            139569..141410
FT                   /locus_tag="Gobs_0132"
FT   CDS_pept        139569..141410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0132"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG:
FT                   bcv:Bcav_0777 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72938"
FT                   /db_xref="GOA:D2SGQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB72938.1"
FT                   /translation="MVAIADTRGPGGGRPGRTVDPADRAQLERNPVPLRRVTALFAPFR
FT                   WQVTTVVVLIVASSLVALATPFLVRLVIDEALPRQDVRLLVRAVLGMLAVAATTAVLGV
FT                   VQTWLSTTVGQRVMHGLRTAVFTHLQRQSLGFFTRTRGGEVQSRLTHDIAGMQSVVTST
FT                   ATSLASNATTVVGTVAAMVALSWRLSLLSLVVLPPAVLLTRKVAQMRRTVTAQRQRHLA
FT                   DMHAQVEEGLSVSGVLLGKTLGAGPAQSRRFADTSQDLVGLEVRAQLAGRWRMATMSIV
FT                   FAGIPALIYLAAGLPATSGGMTIGTLVAFTALQGTLFRPLMGLLDVGVQVTASMALFSR
FT                   VFEYLDLPVEVDDPADPVPLDPADVRGEVRLEGVSFTYPDGHRPALDGVDLVVPAGTTL
FT                   ALVGETGSGKSTLASLVARLADPTAGRVTVDGIDLRDLSLATLSRVVGVVAQETYLLHT
FT                   TVRENLRHARPDATDAEIEDAARRAQVHEAIAALPDGYDTVVGARGHRFSGGEKQRLAI
FT                   ARTLLRDPRVLVLDEATSALDTGTERAVQAALDEASRGRTTITIAHRLSTVRHADRIAV
FT                   LDAGRVAESGTHDELVARDGRYAALVAAGDRGVPVAA"
FT   gene            complement(141407..141550)
FT                   /locus_tag="Gobs_0133"
FT   CDS_pept        complement(141407..141550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72939"
FT                   /db_xref="GOA:D2SGQ7"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ7"
FT                   /inference="similar to AA sequence:KEGG:SACE_0039"
FT                   /protein_id="ADB72939.1"
FT                   /translation="MYAWIWRHLPGPLAVRGTTALLLVLATTALLLFAVFPALDGLWEP
FT                   RP"
FT   gene            complement(141554..142210)
FT                   /locus_tag="Gobs_0134"
FT   CDS_pept        complement(141554..142210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0134"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: sen:SACE_0038 putative sortase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72940"
FT                   /db_xref="GOA:D2SGQ8"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ8"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ADB72940.1"
FT                   /translation="MTRTIIRGLSELAVTAGAVLLLFVVYEVWVTDLWSDRAQDQVAEE
FT                   LREDWTSGTPVPEPDPGQAFAFLHVPRFGEDWTRAVVEGTDPDELEDGPGHYAGSAMPG
FT                   EQGNFAMAGHRVGRGSPFIALDVLRPGDPVVVETVDAWHVYRVTTTTVVDPSESSVVAP
FT                   TPGGAANSEATGAFLTMTTCHPKFSTRERLVVHGQLEASVGKDVAPDGPAALEEV"
FT   gene            complement(142278..143438)
FT                   /locus_tag="Gobs_0135"
FT   CDS_pept        complement(142278..143438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0135"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="KEGG: cmi:CMM_0825 putative cell surface protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   PKD domain containing protein; Gram-positive anchor; SMART:
FT                   PKD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72941"
FT                   /db_xref="GOA:D2SGQ9"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGQ9"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ADB72941.1"
FT                   /translation="MKRTASLIATGALSLGSFAVLGTVAPGIASASGCGVTPLDLAGLE
FT                   GAFTGALTGVGEGATAEMRTDGLRLTMPSAEADPQSAAYASYFMDGLEIPLADATAQSN
FT                   VDLDTTLAPGQPVGNHPTYELYVDLDGPAGDDPAQAILVYWEPEAGEPTDLWWSALGPL
FT                   AELDSESSEEATLVEISAAYPDATVTSLGFQLLYQPGADVVVHGLTFGCNEFRFGSGAG
FT                   TGPGGDPGGDPGGNPGGNPGGGPANQAPIAAVTTTSTGATFTFSAAGSADSDGAVTGFT
FT                   WSFGDGSTPATGEQVVHEYAAPGTYTVTLTVTDDDGASTTTSRQVVVPATDPTDPTDPP
FT                   APTEYGTPLPDTGADVLGLAAVGGLVLAGGGAGLVVSRRRRAGSAS"
FT   gene            143737..144375
FT                   /locus_tag="Gobs_0136"
FT   CDS_pept        143737..144375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0136"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: ank:AnaeK_1068 bifunctional deaminase-
FT                   reductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72942"
FT                   /db_xref="GOA:D2SGR0"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGR0"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ADB72942.1"
FT                   /translation="MRPLVVTEFTTLDGVVQAPGGPDEDTAGGFAHGGWLVPFFDDTLG
FT                   AQMDAWFAGVEDFLLGRGTYEIFAAAWPQAPTEDDPVAEALNTRTKHVASRTLTSLDWS
FT                   GARLLEGDVVDAVRALRDRDGGELQVHGSPGLVQTLLRADLVDELRLVVAPVVLGQGKR
FT                   LFGDGAIAWSWRLTSSAATPTGVLLCTYRRGGEVETGAMGAEYEDAVSG"
FT   gene            complement(144365..145588)
FT                   /locus_tag="Gobs_0137"
FT   CDS_pept        complement(144365..145588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0137"
FT                   /product="diguanylate phosphodiesterase with GAF sensor(s)"
FT                   /note="PFAM: EAL domain protein; GAF domain protein; SMART:
FT                   EAL domain protein; GAF domain protein; KEGG: kra:Krad_0179
FT                   diguanylate cyclase/phosphodiesterase with GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72943"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGR1"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADB72943.1"
FT                   /translation="MRRKRSAADQQIADLLVTAKKSLDLSVAFLSRLDGTTQHLEVVKT
FT                   AVPVLVQEGAKVRQDTSICQAILDGRLPAVIPDVTKYPEAMKLPSARIPRIRSYVSTPV
FT                   HLSDGSLYGTFCAFGFRSDKELGKRDLALVKVLASAAAVIVEPEVRDQERRTEIEGRLD
FT                   PVVADGGPVVLLQPIVDLATGGRVGAEALSRFPAEWGRTPDVVFAEAHSVGMGHALELQ
FT                   ALERAAEHLDRVAGYVAMNVSPATVLTPACGELLGRLPLDRVVLELTEHDEVEDYDVLL
FT                   ATLAPFRAAGLRLAIDDVGAGFSSLRHIVVTSPDVIKLDRSIAAGVAGDHVLATLVGSL
FT                   VTFAHGSGARVVAEGVETADDAAALRTLGVDLGQGWHFGRPGPPEALAVPVPRTPADDA
FT                   APEPVLSR"
FT   gene            145728..146717
FT                   /locus_tag="Gobs_0138"
FT   CDS_pept        145728..146717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0138"
FT                   /product="luciferase family oxidoreductase, group 1"
FT                   /note="TIGRFAM: luciferase family oxidoreductase, group 1;
FT                   PFAM: Luciferase-like, subgroup; KEGG: ach:Achl_3681
FT                   luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72944"
FT                   /db_xref="GOA:D2SGR2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGR2"
FT                   /inference="protein motif:TFAM:TIGR03558"
FT                   /protein_id="ADB72944.1"
FT                   /translation="MSIPLSVLDLAPISRGQTPGESIAASVALAQRAEQSGYRRVWYAE
FT                   HHNMPTIASSATSVLIAHVAAHTSSIRLGAGGVMLPNHSPLTIAEQFGTLEAVHPGRID
FT                   LGLGRAPGSDQNTVYALRRDPRSADRFPQDVLELQGYLAGETRVPGVDAVPGKGTNVPL
FT                   YILGSSMFGATLAAALGLPYAFASHFAPAMLEPAVEAYRREFKPSAQLDRPYVIAGVNA
FT                   VAADSREAAEEAVTAARRRLAVGLFGRGRQMSDDEAQLLLDGGAGLHVDTMLTHTAVGT
FT                   PAEVREYLTGFAREADADELIVAHQFPGVEGRLRSVELTAEAMQTVPA"
FT   gene            complement(146790..147374)
FT                   /locus_tag="Gobs_0139"
FT   CDS_pept        complement(146790..147374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ach:Achl_0802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72945"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D2SGR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72945.1"
FT                   /translation="MHAHSQTTRRTLHLLTAVGAMTLTLTFAGQSIAQADEHRGGASPT
FT                   WDGQRGDGDRPRWDDDAAEAAPAPAPAPAPAPAPAPAPAPAPAPEPAPAPTGTGKQAYK
FT                   DYAAAEVDDATQFDCLDALWEAESNWTPAAQNPTSTAYGIAQFLNGTWAGTGIAKTSDP
FT                   FRQIDAGLVYIENRYGSACAAWDFHQANNWY"
FT   gene            complement(148003..148434)
FT                   /locus_tag="Gobs_0140"
FT   CDS_pept        complement(148003..148434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0140"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bwe:BcerKBAB4_2400
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72946"
FT                   /db_xref="GOA:D2S3R8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3R8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB72946.1"
FT                   /translation="MSLRGFSAVIFLVDDVAAATAWYTEFLGHAPVFTRPGPGGRAIYA
FT                   KFVIGDHQGELALADGSRAPVGRAAGPGGAIVHWRVDDVAGTLNRLLTMGAQEYTPITP
FT                   HGPFVTAVVVDPFGNLLGLQGVLAVPHYTDDHLAVTKAT"
FT   gene            complement(148437..149255)
FT                   /locus_tag="Gobs_0141"
FT   CDS_pept        complement(148437..149255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0141"
FT                   /product="Polyketide synthesis cyclase"
FT                   /note="PFAM: Polyketide synthesis cyclase; KEGG:
FT                   sma:SAV_2842 cyclase II"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72947"
FT                   /db_xref="GOA:D2S3R9"
FT                   /db_xref="InterPro:IPR006765"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038474"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3R9"
FT                   /inference="protein motif:PFAM:PF04673"
FT                   /protein_id="ADB72947.1"
FT                   /translation="MTQTTPSADPAADASTTPTEQPWANDTVEFANTASAPASWYSGTW
FT                   RPFRNVIVCRMVPGSEDKVGPVFAYYDRTTRPQDLGVVGRVLLSYEGLYLHVIERKEDP
FT                   EVSGQRRGLPAFQAIAEAIAPYVTPYPSYWQNPSHSVAKHFYTWVPEGEVSPDREMTVI
FT                   VQRMRPGSEEDIARVFAESDAGGLPTETGVTGRWLYSMEDVFVHLLEQDRVKAAAVREN
FT                   HESMRPAFAKVMADLAPYVSPYRPETWQSPRDSVARVFHRWTAPDWKPED"
FT   gene            complement(149252..150532)
FT                   /locus_tag="Gobs_0142"
FT   CDS_pept        complement(149252..150532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0142"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: sco:SCO3099 cytochrome
FT                   P450 hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72948"
FT                   /db_xref="GOA:D2S3S0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S0"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADB72948.1"
FT                   /translation="MTQTAPASSGTSDDVVPGGEIYTPEFRADPYPVYARLRAERPVVK
FT                   VRTPRFDSFLVTRYDDARQALSDPRLSKDLYRAGDTYLAVFGEKARQINTNMLNSDPPE
FT                   HSRLRRLVTQAFTPRRIEAMRPRVEEIVEGLLDRIAPRGATDFVDDFALRLPLAVIGDL
FT                   LGIPEADHEEILAGTQVIRTVGTGGRSPQEDRAAIGQAQERLHAYFTGLVAAKRRDPGE
FT                   DLVSALITARDGDGRLSEAELVSTCFLLLFAGYQTTSDFLGNAVVALLTHPEEMEKLLA
FT                   DPDLVPDAVEELLRFDGSVPVSSFRFATEDLEIGGVPIPAGSIVTVVLSSANHDPELVA
FT                   DPDALDLTRGDTQHMSFGHGVHYCLGTALARLEATTALRRILVRLPDLRLDVPVEELQW
FT                   LPAASAFRGLLELPLRFTPTPTPGGTR"
FT   gene            complement(150576..153482)
FT                   /locus_tag="Gobs_0143"
FT   CDS_pept        complement(150576..153482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0143"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; Antibiotic biosynthesis monooxygenase;
FT                   KEGG: rha:RHA1_ro04915 monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72949"
FT                   /db_xref="GOA:D2S3S1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S1"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADB72949.1"
FT                   /translation="MTAAPEGGGRAAVRTLLRMRAQEGCEAEFEAAWRRAAAEISRVPG
FT                   NLRQELMRDEGDPRWFAIVSDWTDRASVDAFGRSEARETLTEALRDLREDATRSTFTVL
FT                   ATVDAERPRPVRIDFSTSVKPGEQVAFERAYTTVTERIGDSRGYVREELLRDDSGLRYH
FT                   IFAEWESEDDFVQWVEDPSHMAAGAPLARWHSVEFRREVLEIRRRPDADADFPPLDSPG
FT                   GDVEVERVRVDSAVAVEPWEQEAFELAYLAAAQLARSAPGHAREELLREPDGRRYHVVA
FT                   EWDSERHFTDWTAEPANWVAGPLGRWLARGEDRRVFALRVRPVPPAETAAAGTLPAQQP
FT                   AAVDAVVPDGVPVAPEPDLEVVAGQPVQLSAEQAAGTEPALTSTVPSASVQEFVEKPDD
FT                   QHAPAAAALPAPAADVAARPGRAVEVLVVGAGPAGLTHAIELARRGIAVRVVDKRPQAS
FT                   TQADKAIGIHCRTMEIWEDQGIVTEAMDAGIWLYGQTVFVNGEQTHQVDWAGLDELPYA
FT                   HLGLPQYDTERILGAKLASLGVVVERGVELVGFTQDDEGVTAQLRHGSGEGETTRAQYL
FT                   VGCDGAHSAVRSGLGLAFEGGLSMFPQLFMLGDVDVDWDLPAGHLVRFVRIENGDDFTG
FT                   MLVCVPLKGRNRYRIATLAPQRWQDAVGSGVVPPGFWQEYEPPTLADMQAAIDDLGPPG
FT                   TTASNLRWSSIFRIKHGIVDRYREGRVFVAGDAAHLHPPAGGQGMNTGIQDAWNLGWKL
FT                   ALAVRREAAPGLLDSYDAERRPAGKMIVDRAVAIAFTDEMDMEDEKAQFLLEMQMTMNY
FT                   AGSPLVGEGPGGEAFPAGPEPGHRAPDVQGLRRFGVGHPLRLFDLTRGTRSTLLLHADA
FT                   TASEEQVSDLEKLAVAVRQQTRGEVGAYLVAAPEARVPLLVDLPVVRDAEGTFAAAYGT
FT                   AGAGTAAYLVRPDGHVGFRGRPLDEDALLDHLAGVFAQ"
FT   gene            complement(153479..153811)
FT                   /locus_tag="Gobs_0144"
FT   CDS_pept        complement(153479..153811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0144"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   fra:Francci3_2848 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72950"
FT                   /db_xref="GOA:D2S3S2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S2"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ADB72950.1"
FT                   /translation="MTTVPPTGVRTVLRMRTREGCEAEFEAAWRRAAAEISRVPGNLRQ
FT                   ELIRDADDPRTFLITSDWTDRAAVDEFGRSSARETLTEALRDLREDAARNTYEVLATVP
FT                   GVQGTA"
FT   gene            complement(153808..155151)
FT                   /locus_tag="Gobs_0145"
FT   CDS_pept        complement(153808..155151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0145"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG:
FT                   fre:Franean1_2394 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72951"
FT                   /db_xref="GOA:D2S3S3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S3"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ADB72951.1"
FT                   /translation="MTETTVINDEGVVTEVAGYARDTAPEGRAITAPPRGTTRLLVTGI
FT                   GVVAPTGVGVEEHWRSLLRGELAVRPIEGFDASRYGVTVAGQVRDFDPEQYVVPQLKVQ
FT                   TDRWSWMSLAAATLAAEDAGYIPPEEAYATSVFLAAGSGGNEFSQHEIQGLWAKGPRSV
FT                   GAYQSIAWFYAASTGQVSIRDGYKGPSGVVVSEGAGGLDSIGWARRVARRGTPAVLVGG
FT                   TEAGVTPYALLCQVTSGRLSTAPRPEDAYKPFDERANGHAIGEGGAILLLEEADAARAR
FT                   GAQRVWGEVIGYGATHDAHHHEDPAPDATQYTRAIRLALADAGVAPEEVGLVVADGAGV
FT                   PELDALEAQAITAVFGERGVPVTAPSSWTGRLMAGGSALNVATALLAMRDGVLPATGNV
FT                   NRPVAEYGLDLVLENRERDLDVVVVLARGFGGFNSALVLRRYEEEESG"
FT   gene            complement(155148..156443)
FT                   /locus_tag="Gobs_0146"
FT   CDS_pept        complement(155148..156443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0146"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG:
FT                   fre:Franean1_2393 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72952"
FT                   /db_xref="GOA:D2S3S4"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S4"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ADB72952.1"
FT                   /translation="MSASRRRVVITGIGVVAPGSMGREGFWEMITAGRTATRRITFFDP
FT                   SRFRSQVAAEVDFDGRKLGLTAQEVHRNDRFVQFALVAADEAVADSGLRMGVGGAPDAP
FT                   EPERVGVTIGSAVGATTRLEDEYVQVSDAGKHWLVDPRYASRFLHQALVPSCAATEVAV
FT                   RFRAQGPGTVVSTGCTSGIDAVGYGSQLIEDGDADVVLAGASDAPISPISMACFDTIRA
FT                   TTGNNADPEHASKPFDARRDGFVMGEGSAVMVLEELEHAQRRGAEIYCEVTGYANRCNA
FT                   FHMTGLRPDGVEMSEALDQALAQGRIDGSEVGYVNAHGSGTKQNDRHETAAVKLSLGEA
FT                   AYSVPMSSLKSMVGHSLGAIGSIEIAATALAVQRQVVPPTANYEVPDPECDLDYVPKTA
FT                   RDHKVDVAVSVGSGFGGFQSAIVLAKPDRRPA"
FT   gene            complement(156440..156865)
FT                   /locus_tag="Gobs_0147"
FT   CDS_pept        complement(156440..156865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0147"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   fre:Franean1_2392 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72953"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016672"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB72953.1"
FT                   /translation="MTTIQHPPSAKVRCGPTVHRADTPPNRRRGGDIRVLLSPASVGST
FT                   AGFMGTLTLEPGEVVTEHWHPYSEEFLYCQSGDVLVTLDGEERRLTGESAVHIPIGVRH
FT                   RIVNDSATTATFVFLCGPLAPRPELGHVDTEPSPGVR"
FT   gene            complement(156862..157824)
FT                   /locus_tag="Gobs_0148"
FT   CDS_pept        complement(156862..157824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0148"
FT                   /product="acyl-carrier-protein S-malonyltransferase"
FT                   /note="KEGG: bpa:BPP3306 acyl-carrier-protein S-
FT                   malonyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72954"
FT                   /db_xref="GOA:D2S3S6"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S6"
FT                   /inference="similar to AA sequence:KEGG:BPP3306"
FT                   /protein_id="ADB72954.1"
FT                   /translation="MTGTAVVLAGEAGVRAGAVDAWLEDAAARAVVDEASAVVGRDVAT
FT                   WWRDPLNLCCDTTAAHVEVVVSGIAGYRSLTERGLRPVVVAGHGVGEYAALVAAGALPL
FT                   DQVVELVHWRAELLSLSPRPSCAGMAAVVGPGAGEVARAVVEDVGDTGALAVAAVDGPS
FT                   QVLLAGGCEALARARETVLAAGLELVRLPGRTACHGPLVAPVARHLGAAFADLEWSEPD
FT                   VPVVPNADGRPTRDPEQLARCLRAHLTSPVQWEATSRALVEAGATEVVEVAAVPVLGPL
FT                   IRQVHPDLPVHLAAGPGTPLPTTPLEPAPAVPVHTGGET"
FT   gene            complement(157821..158324)
FT                   /locus_tag="Gobs_0149"
FT   CDS_pept        complement(157821..158324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0149"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase;
FT                   cyclase/dehydrase; KEGG: fre:Franean1_2391
FT                   cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72955"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S7"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ADB72955.1"
FT                   /translation="MSSTVEPGTATAGHTDNSIYIDAPIDHVWAMTNDLPSWPDLFTEY
FT                   AEVEILASTENWFRFRLKMHPDESGRVWSWVSERTLDEAAHEVRARRVEPGPFEFMDIR
FT                   WNYAPEGSGTRMRWVQDFRMRPEAPIDTEGMTRRIDANSKVQMGIIKDKVEAAAAARSG
FT                   EPAT"
FT   gene            complement(158456..158683)
FT                   /locus_tag="Gobs_0150"
FT   CDS_pept        complement(158456..158683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0150"
FT                   /product="putative actinorhodin polyketide synthase acyl
FT                   carrier protein (ACP) (ActI ORF3)"
FT                   /note="KEGG: fre:Franean1_2390 putative actinorhodin
FT                   polyketide synthase acyl carrier protein (ACP) (ActI ORF3)"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72956"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S8"
FT                   /inference="similar to AA sequence:KEGG:Franean1_2390"
FT                   /protein_id="ADB72956.1"
FT                   /translation="MNLLSEKAGLPRTSHTTDPDAHFADIGLDSLAFLSMQTELQDRFG
FT                   TEMPDDSPDHYTLGQIVEHVDAAQKSAGMA"
FT   gene            complement(158680..160185)
FT                   /locus_tag="Gobs_0151"
FT   CDS_pept        complement(158680..160185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0151"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain ATP-
FT                   binding; biotin carboxylase domain protein; ATP-dependent
FT                   carboxylate-amine ligase domain protein ATP-grasp;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: fra:Francci3_2926 carbamoyl-phosphate synthase L
FT                   chain, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72957"
FT                   /db_xref="GOA:D2S3S9"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3S9"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADB72957.1"
FT                   /translation="MLVANRGEIAVRVARACRELGIEVVAVYSTSDRNSAVVDLADEAV
FT                   HIGPPAPRRSYLHVANIVEAALRTGADAVHPGYGFLSEDPDFAEICAAEGLTFVGPPPA
FT                   VMQQMGNKATARRLMADAGLPLLPGVVEPVGSVDEAREVAARIGYPLIIKAAAGGGGRG
FT                   MTVVREAADLADAFTTTRATARAVFRDPAVYLERHLARARHVEVQILCDTHGNGVSLGE
FT                   RDCSLQRRHQKLLEEGPAGHLSPEQRAELGRLAVHGALSVGYTGAGTMEFLVDGSGSAY
FT                   FMEMNARIQVEHPVTELLTGVDLVREQILVSAGRRLQLTQADVVPRGAAIECRINAEDP
FT                   TRGFAPAPGRLDVLQVPNGPWTRFDTGYRQGDTVPPDYDSLLGKLVVWAPDREQAIRRM
FT                   DRALAELRVEGPGVHTTVALHRALLRDPDVTADRHDVQFLDRQLPEVLARAASLADAPE
FT                   PGLPAARGSLSLVQTPAAEAQPDSTPPEGPTPCPTRPSLSATS"
FT   gene            complement(160194..160721)
FT                   /locus_tag="Gobs_0152"
FT   CDS_pept        complement(160194..160721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0152"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: stp:Strop_2504 acetyl-CoA
FT                   carboxylase, biotin carboxyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72958"
FT                   /db_xref="GOA:D2S3T0"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T0"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ADB72958.1"
FT                   /translation="MHPSEISPRMGATPPPEPDQGARDLRDEVVALARSLPGGLRRLTV
FT                   RNGDRAIEVEWATDAPGTGSSAPGAPAPAVSAASDDRPDAGAEAAEAAGAVRSPLVGTF
FT                   YAAPSPGADPFVRVGDEVEPGQTVGIVEAMKLMNPILADEAGVVAEVLVGDAESVEYDQ
FT                   VLMRLRPTGRAR"
FT   gene            complement(160724..162436)
FT                   /locus_tag="Gobs_0153"
FT   CDS_pept        complement(160724..162436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0153"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, carboxyl
FT                   transferase, beta subunit; acetyl-CoA carboxylase, carboxyl
FT                   transferase, alpha subunit; PFAM: Acetyl-CoA carboxylase,
FT                   alpha subunit, conserved region; carboxyl transferase;
FT                   KEGG: sen:SACE_0026 acetyl carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72959"
FT                   /db_xref="GOA:D2S3T1"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T1"
FT                   /inference="protein motif:TFAM:TIGR00515"
FT                   /protein_id="ADB72959.1"
FT                   /translation="MTRSSTTTAAAVQAAPDQAGWVCCPDCGWLLYRKRLDRNLHVCPE
FT                   CDHHLRLSARARIVLLTDPGSFSEVAFQPGTPDPLAFTDLRDYPDRLADAARRSGESEA
FT                   VVVGIARIGGAETVVAVMDFAFLGGSMGVEVGRRVSGAAELALERGLPLVTVCASGGAR
FT                   MQEGVFSLFQMARVSEAFGRLREAGLLSVCVLTDPTYGGVSASFATLASVLVGERGAHV
FT                   GFAGPRVVQETIRAELPDDFQTAEFLLAHGLVDRVESRGDLRPLLVRLLALHGAGVPDE
FT                   APDDGGEACVAASDVEEADPWDVVQRARDVDRPTTLDYLHTAFDDFVELHGDRSFADDA
FT                   AVVGGVASIGGRTVVVIGQEKGHTVRERVARNFGMPHPEGYRKALRLLDHAETFGFPVV
FT                   TLVDTPGAHPGPEAEERGQSHAIAETIMRSSRLRVPVVSVVTGEGGSGGALALCTSDRL
FT                   LVLENAYLSVISPEGCAAILWRTAVAAPTAARAMRLGAAHLRASGIATSVVPEPPGGAH
FT                   TDPAAAARLLRQALVRELDDVCRLDVATLMDSRSRRLDRIGGDEGRTLQPVEG"
FT   gene            complement(162465..162791)
FT                   /locus_tag="Gobs_0154"
FT   CDS_pept        complement(162465..162791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0154"
FT                   /product="Polyketide synthesis cyclase"
FT                   /note="PFAM: Polyketide synthesis cyclase; KEGG:
FT                   sma:SAV_2842 cyclase II"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72960"
FT                   /db_xref="GOA:D2S3T2"
FT                   /db_xref="InterPro:IPR006765"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038474"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T2"
FT                   /inference="protein motif:PFAM:PF04673"
FT                   /protein_id="ADB72960.1"
FT                   /translation="MHQTMIIAKMAPTDADKVADIFGRYDATSMPHEIGVRNRSLYQFH
FT                   GIYVHLIDFDRPASEAMRVAQGLPAFRAVSEDLRPYIEAYDPNWRSPQDAMARRFYHWT
FT                   SAPE"
FT   gene            163178..163906
FT                   /locus_tag="Gobs_0155"
FT   CDS_pept        163178..163906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0155"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: tfu:Tfu_0767 LuxR response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72961"
FT                   /db_xref="GOA:D2S3T3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T3"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADB72961.1"
FT                   /translation="MTGPDDAVPDSAGSSAGPPVRVLICDDHEVLRHGLRTVLRRIPGL
FT                   SVVAEADCVREALSLAGMVRPDVTLVGLDGQGPLLQDLVRELTGMGIRVVLLGEAGAGS
FT                   DLVDVLRAGARGYVHTTASPQRLVECVRAVARGETVLDASVTGELLHRLDGAPRTAGGD
FT                   RAAAHGPLTARQQAVAGLVAEGLTNAEIAARLEVSKATVKGHITVALRRLGLRDRTQLA
FT                   IHVHRSAGPGSEWGLSPARS"
FT   gene            164198..164890
FT                   /locus_tag="Gobs_0156"
FT   CDS_pept        164198..164890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0156"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; response regulator receiver; SMART: regulatory
FT                   protein LuxR; KEGG: sen:SACE_0148 two-component system
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72962"
FT                   /db_xref="GOA:D2S3T4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T4"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADB72962.1"
FT                   /translation="MPSPTTLVCVLLCEDREVFRIGLRVVLEAEPDMAVVAETSHLPEA
FT                   LEATEGEGTVVVVVRQGLVAGDALPLLRTLCRRNTAVLVLAEPETESEPELVEILQAGV
FT                   RGFLPRRSGAQRLVDGVRALARHEAALDPAATSHLVHHLTSGPQRRSALEPRALDRLTY
FT                   RQREVAELVAQGLSNEEIAGRLFLSLATVKSHLTASMRRLGVRSRTELAILVTRESSSA
FT                   AGPQQAAL"
FT   gene            164949..166034
FT                   /locus_tag="Gobs_0157"
FT   CDS_pept        164949..166034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0157"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   kra:Krad_0152 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72963"
FT                   /db_xref="GOA:D2S3T5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T5"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADB72963.1"
FT                   /translation="MDLFSPVTLGDIELANRIVMAPLTRMRSGASGVPGDLVVEHYRQR
FT                   AGVGLIITEGTYPNHGGQAFVGQPGIVTDEQVEGWRRVADAVHARGGRIVLQVMHGGRV
FT                   THPDVNGGRRVVAPSAIAIDGEGHTEKGKQPYPVPHALTVDEARQTLQDFVSASRRAVE
FT                   AGLDGVEIHGANGYLLHEFLSPASNRRADEYGGTPANRARFVVQVVTAVAAAIGAGKVG
FT                   LRISPEHNIQDAYETDRDDVRATYGALVDQLRPLGLAYLSVLHSEPAGELVQELRERFG
FT                   GPLVANSGFGSVTTRDEAVRLIEAAHADAVAVGRAVIANPDLVERWQGEHPENEPKAHL
FT                   FYAPGAEGYTDYPTLEARKAG"
FT   gene            complement(166093..166527)
FT                   /locus_tag="Gobs_0158"
FT   CDS_pept        complement(166093..166527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0158"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sgr:SGR_5629 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72964"
FT                   /db_xref="GOA:D2S3T6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T6"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB72964.1"
FT                   /translation="MDFARAKRVNDAVRSLAMRHRAAAAQVLAPLGLHPGQEVLLLELS
FT                   AHGSRTQAQLAVASGCEPPTITGSVRKLESAGLLVRRPSPTDGRVTIVELSDRGRSLVP
FT                   ALEAAWCELAERTVAGLSTDPDRLTASLGEMTAGLDPATA"
FT   gene            166620..167042
FT                   /locus_tag="Gobs_0159"
FT   CDS_pept        166620..167042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72965"
FT                   /db_xref="GOA:D2S3T7"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72965.1"
FT                   /translation="MTRSAAPSLRSRGRLAVRPAALAVAGAAGAAVLTWAVAVPLLGVD
FT                   LRGGTEGAAQAVGPGSVVAAAAVAGVLGWALLALLVRTVARAEAVWRAFAVAVLLLSLG
FT                   GPVAMGVGTASVVVLLALHVVVALVLVPLLPRAVQR"
FT   gene            167039..167410
FT                   /locus_tag="Gobs_0160"
FT   CDS_pept        167039..167410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0160"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: rop:ROP_60110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72966"
FT                   /db_xref="GOA:D2S3T8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024031"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T8"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADB72966.1"
FT                   /translation="MTAPVAAVCFTDAELAYLLGERRLGRLATADAAGQPHVVPVGWSY
FT                   NAELGTIDVSGRRFASTRKYRNVQANPRAAFVVDDVLPPWRPRCVTLQGLAETVEAPPG
FT                   GEALIRIHPRTIVSWGLEG"
FT   gene            complement(167531..168175)
FT                   /locus_tag="Gobs_0161"
FT   CDS_pept        complement(167531..168175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0161"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5870 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72967"
FT                   /db_xref="GOA:D2S3T9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3T9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB72967.1"
FT                   /translation="MTTALRASRLEKTHRRGGEQVHALRGVGIEVEAGRLVALIGRSGS
FT                   GKTTLLNCLLGWERPDRGEVEVPGVRDPAAAPWTTVAVVPQRFGLLDELGLADNVALAA
FT                   RLAGLPRPREAAVEALGELRLAHLADRLPGEVSLGEQQRTALARALVVRPAFLVADEPT
FT                   GQLDEELTGHVLTRLRVACAAGTGVLVASHDPAVVAAADRVVRLEDGRLVD"
FT   gene            complement(168172..169002)
FT                   /locus_tag="Gobs_0162"
FT   CDS_pept        complement(168172..169002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0162"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rca:Rcas_4355 AbrB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72968"
FT                   /db_xref="GOA:D2S3U0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB72968.1"
FT                   /translation="MRRDGRPAAVCEGLVRIHTARSGPVHALRGIDVVIPAGRLTAITG
FT                   PSGSGKTSLLRILAALDRPTAGSAEVAGHVLDELSARRLRAVRRRHIGYVFARPNANLQ
FT                   PHLTGREHLDLAARYRGTGRAEAREQGDALLDLLGLTHRAGSLPGRLSGGEQQRLAFAQ
FT                   AMVGRPALVVADEPTSELDSATTVELLAGVAELTRSGTTVVMATHDRLAADAADQVVHL
FT                   RSGTVAHEEVAGRRLAVVDGSGRVQLPEAALQRFPGRRVLIEETADGVLLRDPS"
FT   gene            complement(168992..171679)
FT                   /locus_tag="Gobs_0163"
FT   CDS_pept        complement(168992..171679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0163"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   sgr:SGR_1440 putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72969"
FT                   /db_xref="GOA:D2S3U1"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADB72969.1"
FT                   /translation="MFRPRRSRSWPVLRRLRILFLPVPGQALGLLLLAVVLGSALVSVP
FT                   LVPAAAEQGAWERERARQDQAVGATLSSSTQPLAQASSPARIARASALDAAVVETIEAE
FT                   GLPRPLSLVRLRNALFTDVPDGVVRTQLVAKTGWEDQVDLLDGEISDRGVVVPERLAER
FT                   AGVGPGDQLTGRSRVGDGAATVLVTGVYAEPATPLPDFWAAQSALFQPGTDPATGEPVP
FT                   APPVVLAPQDVVVATAAAAGQDLLLEWSLPLQPGAGVDDARAAADRFAALQARLADLDS
FT                   PVSRLAVVEGFDRPVLRSGLPDVLAGVDRTVELLRPPVRAVGIGGVAAALVLVGAWAAQ
FT                   RVRRRDTELRALVARGLSPARGAGHAVREALLPVLAGAALGGAAGGLLLALRGPAPGLP
FT                   AGAVPQALAVLGLGCLAALVAVGAVTAALVTRLDQLGRGPLAHALGRVPWVAVTAAVAV
FT                   VTAVPAVTGSRDGGRLDLLTLVLPVLVTVAVVGALTAVLPRLADRRIDRLPPTASLALR
FT                   RVLAGRGAARLVVVTTALSTGLVLYAGALAGSADRTLAAKAAVSTGGDVVVPLVRRTTE
FT                   PGPLPAGATLVGTERGVTLVPGEVTADLLVVEPDEVLDVLRWDRALADRPPSELLAELT
FT                   GYDGDRVPALLAGPVPDAVAASPELTATFFSYYSLPVQVVGRAAAFPGQASRAPLLVVP
FT                   WDAVGAALQAADRDPLQVFDRQVWAPGEPAPLLAALTAAGYAYDEGGVTTAGAFAAQPE
FT                   VQAQAWSLAYLRAVALAAGLLGLLGVAVHALAQQRRRTVAALLLTRMGLPRRSARAATA
FT                   LELGLLTGLGAAVAAVVALPVSALVIRLLDPAPALLPGALSVVPWSSIVAVLGGLLAVT
FT                   AGATLLASRSARTTPAGEVLRDAP"
FT   gene            172307..173428
FT                   /locus_tag="Gobs_0164"
FT   CDS_pept        172307..173428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0164"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: rha:RHA1_ro02594 lactone
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72970"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U2"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADB72970.1"
FT                   /translation="MAEVHGSCNDRFSGVREAFEQGLDGDELGASIAVDLDGETVVDLW
FT                   GGYRDLDRTTPWTEDTIVNGWSTTKTVLALAALVLVERGELDVYAPVADYWPEFAAKGK
FT                   KDVEVRHLLSHTSGVSGWERPFSIRDMYDWQTATERLAAQAPWWEPGTASGYHANNQGH
FT                   LVGEVIRRITGHTFKQFVADEIAKPLGADLQIGARKWDWDRIAPVVPPPRPAEDPRELD
FT                   PESVMVKTYTAPVASAKAANSPEWRRADLGALNGHTNARGLVRAMRVLSLGGEGLLSPG
FT                   TIDLVFDQQSDGVDLVLEAPFRFGIGFCLGSPIVPYVPEGRTFFWGGWGGSMIIMDLDR
FT                   RLTIGYLMNRMAPGILGSDRSAAYTRAVYAALG"
FT   gene            173448..174005
FT                   /locus_tag="Gobs_0165"
FT   CDS_pept        173448..174005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcv:Bcav_1465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72971"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U3"
FT                   /inference="similar to AA sequence:KEGG:Bcav_1465"
FT                   /protein_id="ADB72971.1"
FT                   /translation="MDLDDVVPDADHVTRQSRVIDAPPSVVWEELHRLQLSSLPVSLLL
FT                   GAVRALPVLLAGRGRRRGGLDRTVLDVVPIPELASDPPWHVLFGGVLQPWRLTGGKRPP
FT                   VLDAAGVREWSEPGWVKVGMEFRLTPALGGTRLSCETRIAATDPGTRRRFGLYWLAVRP
FT                   GSSAIRWELLTAVAMRAEARSG"
FT   gene            174015..174188
FT                   /locus_tag="Gobs_0166"
FT   CDS_pept        174015..174188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72972"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72972.1"
FT                   /translation="MAWIERDIPDLIARTTDAWLASHDTDSAHVSHEDVLAALDAARDE
FT                   SGTRLGRPTQER"
FT   gene            174191..175132
FT                   /locus_tag="Gobs_0167"
FT   CDS_pept        174191..175132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0167"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   stp:Strop_2970 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72973"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB72973.1"
FT                   /translation="MAWTERDIPDLTGRTAVVTGANGGLGLQTALALAGAGAHVVMAAR
FT                   DSVKTAAAEERVRVSHPSASLEVVPLDLGDLSSVAAAARAVLDRHERVDLLVNNAGVMA
FT                   MPQWTTADGFEMQFGVNHLGHWALTAHLLPALLRAPAARVVTVTSTARHRAGRLDPADV
FT                   HLERGYGAWSAYARSKMANLHFGLGLQQRFAAAGVTAASLVAHPGLTNTDLQARAVREG
FT                   GAGRVGAFFEVLTARSGMSPFEGVRPQLRAATDPRARGGELYAPRYGSHGPAVRRPILR
FT                   RRGLQEQIDVLWQVSERETGIPLDVTAADCGP"
FT   gene            complement(176155..176817)
FT                   /locus_tag="Gobs_0168"
FT   CDS_pept        complement(176155..176817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0168"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G;
FT                   Polyketide cyclase/dehydrase; KEGG: rop:ROP_32810
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72974"
FT                   /db_xref="GOA:D2S3U6"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U6"
FT                   /inference="protein motif:PFAM:PF06240"
FT                   /protein_id="ADB72974.1"
FT                   /translation="MNLDGSAVLHGSPEAVWEALTDPAVLARTIPGCLALERVGEDSYR
FT                   MDVSVGVGAVKGTYAGEVHLTDQERPKSYVMHASGAGAPGQVRATVTIELAPSEDSSTT
FT                   LTYSADAVVGGPVAGVGQRMITGVAKRMAAQFFTAVDAELTGVAAPAEPRPSAAAAVSQ
FT                   TDAEAPAAPQPQVFVGHAGVPAGTSGDLRTLALGAAGGSLLTLIGVLVGYRLGRRKG"
FT   gene            complement(176814..179228)
FT                   /locus_tag="Gobs_0169"
FT   CDS_pept        complement(176814..179228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0169"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding protein"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: nca:Noca_1491 xanthine
FT                   dehydrogenase, molybdenum binding subunit apoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72975"
FT                   /db_xref="GOA:D2S3U7"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U7"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ADB72975.1"
FT                   /translation="MTTKLFGEPVRRREDARLITGRGRYLDDIGTGALAAAFVRSPHAH
FT                   ARIVDVDVDAALDVEGLVAIYTYEDLTGPLAEPLPVLIPHPQLTAPRTGYPLANGEVNH
FT                   VGEPVVMVVATDRYVAEDAAERIAVTYEELPAVVGVDAAREARSCVHEEIPDNVAARHH
FT                   QETGDVEPALAASPHTLSFTQYVERSAGMPLEGKGVHARWDADDRSLRVHTSTQASTSV
FT                   RAAIAAKLQLPLDQVEVVAPDVGGGFGVKIVHPWPEELLVPMAAIVLGREVKWTEDRRE
FT                   HFISSAHERQQRQEVSVGFDDDGRITALDVHVWHDHGAYTPYGIIVPIITATQLVGPYV
FT                   IPVYRVVVESVYTNTVIVTPYRGAGRPQGCFAMERTMDRIADVLGLDRAVVRERNLIQP
FT                   SQFPYDHHLTFQDGRPVVYDSGDYPALLEKLKALVGWDGVDALRDDAEARGKLLGVGMA
FT                   LYVEGTGPGPYEGGHVQVLGSGKVLVSTGLTTQGQGHETSFAQIVASELGVPIEDVEVT
FT                   TGDTRRFPYAVGTFASRAAVMSGNAIALAARGVRAKALRIAADVLEADPGDLEIEDGVV
FT                   QVRGTPGASIPLRTVAVLSNPLRYAFDEAAKQATQFATHDDTKPPVAEGDAPGLEHRDY
FT                   YSPLRSTFASGAHAAVVEIDPATWEIDVVDYAVVHDCGNVVNPMIVEGQVHGGVAQGVG
FT                   GALYERMAYDRDGQLQNASFMDFLMPYASEVPDIVIDHQQTPSPLNPLGIKGAGEAGVI
FT                   PGSAALASAIEDAVGRRITSMPISPTELYDLVRDPSSERTAASGRRTGVGA"
FT   gene            complement(179225..179746)
FT                   /locus_tag="Gobs_0170"
FT   CDS_pept        complement(179225..179746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0170"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: nca:Noca_1490 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72976"
FT                   /db_xref="GOA:D2S3U8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U8"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ADB72976.1"
FT                   /translation="MTVSVDTDRTVRLTVNGVPREATVPVRRLLSDALRHDLGLTGTHV
FT                   GCEHGVCGACTVLVDGEPVRSCLVLAVQVDGASVTTVEGLAREDHQGGQVLHPVQEAFR
FT                   ECHALQCGFCTPGFLVTIAAGLEARDASEELTEEEVDDLVGGNLCRCTGYANIKKAVRN
FT                   AAATMRDGAA"
FT   gene            complement(179743..180618)
FT                   /locus_tag="Gobs_0171"
FT   CDS_pept        complement(179743..180618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0171"
FT                   /product="Carbon-monoxide dehydrogenase (acceptor)"
FT                   /EC_number="1.2.99.2"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   nca:Noca_1489 carbon-monoxide dehydrogenase (acceptor)"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72977"
FT                   /db_xref="GOA:D2S3U9"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3U9"
FT                   /inference="protein motif:PRIAM:1.2.99.2"
FT                   /protein_id="ADB72977.1"
FT                   /translation="MKPAPFRYADPRSVPEALEVLAAEEGAKVLAGGQSLLPLLSMRLA
FT                   APATLVDLNRVPGLDTVEVGGDGVRVGALVRHAGLLAHEGAARVQPLLARATANVAHPA
FT                   IRNRGTTVGSLAHADPAGEMTSVLALTGGSVTVASSSGTGTVGWRDLFVGPLETSLPGA
FT                   AVVTSAFFPALPPRSGTAFAEVARRKGDYAVCGAGVVVTLDEDRRVTAVRASYVSVGLT
FT                   PEVHDLTDAVAGSPVEKADWAAAGALARTLVDPDGDLHASADYRLLLVGVLTERTLASA
FT                   AEEATERTPA"
FT   gene            complement(180615..182087)
FT                   /locus_tag="Gobs_0172"
FT   CDS_pept        complement(180615..182087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0172"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: rop:ROP_32850
FT                   putative uracil permease"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72978"
FT                   /db_xref="GOA:D2S3V0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V0"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ADB72978.1"
FT                   /translation="MALGWKLYGDGKTPPLGEAVAPDERLSWPRTVGIGAQHVVAMFGA
FT                   TFVFPLIMGLDANLAIMMSGVATIIFLLIVKNRVPSYLGTSAAFVGGVAAIRANGGDSS
FT                   DVVGALLVAGVVLALVGLLIHVAGLSVINRVLPPAVTGAVVMLIGFNLAPVAAGVYWPQ
FT                   DQWVALATMTFVIVASLALRGFLARISILLGLVFGYLLSVLLDVTAGQITSPDGTGEVV
FT                   TRDRINFNSVAAADWFGLPDFTAPSFSLNYSLLVIPAVIALVAENVGHVKAVAEMTKRD
FT                   LDPMMGRAVMADGVATVVATSVGGSPTTTYAENIGVMAATRVYSTAAYYVAAVVAILLG
FT                   LIPKFGALINIVPGGVLGGITVVLYGMIGLLGAKIWKENRVDFANPVNLVPLAAGIIIG
FT                   IGNVTIAFNDQYQLTGIALGSIVAVLAWHVARALAPADMKAALLREGAHPAAGTTFGHV
FT                   HGDEASPDPSSVDEVGRPGVPRRSPGEGTLPR"
FT   gene            182262..183734
FT                   /locus_tag="Gobs_0173"
FT   CDS_pept        182262..183734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0173"
FT                   /product="FdrA family protein"
FT                   /note="PFAM: FdrA family protein; KEGG: nca:Noca_1485 FdrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72979"
FT                   /db_xref="GOA:D2S3V1"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V1"
FT                   /inference="protein motif:PFAM:PF06263"
FT                   /protein_id="ADB72979.1"
FT                   /translation="MTATGVRHVSLRSGVYADSVRLMQVSRDVSAREGVTAVLVAMATP
FT                   LNLELAAGMGLAPAEGASPDQLLVAVSAVDDDALAAAVAAVDAALAARERAAGPAQTVP
FT                   LRTVGAGLGALDGDGPALAVVSVPGQYAVAEAADAIAAGRSVLVFSDGVPVEHEVALKR
FT                   AAHDAGVLVMGSDCGTAIVSGLALGFANVVRRGPVGLVAASGTGAQQVSCLLDTAGVGV
FT                   SHVLGVGGRDLSEAVGGLATLDALALFDADPATERVLLVSKPPAPAVAVAVAEAAAELS
FT                   VPVHPAALSAESPDLTAAVEALLRDMGVAVPEWPSRPAALGAAPGAVLKGLFAGGTLAD
FT                   EAMLIAAPVLGDVRSNTPLRPELDLGTDLVARGHVVVDFGDDALTVGRAHPMIDPTLRL
FT                   EALARIAASGEPAVVLMDVVLGHGADPDPVASLVPALRAAGLPAVVALVGTEADPQGWS
FT                   RQADALAAAGAAVFASNAQATRHALDLLGAAR"
FT   gene            183731..185131
FT                   /locus_tag="Gobs_0174"
FT   CDS_pept        183731..185131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0174"
FT                   /product="protein of unknown function DUF1116"
FT                   /note="PFAM: protein of unknown function DUF1116; KEGG:
FT                   nca:Noca_1484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72980"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V2"
FT                   /inference="protein motif:PFAM:PF06545"
FT                   /protein_id="ADB72980.1"
FT                   /translation="MRDLLFGTPTVVAAGVDVFSDALRAQGADVHDVDWRPPGLGDPAD
FT                   LATLALDRRRAAANRTAVERVMAAGSRLVDVRPARDVLGLPDRTLLHAGPPIGWDDASG
FT                   PLRGALIGACLFEGWASTVEEAERLLASGGIALDPCHHHRAVGPMAGVTSPSMWTWCLE
FT                   DPVTGGRAFCNLNEGLGKVLRMGAYNDEVLARLRWMRDVLGPVLQAAVRSMADPLDVKA
FT                   VLAQMLQMGDEGHNRNRAGSLMTLRELSPAVVEVDAPSSDIAAVLRFIGGNEHFFLNLG
FT                   MPTAKLALDAARDVPGSTMVTVMSRNGTEFGIQTAGTGDRWFTGPANTPVGLFLGDYGP
FT                   DDANPDIGDSAIMETYGVGGFTMAAAPAIVRFVGGTVPDALATTERMYQLTLAENPAMQ
FT                   VPILGFRGSPTGIDVLAVARTGWLPQINTGMAGRVAGTGQVGAGLVQPPRECFEQALAA
FT                   LAAEARVA"
FT   gene            complement(185219..185971)
FT                   /locus_tag="Gobs_0175"
FT   CDS_pept        complement(185219..185971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_1144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72981"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V3"
FT                   /inference="similar to AA sequence:KEGG:Mflv_1144"
FT                   /protein_id="ADB72981.1"
FT                   /translation="MTIGRRTSSPVHQDRTADAAERARTVATRPLASVQALGLGTSRLL
FT                   AAATLDAGRVLVVVPRSGGLAAAVREAPEGDLPAKVTVTSRSVQPLRNPLRAQLELAGW
FT                   LTPVPTEDEADLVLAFAAVRPDDVLLDVGLTATLLRLDLAEVLLHEGGGCTEITPEDYA
FT                   AARPDPLGAAEDELMSEHTGPLAELRARVQAWAGDDPVHLLGLDRHGVLFRVEPRTGCY
FT                   DLRVPFPAPLTSTGELPGAVRTLLSCAR"
FT   gene            186034..186636
FT                   /locus_tag="Gobs_0176"
FT   CDS_pept        186034..186636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0176"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: saq:Sare_4818 30S ribosomal protein S4;
FT                   TIGRFAM: ribosomal protein S4; PFAM: RNA-binding S4 domain
FT                   protein; ribosomal protein S4; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72982"
FT                   /db_xref="GOA:D2S3V4"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V4"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADB72982.1"
FT                   /translation="MNTPRPKVRISRALGIPLTPKAVEYFERRPYPPGEHGRKRRKDSD
FT                   YSTRLREKQRLRAQYDISETQLRAAFDRARRTGGKTGEALIQDLESRLDATVLRAGFAR
FT                   TVYQARQFVTHQHVLVNGKRVDRPSYRLKPGDFVQIAEKSRTKEPFVVAASGAHATPPA
FT                   YLEVCLADLVARVERVPDRDEVPVVCEEQLVVEHYSR"
FT   gene            186725..187258
FT                   /locus_tag="Gobs_0177"
FT   CDS_pept        186725..187258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0177"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   sco:SCO3953 RNA 2'-phosphotransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72983"
FT                   /db_xref="GOA:D2S3V5"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V5"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ADB72983.1"
FT                   /translation="MDPRDVVRRSKRLSYVLRHAPGSVGLTLDAAGWADVDALLAALGW
FT                   TRAELERVVATNDKRRFALDGTGTRIRASQGHSVAVDLGYAAQTPPPVLFHGTAERNVP
FT                   AIEAGGLRPGRRHAVHLSPDEVTARRVGARHGRPVVLRVDAAGMAAVGAVFTRSANGVW
FT                   LVDAVPPAFLTVVG"
FT   gene            187268..187600
FT                   /locus_tag="Gobs_0178"
FT   CDS_pept        187268..187600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72984"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB72984.1"
FT                   /translation="MPRGRASRGRAGRGLPGVPRPAHRDPRRPLAEDPELVAHARTAYE
FT                   HIAVALDGRGRRQWPGDPFAAVLTAQAAATVLVSASTTWQPDHDPTAFLDLVERRFVLV
FT                   RLTLGR"
FT   gene            187597..187884
FT                   /locus_tag="Gobs_0179"
FT   CDS_pept        187597..187884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0179"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: mva:Mvan_2982 stress responsive alpha-beta
FT                   barrel domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72985"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V7"
FT                   /inference="protein motif:PFAM:PF07876"
FT                   /protein_id="ADB72985.1"
FT                   /translation="MIRNVVVGRVRPGTDLAQVQEALDAIVALPVEGLLDVRVGLDAGL
FT                   RPGAWSFAITSDFVDADAYRVYDAEAEHNRIRREQFDPVCEEIARVQFEV"
FT   gene            complement(187891..189135)
FT                   /locus_tag="Gobs_0180"
FT   CDS_pept        complement(187891..189135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0180"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: bbt:BBta_6635
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72986"
FT                   /db_xref="GOA:D2S3V8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADB72986.1"
FT                   /translation="MRWSSAQETTLPGPGVVPAGRPTASRARRRLEREGGAEHAAQRAG
FT                   VLAQASREVSDTSRQAAESLAELRSAIGDISQSTTHASTVAEEAVRDAQSVDERIAALQ
FT                   GATGAITEIVRLLSAISQQSRFLALNAYVEAARAGEVGRGFAVVADEVKQLAERTARAA
FT                   GDIGAQVEAVHRETRAAVDVVSRITTTLGSIAAAQDTVAAAVAQQRAATDRVVESVERA
FT                   AGGSARITEAVAALADDQREAYVRRALAVAEDLLEEAGGVALGDGRRRLTVRDQVTGAT
FT                   RAVELPDLLLGGVPLTRDDDPRRPAPLVDDVVALVGGSCTLFQRLDGDGSMVRAATTVV
FT                   TAQGRRNVGSYIPRRNADGSANPVLTAVLARRTYTGVATVADRPYFTAYEGLHAADGEL
FT                   VGMLYVGMPLDALPG"
FT   gene            complement(189309..190412)
FT                   /locus_tag="Gobs_0181"
FT   CDS_pept        complement(189309..190412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0181"
FT                   /product="ring-opening amidohydrolase"
FT                   /EC_number="3.5.2.1"
FT                   /note="KEGG: rer:RER_58820 barbiturase; TIGRFAM:
FT                   ring-opening amidohydrolase; PFAM: Amidohydrolase
FT                   ring-opening AtzD/TrzD"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72987"
FT                   /db_xref="GOA:D2S3V9"
FT                   /db_xref="InterPro:IPR014086"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3V9"
FT                   /inference="protein motif:TFAM:TIGR02714"
FT                   /protein_id="ADB72987.1"
FT                   /translation="MPAPIEVRKVPLHNVSDASELAKLIDDGVMEADRVVAVIGKTEGN
FT                   GGVNDYTRIIADRAFREVLLEKGTRSKEEVGEIPIVWSGGTDGVISPHATVFATLPEDA
FT                   VEKTDEPRLTVGYAMSDVLLPEDIGRIAMVEKVADGVRRAMAEAGITDPADVHYVQTKT
FT                   PLLTIETIRDAKARGEETYYDEPHGSMDLSNGTTALGIAVALGEIDMPEQGQVMRDLSL
FT                   FSAVASCSSGVELDRAQIVVVGNARGHGGAYRIGHSVMRDALDQDGIWNAIRDAGLDLP
FT                   ERPHPSDLGDRLVNVFLKCEADPTGYVRGRRNAMLDDSDVFWHRQIKATVGGVAASVTG
FT                   DPAVFVSVAAVHQGPSGGGPVAAIVKA"
FT   gene            complement(190417..191442)
FT                   /locus_tag="Gobs_0182"
FT   CDS_pept        complement(190417..191442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0182"
FT                   /product="aspartate/glutamate/uridylate kinase"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   nca:Noca_1504 carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72988"
FT                   /db_xref="GOA:D2S3W0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W0"
FT                   /inference="protein motif:PFAM:PF00696"
FT                   /protein_id="ADB72988.1"
FT                   /translation="MTPGRVVIALGGNAMTGPDGSATPRAQRDAIAAACRHVAAVVATG
FT                   VQVVLTHGNGPQVGNLLVKNELAAHEVPPVPLDWCVAQTQATIGFTLADELDAALSARG
FT                   LPQRTAVLVTRTLVDADDPHFREPSKPVGRYLPRERAERSMAHGQVWEDRGERGWRRVV
FT                   ASPEPRRVLDVPAVEALLAAGFVVVCAGGGGVPVVDDGTGGALHGVEAVVDKDLTAALL
FT                   ARELDAGTLVIATDVPQVLVGYGRPGARPLGRVTPRELREHAAAGEFGRGSMGPKVEAA
FT                   LRFVAGGGARAVITSLEHIADAVTGDDAGTVLQKDPPALHPSRARGGTLQEGRPIPTEE
FT                   E"
FT   gene            complement(191484..192326)
FT                   /locus_tag="Gobs_0183"
FT   CDS_pept        complement(191484..192326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0183"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /note="TIGRFAM: histidinol phosphate phosphatase HisJ
FT                   family; PFAM: PHP domain protein; KEGG: dhd:Dhaf_2109
FT                   histidinol phosphate phosphatase HisJ family"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72989"
FT                   /db_xref="GOA:D2S3W1"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W1"
FT                   /inference="protein motif:TFAM:TIGR01856"
FT                   /protein_id="ADB72989.1"
FT                   /translation="MEEDNPHTMRPPDNHVHTRWSWDTADSSTMVRACERAVARGLPAI
FT                   AFTEHLDFTTWTPEDRATADGLVDRHASRHLPIDVEGYFAELEECRGRFPELRIWSGVE
FT                   TGEPHLFAASVAAHLRDSPVDRVLGSLHSLSQDGRLYGIGRLLYPDPDTTMRRYLAEVV
FT                   DMVENSDVFQVLAHVDFPRRYWPGGSDRYAEKDYEEEYRAVFRALAGTGRALEVNTTSP
FT                   LASVDQVRWFHEEGGEAISFGSDAHQPAGVGQHFDLAVDVVEAAGFRPGRDAFDFWRR"
FT   gene            192384..194609
FT                   /locus_tag="Gobs_0184"
FT   CDS_pept        192384..194609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0184"
FT                   /product="ATP-dependent DNA helicase, RecQ family"
FT                   /note="KEGG: mlu:Mlut_03530 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   PFAM: helicase domain protein; DEAD/DEAH box helicase
FT                   domain protein; SMART: helicase domain protein; DEAD-like
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72990"
FT                   /db_xref="GOA:D2S3W2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W2"
FT                   /inference="protein motif:TFAM:TIGR00614"
FT                   /protein_id="ADB72990.1"
FT                   /translation="MSTAAPTTDLALEALGVLRELTGRPDAEFREGQDAAVAALVERAE
FT                   RALVVQRTGWGKSAVYFVSTALLRRRGAGPTLLVSPLLALMRDQVAAAARAGIRAVEIS
FT                   SANATEWDDVAAALAADDVDVLLVSPERLTNPRFREEQLPDLVARCGLLVVDEAHCVSD
FT                   WGHDFRPDYRRIRDLLGTLPAGTPVLATTATANERVVADVAEQLGAGGVGVTTVRGPLA
FT                   RDSLRLGVLRLPTDRARLAWLAAHLGDLPGSGIVYTLTVAAAEETAALLRDAGHEVRAY
FT                   TGRLDDADRKDAEEALRENRVKALVATSALGMGFDKPDLGFVVHLGAPSSPVSYYQQVG
FT                   RAGRAVEHADVLLLPGPEDLAIWQWFATSSMPREDHAAAVLSAMADGKAWSVARLETVA
FT                   DVRRSRLELLLKVLAVDGAVERVQGGWRSTGRPWVYDADRYARVTRTREAEQRAMIAYA
FT                   KPVDEARCRMAFLQEALDDPTAAPCGRCDVCAGPWYSSDVPEGAAQAASAALDRPGVEL
FT                   APRAQWPTGADRLGVEVKGRIAPGEQLDPGRAVARLTDLGWGQRLRTLLGDDGVGGTVT
FT                   LDLEAPGIEEDPDAAFDVPVQRSVSDVPPDEELLRACARVLGAWDWAERPAAVVAVPSR
FT                   RRPQLVTGLAQGLAGLGRLPYLGELSLAHGGPTGQPGGNSAFRLAGVWQRMVVGPELRE
FT                   RLAQLGPVPVLLVDDLADSRWTMTVAGRELRLAGASRVLPFALALTA"
FT   gene            194772..195395
FT                   /locus_tag="Gobs_0185"
FT   CDS_pept        194772..195395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO7302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72991"
FT                   /db_xref="GOA:D2S3W3"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032854"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W3"
FT                   /inference="similar to AA sequence:KEGG:SCO7302"
FT                   /protein_id="ADB72991.1"
FT                   /translation="MSLAHQPSMWDLAEEATLGPLAVTRHRLGRGAWVDHLPGWVQGSD
FT                   EVLEVLLGDIGWRADRRQMYEREVAVPRLLRWYGGDETLPHPLLTQARETLTGHYRPEL
FT                   GEPFVSAGMCLYRDGRDSVAWHGDRLGRGRSADTMVAIVSFGSPRPLLLRPLGGGESLR
FT                   FPLGHGDLVVMGGSCQRTWEHCIPKTTKPVGPRVSVQFRPRGVA"
FT   gene            196075..197585
FT                   /locus_tag="Gobs_R0004"
FT   rRNA            196075..197585
FT                   /locus_tag="Gobs_R0004"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            198126..201264
FT                   /locus_tag="Gobs_R0005"
FT   rRNA            198126..201264
FT                   /locus_tag="Gobs_R0005"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            201399..201514
FT                   /locus_tag="Gobs_R0006"
FT   rRNA            201399..201514
FT                   /locus_tag="Gobs_R0006"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(201674..202375)
FT                   /locus_tag="Gobs_0186"
FT   CDS_pept        complement(201674..202375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_66400 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72992"
FT                   /db_xref="GOA:D2S3W4"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W4"
FT                   /inference="similar to AA sequence:KEGG:ROP_66400"
FT                   /protein_id="ADB72992.1"
FT                   /translation="MNRVLAAARLQLVHPMAILGVPWMVGALSFAINWAVWRIVDIRSL
FT                   QGEDGFTGGVLALYITVLIVFVQAVTQLMPFAMGISLSRRSYFLGTCLVGVGMALGFGT
FT                   LLAVLDAVEAATGGWGVGLQFWTPPPVDVDGFLPQVAVSGAPMLALIAAGVGMGVVTKR
FT                   WGPSAVWGLIIGGLVVLGGAAVLVTWMRAWTDVGRWLIDQSVMTLAVGLPLALAAALGL
FT                   LAFAGIRRVVP"
FT   gene            complement(202372..203298)
FT                   /locus_tag="Gobs_0187"
FT   CDS_pept        complement(202372..203298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0187"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rop:ROP_66410 putative ABC transporter ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72993"
FT                   /db_xref="GOA:D2S3W5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB72993.1"
FT                   /translation="MTPPTTAAATVRDVTMRFRGHTALDGVSTVIERDSITGLVGRNGA
FT                   GKTTLMQLLTGHRVPTSGSVEVLGGAPYENDGVLSRICFVKEGQRYPDHFRVRDALDAA
FT                   ALVYPDWNAGLAAELLRDFDLPAKRSVKKLSRGMTSAVGIVIGLASRAPITLFDEPYLG
FT                   LDAVARQLFYDRLLADYAEHPRTVVLSTHLIEEIAALLERVLLIDRGRVLLDADAESLR
FT                   GSAVTVTGPSDRVAAFAGRHELLHTESLAGQSRSVVRLTGGSAGGDAADAGLAWEPVTL
FT                   QQLVVAMSLRTSRPESSTSTDLEEVSR"
FT   gene            complement(203295..203657)
FT                   /locus_tag="Gobs_0188"
FT   CDS_pept        complement(203295..203657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0188"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: nfa:nfa3720 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72994"
FT                   /db_xref="GOA:D2S3W6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W6"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADB72994.1"
FT                   /translation="MNEDAGPIFRQVAADIENAIVDGSLVEETQAPSTNELAAFHRINP
FT                   ATAAKGLNQLVADGVLYKRRGVGMFVATGAREQLLKRRRSEFADQYVSPLMAEARKLGI
FT                   PVHELTAMIGNWEEQR"
FT   gene            203832..204134
FT                   /locus_tag="Gobs_0189"
FT   CDS_pept        203832..204134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0189"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: msm:MSMEG_3627 urease subunit gamma; TIGRFAM:
FT                   urease, gamma subunit; PFAM: Urease gamma subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72995"
FT                   /db_xref="GOA:D2S3W7"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W7"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ADB72995.1"
FT                   /translation="MHLSPHEQERLLLSYAAELARRRRARGLRLNLPEATAIVTDHVLE
FT                   GARDGVLVAELMQSGRTVLTRDDVMDGVPALLEEVQVEATFPDGTKLVTVHHPIP"
FT   gene            204182..204565
FT                   /locus_tag="Gobs_0190"
FT   CDS_pept        204182..204565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0190"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: rop:ROP_57390 urease beta subunit; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72996"
FT                   /db_xref="GOA:D2S3W8"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W8"
FT                   /inference="protein motif:TFAM:TIGR00192"
FT                   /protein_id="ADB72996.1"
FT                   /translation="MVPGEVIPAEGVVETLPGAPRVEVEVTNAGDRPVQVGSHFHFPQA
FT                   NRALEFDRGAAHGHRLDIAAGTAVRFEPGITRTVTLVPLAGARVVPGLTTARGAPQRGT
FT                   SDERTGARSPASGQGLTAGGGLG"
FT   gene            204565..206286
FT                   /locus_tag="Gobs_0191"
FT   CDS_pept        204565..206286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0191"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: rha:RHA1_ro05680 urease subunit alpha;
FT                   TIGRFAM: urease, alpha subunit; PFAM: amidohydrolase;
FT                   Urease alpha-subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72997"
FT                   /db_xref="GOA:D2S3W9"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3W9"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ADB72997.1"
FT                   /translation="MVLLSRERYAQLYGPTVGDRVRLADTDLLIEVEEDRCGGPGRAGE
FT                   EAVFGGGKVIRESMGQGRATRAEGAPDLVITGAVVLDHWGVVKADVGIRDGRIVALGKA
FT                   GNPDTMDGVHPGLVIGPGTEVLAGNGRILTAGGIDCHVHFICPQIVPTALGSGVTTLIG
FT                   GGTGPAEGSKATTITPGDWYLARMLEAMDPWPVNVALLGKGNTVSQESMEEQLRGGASG
FT                   FKLHEDWGSTPAAIDACLTVAGRNGVPVALHSDTLNEAGFIEDTLAAIAGRSIHAYHTE
FT                   GAGGGHAPDIITVAGHPNVLPSSTNPTRPHTVNTLDEHLDMLMVCHHLDSSVPEDLAFA
FT                   ESRIRPTTIAAEDLLHDVGAISMIGSDAQAMGRVGEVVLRTWQTAHVMKRKRGSLAGDG
FT                   AADNLRARRYVAKYTICPAVAHGIDGEVGSVEPGKLADLVLWDPRFFGVRPHAVLKGGV
FT                   IAWAQMGDANASIPTPQPQLPRPMFGAYGRVPARTALHFVAPAAVEAGLADRLGVDRRL
FT                   VAVTDTTRLAKADMPENTALPDIRVDPDTFTVRVDGEVWEPEPVRELPMAQRYFLF"
FT   gene            206286..207059
FT                   /locus_tag="Gobs_0192"
FT   CDS_pept        206286..207059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0192"
FT                   /product="urease accessory protein UreF"
FT                   /note="KEGG: mva:Mvan_3081 urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72998"
FT                   /db_xref="GOA:D2S3X0"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X0"
FT                   /inference="similar to AA sequence:KEGG:Mvan_3081"
FT                   /protein_id="ADB72998.1"
FT                   /translation="MTAALLTLADSRLPAGGHTHSGGVEQAVAAGVVHDPGSLTTFLLR
FT                   RLHTAGVVAAGLAAAATTVSSSGRHRGQVPSPAAESAAPVPGLRVVGRTGSSCSSRETA
FT                   APASSSLVAALLDLDAEADARTPSPALRAASRQQGRGLVRVGRRAWPSPVWDALPDRPH
FT                   HPVAMGVAGTAAGLAPSDAAAAAAYLSISGPATAAQRLLAMDPLTVAAVTARLARAVDA
FT                   VAVAAVEAGLPADADPLLDLLAEVHAARKDRFFAS"
FT   gene            207078..207755
FT                   /locus_tag="Gobs_0193"
FT   CDS_pept        207078..207755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0193"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: msm:MSMEG_3623
FT                   urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADB72999"
FT                   /db_xref="GOA:D2S3X1"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X1"
FT                   /inference="protein motif:TFAM:TIGR00101"
FT                   /protein_id="ADB72999.1"
FT                   /translation="MPPDHNLDDYVDPHEHGHRSGGPLRVGLGGPVGSGKTALAAALCR
FT                   TLGGEYDLAVVTNDIYTTEDADFLRRNAVLPDDRIEAVQTGCCPHTAIRDDITANLDAV
FT                   ELLEWRHPGLELVLVESGGDNLTASFSYGLVDVQVFVVDVAGGDKVPRKGGPGVTAADL
FT                   LVVNKTDLAALVGADLGVMRRDADAVRGGKPTLLVSLREDPSAAAVADWVREQVRARAL
FT                   QEA"
FT   gene            207752..208471
FT                   /locus_tag="Gobs_0194"
FT   CDS_pept        207752..208471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0194"
FT                   /product="putative urease accessory protein"
FT                   /note="KEGG: mva:Mvan_3079 putative urease accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73000"
FT                   /db_xref="GOA:D2S3X2"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X2"
FT                   /inference="similar to AA sequence:KEGG:Mvan_3079"
FT                   /protein_id="ADB73000.1"
FT                   /translation="MRTLVEVVACRGPGGRTVLPVVRGGGQYAVRRTGPATVHLVATAF
FT                   GPLGGDDARIRLVVEEGARLRVRSVAAAVALPSRSIAEPSVQRVHATVAGELDLAPEPT
FT                   VVAARARHVAELEAELGPAAVLTSAEQVLLGRRGEEPGRWTGTTRVLREGRPLLHTTVD
FT                   LGPGAPAWLPPVAPRAYASTVHLDAGAHPPQQPVATGEDAVRLPLPGGWTATAWGAELH
FT                   RVTGALAALTAPGQETA"
FT   gene            208567..209718
FT                   /locus_tag="Gobs_0195"
FT   CDS_pept        208567..209718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0195"
FT                   /product="allantoicase"
FT                   /EC_number="3.5.3.4"
FT                   /note="KEGG: rop:ROP_44360 allantoicase; TIGRFAM:
FT                   allantoicase; PFAM: Allantoicase region"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73001"
FT                   /db_xref="GOA:D2S3X3"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X3"
FT                   /inference="protein motif:TFAM:TIGR02961"
FT                   /protein_id="ADB73001.1"
FT                   /translation="MSDPTRLPDLASRALGGAVLAANDEFFAAKENLVLPHPPQALPGF
FT                   GHRGKEYDGWETRRRRSPGSDWAIVRLGVPGVVAAVVVDTAHFTGNHPAQASLEGASVE
FT                   GHPTVAELERADWQPLVPLSDLAGDSANTFPVDSTRRVTHVRLTISPDGGVARLRVHGT
FT                   AVPDPRLVDAGPFDLAALENGGRVTGVSDEFYGRPVQLVSPGLARSMGEGWETRRRRGE
FT                   GNDWVQLTLACEGVVTLAELDTSWFLGNAPGSASLTGSGPDGEVVVLPRTRLQSDTRHR
FT                   FVLEGGPAVDRVRLDVLPDGGMARLRLWGRPTAAGREALGRRWFDALPDVQALEVLQSA
FT                   GVAPAEAGRLVGARPLGADLPPAVARLVLGPGNGTVQDAGGRR"
FT   gene            209750..210025
FT                   /locus_tag="Gobs_0196"
FT   CDS_pept        209750..210025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0196"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_08950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73002"
FT                   /db_xref="InterPro:IPR025637"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X4"
FT                   /inference="similar to AA sequence:KEGG:RER_08950"
FT                   /protein_id="ADB73002.1"
FT                   /translation="MLAAVPVLAIGLTACSSSIGQDELETQVAGTLESRFGVAAGVSCP
FT                   GDLDAEVDATTECTATEIDTGEEVVLRITVTSVEDGAAEFDIAPVD"
FT   gene            210071..211444
FT                   /locus_tag="Gobs_0197"
FT   CDS_pept        210071..211444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0197"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   fra:Francci3_0845 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73003"
FT                   /db_xref="GOA:D2S3X5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X5"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADB73003.1"
FT                   /translation="MRTPADLLVHDAELLATVDDGRREIPGGWVAVTDGVVTGVGGPGD
FT                   PAPAAVRRVDARGCLVTPGLVNTHHHLYQNLTRAFAPALTGGLFEWLVTLYPLWARLDE
FT                   EAAFVSAYVGLTELALSGCTTSTDHLYVHPRGGGDLISAEVAAARELGVRFSPTRGSMS
FT                   LSVEDGGLPPASVVQDDDDILADSKRLVDAHHDRSPHAMTRIALAPCSPFSVSPALMRR
FT                   TAELAEDLDVRLHTHLCETRDEDAFCLATFGRRPVDHLADVGWLSDRVWLAHVVWPSAD
FT                   EVARLGAARVGAAHCPSSNMVLGSGLAPVAELRAAGAPVGLGVDGSSSADSASLWLEAR
FT                   TAMLQGKLRHGAGAMSARDALEMATRGGAACLGRTGEIGELSVGACGDLAVWSLEGPAF
FT                   AGALSDPVEAWLRCGPVAARHTVVAGRSVVEDGVPVHPGLDEQLAVHRRVSAWIQAAV"
FT   gene            complement(211554..212684)
FT                   /locus_tag="Gobs_0198"
FT   CDS_pept        complement(211554..212684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0198"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   msm:MSMEG_6246 pyridoxal-phosphate-dependent transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73004"
FT                   /db_xref="GOA:D2S3X6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027563"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X6"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADB73004.1"
FT                   /translation="MTALGSTLAHEDLGAVWRSARPRPAGRHLDTAACSRQSHRVLEAV
FT                   AHHARHEAELGGYVAEATAEDLLQQGRSVIGGLVGMAAADVVFVESAQAALAALLAGWR
FT                   LPPGARVACLPGEYAPNAAQLRAAELTVEALPVDDLGRADLDGVARLLATDPPHAVHLT
FT                   HVASHRGTVQPAAEVAALCREAGVPLVLDAAQSLGHVDTDLGADVVYSTSRKWLAGPRG
FT                   VGVLCVRPAVAAELTPLLTAPDDVPPLRAFESGEAHVAGRVGLVLAVGEHLAAGPLRVR
FT                   ERLAALGRAGREVLDGAAGWRVVEPHDEPTATTTLRPPDGVDVVTTRARLLAEQGIVTT
FT                   AIGTQRAPGEMTGPVLRVSPHLDATLDDLEALAAAL"
FT   gene            complement(212708..213508)
FT                   /locus_tag="Gobs_0199"
FT   CDS_pept        complement(212708..213508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0199"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="KEGG: ach:Achl_0375 putative transmembrane anti-
FT                   sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73005"
FT                   /db_xref="GOA:D2S3X7"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X7"
FT                   /inference="similar to AA sequence:KEGG:Achl_0375"
FT                   /protein_id="ADB73005.1"
FT                   /translation="MRHCTPEQLSLAALREPLPADDTAHLESCAQCREELASLRRGVDL
FT                   LAVPQLAAPGAAVLPPPSVWAGIAAATGVTTAPRAEALAAAAPPPPAAAPPAPPAAAPP
FT                   APPAAAPEPAPAAVVPLRTRRSRLLLAAAASLVVGVGIGAGAVALGTGDDGLAVAAAAL
FT                   DPLGDSDASGEARVVERDDGSRALELTLDAVPLDEGYYEVWLLDEAVARLVPVGVVQGG
FT                   SDATLELPPGLDLGEYPVVDVSVEPLDGDPSHSGESVVRGVLES"
FT   gene            complement(213489..214130)
FT                   /locus_tag="Gobs_0200"
FT   CDS_pept        complement(213489..214130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0200"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   kra:Krad_3107 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73006"
FT                   /db_xref="GOA:D2S3X8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X8"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADB73006.1"
FT                   /translation="MTGLLEQGTARVGRVASDVEPLRDPDPEPDDAEVGRRFAAGDEQA
FT                   LAWAYERFAGQIHGMAVRAFGPGPDAEDVTQQVFVSAWTGRAGYRPEQGPLPAWLVGVC
FT                   RHKIADTWARRDRQRRAAEAAITEARSAPQTTGPQVDTAVADRVLLLGELEQLGQPQRG
FT                   IIELAFFEDLTHTQIADRTGLPLGTVKSHIRRTLERLRSRLEVDGAALHA"
FT   gene            complement(214127..214345)
FT                   /locus_tag="Gobs_0201"
FT   CDS_pept        complement(214127..214345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73007"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3X9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73007.1"
FT                   /translation="MTCSRTASGLAAAATRRRVASHEVVDEEAFPLDRPSAHPGPPRPV
FT                   PVPRDGPFLPGVGGFQGDVVAVAEPVR"
FT   gene            complement(214590..215558)
FT                   /locus_tag="Gobs_0202"
FT   CDS_pept        complement(214590..215558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0202"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function DUF2260; KEGG: msm:MSMEG_6247 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73008"
FT                   /db_xref="GOA:D2S3Y0"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032888"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y0"
FT                   /inference="protein motif:TFAM:TIGR03438"
FT                   /protein_id="ADB73008.1"
FT                   /translation="MSISLTSHLAPEDAAAALRADALAGLTASPKTLPPRWFYDERGSE
FT                   LFDEITRLPEYYPTRAERAVLAAHAGAIAAASDADVLVELGSGTSEKTRLLLDALRDAG
FT                   TLRRFVPCDVDPSVLQAAGAAITAEYPGVAVDAVVGDFTRHLGELPRSGRRLVAFLGST
FT                   IGNLEPAARAAFLTDLAGTLQPGDSFLLGTDLVKDPARLVRAYDDAAGVTAEFNRNVLR
FT                   VLDRELGADFDPAAFEHVAAWDAEHEWIEMRLRSLTDQVVRVPALDLDVRFAAGEEMRT
FT                   EVSAKFRRERVEAELAAAGLRMTQWWTDPDGDFGVSLSVPA"
FT   gene            complement(215567..216256)
FT                   /locus_tag="Gobs_0203"
FT   CDS_pept        complement(215567..216256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0203"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mjl:Mjls_5248 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73009"
FT                   /db_xref="GOA:D2S3Y1"
FT                   /db_xref="InterPro:IPR017808"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR032889"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y1"
FT                   /inference="similar to AA sequence:KEGG:Mjls_5248"
FT                   /protein_id="ADB73009.1"
FT                   /translation="MCRHLAWLGRPRTLSALVTEPPSSLLVQSYAPRRQRYGTVNADGW
FT                   GVGFFTPGRVQPARWRSARPLWGDPSFASVAPVVSSGCVVAAVRSATVGMPLEESAAAP
FT                   FTDGRWLLSHNGRVDRAVLPPVRDAESTVDSALLAALVFDRGLDALGATVREVGAADPG
FT                   ARLNLLAADGTRLLATTWGDTLSALVTPDGTALASEPWDDDPRWADVPDHSLVEVTPDG
FT                   LTLTPLP"
FT   gene            complement(216259..217587)
FT                   /locus_tag="Gobs_0204"
FT   CDS_pept        complement(216259..217587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0204"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   msm:MSMEG_6249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73010"
FT                   /db_xref="GOA:D2S3Y2"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR032890"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y2"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADB73010.1"
FT                   /translation="MTDLTETLARDLEAARQRTLRLTDHDEPELLRQHTPLLSPLVWDL
FT                   AHIGQQEDLWLLRRGDARREGLLPADVEALYDAFTHPRAVRSRLPLLPPVEARSFCGEV
FT                   RGRVLDRLGRLGRDDDGDPFDFAMVVSHEQQHDETMLQALDLRSGPPLLGAGTPLPPGR
FT                   SGVAGTSVLVPGGEFVLGVDAADEPFSLDNERPAHVVDVPSFRIGRVPVTNAEYAGFVA
FT                   DGGYGDRRWWSERGWAHRVEAGLERPQSWSADGTRTRTRFGVVETVPGDEPVQHVTYFE
FT                   AEAYAAWAGATGAAPAGARLPTEVEWEKAAVWDPATRRRRRFPWGSAEPSSALANLGGD
FT                   ALRPAPVGAYPAGASAYGVEQLMGDVWEWTSSDFTPWPGFRPMLYADYSAPFFGGDYKV
FT                   LRGGSWAVGASILRPGFRNWDHPIRRQVFSGFRLAWSVDGTAA"
FT   gene            complement(217584..218840)
FT                   /locus_tag="Gobs_0205"
FT   CDS_pept        complement(217584..218840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0205"
FT                   /product="glutamate/cysteine ligase family protein"
FT                   /note="TIGRFAM: glutamate/cysteine ligase family protein;
FT                   PFAM: glutamate--cysteine ligase GCS2; KEGG: msm:MSMEG_6250
FT                   glutamate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73011"
FT                   /db_xref="GOA:D2S3Y3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017809"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y3"
FT                   /inference="protein motif:TFAM:TIGR03444"
FT                   /protein_id="ADB73011.1"
FT                   /translation="MAPITEERTAALDLDAAAAHVAGAALRAGPVGSVGLELEAHLVDL
FT                   AAPATRVPWQRITGIVDALPALPGGSRVTLEPGGQVELSGPPYPDVAAAVAALRADRDV
FT                   LAAALVAERLAVAPVGADPLRPPARVCPAPRYAAMEEHFAAVGCAEAGTAMMAGTAALQ
FT                   VNLDAGPCAGWSERVSLAHQLGPTLVAVAACSPLAGGRPTGWVSQRQRVWSDLDQARCG
FT                   PLLGGADPAGEWAAYALAAPVMLVSDPDGGGAAPVRERVRFADWVTGAVPLGGRAPTAA
FT                   DLDYHLTTLFPPVRPRGYLEIRYLDAAPEPWWPALAAVTAVLLDDPVAAGHAAAATAPV
FT                   AGAWDRAARVGLADPALHTAARTCLAAACAAVPVALRPEVEALADLVDRGRCPGDALLD
FT                   TARAGGPTAALLSATEASS"
FT   gene            219002..219544
FT                   /locus_tag="Gobs_0206"
FT   CDS_pept        219002..219544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0206"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   sgr:SGR_879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73012"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y4"
FT                   /inference="protein motif:PFAM:PF03745"
FT                   /protein_id="ADB73012.1"
FT                   /translation="MDVDRDRDPAGRARNARPRDALGRPLPRGAVGEERAPEGVLRTPD
FT                   RALTEAQQLLDAGRPFHAHEVLEDAWKSSPEEERQLWRGLAQLAVGLTHVARGNDRGAA
FT                   SLLERGAGNVAAYADAPPHGVDVAGLVAWARELAASPPASRDAAALAPRLRAARPSTWS
FT                   SAHNRPGPADPRHPGLG"
FT   gene            219610..220395
FT                   /locus_tag="Gobs_0207"
FT   CDS_pept        219610..220395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_1741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73013"
FT                   /db_xref="GOA:D2S3Y5"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y5"
FT                   /inference="similar to AA sequence:KEGG:Rxyl_1741"
FT                   /protein_id="ADB73013.1"
FT                   /translation="MTDGRRADAVRAGAVLAAAVAQIAGSPLGTALAGRSVGEVSDATR
FT                   ALITPAGYAFSIWGPIFAGALAWAVYQALPAQRGRAVHRRTGWPLAAAFAGNAVWELVF
FT                   PLVGDRVPVLPAVLLFAIVAAAATAWARLQAMPLTGLPRLLPAAVTGLLLGWVTLASAV
FT                   QVASAGVALGAPAQGAAAQVWAVVALAAVATLGTALVRVAQVAAGPFALAVVWGLLAVA
FT                   VDGGPGVVTAAAVAAAVVVTGTLAVRVAGRRGRGALLVG"
FT   gene            220476..220631
FT                   /locus_tag="Gobs_0208"
FT   CDS_pept        220476..220631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73014"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73014.1"
FT                   /translation="MSAAPAVDRVREARAALGADGADPWGDSPRGGGPGIVVADTYLQT
FT                   TAVRAG"
FT   gene            220643..221083
FT                   /locus_tag="Gobs_0209"
FT   CDS_pept        220643..221083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0209"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   jan:Jann_2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73015"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y7"
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /protein_id="ADB73015.1"
FT                   /translation="MRSYEAAARIDASPEQVWALLVDVGSWRDWDSGVDRVDGRVALGE
FT                   KLTLYATMIRNRPFTVTVTEIRPREVMRWRGGLPLGLAVIERTYSLDDQEDGSTVLTVR
FT                   EDHSGPLAGLLARSTPDLNPSFRHFCEGLKARAEGRASRPTG"
FT   gene            complement(221087..221593)
FT                   /locus_tag="Gobs_0210"
FT   CDS_pept        complement(221087..221593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_6567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73016"
FT                   /db_xref="GOA:D2S3Y8"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73016.1"
FT                   /translation="MTAGTDTYRRELVQALRAGNVAPERIGEIVAEVESHVADTGEDPR
FT                   EAFGPAREYAAGFRRPRSRWSAAARPVPTLLGALCGFLVANGVVGLVDDEPALGMPAWI
FT                   VLTAGAVLWIPSLVAVLRLSVPVPDPRTGRSITPAPGPVATAVGMGGTLVAVAVACWGL
FT                   AVLTS"
FT   gene            complement(221590..221934)
FT                   /locus_tag="Gobs_0211"
FT   CDS_pept        complement(221590..221934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0211"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: kra:Krad_2816 PadR-like family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73017"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Y9"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADB73017.1"
FT                   /translation="MPLEPWPAEWLRATLPLTVLAVVAEEETYGYAIAQRLQAAGLGAV
FT                   KGGTLYPVLNRLEQDRLVTSSWREGAGGPGRKFFTVTPHGRAHLAERAAAWHTFTERAA
FT                   GLLPSVGSPR"
FT   gene            222044..223546
FT                   /locus_tag="Gobs_0212"
FT   CDS_pept        222044..223546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0212"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: nca:Noca_0113 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73018"
FT                   /db_xref="GOA:D2S3Z0"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z0"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ADB73018.1"
FT                   /translation="MSTDTAATPSTDDTSLGEPTTPPRGPVTSASYSITVRLTADGDPA
FT                   SIGRIATAVGSAGGAVTAIDVVDSRSDGLTVDVTCSAADAAHSEEMVDALRAVPGVRVR
FT                   KVSDRTFLLHLGGKLEVASRVPLKTRDDLSMAYTPGVARVCLALADNPDDVRRLTIKGN
FT                   TVAVVTDGSAVLGLGDIGPGAAMPVMEGKAVLFKRFADIDAWPICLDTQDVDEIVRTVE
FT                   LIAPGFGGINLEDIAAPRCFEIEARLREKLDIPVFHDDQHGTAIVALAAMRNALRVVDK
FT                   QLEDVKIVVAGGGAAGTAIVHLMLKAGARHVLVWDREGILSPDDERLSPAKLDLAQRTN
FT                   PECVRGELPDALDGADVFIGVSAANVLPVEALARMAPKAVVFPMANPTPEVDPVRARQH
FT                   AAVVASGRSDLPNQINNVLAFPGMFRGLLDARAREISDGMLLAAAEAIASVVKDDQLNA
FT                   NYIIPSVFDPAVTQAVAAAVADQARQEPGATAPVTEDGDLVG"
FT   gene            complement(223564..223800)
FT                   /locus_tag="Gobs_0213"
FT   CDS_pept        complement(223564..223800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73019"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73019.1"
FT                   /translation="MDGTAVGRMPPQERSRDMTENQQGRPPVDETRPSAPEQDRGGGPS
FT                   VPTDSSGVGMGLGEADTFEPEESAPAGEDTDQP"
FT   gene            223881..224735
FT                   /locus_tag="Gobs_0214"
FT   CDS_pept        223881..224735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0214"
FT                   /product="DNA-formamidopyrimidine glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycosylase catalytic
FT                   domain protein; DNA glycosylase/AP lyase, H2TH DNA-
FT                   binding; KEGG: sma:SAV_7289 formamidopyrimidine-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73020"
FT                   /db_xref="GOA:D2S3Z2"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z2"
FT                   /inference="protein motif:PRIAM:3.2.2.23"
FT                   /protein_id="ADB73020.1"
FT                   /translation="MPELPEVEALTAFLREHAVGSVVTRVDLAAVQAIKTFDPPLSALG
FT                   GLELTGVARHGKFLDLDVSGLHLVVHLARAGWLHWRTGLPTAPPKPGKGPLAVRVHLED
FT                   GDGFDLTEQGTRKGLAVYVVRSPAEVPGIARLGPDALAVDRDTFVALLAGRSGQLKGAL
FT                   TDQTLLAGIGNAYSDEILHAARLSPFKMADKLSDDEALRLYDAMRATLTEALQRQVGQE
FT                   AATMKGEKRSGLQVHARTGLPCPVCGDTVREVSFADTSLQYCPTCQTGGKPLADRRMSK
FT                   LLR"
FT   gene            complement(224892..226121)
FT                   /locus_tag="Gobs_0215"
FT   CDS_pept        complement(224892..226121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0215"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rop:ROP_50980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73021"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB73021.1"
FT                   /translation="MLEVVPSSAARRTALALTATLAGPVAWVARAAWGLPTALGAGQRE
FT                   VQASAAGSPQFAEGRFHNRLSTPARPPANAQRGLLRQMHEERHTGLPARPIPLVRPELP
FT                   AEAAELAVTWFGHSSALLEVDGRRVLVDPVWGERVSPSPLVGPTRLHPAPLPLEDLPQV
FT                   DAVLVSHDHYDHLDLPTVRALLRSQSAPFVVPLGLGAHLRGWGVPEERVVELDWDGAVD
FT                   VAGLTLTCTEARHFSGRFLTRDTTLWASWVVAGPRHRVFFGGDTGYTPAFAQIGALQGP
FT                   FDLTLLPIGAYNDAWALIHMTPEEAVRAHGDLGGGLLVPVHWATFNLAFHRWAEPVQRL
FT                   CAAAERSEARVAVPRPGQRVDVLAPPPLTDWWSPVGSLADEPAETGDGGAGSSVVARAA
FT                   SWLTARRMAD"
FT   gene            226126..226347
FT                   /pseudo
FT                   /locus_tag="Gobs_0216"
FT   gene            complement(226352..227665)
FT                   /locus_tag="Gobs_0217"
FT   CDS_pept        complement(226352..227665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0217"
FT                   /product="Rieske (2Fe-2S) iron-sulphur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   fal:FRAAL1456 putative oxidoreductase, Rieske [2Fe-2S]
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73022"
FT                   /db_xref="GOA:D2S3Z4"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z4"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADB73022.1"
FT                   /translation="MGTSARTMTGWYPVARAAEVGMEPLPVGAGGRAYVLVRLSPGAEV
FT                   SAFPARCPHRLVPLSAATVVDGRLTCPYHGWQYDGEGRCLSIPSLGPDGTAPPRADLPV
FT                   PWAVEERHGWVWLAPERTAVAPPRPAGDTGAELVPPPPAPDGPVLGNLDPALETAWHPV
FT                   ALSGELRPGGWLQVRLLGRTWTLRRTDRLEVDPPAYGVRERLGVVWLAPAEPRDVPLEV
FT                   PEDRDRRFVTGWLPPQRSAGTAGVLADVLLDVAHMPFLHGGSTSAADHPEVAAHDVAPE
FT                   PGGFRSAHEQWFDAVTDPGVATGERPLRQRRRATSVYRAPFQLLMRLESLDSGAVTTVQ
FT                   HLLQPEDADSTRIYTRLLLSSGPGNPLPAPADVEREVASAQRVLAEDLALVAHVAGQGL
FT                   PLAGRDELHVRADRMGVALRRALCDFVLSAPRVTRRAA"
FT   gene            227861..228262
FT                   /locus_tag="Gobs_0218"
FT   CDS_pept        227861..228262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0218"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   bcv:Bcav_3374 protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73023"
FT                   /db_xref="GOA:D2S3Z5"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z5"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ADB73023.1"
FT                   /translation="MTPPAERRLLTPEEYREAQASPEFVELKRRFRRFAFPMTVAFLAW
FT                   YLLYVLLSTYAPDFMATLVFGNVNLGILLGLGQFVSTFVITHVYVAHANKRTDPISDDM
FT                   RGRLEHHEYARPGGVGVTRNADETRGGQH"
FT   gene            228262..229920
FT                   /locus_tag="Gobs_0219"
FT   CDS_pept        228262..229920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0219"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: kra:Krad_3659 SSS family
FT                   solute/sodium (Na+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73024"
FT                   /db_xref="GOA:D2S3Z6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z6"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ADB73024.1"
FT                   /translation="MLFAAPAAPATTTVGNPAVNISIFGAFVLVTLAITFKASRNNKSA
FT                   ADYYAAGRNISGTQNGLAIAGDYLSAASFLGIAGAIAIYGYDGFLYSVGFLVAWLVALL
FT                   LVAELMRNTARYTMADVLAFRMRQRPVRTAAATSTLVVSLFYLLAQMAGAGALVTLLLG
FT                   VTGELAQAVVVILVGALMMVYVLVGGMRGTTYVQIIKATLLIAGAAVMTVWVLGKYGFN
FT                   LSALLGGAVETSATQATPRDVLSPGGQYGATSISKLDFISLALALVFGTAGLPHVLMRF
FT                   YTVPTAKDARRSVVWAIWLIGIFYLFSLVIGYGAGALVGADTILAAPGAVNAAAPLLAF
FT                   ELGGTILLGVIAGVAFATILAVVAGLTITASASFAHDIYASVIKKGQGNPEAEVKVARI
FT                   AAVVIGAISIGLGILALQAGLNIAFLVALAFAIAASANLPTIIYTLFWQRFTTQGALWS
FT                   IYGGLIACVTLILFSPVVSGAPVNPATGKSPSLIQNVDFSWFPLNNPGLVSIPLSFFLG
FT                   WLGTKLSKEQPDELKNAELEVRALTGIGAEKAVAH"
FT   gene            complement(230263..230484)
FT                   /locus_tag="Gobs_0220"
FT   CDS_pept        complement(230263..230484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73025"
FT                   /db_xref="GOA:D2S3Z7"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73025.1"
FT                   /translation="MHLSVPAVLLTVVYAAALAVAVSAPGQHLVAGLVVLTGLVTRWAV
FT                   RHRRVHVAVPAPVAPADTVLAPGPAPAA"
FT   gene            complement(230587..231447)
FT                   /locus_tag="Gobs_0221"
FT   CDS_pept        complement(230587..231447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0221"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: manganese containing catalase; KEGG:
FT                   mes:Meso_1876 manganese containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73026"
FT                   /db_xref="GOA:D2S3Z8"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z8"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADB73026.1"
FT                   /translation="MFTHTHALQYEAKPDGPDPDFARKMQEILGGQWGEMTVATQYLLQ
FT                   GWNCRLPGKYKDMLLAIGTEELAHVEMIVTMIDRLLDHAPLKPDSADRTKEAAAGYGQH
FT                   NPQHLIVNGQGASYIDAMGNPWTGAYVTASGNLMADFMYNATAEMQGRLQVARLYNMTD
FT                   DPGVKDMLRFLITRDHMHQQQWLAATEELKSDGIEGIPVPEAFPLEEEVGDLGYTFVDA
FT                   SDGPEASAGRWASGPSVDGRSEFRARPIEATADAPILPPGDPRLFSTPQMPGQSLLQKA
FT                   KDMLK"
FT   gene            complement(231677..232426)
FT                   /locus_tag="Gobs_0222"
FT   CDS_pept        complement(231677..232426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0222"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: mva:Mvan_0011 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73027"
FT                   /db_xref="GOA:D2S3Z9"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2S3Z9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB73027.1"
FT                   /translation="MTLAANPPTSLEPGRVLPAALRRLLRRRAPERPDTPDLPAPPEAL
FT                   VQALCHDMCSPLASLEALLGALGRPAEPSAGPAPDPEEVLELARAQTAQLASMLRTAAA
FT                   TGGAAPLGRGTRRLGDVVRASMAASGLSAAQLTLELGPGAEDVAVADARVQRILTNLLE
FT                   NAHRHGAGAAVRLSVRCRPGWVDLALTQAVVRPEQLLGHLRTEAPPVDLTGLGLWSVRR
FT                   QTGELGGRIVADDDGESLRLTVQLPDR"
FT   gene            232462..233175
FT                   /locus_tag="Gobs_0223"
FT   CDS_pept        232462..233175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0223"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: mva:Mvan_0010 two component
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73028"
FT                   /db_xref="GOA:D2S400"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D2S400"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB73028.1"
FT                   /translation="MQLSVWGKMEQSDAGAERRRPVDVVLVDDHPLFSRGLALLLPGVS
FT                   EGQVRVVATTDDASAAAAMVRRHHADVAVVDLHMPPPGGTRAIAAIRRADPTVRVVALS
FT                   GQAEEDAVLEALRAGAAAYLPKTADPELLVRPLLAVLDGWSVIPEDLLRRLLEDSAPSG
FT                   EQGLADRLTADERRLWRLVADGTSTVEIATTLHVSERTAKRLVAALLRTLGVATRVEAA
FT                   ALAGRVHLGGNGRQG"
FT   gene            complement(233302..234768)
FT                   /locus_tag="Gobs_0224"
FT   CDS_pept        complement(233302..234768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0224"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: tfu:Tfu_1948
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73029"
FT                   /db_xref="GOA:D2S401"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:D2S401"
FT                   /inference="protein motif:PFAM:PF03703"
FT                   /protein_id="ADB73029.1"
FT                   /translation="MIDAGTQPRRTSPRVVLVHTATFRQARQLVPVLIPVAAVVGLDDG
FT                   LLTVVVMAVVITALSLAGAVLSWWRFGYADGPTAVVVTRGLLARSVRTVPNDRIRGVEV
FT                   EAPPLHRLLGLVRVRIDAAAGSVGTNEEELVVDGVPRAEGDRLRTRLLARRPTGAPAPD
FT                   GDQPPEAPVEEELSRFRPRWLLYAPLVGSYLVVPLAAVGTLFRLVQELPDAVVPDLAGP
FT                   EPSPHLVVAGLVAAVPLLALAAVVGAAVVNWGYRLVRRGGSLVAVRGLLTRRHTELEVD
FT                   RIRGGTLSEGLGMRWVRAARVNALVTGLGQANRRGQLLPLGPRAEALRLLGRLVEDPGP
FT                   LTGHPPAALRRRLVRALAAGLLVTAAGTWAAVALGWWWVPVAGVVLTVLGVPMGIGRFR
FT                   ALGHGAGPRSFSVRSGWLVREQAVLQRRAVVGWQVRQSVFQRRAGLATVVACVGAGSGG
FT                   YAAVDMAAAEVAGFTAAASSGTWAGTLAPR"
FT   gene            complement(234765..235310)
FT                   /locus_tag="Gobs_0225"
FT   CDS_pept        complement(234765..235310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0225"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: rer:RER_41850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73030"
FT                   /db_xref="GOA:D2S402"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:D2S402"
FT                   /inference="protein motif:PFAM:PF03703"
FT                   /protein_id="ADB73030.1"
FT                   /translation="MITAGLADRMGAMTADAPAPVRDPAWSLSRSAIGLWVTEGVIGAL
FT                   FWVVVVTAVFVFVPDGGLPSPLRWALVAFAVLEAAVTIGIRPWIRYRVHRWEVTGEAVY
FT                   TLTGWLTRTWTLVPISRIQTVDVTRGVLQQLFGLATVAVLTASSQGTVRVLHLEADVAQ
FT                   RVADDLARRAELVRDEAT"
FT   gene            235417..235758
FT                   /locus_tag="Gobs_0226"
FT   CDS_pept        235417..235758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0226"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: kra:Krad_0166 rhodanese
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73031"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D2S403"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADB73031.1"
FT                   /translation="MGRVMPQQVPTVPASEVPEDAVVLDVREDDEWVAGHIDGATHIPM
FT                   GEVPARLDDLPEADPLYITCRGGGRSARVAAWLNANGYDAVNVGGGMGEWEAAGRPMVS
FT                   ETGQQPFVR"
FT   gene            complement(235978..237150)
FT                   /locus_tag="Gobs_0227"
FT   CDS_pept        complement(235978..237150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0227"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   mva:Mvan_4861 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73032"
FT                   /db_xref="GOA:D2S404"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D2S404"
FT                   /inference="protein motif:PFAM:PF01270"
FT                   /protein_id="ADB73032.1"
FT                   /translation="MSPRGITVGALGVLALLVVVLAAVVGTRGGGTTGAPLPSPTGPST
FT                   VAPAPPAELRTYTAAEAGRAFLDGYVDEDGQVVRPDQGGDTVSEGQAYAMLVAVGLGDA
FT                   KTFARAWNWTRENLQRPDGLLSWRWEEGGVVDASSASDADLDAARALVLAGEQFGRPEY
FT                   TAAGLDLGRAVLDLETVPTAAGRILTAGQWATTEPYAYNPSYASPGATAVLAAASGDPR
FT                   WTELAEGSRAVTAALLSQAPLPPDWAQVRADGTVEAMPGAMGRGQSVRYGYDATRTPIR
FT                   FAESCDPADRALAAAVVEPLDRGGDSAELDLGGSPVAPGESVVAAAGQAAAVAAAGDAG
FT                   RAVEELVDADHLAQSAPSYYGAAWAALGRFMLTDDVLGGCPPVPATSGTA"
FT   gene            237573..238130
FT                   /locus_tag="Gobs_0228"
FT   CDS_pept        237573..238130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0228"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: pfo:Pfl01_1381
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73033"
FT                   /db_xref="GOA:D2S405"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D2S405"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADB73033.1"
FT                   /translation="MLLQALWRAQIARFALVGLAMTALHLLVFRLVLPWSVPEAANVIA
FT                   FLTATQVNFALSYFWTWSARRPVGQETIRSVLRRALLFNGSAALGFGVNAVVFSAAHRV
FT                   AGLGPTASALTATVVSAAASFLLSSRVVFARREVLTAADLVNPSGPGPVSPLVTPPSAE
FT                   WERVSASSTTSPSVSPWKVSQR"
FT   gene            238127..238858
FT                   /locus_tag="Gobs_0229"
FT   CDS_pept        238127..238858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0229"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   gbm:Gbem_1049 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73034"
FT                   /db_xref="GOA:D2S406"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR035518"
FT                   /db_xref="UniProtKB/TrEMBL:D2S406"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73034.1"
FT                   /translation="MSQRNPDLDIVVPVYNEEARLGATLRALTAHTATLPLSVAITVVD
FT                   NGSVDRTAEVVDEVAERRPDNTVLRLIGCARQGKGAAVRRGLLASTARWRGFCDADLST
FT                   PPQVLTDVIGHLERGAPVVIGSRRAPGASYAVPQPLVRRLGSSTFRMLTRPLVGDVADT
FT                   QCGFKFFSGEAAEQVFRRVTANGFAFDVEVLAVANRLGLPVVEVPVRWTDQAGSSFHVW
FT                   THGKRVVSEVVAVRAALARMS"
FT   gene            238855..240354
FT                   /locus_tag="Gobs_0230"
FT   CDS_pept        238855..240354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0230"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   fre:Franean1_5300 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73035"
FT                   /db_xref="GOA:D2S407"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S407"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73035.1"
FT                   /translation="MRWAVPPSSVVVLNWRDRRHPAAGGAELYCERLARELARRGRSVV
FT                   LVTSRPAGTAARESLDGYSVRRLGSWWSVYPLALLWLLRHRRSVGAVIDSQNGVPFFSP
FT                   LVLGPRTPVVLLVHHVHQDLFTRALHPLAARLARWLEGPASRRVYRRRTVVVLSPSART
FT                   QVRRRLRFDGAVRVVPTGADTLGLRGERSAAPRMVVVGRLTAYKRLDSLVDAMAEVQRW
FT                   LPDAELHLVGKGPARRDLEQRARAAGARVVFHGRLPDVERDELLSTAWLTVSASDGGDW
FT                   AVSLVEANAAGVPALARRVSGLRDTVRHGQTGWLVDGSEDGLAEAITRALVTLADPVVA
FT                   GTVSERARAWADRFTWARTADGVLQALDTERARLERQLHGHRERRTGNDLVVVLSVAQS
FT                   ALPEGWESLRRTNDVWVSDGTTVRALLTGADEGDVEVILARLGIRRDGPSVSVLVARHA
FT                   DLLGGRSLLDEPVVDLVEGVERAAASLEDQRPGGRGGRHAA"
FT   gene            240344..241633
FT                   /locus_tag="Gobs_0231"
FT   CDS_pept        240344..241633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0231"
FT                   /product="glycoside hydrolase family 8"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   ank:AnaeK_1847 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73036"
FT                   /db_xref="GOA:D2S408"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D2S408"
FT                   /inference="protein motif:PFAM:PF01270"
FT                   /protein_id="ADB73036.1"
FT                   /translation="MRRDLLIVRDGDARLRPGAARRAQRRRRRTAVVAVVAAAVSVVGG
FT                   IRLADDVQRAAAVVAADQPMVASDKTVLTDLWRDYRQTHLEPGTGRTLVLQDGAVTTSQ
FT                   GQGDTMLRAVWMDDQETFAQSWQWTKDNLQRDDALLASRFGERPDGSYGIQAELGGEDP
FT                   VSGADVDVAFALLMAYSRWQEDDHLYDALPLIEAVWERSVVRVDGGPVLVASDSERDDA
FT                   GQVLVTPASFAPYAFRVFARVDPQHDWPALVDNSYALLAQLADEPLDADRTAGLPPDRV
FT                   SLDRRTGEFSAVGGDVTTQSGRDALRLSWRLALDHAWYGDERALRLLEGQSVLADSWTD
FT                   QGRLVAAYDRDGTPAVDRESPAVYGGAMGYFDTVRPDLADEVYADELLPLYDADSGDMA
FT                   EQLSNDDANWVWFGMALHLDELPNLNVTEE"
FT   gene            241641..243275
FT                   /locus_tag="Gobs_0232"
FT   CDS_pept        241641..243275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0232"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   reu:Reut_C6029 cellulose synthase (UDP- forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73037"
FT                   /db_xref="GOA:D2S409"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S409"
FT                   /inference="protein motif:PRIAM:2.4.1.12"
FT                   /protein_id="ADB73037.1"
FT                   /translation="MSLAPGRSATARPDTTGFLRYVPNRGFLVANVVLAVAYTLVISFA
FT                   FEHGNWFLFAALLATELFHLVQIVGYCWTVWGRDTARTFDPDFNAPVDVFITVCGEPVD
FT                   VVRETARAAQAMRYPTPFRVYLLNDGLVAGKDDWREIEELADELGVTCITRVTPGGAKA
FT                   GNINHALSRTDSPFFVVFDADHVPHADFLAEVMGYFVTDDMGFVQTPQFYANQLRNRIT
FT                   RVAWDQQTLFFGPIMAGKSRLDSAFMCGTNMAVRRSAIADAGGMCEFNIAEDFLTSLFM
FT                   HERGWKSVYVPKVLAEGLAPDDFLNYYKQQFRWTRGSLEVIFKYNPLLRQGLSTAQKLQ
FT                   YLLSASYYLSGSVILLDALLPIVFLLTGETPIVTSTMTLALVFVPYMWINLYVLQRTSN
FT                   FTYSYQAIAFSLSAWWLQITALVAVLANRKTSFAVTSKTASDGARPNFLRLVVPQLVYA
FT                   VVAAVALAIGAAREGASPSLMANVAWLTVHLAIAVPFIMAASPSRASRSASFVPASLPS
FT                   RPAAAAEDRATAPPTPSVEPALQPAHD"
FT   gene            243294..244883
FT                   /locus_tag="Gobs_0233"
FT   CDS_pept        243294..244883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0233"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: seg:SG1482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73038"
FT                   /db_xref="GOA:D2S410"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D2S410"
FT                   /inference="protein motif:COG:COG5305"
FT                   /protein_id="ADB73038.1"
FT                   /translation="MSTDLLSAPPSPAVGPRARHRAHQGSRLVVPRRSGDPVVVGLVHL
FT                   LCLGLVVLGARAEFLRNSIRLDEAQSLWQTNHSYGELLRIIAEDVHVPLYHVLLRTWRL
FT                   VLGPDVETARLLSLVFLLAAVPVFYAVARKVLSTPWALFALVLFSCSPFLQWYGNEARM
FT                   YSMLVLVTLVSQYFFLTLVATDRTTAWAGYAAAAVVGVYTHYFFAFVLVAQGVYVLLMW
FT                   RRLPRTTIVKMAGVAGLVGAAYLPWFLYFRSQGSASETRPNLPEPSSVDYSNVYSQFLF
FT                   GFQSDTINTVLVSTWPLLVLAALASVRVGVRLDRATAYLVVAAFVPVLLAFVVSHLVTP
FT                   FFLSRYMIAALPALLLVVVRFSSSLTRPVARVLAAVLLAVTVLGTVVQAANPETPVDED
FT                   YRTAAQLVAGGATPQDVVVLSSSFTVYPFEYYYDGDARVATLPLWDREGSAPAFDPAQL
FT                   PEQVESLTEGHRYVYLLLSYDQGYEEDVFQHFQRNFEQTAVHEPSPGLRLLVYRVGYSE
FT                   LLPAGELDGVGD"
FT   gene            complement(244887..246155)
FT                   /locus_tag="Gobs_0234"
FT   CDS_pept        complement(244887..246155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0234"
FT                   /product="1, 4-beta cellobiohydrolase"
FT                   /note="PFAM: 1, 4-beta cellobiohydrolase; KEGG:
FT                   fre:Franean1_1657 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73039"
FT                   /db_xref="GOA:D2S411"
FT                   /db_xref="InterPro:IPR001524"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:D2S411"
FT                   /inference="protein motif:PFAM:PF01341"
FT                   /protein_id="ADB73039.1"
FT                   /translation="MKESVHYFTCMPVVTTAPPSTSGRHRPGRGRRLLWTSGLAAALVG
FT                   TGLVTPLLTGPEATPAAQPAIEQVRKVRPAPTTTAPAPAPAIASPTTSAPAPSSTTTAA
FT                   PSTPASAAPTSSSAAGAPSTTTPAAPTSTAAPAPSTANPLAGMTFHGPNTGAALAAAQP
FT                   GRSPEDAAALAQLAGVPTATWLGAWSGDVTAAVRQEVTAARAAGAVPVLVTYNVPGRDC
FT                   GGYSAGGVDSSAEYLRWVQAVAAGIGTAQAVVVVEPDALALLCGDPAQRLSLLRSAVEV
FT                   LEANAGTHTYLDAGHSTWIDAATMAERLRAAGVTAADGFALNVSNFQTTASNVAYGHQV
FT                   SSLLGGAHFVVDTSRNGNGPGSDWCNPPGRALGERPTAQTGQPRVDAFLWVKRPGESDG
FT                   TCNGGPAPGTFWDAYAIGLVRGY"
FT   gene            complement(246254..247870)
FT                   /locus_tag="Gobs_0235"
FT   CDS_pept        complement(246254..247870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0235"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mva:Mvan_0905 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73040"
FT                   /db_xref="GOA:D2S412"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2S412"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB73040.1"
FT                   /translation="MRGLMQDYSLTIDAIFRHVEQHYGDGTIATAGPGGVTRATYAEWA
FT                   ERTRRLGGVLDTLGISADGRVGTFGWNSQRHLELYFAAPSSGRVLHTLNVRLFPEQLTY
FT                   IANHAEDEAVFVDRTVLPLLWPLVDTMKTVRHVVVMDDGGDNEIPDDPRVLDYEALLAD
FT                   AQPVEFGVTDENSAAYMCYTSGTTGNPKGVVYSHRSTFLHTMGVMAPNAFGLGIRDVAM
FT                   PVVPMFHANAWGIAQAAPAAGASLVMPGSMMQPEALANLIVEEGVTFTAGVPTIWQGVL
FT                   PHLAGRPHKLRDIGCGGSAVPRALSEAYREQVGLPILQAWGMTETHPVASSGVLPRRYA
FT                   DADAETQADQRSRAGLPFLGVEARIVDAETLEPQPWDDKATGELQVRGPWCAQDYYNPD
FT                   AGVELTTPDGWMRTGDVAAMDPFGSIRIADRTKDLIKSGGEWISSVDLENAIMSHPKVR
FT                   EAAVVGVPHPKWDERPLACVVLRDGETATEEEILEHLKPQVAKWWLPDAVEFIDEVPKT
FT                   SVGKFSKKDLRTRFAGFLAKG"
FT   gene            complement(247932..249140)
FT                   /locus_tag="Gobs_0236"
FT   CDS_pept        complement(247932..249140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0236"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: sen:SACE_0125 putative
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73041"
FT                   /db_xref="GOA:D2S413"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D2S413"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADB73041.1"
FT                   /translation="MTPAAAPIDLTDPTVVADPYPAFARARSQAPVQWHEGLGLWLAFT
FT                   HAESNAVLRDRRLGRIWRDREPAERFRSFNLVHRNALLEMEPPDHTRLRRLVSAAFARG
FT                   HVERLRPWVQQLAAELVDGLVERSGGTEPADVLSGMADELPVAVIAELLGVPQADRPLL
FT                   RPWSNAIVKMYEYGRTAAVEDAAERAADRFVTYLRGLAAERRRTPGDDLLSHLVTVRDT
FT                   EGDRLTEDELVTTCVLLLNAGHEATVNVSGNGLLALLEHPDQLARLRADPGLLPTAVEE
FT                   LMRFDSPLQLFERTATADVDLGGTTVRQGQKVAALLGAANRDPAVFADPDSLDVGRTDN
FT                   PHTTFGAGVHFCIGAPLARVELQASFGALLERTSRLELGGEPVRRPEFVIRGLAELPVV
FT                   LAR"
FT   gene            249336..250271
FT                   /locus_tag="Gobs_0237"
FT   CDS_pept        249336..250271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0237"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   sen:SACE_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73042"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:D2S414"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADB73042.1"
FT                   /translation="MARSATRKRPAAPATGNDVNPKAPCPCGSGRRYKHCHGSGYAPPV
FT                   ARPFEGLPGEPHWVALRELVPAATAPLRTADGRDVTLASVLPGGAPALVRANGEILLGV
FT                   QLQGGSDDVSRDLGTALAAALEAPAGAPVDPGPLGGAGSAGPRLQELVDLGAPLEVTVH
FT                   EDFGFWLEGVEAGAAAQAGLEQANAAILPTELLPGLGAAYWVRPGAERAHLRWVRPEPE
FT                   ERLLDALARLRASGEILLGEGTRYAGAFRAHGLLVPVWDLPAETPAADWTDAATAFQAR
FT                   LEQALETTDPLTADERRARAGLLSRQVTLR"
FT   gene            250589..251743
FT                   /locus_tag="Gobs_0238"
FT   CDS_pept        250589..251743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0238"
FT                   /product="putative sugar ABC transporter"
FT                   /note="KEGG: bcv:Bcav_2998 putative sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73043"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2S415"
FT                   /inference="similar to AA sequence:KEGG:Bcav_2998"
FT                   /protein_id="ADB73043.1"
FT                   /translation="MSKRLGFAALSAGMALTLAACGGEGAGGSGGAGGEGAAAEDLAIG
FT                   VSMPTQTSERWIADGNNVKEQLEGEGYTVDLQYANDDIPTQSQQIDQMITEGADILVVA
FT                   AIDGTALSGQLENAAANNIPVVSYDRLIRDTENVDFYVTFDNFAVGQAQGNALLQGLGL
FT                   RNEDGSPGTATGPFNIELFAGSLDDNNAFFFFNGAMDVLQPLIDDGTLVVKSGQTNIEQ
FT                   AAILRWQQETAQRRMEDLLTSAYNDGSRVDGVLSPYDGLSRGIITALQNAGYGPTLDAA
FT                   NPMAVVTGQDAEIASVKLIQDGVQSSTIFKDTRLLAEQAVAAASAFAEGGEPQANDTET
FT                   YDNGVKVVPSYLLPVETVFADDIQSVLIDSGYWTADEVASGQSD"
FT   gene            251913..253451
FT                   /locus_tag="Gobs_0239"
FT   CDS_pept        251913..253451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0239"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: kra:Krad_2945 ABC transporter-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73044"
FT                   /db_xref="GOA:D2S416"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S416"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB73044.1"
FT                   /translation="MDDHILEMRGITKTFPGVKALEDVNLAVRRGEIHAICGENGAGKS
FT                   TLMKVLSGVYPAGSYEGEIVFDGQPVRFSGIRDSEHVGIVIIHQELALVPYLSIAENMF
FT                   LGNERRGRGGLIDWNKANAEAARLLAEVGLDENPVTPVGQLGVGKQQLVEIAKALSKDV
FT                   RLLILDEPTAALNDNDSAHLLDLMRRLRERGITSIMISHKLGEITAVSDNVTVIRDGKT
FT                   VETLNLHAGEVTQERIIRGMVGRDLESYYPERESHPGEEVLRVEDWTVWHPTQERKVVD
FT                   GANFTVRAGEVVGIAGLMGAGRTELAMSIFGRAYGRNITGRLFVHGKEVKPRNVSEAID
FT                   AGIAYATEDRKHYGLNLIQDIRRNISAAALDKLASKGFVNGNEEIKVAEGYRKSMNVKA
FT                   PSVASVVGKLSGGNQQKVVLSKWLYTDPEVLILDEPTRGIDVGAKYEIYTIINRLVAAG
FT                   KAVLVISSELPELLGICDRIYTLSAGRITGEVPVGQATQENLMELMTKEKELAA"
FT   gene            253448..254710
FT                   /locus_tag="Gobs_0240"
FT   CDS_pept        253448..254710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0240"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   kra:Krad_2944 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73045"
FT                   /db_xref="GOA:D2S417"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D2S417"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADB73045.1"
FT                   /translation="MTRTVPPSEPEAQTATAPKDVAPAVALHTGTSNVRALLTSNLRQS
FT                   GIYIAFVAIIALFTVLTDGTLLSPGNVTNIVLQYSYILILAIGMVIVIIAGHIDLSVGS
FT                   VVALTGAVSAVLVIQQGMPWWVGVLAALATGVAIGAWQGFWVAYVGIPAFIVTLAGMLL
FT                   FRGLTLQVLDNISLSPFPQGYGRIASGFLNGLLGGNGYDAFTLLIGGIAVAGYAVSQYR
FT                   SRIARIRYDQPVESFPLFVAKIALVGAVVMYFAWQLAHARGLPIVLIILAVLVITYSVI
FT                   TTRTVFGRQVYAIGGNLAAATLSGVKVRAVNFWIFVNMGLLAGIAGVVFSSRSNGAQPG
FT                   AGNMFELDAIAAAFIGGAAVTGGVGTVVGAMVGGLIMAVMSNGMQLMGVDQSIQSVVKG
FT                   LVLLLAVAFDVYNKRRAGTSR"
FT   gene            254806..255852
FT                   /locus_tag="Gobs_0241"
FT   CDS_pept        254806..255852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0241"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: art:Arth_0219 LacI family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73046"
FT                   /db_xref="GOA:D2S418"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2S418"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADB73046.1"
FT                   /translation="MGPEGASRALVMSDVAARAGVSHQTVSRVINGHRNVAPGTRERVE
FT                   QAIRELGYRPNTAARALVTGSTRTLGFVTVNINQYGPGQTLVGLERAARAAGYSLSVTV
FT                   LDEATADAMRDAVDRFVAQSVDAVLALATYDDAAEALHAVDTPLPLVTVQSGGALEEPA
FT                   VGVDQVAGARLATRHLLDLGHRTVHHVTGPADSQESRDRVEGWRAELVAAGAAVPVCVH
FT                   GDWTPSSGHRAGRLLATRRREGEEVTAVFVANDQMAMGLLAAFHEEGLEAPRDVSVVGF
FT                   DDLPEAPYLTPPLTTVRQDFAELGHRAVQLVLARLAGRELRLQPVPPVLLVRSSSGPVP
FT                   VVSMPAGV"
FT   gene            256106..257701
FT                   /locus_tag="Gobs_0242"
FT   CDS_pept        256106..257701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0242"
FT                   /product="Carbohydrate kinase, FGGY-like protein"
FT                   /note="PFAM: Carbohydrate kinase, FGGY-like; KEGG:
FT                   cpy:Cphy_1145 carbohydrate kinase FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73047"
FT                   /db_xref="GOA:D2S419"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2S419"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ADB73047.1"
FT                   /translation="MTTDAGEAITGGRTALGIELGSTRIKAVLIGPDHAPLAVGSHDWE
FT                   NQFVERRWTYSLEAVWSGVQQSFAALTDDVRQRHGVELAGVGALGVSAMMHGYLAFDVD
FT                   GELLTPFRTWRNTNTGRSAERLSAEFGVNIPHRWSVAHLYQAVLDREEHVGRLDHLTTL
FT                   AGYVHRQLTGEKVLGIGDASGMFPIDVGTGGYSAPMLARFDQLAAEAGAELTLADLLPR
FT                   IAPAGQPAGQLTEAGAQLLDPTGRLRPGIPLCPPEGDAGTGMVATNSVAPRTGNVSAGT
FT                   SIFAMVVLERELTRAHRELDLVTTPAGDPVAMVHCNNGASELNAWAGLFTEFARAMGAE
FT                   VDPSKVFETLFTAALDGASDCGGMLAYNYLSGEPITDLEEGRPLFVRSPDSRFDLATFM
FT                   RTHLFASLATLRIGMDVLQKTEGVRLDRMFAHGGLFRTKGVAQRFLAAAIDTPVSVGDV
FT                   AAEGGAWGIAVLAAFATGRSPGQDLADYLDTAVFTGTGLQTAAPEPADVAGFDAFVQRY
FT                   VAGLTVERAAVTCV"
FT   gene            257801..258481
FT                   /locus_tag="Gobs_0243"
FT   CDS_pept        257801..258481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0243"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: nca:Noca_0381 L-ribulose-5-phosphate 4- epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73048"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D2S420"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADB73048.1"
FT                   /translation="MTATQPRTERGTHRAQREHVAALHAELTRNGLVTWTSGNVSERVP
FT                   GEDLFVIKGSGVLYDELTWEGITVCDLDGNAVDGVKRPSSDTDAHAYVYRHMPEVDGQV
FT                   HTHSPYATAWAARAEPIPCVLTAMADEFGGPIPIGPFALIGDDSIGRGIVATLRESRSP
FT                   AVLMQNHGVFTIGPSAKAAVKAAVMTEDVARTVHLSRQLGEPLPIAQSDIDSLYARYQN
FT                   VYGQ"
FT   gene            258496..260001
FT                   /locus_tag="Gobs_0244"
FT   CDS_pept        258496..260001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0244"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="PFAM: L-arabinose isomerase; KEGG: nca:Noca_0382
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73049"
FT                   /db_xref="GOA:D2S421"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D2S421"
FT                   /inference="protein motif:PRIAM:5.3.1.4"
FT                   /protein_id="ADB73049.1"
FT                   /translation="MVDPFEGHEVWFLTGSQGLYGEETLQQVAEQSQRVAAALDEAAEV
FT                   PVRVVWKPVLTDAAAIRRAMGEANEDPACVGVVTWMHTFSPAKMWISGLDALRKPLLHL
FT                   HTQADAALPWATIDMDFMNLNQAAHGDREYGFVLTRLRMPRTTVAGHVSNPRVRSRVGS
FT                   WARAATAAAAARSLRLARFGDNMRNVAVTEGDKVEAEIRFGMSVNTWGVNDLVAVVDTV
FT                   EDKAVDALVEEYGDLYEFADDARPGGPQHEAVRYQARIEAALRSFLEDGGFTAFTTNFE
FT                   DLGGLRQLPGLAVQRLMADGYGFGGEGDWKTAALLRTLKVAAAGLPGGTSFMEDYTYDL
FT                   AGTPKILGAHMLEVCPTIAGDRPRVEVHPLAIGGREDPARLVFTAAPGEGVVVGWCDLG
FT                   DRFRWVANEVDVVEPDEPLPNLPVARAVWQPRPDFETATEGWLTAGGPHHTVLSTAIGA
FT                   DELTDLAEVFATELVVIDAQTTRRRLAQELRWGAAYHRLAQGL"
FT   gene            complement(260157..261380)
FT                   /locus_tag="Gobs_0245"
FT   CDS_pept        complement(260157..261380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0245"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: stp:Strop_4517
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73050"
FT                   /db_xref="GOA:D2S422"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D2S422"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ADB73050.1"
FT                   /translation="MITPAAVRGATSEVGPLRTVLLHRPGAELRRLTPRNNDQLLFDGV
FT                   PWVRRAQEEHDAFAAELGARGVEVLYLDRLLAEVLTDPAARAELITAAVDDPRLGATLK
FT                   RTAAAHLAALSPEDLARALVAGVAHDELPGARGLSWALMARGDFVVPPLPNLLFTRDSS
FT                   VWVGDQVAVTSLAMPARHRESTITAAVYAHHPRFAGAEQLYDASLEHLEGGDVLLLAPG
FT                   VVAVGVGERTTPGGAERLARRVFARGLAHTVLVVPIAQQRATMHLDTIATMVDVDAMVV
FT                   YPAVASSLVAWTVTAEVPPDDDDTTDLVVRGPAPFLEAAAAAMGIDRLRVIDTGLDPVT
FT                   AEREQWDDGNNTLALAPRLAVAYERNTVTNAALEAAGIEVVRIAGSELGSGRGGPRCMS
FT                   CPVRRDPL"
FT   gene            261474..262241
FT                   /locus_tag="Gobs_0246"
FT   CDS_pept        261474..262241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0246"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   mjl:Mjls_2652 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73051"
FT                   /db_xref="GOA:D2S423"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S423"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB73051.1"
FT                   /translation="MHLFDLTGKVAVVTGGTRGIGLMMARGLLQAGASVYISSRKAEAG
FT                   EQAAAELSQFGAVASIPADVSTEAECVRLAEEVGRREERLHVLVNNAGATWGEPFATFP
FT                   ASAWDKVLDLNLKAPFFLTRALLPLLEAAGTDDDPARVVNVGSIDGLHAPSLPTYSYSA
FT                   SKAGVHHLTRVLAKELGPKRITVNAVAPGPFESKMMAATLAARGDEIAASSPLGRIGRP
FT                   DDMAGVVVYLASRAGAYVTGAVIPVDGGRATTL"
FT   gene            262247..262852
FT                   /locus_tag="Gobs_0247"
FT   CDS_pept        262247..262852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73052"
FT                   /db_xref="UniProtKB/TrEMBL:D2S424"
FT                   /inference="similar to AA sequence:KEGG:SGR_303"
FT                   /protein_id="ADB73052.1"
FT                   /translation="MARRLRFDGWILGAGTASGTRVVVGHWPRSPLGPLSDVMVQRPDG
FT                   ARLLLAPTREAADLIAATYAFDEVRLVPVVVQRPDLRTWVVTAGPLRLRVTTGRRPPLG
FT                   RLLRAVPPPLARTPVWVGLLDRPARLLTGLRTTGSAGNGRTEWYGVQDLHVVTALDATW
FT                   DGEPLGALAAVRPPVTFGFGSVPPRPSLARVTTTVQLP"
FT   gene            complement(262969..263130)
FT                   /pseudo
FT                   /locus_tag="Gobs_0248"
FT   gene            263144..263527
FT                   /pseudo
FT                   /locus_tag="Gobs_0249"
FT   gene            263969..265351
FT                   /locus_tag="Gobs_0250"
FT   CDS_pept        263969..265351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0250"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sen:SACE_4261 (S)-2-hydroxy-acid oxidase, subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73053"
FT                   /db_xref="GOA:D2S425"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2S425"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ADB73053.1"
FT                   /translation="MALDAGVLTELESIVGREHVRHEQGEVAPYARDATPLFSSPPDAV
FT                   VFPARTEEVAAVLRLATARRIPVVPRGAGSNLCAATVPLQGGILLVLTRMDRVLEISTE
FT                   ELLVRAEPGATTATVAEAAAAQGLLFAPDPGSRTVSTVGGNVATCAGGLRGLKYGVTRN
FT                   YVLGLEVVLPTGEVIRTGGRLWKDVAGYDLTRLLTGSEGTLGVITEVTLALLPMPATAS
FT                   TGVAYFSSLAEAGRAVTQVLAHGVVPATLEFLDRTCIGAVEDYARLGLRGDAGALLLFG
FT                   DDGEPDAVERNLTRMGELCADEGALEVTVAKEIAQSEALLAARRCALPALSRLDTLTVL
FT                   EDVTVPRPRLAEMVDRIEAVAARHDLLIGTFGHAGDGNLHPTAVVDVRDPAAADRTHAA
FT                   FAEIFAAALELDGTITGEHGVGAAKLPYLRDRLGDDQMALLRRIKTAFDPAGILNPGKT
FT                   GS"
FT   gene            265348..266652
FT                   /locus_tag="Gobs_0251"
FT   CDS_pept        265348..266652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0251"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: sen:SACE_4263 glycolate
FT                   oxidase, iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73054"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2S426"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADB73054.1"
FT                   /translation="MSAEVPGATDAPGAAGAAARGIFPPELLDRCISCGFCLPACPTYA
FT                   LSKDEKSSPRGRITLMRALETGVLEDDDPTLREESSFCLGCRACEPVCPAGVQYGELLE
FT                   RWRSHQWQGRRRPPLARVLTNVVVRNWLVRRLGTFRRHARTATSSPQGPHLMLGCFERA
FT                   LFPAVSRAARRLRPELDAPGDQGCCGALHAHNGDLELGRSMARRLGEQLPGRIVTTAGG
FT                   CAAHLAGVLGRDRVQEFSEYVTRDGSASFGELRVDGRRARVALQDSCHLRNGMDVWREP
FT                   RELIAAVADYVELPGAAQCCGSAGTYSLLRPKDSRRVLAPKLDQIEAAGVDYVVAVNPG
FT                   CQRQLVTGLRRRRSRVRVLHLTELLAAAQDGGLPGRRLRLGARPGRRTEVPADEAAGLA
FT                   AHLNDRPMPDDPGAAGAGRPDALDGSAGLDETHRS"
FT   gene            complement(266666..267613)
FT                   /locus_tag="Gobs_0252"
FT   CDS_pept        complement(266666..267613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0252"
FT                   /product="LigA"
FT                   /note="KEGG: ade:Adeh_0244 LigA"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73055"
FT                   /db_xref="GOA:D2S427"
FT                   /db_xref="UniProtKB/TrEMBL:D2S427"
FT                   /inference="similar to AA sequence:KEGG:Adeh_0244"
FT                   /protein_id="ADB73055.1"
FT                   /translation="MIALHPTIADSASAAWRSLLAILTGFALAVGLYEVTRGGAQRPHH
FT                   RAHRRRGDPRRAAAAVARAGQLGQLRRRPHDHRGTRRPRRLRAALRRADAARRRHRRPR
FT                   HHGALPTAAADPRGRPDRPRPVAARHSPRRDRRHAARRAGARPGGVGRPRRGARRCAGP
FT                   DARRRGPGGAGPPGQPACPPLAGPGGRHPRGVPRGRPRRRPRRRPHLAGRRTAAAPARH
FT                   RPGRGRGRLGARRRARRPGRCRPDAAPQHRRDDARPPGRADRRSRGRAGPAGHPAAHDA
FT                   ARRRGRLLRSRAVAVGVRRGLAALGAHRRQPQAA"
FT   gene            complement(267638..267754)
FT                   /locus_tag="Gobs_0253"
FT   CDS_pept        complement(267638..267754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73056"
FT                   /db_xref="UniProtKB/TrEMBL:D2S428"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73056.1"
FT                   /translation="MSLWVQLHRPAVQRGVRAAVAAALAWQVAVLLPPMLSE"
FT   gene            267838..268659
FT                   /locus_tag="Gobs_0254"
FT   CDS_pept        267838..268659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0254"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   rha:RHA1_ro05897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73057"
FT                   /db_xref="GOA:D2S429"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2S429"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB73057.1"
FT                   /translation="MVCEVEAATVDTYTHGHADPVLQSHRWRTAENSAAYLLPSLRPGL
FT                   DLLDVGCGPGTITVDLAERVAPGRVLAVDLSPDPLDEARALAGRRGVRVEFAVGDVHAL
FT                   DTADDSFDVVHAHQVLQHLTDPVAALREMARVCRPGGVVAVRDVDYATFTWFPADEGLD
FT                   RWLDLYHRVARHNGAEPDAGRRLLAWAHAAGLRDVTATTGSWCYASPAEREWWGNSWAG
FT                   RATASAFAEQALAYGLATPAELEEVAAAWRRWAASDDGWLGMVHGELLIRV"
FT   gene            complement(268738..269493)
FT                   /locus_tag="Gobs_0255"
FT   CDS_pept        complement(268738..269493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0255"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: TipAS antibiotic-recognition domain protein;
FT                   regulatory protein MerR; Transcription regulator MerR DNA
FT                   binding; SMART: regulatory protein MerR; KEGG: sco:SCO3413
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73058"
FT                   /db_xref="GOA:D2S430"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="InterPro:IPR036244"
FT                   /db_xref="UniProtKB/TrEMBL:D2S430"
FT                   /inference="protein motif:PFAM:PF07739"
FT                   /protein_id="ADB73058.1"
FT                   /translation="MNVGQVAALAGVTVRTLHHYDRIGLLSPSGRTAAGYRRYAPSDLD
FT                   RLHQVLVYRELGFPLEEVATLLDDPTADPAEHLRRQHRLLLDRMERTRAMVAAVEKEME
FT                   ARQMGISLTPEERFELFGDWLPEEYEAEAEERWGDTEAWAQSQRRTRSYTKEDWVRIKA
FT                   EGDDVERRFAEAMRSGVPAHSEQAMDVAEEHRQLISRNFYDCPPEVHAGLGRMYVEDER
FT                   FTAHYEQVAPGLAQYVSTAVQANAARQGG"
FT   gene            269584..270198
FT                   /locus_tag="Gobs_0256"
FT   CDS_pept        269584..270198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0256"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: protein of unknown function DUF664; KEGG:
FT                   art:Arth_3852 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73059"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D2S431"
FT                   /inference="protein motif:PFAM:PF04978"
FT                   /protein_id="ADB73059.1"
FT                   /translation="MDGKTALLEYLRARRADLLTKLDGLGEYDVRRPMTPTGTNLLGLV
FT                   KHVSYVQLGYFGEVFGRPSGRSYPWDAEGAEEGVDLWAAPEETRADVLELYASAAAHAD
FT                   ATIEELPLDATGTVPWWREERRHPTLHTVLVHVGGEVARHVGHADVLRELIDGSAGVSS
FT                   PGDNLPERSAAEWAAFRERIEAAARQAAGLPTPSGAPPGDG"
FT   gene            270209..271111
FT                   /locus_tag="Gobs_0257"
FT   CDS_pept        270209..271111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0257"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmi:MMAR_0112
FT                   haloalkane dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73060"
FT                   /db_xref="GOA:D2S432"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2S432"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB73060.1"
FT                   /translation="MAADVSPDDPFPRQRVRVDRRADGNLQMAYVEAGEGDPIVFLHGN
FT                   PTSSYLWRNVIPHVQHLGRCLAPDLIGMGESDKLPDPTRGSYSFSAHAGFLERFLEAVG
FT                   ATERVTFVLHDWGSALGFDWAHRHPGAVRGIAFTEALVVPLTWADWPAAARGIFRTMRG
FT                   PDGEAAVLEKNVFVERILPASVARGLSAEAHARYREPFADPAHRWPTLEWPRQLPIENV
FT                   PPKVRDVVARYGQWLRTSDVPKLFVNADPGSILVGRPRAFVRKWEALTEVTVPGAHFVP
FT                   EDSPHEIGRALADWIPTLR"
FT   gene            complement(271271..271717)
FT                   /locus_tag="Gobs_0258"
FT   CDS_pept        complement(271271..271717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0258"
FT                   /product="Domain of unknown function DUF1905"
FT                   /note="PFAM: Domain of unknown function DUF1905; KEGG:
FT                   bcv:Bcav_1963 domain of unknown function DUF1905"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73061"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:D2S433"
FT                   /inference="protein motif:PFAM:PF08922"
FT                   /protein_id="ADB73061.1"
FT                   /translation="MEFRTTVVQSGKTATGLQVPDEVVAALGGGRRPPVTVTLGGYGYR
FT                   TTVAPMGGAFWIPLAAEHREAAGLQAGQEVDVRVELDTAPRETPLPEDLAAALDDGARA
FT                   FFDGLAPSHRKEWVRWVEDAKKPETRAARVEKTAEALRAGRRTR"
FT   gene            complement(271893..272726)
FT                   /locus_tag="Gobs_0259"
FT   CDS_pept        complement(271893..272726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0259"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sen:SACE_0206
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73062"
FT                   /db_xref="GOA:D2S434"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2S434"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB73062.1"
FT                   /translation="MSTDTAAPGLVVEVGAPAPGRPDVGRAFRALLWRDVFVTGRELVP
FT                   FLLQVVLQPVFLLFVFGKVLVELGFATSQYSDVLLPGVIALTAFLTALQNTAFPLVIDF
FT                   SFTKEIEDRLLAPLPTALVAVEKVVFALLRALVAAAVMFPISWWVLGTLPVEWGDLPAL
FT                   TAFLVLGSLVGAVMGMTLGTFVKPNRINIVFAVVLTPVLFTGSTQFPWQALDTLRWFQV
FT                   ICALNPLTYVSEALRAQMAPGVPHLPLWLCAVALAGFLVVFGVTSLIGFRRRALD"
FT   gene            complement(272723..273712)
FT                   /locus_tag="Gobs_0260"
FT   CDS_pept        complement(272723..273712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0260"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sen:SACE_0207 daunorubicin resistance ABC transporter
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73063"
FT                   /db_xref="GOA:D2S435"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S435"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB73063.1"
FT                   /translation="MDTGGAQRSADPAVQVTDLVKRYPGRPVNAVDGISFAVERGEVFG
FT                   LLGPNGAGKTTTIGVLTTRVLPTSGAASVAGVDVAADPVTARSRLSVVPQRPNLDRALT
FT                   ARQNLVFHAAYHGVGRAERNRRADALLEQLGLGGRGGDKVDDYSGGMAQRLLIARALMH
FT                   APQVVFLDEPSTGLDPQARLFVWDRVRELRDGGITVLLTTHDMDEAATLSDRVGIMDSG
FT                   RLLALDTPAALTRSLPGSATLDIDVERAPEDSDEAVLAALAPLVERVEQVADGSGLRAR
FT                   LYLSGDAAALVGPVSEALNGRRARLTGVRIGEPSLEDVFLSLTGRELR"
FT   gene            complement(273755..274135)
FT                   /locus_tag="Gobs_0261"
FT   CDS_pept        complement(273755..274135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_7325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73064"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2S436"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73064.1"
FT                   /translation="MPVIPDLPWTADSVGDGPGIVMVTHLHLRRFRDIPAFLRDSLAIR
FT                   TQTMAAPGARSLYLRAQPLARHFTTVSWWDDDAAVHAFVRTDPHRAAMRRWHAEMREFS
FT                   NRSYPGTEGVVPTLKTAAALSA"
FT   gene            complement(274218..274817)
FT                   /locus_tag="Gobs_0262"
FT   CDS_pept        complement(274218..274817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0262"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   kra:Krad_0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73065"
FT                   /db_xref="GOA:D2S437"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D2S437"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ADB73065.1"
FT                   /translation="MSLTVVLTAFVLVLPVELPDKTLFASLVLATRFPPLPVFVGVGTA
FT                   FGLQVAIAVTAGSLLSLLPEALVSGVVAVLFLVGAVLLWRSAQEGPEDAADVAEGKEGR
FT                   SFLRVAAISFGVLFAAEWGDLSQLATAGLAARLDDPVSVFAGAWAALLTVSGLAVFLGR
FT                   KLADRLPVALIRRVAAVLFLVFAVVAAVETVRTLAG"
FT   gene            275142..276245
FT                   /locus_tag="Gobs_0263"
FT   CDS_pept        275142..276245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0263"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sco:SCO1457 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73066"
FT                   /db_xref="GOA:D2S438"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2S438"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB73066.1"
FT                   /translation="MGWTALSELVPLYPLYALLFLDTGLSAADVSLLFAAWSVTAVLTE
FT                   VPAGALADRWSRRGALVLAGVLEAAAFAVWTVSPQFSGFLAGFVVWGVAGALVSGAVEA
FT                   LVHDGLAEVGAEGSFARVNGWMTSAELLVQVPTAAAAGVLYALGGYALVGWASAAVCLA
FT                   WAALALRFPEPAREPDGESLLGTLRSGVTETVRVPALRLTVLAVALVGAVDAVEEYFPV
FT                   LAGDRGVPTVAVPVVVLGITLAGALGAALGGRADRLPDRALSVLLLLAGVLLGAVAVVP
FT                   GPGALALVAVAYGLYLVVLVVAEARLQERIDSSRRATVTSVAGLGTELAALLVFAAWAL
FT                   GGVVAVGVLVVAVVPVVEAGLRRRPVS"
FT   gene            complement(276287..277141)
FT                   /locus_tag="Gobs_0264"
FT   CDS_pept        complement(276287..277141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0264"
FT                   /product="Helix-turn-helix, AraC domain protein"
FT                   /note="SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   bcv:Bcav_0118 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73067"
FT                   /db_xref="GOA:D2S439"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D2S439"
FT                   /inference="protein motif:SMART:SM00342"
FT                   /protein_id="ADB73067.1"
FT                   /translation="MPSWTNATGPASGLLRPAETAQEVGLRRDAPVSPVQAPFVERYWS
FT                   VRWDRTGRPPHRSEVLSHPSVNLSVESGSEPRFGHVLPAVLVHGVTPRRFTIDLAGTGR
FT                   VTAAKFRPGGWVALGGRLPGRATVAPLGTALGLDAARLLDAVLAAEDDDARAAVLDAVL
FT                   APLAPDPPAAYLELLALLERMAADRSLVRVEQVAVLGSMSTRSLQRLFAGYVGLSPKAV
FT                   LARYRLQDAAATIDAGGVGDLAGLAASLGWFDQAHFSRDFRAVTGTTPSAYLRRARAAQ
FT                   DTG"
FT   gene            277169..277648
FT                   /locus_tag="Gobs_0265"
FT   CDS_pept        277169..277648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0265"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mva:Mvan_4455
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73068"
FT                   /db_xref="GOA:D2S440"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2S440"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB73068.1"
FT                   /translation="MAITDGRPDGYTTLTPFLVCSPAAEAIRFYADVFGATVVQRMDGP
FT                   DGTVVHAELDLGLGRLQLGDPNDAYGLVAPSGQAEDRVSSSTCVYVADVDAVFARAVER
FT                   GATVREEPATFVTGDRFASVHDPFGHRWVVMTKVEDVSPEEQERRLAEWAASGAR"
FT   gene            complement(277666..280494)
FT                   /locus_tag="Gobs_0266"
FT   CDS_pept        complement(277666..280494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0266"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: nca:Noca_0169 circadian phase modifier CpmA;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73069"
FT                   /db_xref="GOA:D2S441"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:D2S441"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB73069.1"
FT                   /translation="MTARTGRGGWDGSAPGSRRAPLPVLDSVDNGVHSALVPPGALHHR
FT                   VTAALSNWQLDDAEELLADVGTDSSPYVAPAPRDGGGDRPTDLGRAWADTLRAELLVRR
FT                   LRQAGFTLVGEPVESPSGPGAEPALDLHAGVAELIDGAGASEDGDPRASSAALAIALVR
FT                   SAKAAFDATADELQRAAGLARHARIELLSRRTDAAMDEAVEAASLLGPAMPPSALLVQT
FT                   LTDLAGVLADLELMPLALDYQRRAHETAVTAAAVPGALRPEDGDPDVLVARAASSLGEL
FT                   CAELGEALLDEGVPDAAEPHFAEARTLAEQALTLLPSESAEAVVAAQVVHGWALVGLGE
FT                   LASAAGPLRAAVRATTAGDRALHAAALLALGRALRRQGNGRDADEQLVQALATATEHGR
FT                   PRLRRAALRELCTLHAELDDAGRALPYLQAYLADELDRVDERRTRWVELFGRRKSLLET
FT                   ERAAGQLRRQAYEDPLTHLPNRRYAEATLDGLLGSGTTPALAVVDVDRFKEVNDAVGHA
FT                   GGDDVLRRVAEILVAGCRDTDEVCRWAGDEFVVLLPDTTAEQAEHALERCRRAVAETDW
FT                   AALGLPVPVTISVGIASATRGDDRRTLFAAADGVLYDAKRTGRDRVVRLSTVTQTRAAG
FT                   SPLDALPGPAATAVTDGSSRDGTASAGSPEEAAATPGVPAVQPPPLADLTAVSSGFASL
FT                   LVEPADPPLGLGSAAEPALAPAPPTAASPAEPAVPPAAPACGTPAEPDVIWGTGRSTER
FT                   VLALVREARRQSPDRPAVVVRASAETLVALAGEHDAHTTVDAASMSAAVGPLPEPVGRI
FT                   GVLCGVGGDLAVAAEAAFAARVTGTAVVRVDDVGGSRFRAGLPGDALPDDVDCLVVVAG
FT                   LDASLAGLVGVLTDVPIVAVPTSTGQPGSFGGFGALLTMLTSAAPGVVVSNIDNSHAAG
FT                   VFAARVARRTRR"
FT   gene            complement(280491..282143)
FT                   /locus_tag="Gobs_0267"
FT   CDS_pept        complement(280491..282143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0267"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: sen:SACE_0749 putative responce regulator with
FT                   diguanylate cyclase; TIGRFAM: diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73070"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2S442"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB73070.1"
FT                   /translation="MTPGPERLTEGDLDDALWRLLSASDRDDPAAFAAEHDRAAEALDA
FT                   ATDPRWVAWRHALAARRALADGDPEAVAAGVAAARDALGRCLPCAQTALTLAYLAAVEV
FT                   ATDHVDAAMVLAIDAGLLAETAAADGPSRALHQAHLWLSLTLAALDLEELAVAQALQGS
FT                   RVADELPGVPDRWRLLQLCAQQHAELAQALHRRGQGERARELAGTAVECAEAARALDWE
FT                   AGPADQDLLDVVQAWAMAGRGEVEDALGPMRRAHKRVHRDGGTWLRGYADLVLARLLTR
FT                   LAGNRSGGGHDAEATDLLVDAAGAFAAAGDRRRYRQCLLELGQGTAAMGRPAEALHWLE
FT                   AYRADTGRAHARGRELWAEMFVRRSRLREAERQTAHLRRVALEDPLTGLGNRRSAERRL
FT                   GGMRVGAEPVSLAVVDIDRFKAVNDDASHSHGDEVLRRVAELLREHSRTGDEVYRWAGD
FT                   EFLVVLPTATEAQALAAVDRLRAAVAGADWGDLQLPEPVTVSIGVATAPAAADEPLGWR
FT                   LLFDTADLHLFTAKRGGRNRVRAHGGRAGDDTP"
FT   gene            282256..283191
FT                   /locus_tag="Gobs_0268"
FT   CDS_pept        282256..283191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0268"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: saq:Sare_5032 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73071"
FT                   /db_xref="GOA:D2S443"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D2S443"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADB73071.1"
FT                   /translation="MPGTPPTRYAYLGPEGTFAEAALISAVAPGEGSRIPSPGVPAALA
FT                   AVRSGDADAALVPLENSVEGSVPATMDGLAEGDPLLITREVFLAPTFVLAGRPGTTLSA
FT                   VRSVASHPHALAQTAGRLARLLPGVVPLPATSTAEAARQVAAGEHDAAVCAPIAAERYG
FT                   LTALVDDVADRSGAVTRFVLVAPPGPLPAPTGNDKTSLVAVVGDRTGALLDLLREFAVR
FT                   EISLTRIESRPTRERLGVYSFSLDCEGHAADARVGEALAALHRVCDELRFLGSYPRADG
FT                   RENKPVTPVSNDAAFGEAAGWLERVRAGRV"
FT   gene            complement(283271..285373)
FT                   /locus_tag="Gobs_0269"
FT   CDS_pept        complement(283271..285373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0269"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: rha:RHA1_ro03267
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73072"
FT                   /db_xref="GOA:D2S444"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D2S444"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ADB73072.1"
FT                   /translation="MARLRWLLPALVLLVWLGGAGPLSTLSAQLTGLQENDTAAFLPDS
FT                   AESTRVADLQQGFSPVQAIPAILLWEGDGPLDAATLQAVAERSAEAARVAEDAGALSAP
FT                   PSPPVPSADGAAVQVLLPLDPEVGDEIVPLVADLRATIAVEGTDTFVTGPGGIFADFAN
FT                   GFAGIDGLLLLAAFGVVLLILLVVYRSPILPFLVIGTAGLALTAGNAVAYLLADAGVIT
FT                   VNGQSQGIASILIVGAATDYGLLLVARFREELRRERSKYTAMRTALRRSWEPIVASGAT
FT                   VVLGVLCLLFSDLASNRGLGPISAVSVTLSVLAALTFLPAALVLLGRAAFWPFRPRYGV
FT                   EPPAGRGWQRVAATVGRRPRRVLAVSTLALVAAAVFAPGYDASGITFSDAIQGESNGVA
FT                   GQEALARHYDAGSGSPTVVVTPEDTWPAVADAAASADGVATVTPFTGGPPGGPPVVVDG
FT                   LVRLDVVLGVPADSTEAIEVVQELRGTLDAADPAALVGGDTASNLDARETAARDLQVIV
FT                   PTVLAVITVVLALLLRALVAPLLLMATVVLSVGATVGVAALLFDGVFGFPGSDPGILLI
FT                   AFVFLVALGIDYNIFLMTRAREESLRHGTRDGVLRALAVTGGVITSAGLVLAATFGALS
FT                   VLPLLFLVQLSFLVGFGVLLDTFVVRSLVVPSAVALLGDRTWWPGRLARRPEPEPDREL
FT                   EPVGPR"
FT   gene            285454..285900
FT                   /locus_tag="Gobs_0270"
FT   CDS_pept        285454..285900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0270"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: sco:SCO2209 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73073"
FT                   /db_xref="GOA:D2S445"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S445"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB73073.1"
FT                   /translation="MDVEERRELALLLRRLTVELDAVGQRFAELHAIGRTDVRAMVAIM
FT                   DAARRGEALTAGALGRAVDLSSASVTALVDRLERAGHVRRVRDPQDRRRVVLEMSESAM
FT                   AAGGQFFGGLQRDLVAAMEGYADEELTAIRRFLTEMTEVIVRHR"
FT   gene            complement(286018..286353)
FT                   /locus_tag="Gobs_0271"
FT   CDS_pept        complement(286018..286353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0271"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: sen:SACE_7319 GroES
FT                   family molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73074"
FT                   /db_xref="GOA:D2S446"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D2S446"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADB73074.1"
FT                   /translation="MIGVPEAAGKLPIKMLHDRILVAQRREDGERRSTGGILIPATAQV
FT                   AKRLVWGEARGVGSSVRQVKVGDQVLFSPEDQHEVEVHGEELIILRERDVHAVAAERIE
FT                   ESTGLYL"
FT   gene            complement(286487..286834)
FT                   /locus_tag="Gobs_0272"
FT   CDS_pept        complement(286487..286834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0272"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   msm:MSMEG_6415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73075"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:D2S447"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ADB73075.1"
FT                   /translation="MRPLPLAVFEGLVADALDQVPPDLLALMDNVVVLVEDRNADEPDL
FT                   LGLYEGYALTERGWEYGGALPDRIMVYREAICDICSTAEEVVEEVTITVVHEIAHHFGI
FT                   DDDRLHELGWA"
FT   gene            complement(286831..288264)
FT                   /locus_tag="Gobs_0273"
FT   CDS_pept        complement(286831..288264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0273"
FT                   /product="IMP dehydrogenase family protein"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: tfu:Tfu_2440 inosine 5-monophosphate
FT                   dehydrogenase; TIGRFAM: IMP dehydrogenase family protein;
FT                   PFAM: IMP dehydrogenase/GMP reductase; CBS domain
FT                   containing protein; SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73076"
FT                   /db_xref="GOA:D2S448"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR005991"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2S448"
FT                   /inference="protein motif:TFAM:TIGR01303"
FT                   /protein_id="ADB73076.1"
FT                   /translation="MRFLGDTRPATDLTYADVFMVPNHSTVGSRLEVDLTTPDRVGTTI
FT                   PLVVANMTAISGRRMAETVARRGGLAVLPQDIPVDVVAEVVAWTKARHPVYDTAITLSP
FT                   TSTVADALSLLTKRAHGIVVVVEDGFPLGVVTDGQCQGVDRFTQLSQVMTEDPLTVPAG
FT                   TDLPKIFDVLSGERVSAAPVVEGDRLVGVITRKGALRSALYQPAVDAQGRLLTSAAVGI
FT                   NGDVAGKSAALLAAGVDVLVVDTAHGHQEKAVEAVRAARSVAGTTPVVAGNVVTAEGTR
FT                   DLVEAGADVVKVGVGPGAMCTTRMMTGVGRPQFSAVEECAAAARALGKHIWADGGVRHP
FT                   RDIALALAAGAASVMVGSWFAGTYESAGDVHDDGSGRLYKESFGMASARAVKARTSTRS
FT                   GFDRARAGLFEEGISSSRMYLDPARPGVEDLVDQIVAGVRSSFTYAGARTVDEFHERAV
FT                   VGVQSAAGYEEGRPLPTSW"
FT   gene            complement(288358..289812)
FT                   /locus_tag="Gobs_0274"
FT   CDS_pept        complement(288358..289812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0274"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; chitin
FT                   synthase; KEGG: krh:KRH_23180 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73077"
FT                   /db_xref="GOA:D2S449"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S449"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73077.1"
FT                   /translation="MREVLVDVLLTMSWAVLGYTLLLDLVMLALVLAGARRVSASRRWD
FT                   GSEGHEEIFASPLTPGVSVLIPAHDEEAGILDTLAAVLAQRYPVLEVVLVDDGSTDRTF
FT                   DMVAERFGLVQVTARPTAALPVDGTVLSVHRATTGDPLTVVRKTSVGRRSDALNAALNV
FT                   ARHPLVCMVDADSLLEPEALVQVARPFVEDPANVVASGGVIRAANGARVARGSVLEPRL
FT                   SSRWVVRFQVVEYLRSFLLGRTGWADANALLIISGAFGLFRRDLVVEVGGLDALSLAED
FT                   AELVVTVQEHLRRQRRPHRVVFVPEPVCWTEVPETLAVLGRQRRRWSHGLAQLLWKHRR
FT                   MIGNPRFGPVGLLALPFFLLFELLGPVVEVVGLVSVVLAAFLGLLDTGTALVMFGLALG
FT                   LGTLLSTAAVAVEEFSYARYTRGREVGVLLLTGLLENVGYRQLHAWFRLRGLVAALMRR
FT                   TPVWTAMPRTGFTEAEPIAVEPAAAT"
FT   gene            complement(289812..290864)
FT                   /locus_tag="Gobs_0275"
FT   CDS_pept        complement(289812..290864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0275"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein repeat-
FT                   containing protein; KEGG: rrs:RoseRS_1736 heat
FT                   repeat-containing PBS lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73078"
FT                   /db_xref="GOA:D2S4W7"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4W7"
FT                   /inference="protein motif:PFAM:PF03130"
FT                   /protein_id="ADB73078.1"
FT                   /translation="MNSLAAPAAAATAVLGVLVVVLLVAVAAVHTTRARRLAAAQGNRA
FT                   ELMALVYVLLDDGDTDAVVAAPRDLDEVLLHLLPQLRGADREAIQTALTRRGVVARAAA
FT                   DLDARAAWRRGRAATLLGSTAGRDHLARLTALLADRSLEVRCAAARALGRVGDPAAVHG
FT                   LLASLTTARPLPAGLVGMAVLDLGTAVLPALRATLVTGSPAARALSADVVGVHGDLAAT
FT                   AALVDLLTDARQPEDVRRAAATALGRIGDPAATDPLAQVLFDAALPPLQRAAAEALGRI
FT                   GDPAGGPALLAGLTCPAREVAAACDDALVALGPEGSAVLADAAARGGPLGTAAAATLDA
FT                   TPQPGRLVGV"
FT   gene            complement(290861..291241)
FT                   /locus_tag="Gobs_0276"
FT   CDS_pept        complement(290861..291241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0276"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: nca:Noca_1748 response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73079"
FT                   /db_xref="GOA:D2S4W8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4W8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB73079.1"
FT                   /translation="MPHVLVVDDDPVVADLVAFRLQRLGLQVTVRTDGETGLAAARRLR
FT                   PDLVVLDWLMPRMDGLEVCRALRADADPALARTPVLMLTAKSQEPDLERGFAAGATDFV
FT                   AKPFSTRELVSRVTAALPAVPA"
FT   gene            291320..294193
FT                   /locus_tag="Gobs_0277"
FT   CDS_pept        291320..294193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0277"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; Hpt domain protein; CHASE3
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; Hpt domain protein; response regulator
FT                   receiver; histidine kinase HAMP region domain protein;
FT                   KEGG: mag:amb3735 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73080"
FT                   /db_xref="GOA:D2S4W9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4W9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB73080.1"
FT                   /translation="MDRHPVAFKEAVPAADTGSVLPHPARRPGAEPLPLRVLLRRPLLV
FT                   ALSGVSVVALTLLGLAVLVVPVLGNRITTYDQMSRALQDSHVAMLNQETGLRGYLITRE
FT                   ARFLQPYEAGVADLKQVDAEIASWTGADAELAGRLAELTAAHQRWTQDWVRPMLAGQPA
FT                   VGDAVALAELLRQDKALFDHYRAIEAQARAAVGERRAGAMALQQLALYAGALVGVGTAA
FT                   AVAAVLRGAYRRLEAQVVPPTQEVRDALAALAAGDLTRRAGESGSAELRRIAADVNALG
FT                   DALQERNELVATRERDLVAARDEAERAGQAKTAFLATMSHEIRTPLNAVLGLTDVLLAT
FT                   DLTDEQRGHLETVAGSGDSLLSLINDILDFSKIEAGELDLEAAPFDLVGVVYDVAQLLA
FT                   PTASGAGLDLLVDVAGDGPWQVVGDGSRFRQVVTNLVGNAVKFTSEGHVVLRLTGTAAE
FT                   GRLQCRLSVVDTGIGISPDQRHRLFRSFSQVDASVTRSYGGTGLGLAISQRIARAMGGD
FT                   IQVHSELGVGSTFTVALDLPLAPAVPDDPSADGLAGLRLLVVDDSPTNLRILEHQLARH
FT                   GAECILAGGGPAALELLDRGTGVDVAVLDLDMPGMDGDVLAARLRARPGTADLPLVLVS
FT                   SSATLPAERYAHFDARLNKPVRPERLARTVRSVALRGRTEGANGGGERGRLALPAPARS
FT                   LRVLVAEDNAVNAQLMSLYLRQLGHRCTHVGDGEQAVDAVLRGTYDVVLMDAQMPVLGG
FT                   VEATAAIRLLPLATQPRIYAVTASVLAADRTAFLEAGADGFLTKPIRMATLRDALDEVT
FT                   LSPDAPVAAEPGPPAALDPETVEDLRDLGDDAFAHLYTRYLTTLDDAVAAIVAAADRPS
FT                   WSVDDEGSVPRLAHGLKGSSAALGATALAQVCHSLETVDPATLAVGDTLAVLDRERSRV
FT                   RTAVTELLAAVGPGGRDRAAGPPTIER"
FT   gene            294190..295491
FT                   /locus_tag="Gobs_0278"
FT   CDS_pept        294190..295491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0278"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: msm:MSMEG_6413 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73081"
FT                   /db_xref="GOA:D2S4X0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X0"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADB73081.1"
FT                   /translation="MIDLRLVREHPDLVKASQRARGADESRVDELLAADAARREAVKRT
FT                   DDLRAEQKAASQAVKKASSEERPAVLDRARALAAEVKDAEEALRGADAALRAAHLRIAN
FT                   VVHDGVPPGGEDDAVTLRTVGEVPAYDFPVRDHLEIGEALGAIDTERGAKVSGARFYFL
FT                   TGPGAMLEFALAQLAIGQAVSAGFTPVVAPALVRPEAMEGTGFLGEHDEEVYRVERDDL
FT                   YLVGTSEVALAGMRSNEVLDLSAGPLRYAGWSSCFRREAGSYGKDTRGIIRVHWFDKVE
FT                   MFSFCRPEDAAEEHRRLLAWEEEFLQALELPYRVVDIAAGDLGTSAARKYDIEAWFPSQ
FT                   GTYRELTSTSDCTTFQARRLNTRYRDAEGKNQTAATLNGTLCAVARTIACLLEVHQRAD
FT                   GSVYVPKALRPWLGGVEALTPGMTLVAPVPAPNA"
FT   gene            295488..296414
FT                   /locus_tag="Gobs_0279"
FT   CDS_pept        295488..296414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0279"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; sucrose-6F-phosphate phosphohydrolase; KEGG:
FT                   stp:Strop_4525 Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73082"
FT                   /db_xref="GOA:D2S4X1"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X1"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ADB73082.1"
FT                   /translation="MTADRPGVLPSTGTAGARADDVVELGDLGTWRPKLVASDLDGTLL
FT                   TSDGEVSPRTRAALTACWDAGIPVVGVTGRGPRLFDSVRAALDGRGIAVLAQGGFVVDL
FT                   ERDEVLRTVGLPREQATAVIERIEAVAGELVLAVEDAAEQGEVHSPLRVQHGFDWPYPE
FT                   PAHLLPRHQVLPPGAVLKVFLRSSTLGQDELLARAREVVDPARAEVTHAGLGFIEVLPP
FT                   GITKATGLAIALERYGVGFGDVLVFGDMPNDLPMMEAVRDAGGRAVAVANAHPAVRAAT
FT                   PLVTSGHDVDGVARYLEALLDGRRPGV"
FT   gene            296407..297210
FT                   /locus_tag="Gobs_0280"
FT   CDS_pept        296407..297210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0280"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; sucrose-6F-phosphate phosphohydrolase; KEGG:
FT                   sgr:SGR_3642 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73083"
FT                   /db_xref="GOA:D2S4X2"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X2"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ADB73083.1"
FT                   /translation="MSDWRPRLIASDMDGTLLRGNDTVSDATVAELERWRSEGVPVVLA
FT                   TGRPPRWMVRIREVLRHGTAVCCNGAVLLDLAGFEVLEEDALEPAVLQEVTAQLRRHQP
FT                   DTWFAVEYGLEFRHEPVYQPRWDVDAPGVAVATLEEMVAGPAAKLLARHEALPRDEFLA
FT                   LVERVVGDTATVTNSSTDALAEISARGVTKATGIAKVAAQHGVGPEDVVVFGDMPNDIA
FT                   AFDWVREAGGRAVAMAHAHPDLLAAATDVTGTNEDDGVAAFLSAL"
FT   gene            complement(297371..298882)
FT                   /locus_tag="Gobs_0281"
FT   CDS_pept        complement(297371..298882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0281"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: GAF domain protein; transcriptional regulator
FT                   domain protein; KEGG: sen:SACE_2916 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73084"
FT                   /db_xref="GOA:D2S4X3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X3"
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /protein_id="ADB73084.1"
FT                   /translation="MSGSARHRPPRPGVPGDDAAAHARQLAETFDAVLGSSPARRAPRP
FT                   LVSASWARSVAARVDPDRRTPPVVHAPDELRDIRSAHPLNAVMPLLRHSLVGIAEEGVH
FT                   LLLVTDAAGHVLWREGAGQLLGPADRVGLFPGTNWSEAAIGTNAMGTTLAVDAPVQIHS
FT                   AEHLVRTYHSWTCVAAPVHDPDTGATLGAVDVSGPLRTMHPSLTQLVATTARLAESELR
FT                   ARMAEADQRFLLRNTPHLTQLGRAAGALVTPTGRVLAPDPSGWPERVDLDAATERVLLP
FT                   DGREVLVEPLAEGWLLRTAERAPRATRPSHTAALSLRFTGNGTSSAVLDGRLVTLPLRA
FT                   AEILTALVLHPEGLTAEQLGYLLYGDDGNQTTVRVQVRRLRTLVGADVLRTRPYRLAGA
FT                   VDSDFGSARRSLRAGQVAAALRACAGPLLPRSDAAEIRQLREELTAGLRSAVLATRDVD
FT                   LLHAFVVHPQGEDDLDAYDRLLALLPAGDPRAGAVALRAERLRAE"
FT   gene            complement(298980..299387)
FT                   /locus_tag="Gobs_0282"
FT   CDS_pept        complement(298980..299387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0282"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   msm:MSMEG_1544 PduO protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73085"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X4"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ADB73085.1"
FT                   /translation="MSASLTYDTARRVLEAGIARAEEIGQPMNIAVVDDGGHLLAFGRM
FT                   DGAIKASIDISTRKAVTSVLMALPTADLTPLVQPGAELYGLEQTAGGMVTFGGGVPLVR
FT                   DGEIVGAVGVSAGSVEQDVTVATAAAAALEG"
FT   gene            299495..300004
FT                   /locus_tag="Gobs_0283"
FT   CDS_pept        299495..300004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0283"
FT                   /product="dehydratase small subunit"
FT                   /note="PFAM: dehydratase small subunit; KEGG:
FT                   msm:MSMEG_1546 coenzyme B12-dependent glycerol
FT                   dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73086"
FT                   /db_xref="InterPro:IPR003207"
FT                   /db_xref="InterPro:IPR036091"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X5"
FT                   /inference="protein motif:PFAM:PF02287"
FT                   /protein_id="ADB73086.1"
FT                   /translation="MQRGACHSGATLRGPSESEPALSAFLPPELTTADYPLSINRPELL
FT                   RTPSGKPITALTMDAVVSGELSAEDLRIAPETLLLQAELADASGRPQLAANFRRAAEMT
FT                   AIPDAEVLAMYNALRPRASTAAQLAELADRLERAYSAPVCAALVREAAEVYGRRDLLAR
FT                   PTADVG"
FT   gene            300039..301733
FT                   /locus_tag="Gobs_0284"
FT   CDS_pept        300039..301733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0284"
FT                   /product="Glycerol dehydratase"
FT                   /EC_number="4.2.1.30"
FT                   /note="PFAM: dehydratase large subunit; KEGG:
FT                   msm:MSMEG_1547 glycerol dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73087"
FT                   /db_xref="GOA:D2S4X6"
FT                   /db_xref="InterPro:IPR003206"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036999"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X6"
FT                   /inference="protein motif:PRIAM:4.2.1.30"
FT                   /protein_id="ADB73087.1"
FT                   /translation="MTTTEPRPSIRTEVLESRPVNLDGFVEEWPEKGLVAMESDFDPAP
FT                   SIRVEDGRVVELDGKARADFDFMDTFIANHAIDVASAEASMAIPSAQVARMLIDPGVSR
FT                   DEVLAVTRGLTPAKVLDVVKLMNVVEIMQGMQKMRARRTPANQGHSTSARDNPIQVAAD
FT                   AAEGALRGFAELETTLGVLRYAPLVAIALQVGAQVGRGGVLTQCALEEATELELGMRGI
FT                   TAYAETISIYGTESVFVDGDDTPWSKSFLAAAYASRGIKMRFTSGTGSEVQMGNAEGKS
FT                   MLYLEIRCILMAKGAGVQGLQNGSISCIGVPGAVPGGLRAVAAENLVASMVDLECASGN
FT                   DQSFSHSAMRRTARAMPQMLPGTDFVCSGYSSVPNADNMFAGSNFDTEDFDDWNTIQRD
FT                   FQVDGGLRHVREDEILAARNKAARALQAVFAHLDLPPITDDEIEAATYANSSNDYPLRD
FT                   VLADLKGAQSVMDREITGLDLVKGLESAGFHDVAENLLTVLRQRVSGDLLQTSAVLTAD
FT                   FTPLSAINDPNDYAGPGTGYRLQGERWEQLKKLRHVTSSTNPETEVG"
FT   gene            301737..302330
FT                   /locus_tag="Gobs_0285"
FT   CDS_pept        301737..302330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0285"
FT                   /product="dehydratase medium subunit"
FT                   /note="PFAM: dehydratase medium subunit; KEGG:
FT                   msm:MSMEG_1548 propanediol utilization: dehydratase, medium
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73088"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X7"
FT                   /inference="protein motif:PFAM:PF02288"
FT                   /protein_id="ADB73088.1"
FT                   /translation="MTTPTTTAPERTVSLREVGPARRGTRPDEVVIALSPAFAGHFTKT
FT                   IVDVPHAEVLRQLMAGIEEQGVTARLVRVLDTADLAAISHTAARLSGSGISVGVLSRGT
FT                   TMIHQKDLPRLSNLELFPQSPLLDAPVFRMIGSNAAQYAKAESPQPVPTRNDQMARPRW
FT                   QAKAALLHLKEFDCIEAGRGPVEVEAVFGPGTAG"
FT   gene            302332..304227
FT                   /locus_tag="Gobs_0286"
FT   CDS_pept        302332..304227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0286"
FT                   /product="Diol/glycerol dehydratase reactivating factor
FT                   large subunit"
FT                   /note="PFAM: Diol/glycerol dehydratase reactivating factor
FT                   large subunit; KEGG: yen:YE2733 putative propanediol
FT                   utilization protein: diol dehydratase reactivation"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73089"
FT                   /db_xref="InterPro:IPR009191"
FT                   /db_xref="InterPro:IPR028975"
FT                   /db_xref="InterPro:IPR030994"
FT                   /db_xref="InterPro:IPR040916"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X8"
FT                   /inference="protein motif:PFAM:PF08841"
FT                   /protein_id="ADB73089.1"
FT                   /translation="MGAREGAPPEGLLVVGVDIGNSTTEACLAVVAPDGSLTFLGTDLT
FT                   RTTGVKGTPDNTEGALKAIRGALARAGRSAGQVETVLLNEATPVISGLAMETITETIIT
FT                   ESTMIGHNPTTPGGEGLGVGTTRSIGELGEQQPGEPVVCVVPHGWDFDDVAATLNAAVA
FT                   AGVDVVAAILAGDDAVLVTNRLTRPIPVVDEVSAVEKVPLGMLAAVEVAAPGRTIRTLS
FT                   NSYGLATVFDLDPVQTRQVSPVARALTGNRSAVVVRTPTGDVTDRRIPVGELVLHGAGK
FT                   TLRVDVDAGAEAIMEVVGRAQPLDDARGEPGTHVGGMLAQVRDTMADVMDVAGQPDVPV
FT                   SDIAIRDVLAVDTFVPAEVRGGLAGEVALENAVALAAMVRTSRSRMQLVADLVSEGLGA
FT                   AAEIGGVEGEMAVGGALTTPGVDRPIAVLDLGGGSTDAALLTREGECTAVHVAGAGELV
FT                   TKLIDSELALGDREVAEGVKWFPLGKVESFFHLRHEDGTVEFVDQPLPPHVFARVVVLT
FT                   PDGPAPVPTRHGLDHVRRVRREAKRRVFVVNALRALRQVAPGGNLRALEFVVLLGGSAL
FT                   DFEIPDMIADALAPHGIVCGTGNVLGTEGPRNAVASGLVRAHAALLAEEARCRSS"
FT   gene            304212..304571
FT                   /locus_tag="Gobs_0287"
FT   CDS_pept        304212..304571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0287"
FT                   /product="PduH protein"
FT                   /note="KEGG: msm:MSMEG_1550 PduH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73090"
FT                   /db_xref="InterPro:IPR003208"
FT                   /db_xref="InterPro:IPR010254"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4X9"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_1550"
FT                   /protein_id="ADB73090.1"
FT                   /translation="MPEQLTAPGPRPAVLVYRHPGAPAAVLRQVRAGVEEEGVPTDVTE
FT                   VPGPDDATALAHAAAGESRLGVGIGLDAAGAAAVHHGTLPEETPVAATPAEAGPSDWRR
FT                   AGRIAARVVKHLPLA"
FT   gene            complement(304615..305169)
FT                   /locus_tag="Gobs_0288"
FT   CDS_pept        complement(304615..305169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0288"
FT                   /product="Protein of unknown function DUF2587"
FT                   /note="PFAM: Protein of unknown function DUF2587; KEGG:
FT                   rer:RER_02610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73091"
FT                   /db_xref="GOA:D2S4Y0"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y0"
FT                   /inference="protein motif:PFAM:PF10759"
FT                   /protein_id="ADB73091.1"
FT                   /translation="MTAPDNGSGRPQQVVVVGPDGRPVGTMPGPDGALGGQGSDGGGAL
FT                   GDMVEQPAKVMRIGTMIKQLLEEVRAAPLDDASRNRLRDIHASSIRELEQGLAPELREE
FT                   LERITLPFSEGETPSDAELRIAQAQLVGWLEGVFHGIQTALFAQQMAARAQLEEMRRRA
FT                   LPGGSSPAPGPHPHPGGGQYL"
FT   gene            305259..306482
FT                   /locus_tag="Gobs_0289"
FT   CDS_pept        305259..306482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0289"
FT                   /product="cysteine desulfurase family protein"
FT                   /EC_number="2.8.1.7"
FT                   /note="KEGG: stp:Strop_1769 cysteine desulfurase family
FT                   protein; TIGRFAM: cysteine desulfurase family protein;
FT                   PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73092"
FT                   /db_xref="GOA:D2S4Y1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y1"
FT                   /inference="protein motif:TFAM:TIGR01976"
FT                   /protein_id="ADB73092.1"
FT                   /translation="MGPGEGRLDVARVRGLFPGLSDGLVHADGPAGSLLPENVVLAVAQ
FT                   AMRVPVADRGGAFPASARAEGLLASARTAVADLVGGVSGGVVLGPDTARLTWTLARALA
FT                   RTWRPGDEVVVSRLDHDANVRPWVELAVRAGVGVRWAEVDIETGELPDWQYDELLGPRT
FT                   RLVAVTAASSAIGTRPDVAAIARRAHAVGALVFVDATHAAAHDLLDLRALGADFLAVAA
FT                   DMWCGPHVGAVVADPALLVELEPEKLAPVPDRVPDRFESGGHAFELLAGVPAAVEHLAS
FT                   LSEDACGTRRERLETSMAAVAAYERGLFDWLDQALRAMRHVQVIGSAPLTTPALSFTVA
FT                   GMRPRQVAHELSRRGICAWDGDLYARELFDALGVNEEGGAVQLGLMHYNTAEEVGYLID
FT                   AVAALRPR"
FT   gene            complement(306566..307555)
FT                   /locus_tag="Gobs_0290"
FT   CDS_pept        complement(306566..307555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0290"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV_4368 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73093"
FT                   /db_xref="GOA:D2S4Y2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y2"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADB73093.1"
FT                   /translation="MRAVTVSGPGGPEVLGWGEVPDPVLRPGEVLVDVVATAVNRADLL
FT                   QRAGAYPPPPGASDVLGLECSGVVSEVGEGVAGWSVGDEVCALLSGGGYAERVAVPAGQ
FT                   LLPRPAGVELATAAALPEVVCTVWSNVFMLAGLRRGDTFLVHGGSSGIGTMAIQLAARA
FT                   GARVLTTAGTQAKLDVCRELGAEVGINYRAEDFVERVREETDGAGADVVLDNMGAKYLA
FT                   RNVDVLATGGRLVCIGMQGGTRAELDLGKLMRKRASVHATTLRARPATGPGGKAEIVAA
FT                   VRHDVWPDVERGVVRPIVDRRLPMSRAAEAHRVVDASEHVGKVLLLAQ"
FT   gene            complement(307543..308369)
FT                   /pseudo
FT                   /locus_tag="Gobs_0291"
FT   gene            308444..309523
FT                   /locus_tag="Gobs_0292"
FT   CDS_pept        308444..309523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0292"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain; KEGG:
FT                   bcv:Bcav_1816 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73094"
FT                   /db_xref="GOA:D2S4Y3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y3"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADB73094.1"
FT                   /translation="MTARPGAVPVRPDGLDGGYGRRQAGDVTTDAVPGLPWTPVDPVGG
FT                   VLADLRIRGVFYCRAEATAPWGVEMPALEGCMSFHVVTAGRCVLEADGVRSVLQPGDLA
FT                   LVPHGRGHLLRSGPDAPIAGRADLLPQQYLAEHYSVLRLDGGGVPAGMVCGVVQPERPG
FT                   AAHLLDLLPPVLHVDGRDGARGGWLPVLLGVIADESRHDRPGSEAVVTRLADVVVIQAV
FT                   RAWLDTAATGPGWLRALRDPQVGRAVAQLHREPGTAWTLTRLAREARMSRSSFAARFTE
FT                   LAGEPAMHYVARWRMHLATVALAEGARVGELARQLGYESEAAFSRAYKRVVGVPPVAAT
FT                   RRDPGRAEAPAATRAAGAR"
FT   gene            complement(309594..311195)
FT                   /locus_tag="Gobs_0293"
FT   CDS_pept        complement(309594..311195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0293"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rha:RHA1_ro05328 CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73095"
FT                   /db_xref="GOA:D2S4Y4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB73095.1"
FT                   /translation="MALASRYPDVEIPDVSVPEFVLAAGRDKPDAPALIDGLRGDVITH
FT                   GQLAAYVDRVAAALHARGLRKGDVVAMFCPNTPWYPVVFHGIAAAGCVMSPINSLYTPD
FT                   EIAFQLRDSGAKILITVSPFLDRALAAVEKAPVGEIVVMDGAEGHASLVDLLSTDAPSA
FT                   QVDFDPADDLVTLPYSSGTTGLPKGVMLTHRNLVANVAQCRPLIQLGADERIIAVLPFF
FT                   HIYGLTVLMNQGLAWGGAVVTLPRFDLEDFLRTIQDHKITRAFVAPPIVLALAKHPLVD
FT                   QYDLSSLTSVLSGAAPLDEQLALAAEKRLRKGADSGVTVAQGYGMTELSPVSHTTPDLG
FT                   AEPPGAAPGSVPKGSVGFAVPNSECRLVDPATGEDAAPGTRGELWVRGPNVMKGYLNNP
FT                   TATADTIDADGWLHTGDVAVVDENGCYTVVDRVKELIKYKGYQVAPAELEAVLIGHPEI
FT                   ADAAVIGVPDEESGEELPKAFVVRAPGSTLTQDAVIEYMAGKVAPHKKIRIVEFIEAVP
FT                   KSAAGKILRKDLRAAG"
FT   gene            complement(311357..311782)
FT                   /locus_tag="Gobs_0294"
FT   CDS_pept        complement(311357..311782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0294"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rxy:Rxyl_0908 phenylacetic acid degradation- related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73096"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y5"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADB73096.1"
FT                   /translation="MAATGFHTADELNALLPGTLPGLLGLTITAHEPGRLEAALDVRPE
FT                   LLAPNGYLHAATVVGLADTACGLATRALLPEGSSGFTTIELKSNFLGTLREGRVMTVAT
FT                   NAHAGRTTQVWDAVVTAAGSGKTVALFRCTQSVLWPR"
FT   gene            complement(311899..312774)
FT                   /locus_tag="Gobs_0295"
FT   CDS_pept        complement(311899..312774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0295"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: saq:Sare_0649 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73097"
FT                   /db_xref="GOA:D2S4Y6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y6"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADB73097.1"
FT                   /translation="MRGAGLLRLGALSVPDGALVVMAIVNRTPDSFYDRGATYELAAAV
FT                   ERVDRVVAEGADMVDVGGVKAAPGEEVDAAEEIRRTVDLVAAIRAAHPTLPISIDTWRA
FT                   EVAREALAAGADVVNDAWGGVEPELAAVAAECGAGIVCTHAGGLPPRTRPHRVAYDDVV
FT                   ADVVARTTALAEAAVAAGVDRDRVLVDPGHDFGKNTRHSLEATRRLDELVATGWPVLVA
FT                   LSNKDFVGETLDVPLDQRLTGTLAATAVSAWLGATVFRAHDVAATRQTLDMVASIRGDR
FT                   PPARTTRGLA"
FT   gene            312832..313293
FT                   /locus_tag="Gobs_0296"
FT   CDS_pept        312832..313293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0296"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   sgr:SGR_5802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73098"
FT                   /db_xref="GOA:D2S4Y7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y7"
FT                   /inference="protein motif:PRIAM:4.2.1.17"
FT                   /protein_id="ADB73098.1"
FT                   /translation="MAQTTVEGVEGVLAKVGQHLGHSDWVEITQEQVDKFAEATHDHQW
FT                   IHVDVERAKRESPFGGPIAHGYLTLSLVSALSGQIIEATGFRMGVNYGADKIRFMSPVP
FT                   VGARVRASATLDEAKQFEGGVQMNLGITMEIENQSKPAMVASILFRRYL"
FT   gene            complement(313465..314718)
FT                   /locus_tag="Gobs_0297"
FT   CDS_pept        complement(313465..314718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0297"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sen:SACE_2212
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73099"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y8"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADB73099.1"
FT                   /translation="MTALEVDTDPAEVGFDAARLARLDRRLARWVDDGQLPGYLVTVAR
FT                   HGHLVHVSSAGYRDVEAGLPVERDTRWRIYSMTKPITSVAAMMLYEEGAFELSDPIAKW
FT                   LPEFAETRVYVAGSALKPVTQPQVEPIRVRHLLTHTSGLTYGFHHAHPVDAMYRAAGHE
FT                   WGTPAGADSAEVCRQWAVIPLVFQPGSEWNYGVSTDVLGRLVEVVSGLPLDEFFEQRIF
FT                   RPLGMTDTSFGLREGDDVDSLARLYAAVPGQPGGAPTRFAPYDAMGAAAHAKPAFLSGG
FT                   GGLVSTAGDYLRFVELLRRGGSYDGGRLLSTRTIGYMTRNHLPGDQDLETFGRPLFAET
FT                   PLRGVGFGLGFSMVIDPVRYGVLSSLGDYSWGGAASTAFYVDPVEDVTVGFYTQLLPSS
FT                   TLPIRNHLRQLVNQALAD"
FT   gene            complement(314891..315175)
FT                   /locus_tag="Gobs_0298"
FT   CDS_pept        complement(314891..315175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0298"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   bcv:Bcav_2752 histone family protein DNA- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73100"
FT                   /db_xref="GOA:D2S4Y9"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Y9"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADB73100.1"
FT                   /translation="MNKAELVSAIAKRADVPTSTVDSVLTGLQDELVDAITRGEKVAVS
FT                   GLLTVERTQRSARTGRNPQTGESIDIPAANTVKVTAGSNLKKAASNVPV"
FT   gene            315443..316360
FT                   /locus_tag="Gobs_0299"
FT   CDS_pept        315443..316360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0299"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sco:SCO4109
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73101"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z0"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB73101.1"
FT                   /translation="MIPGTDLTVSDLCLGGNVFGWTADEPTSFAVLDRFTDATVSTLAP
FT                   FVDTAESYGRGASEEILGNWMTERGLHDRMVVATKASRLEKEHPLSAAEIRTAVEGSLR
FT                   RLQTDRIDLYYAHYDDGSTPLEETLRAFDELVQAGKVRYVAASNYSPDRLTEALETSGR
FT                   RGLTRYVALQPHYNLMERAVYEDGLRDVVAAHELGVLPYYALAKGFLTGKYRAGEQVDS
FT                   PRAEGASAYVGERGDRVLAALRQVAEAHGVTVAAVALRWLADRPTVVSPIASGRSVEQL
FT                   ADLLPMQDLVLTEEQTQALDTASA"
FT   gene            complement(316443..317531)
FT                   /locus_tag="Gobs_0300"
FT   CDS_pept        complement(316443..317531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0300"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; SMART: EAL domain protein;
FT                   KEGG: ace:Acel_0529 diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73102"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z1"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ADB73102.1"
FT                   /translation="MHDGPPVSSLPDCRPLLADPDDLTLVFQPIVDLAAVRVVGYEALS
FT                   RFPGTAGPGVWSAAASDCGLAAELEALAIAKALAVVPLLPADTFLTVNVSPHLLGSAPV
FT                   QEALAARPNLHRVVVQLTGHTPADDLDALRRQTDALRTRGALVALDDAGSGLQQMAAVR
FT                   PRLVTLDRALVTGVDTDPVRTALAEVVGEFAGRIDARLLAEGVETVAELAALTRLGVPL
FT                   AQGWLLGRPASGFAPLAPEVAALVRTHAARAQVTRGVAALVRPVRQSDAGEPPSAVPPA
FT                   VLVGGRGEPVALWLACPRTGAPYLAPVSLQASPTDDVAATLQRAVTRPAAQRFDPVLCT
FT                   DASGAVVGLLRVEDLATAVARS"
FT   gene            317714..320546
FT                   /pseudo
FT                   /locus_tag="Gobs_0301"
FT   gene            complement(320693..321412)
FT                   /locus_tag="Gobs_0302"
FT   CDS_pept        complement(320693..321412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0302"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   rpa:RPA2993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73103"
FT                   /db_xref="GOA:D2S4Z2"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z2"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ADB73103.1"
FT                   /translation="MEILAAAAETLRVPAPVDLAAIVIGALTGGLLAAREGFAVSGVLL
FT                   LAVSGGLGGGLVRDVLLGDLPPVALTNPAYLPTVAITAAVTFYFSGWLSRLTGLLVVLD
FT                   AVTLGFFTVIGAQKAQLAALPSASVVFVGTLTAVGGAVIRDVLLAQRADIVQPGPYNAV
FT                   AALLGAIALTVLAGPVGLDPIPVAALVIVLVAALRVLSVWRGWEAPVAVDLPGRARRRL
FT                   RRQRAGRPARWRRRDRR"
FT   gene            321636..323171
FT                   /locus_tag="Gobs_0303"
FT   CDS_pept        321636..323171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0303"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: aau:AAur_pTC20148 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73104"
FT                   /db_xref="GOA:D2S4Z3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z3"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ADB73104.1"
FT                   /translation="MPVRPPDENEVAALAASYGMKPTAEEVAAYTPIVAAFLTSYDAVE
FT                   ELYAGIAPQAPDDRPSTRPAEADNPLGAWYVTTEIRGAAEGPLAGRTVAVKDNVEVAGV
FT                   PMMNGSHTVEGFVPREDATVVTRLLEAGATITGKSVCEDLCFSGGSHTSVTGPVRNPWD
FT                   PSRTTGGSSSGSAALVASGEVDLAVGGDQGGSIRMPAAFSGIVGHKPTHGLVPYTGAFP
FT                   IELTLDHLGPMTRTVADAAAMLDVLAGRDGDDPRQPADVVPEQYAAALDGDVAGLRVGV
FT                   VAQGFGWEELSEDGVDDTVRAAAERLRELGIEVVDVDLPWHRHALHVWNVIATDGATVQ
FT                   MVEGNGYGWNYEGRYDPELIAHYGRQRREVVDRWSPTVTAVALTGRWSLEREQTRHYAM
FT                   AQNLATEVRRQYDAALADVDLLVMPTVPMVAPEIPAPDDPVETRVARALEMIVNCAPFD
FT                   VSGHPATSVPAGLSQGLPVGMMLVGRRFEDTTPLKVAHAFEQLVGGFPRPPAR"
FT   gene            complement(323297..325309)
FT                   /locus_tag="Gobs_0304"
FT   CDS_pept        complement(323297..325309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0304"
FT                   /product="acyl-CoA oxidase domain protein"
FT                   /note="PFAM: acyl-CoA oxidase domain protein; acyl-CoA
FT                   dehydrogenase domain protein; KEGG: sen:SACE_7372 acyl-CoA
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73105"
FT                   /db_xref="GOA:D2S4Z4"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z4"
FT                   /inference="protein motif:PFAM:PF01756"
FT                   /protein_id="ADB73105.1"
FT                   /translation="MTTSLPHAVDPRTLTEVLDGRWGHVRHDARENLHDPDLLPVYGEN
FT                   VQEARERVTRMAEKIAASGRVTLGFPKEYGGEGDAGGSVTAIEMLAFTDLSLMVKAGVQ
FT                   WGLFGGAVQALGTERHHDAYLRDIMGFDLPGCFAMTETGHGSDVQQLRTTCTYDPGTRT
FT                   FDLHTPHEAARKDYIGNAAKDGRMAVVFAQLVTKGERHGVHAWLVPIRDEQGAPMPGVT
FT                   IGDDGPKAGLLGVDNGRLSFDHVTVPRDMLLDRYGQVAEDGTYTSSIENETRRFFTMLG
FT                   TLVRGRVSVGGSAAAATKLALDIAVRYGQTRRQFSAPGADREVLLNDYLVHQRKLLPAL
FT                   AATYAYSFAQEELVGTMHDVQGAEDLDEGAQRELESRAAGLKAAQTWHATRTIQTAREA
FT                   CGGAGYLQENRLPHLKADTDVFTTFEGDNTVLLQLVAKGLLTGYRDAFGSLDGWGKVGF
FT                   IADMVRETVLERTAARGLIARLVDAVPGREDEVPLLDRGWQLKMLEDREKHLLEGAIRR
FT                   LRRGAETPGARPFDVFNDVQDHVLRTAQAHTDRIVLEAFVAGIERTTDAGAKALLERVC
FT                   DLYALTTIEADRAWFLEHGRLTPNRSKALTATVNGVLKELRPHLVTLVDAFAIPEDWKG
FT                   AAILREEPARQEAMATGDAELRRGTATSVEVPPGQ"
FT   gene            complement(325306..325953)
FT                   /locus_tag="Gobs_0305"
FT   CDS_pept        complement(325306..325953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0305"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_4029
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73106"
FT                   /db_xref="GOA:D2S4Z5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB73106.1"
FT                   /translation="MKSETSRRDRRDSRWDEHRRARREQLVDATITAVGRHGAGVGMEE
FT                   IATAAGTSKAVVYRHFADRSELHVAVCARVAANLTDRLREAMDTTTDPRQMLTAAVETY
FT                   LAFLEADLELYRFVVQGPPVGHPADSDPIANLSHLVGDQAAALVAVVLEQAGRDPAAAR
FT                   PWGHGLVGLVRSAADWWLQADRPMPRVELAAHLTDLTWAGLSGVVTRKEDNA"
FT   gene            326050..327336
FT                   /locus_tag="Gobs_0306"
FT   CDS_pept        326050..327336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0306"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: nca:Noca_2847 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73107"
FT                   /db_xref="GOA:D2S4Z6"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z6"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADB73107.1"
FT                   /translation="MAPQTRRAAIVGGNRIPFARSNSAYAQASNQDMLTATLDGLVARF
FT                   GLQGAQVGEVVAGAVLKHSRDFNLTREAVLGSRLSAATPAYDVQQACGTGLEAAVLVAN
FT                   KIALGQIESGIAGGVDTTSDAPLAIHDEMRRVLITLSSARTLRQRLEALAGVRPGMFVP
FT                   EAPRNTEPRTGLSMGDHQAITAKEWGVSREAQDELTVRSHQNLAAAYERGFFDDLVTPY
FT                   LGLTRDENLRPDTSMEKLAKLKPVFGTGDPDATMTAGNSTPLSDGASAVLLASDAWAAE
FT                   RGLPVLAHLVDAQTAAVDHVHGGEGLLMAPAYAVPVLLARNGLTLQDFDFYEIHEAFAS
FT                   TVLATLEAWEDPAFCKERLGLDAPLGAIDRSKLNVNGSSLAAGHPFAATGGRIVASLAK
FT                   QLHQEGPGRRGLVSICAAGGQGVVAILES"
FT   gene            327351..328694
FT                   /locus_tag="Gobs_0307"
FT   CDS_pept        327351..328694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0307"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   stp:Strop_0141 3-ketoacyl-(acyl-carrier- protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73108"
FT                   /db_xref="GOA:D2S4Z7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB73108.1"
FT                   /translation="MTDWYRDLANSGVGSTLVEQLGLPRPAVLRRYEPGAPLLTGPAVV
FT                   GTAGGGGLHEILTRVLEDAGVPVRSSAATDGERLGAVLLDATGGTGPADLAAAHEVLAP
FT                   AVKRLGPSGRVLVLAHPPSDADSPAQAAARQALEGLVRSLAKELRNGATANLLFVPVGA
FT                   EASVPGPVRFFLSGRSAYVDGQVVTLTAADVPAGEDAERPLAGKVAVVTGAARGIGAAI
FT                   ARVVARDGAHVVAVDVPAAGQSLAEVANEIGGTAFQLDITAPDAAQRLIAHLRERHGGV
FT                   DVVVHNAGITRDKLLVNMDAARWNSVMAVNLQAQLDVTQALLDAHGVLRPGARVVCVSS
FT                   QSGIAGNRGQTNYAASKAGIIGMVRAWAPAFAERGATINAVAPGFIVTEMTAKMPFGTR
FT                   EIGSRINSLQQGGLPVDVAETIAWLSQPSAAGVNGQVVRVCGQSFLGA"
FT   gene            328694..329548
FT                   /locus_tag="Gobs_0308"
FT   CDS_pept        328694..329548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0308"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   sen:SACE_7302 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73109"
FT                   /db_xref="GOA:D2S4Z8"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z8"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADB73109.1"
FT                   /translation="MARTVLEAAPSMPALFARAVATARGRGGDLPDTRLARTGVRVEAA
FT                   DLAAYDRVCGFPLADTLPPTHPHVLTFPLQLALMSDRSFPLALPGLVHVRNRVEVLRPV
FT                   QADEALDLEVWAERFARHPRGATVDLCASVSAGGAEVWRSRSTYLARGARAPEGAPGSD
FT                   LDLAVGDLARPVATWRVPDDAGRRYARVSGDVNPIHLSGLTAKAFGFKRAIAHGMWVKA
FT                   RALATLTGRLPDAMTVDVVFRKPLLLPSTVTLSTAAVGGGWDLAVRNARSGAEHLLGTV
FT                   RPR"
FT   gene            329653..331467
FT                   /locus_tag="Gobs_0309"
FT   CDS_pept        329653..331467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0309"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   glycoside hydrolase family 2 TIM barrel; KEGG: scl:sce3052
FT                   glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73110"
FT                   /db_xref="GOA:D2S4Z9"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2S4Z9"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ADB73110.1"
FT                   /translation="MEHTDPTEHPRPLLRRPWTSLDGEWEFAADPDLVGTVGGIAFDRT
FT                   IRVPYAPETPASGVTWPGRLNRAWYRRRLPGRAGDRRTVLHFGAVDRICDVWVGGAHVT
FT                   SHEGGYTPFSVDVTDFLGDDGADLVVRADDDPLDLEAPRGKQDWRDEPHEIWYPRTTGI
FT                   WRTVWLEQVGSRRIADVQWRAHPRTMQLDVRVELAAPLAGARLHLRLRAGDRLLVDDSV
FT                   RVDGRVVERTVQVGDGGIDDRSRLLWRPGPDPVLLDAELTLVADDGELLDEVESYTALR
FT                   SVEVGDGRLLVNGRPAPLRLVLDQGYWPDTGATPPDVAALRRDLELTRALGFTGARKHQ
FT                   KTEDPRYLALADRMGLVVWAEMPSAYRPGPTASARLLREWADVVVAHRGFPSVVAWVPL
FT                   NESWGVQEAEVDERQRGLIRAMAATADALDGTRPVSANDGWETLGGDILGVHDYEQDPA
FT                   VLGERYATAEDLERLATGRRPDGYLADLERAGVAGRAVVLSEFGGVALRSPEDEGWGYA
FT                   DATSPEDLLARYRAQWAAVHGSTALAGACWTQLTDTYQEVNGLLGMDRVPKVDIEALRR
FT                   ATLGEPEAPPAPPAPPAPPIQPTRLSPS"
FT   gene            331694..333232
FT                   /locus_tag="Gobs_0310"
FT   CDS_pept        331694..333232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0310"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: kra:Krad_3863 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73111"
FT                   /db_xref="GOA:D2S500"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2S500"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADB73111.1"
FT                   /translation="MRSNRLLPLLAAGALVLSACGGGGESVDTGTGGGGGGGGGGSTLV
FT                   AAVSAQPDQFDPHVTTAYPSFQVLENVYDTLVVPNAEDLTMEPSLAESWETSEDQLTWT
FT                   FTLRDGVTFHDGSAFDSADVVYSYRRIIDEQLSNSFRFQNVASVEGPDPRTVVITLTQP
FT                   TPNLLERIGSFKGMAILPENAAADLDLTTEANGTGPFQLESSDASSTVLTAYQEHWGGA
FT                   PSVDGVEFRYITEPAAALTALQNGEVQWTDNVPPQQIESLGGDDTVELQTTPSVDYWYL
FT                   SMNYARPPFDNRDVRRAISFAVDREAVAEAAWFGAAQPNQTAIPEDSFFHTDYAPFQPD
FT                   PDQARQLLEQAGVQTPLTMGLMVTDEFPETVTAAQVIASQLEPIGINVEIETLDFATWL
FT                   DRQGQGDFDAFYLGWLGNLDPAAYYQEQHQTDGPNNYQGYSNPQVDQLLQAGATETDDN
FT                   ARKQIYDQAAQLIVDDVSYLYLYNPDVVQAWAPGLSGYQIRADKAINFESVELP"
FT   gene            333229..334170
FT                   /locus_tag="Gobs_0311"
FT   CDS_pept        333229..334170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0311"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: kra:Krad_3862
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73112"
FT                   /db_xref="GOA:D2S501"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2S501"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB73112.1"
FT                   /translation="MTGYLLRRVGQSLVVLAGVSVIVFGLVQLVPGDPIRLALGTRFDQ
FT                   ETYDALLARSGLDQPLVTQYFGWAGRALTGDLGVSFRSGETVTSLIGERLPATLTLAFA
FT                   SILVALLIAVPLGTLSALRPRSVVDRVATVLSQIGISVPEFWMAIVLILVFAGTLGWLP
FT                   SGGYVPLTEDPGGWARRLLMPAVVTGVVSGSVITRFVRSSVLEALGADHVRTAQAKGLP
FT                   ARQVFTWHVLRNALLPLVTVTGVQLAYLLSGVVVVEIVFSWPGLGQLALQAVQSRDYPV
FT                   LQGAILLFAVVFLLINLVVDLLYTAIDPRIRR"
FT   gene            334220..335161
FT                   /locus_tag="Gobs_0312"
FT   CDS_pept        334220..335161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0312"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: kra:Krad_3861
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73113"
FT                   /db_xref="GOA:D2S502"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2S502"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB73113.1"
FT                   /translation="MTGAPLPEPAASPTATDAGVPSTARPPRPRWRQTLGLLARNPTAA
FT                   VAATVLLGIVLMAVFDESLAPEGPNVIAVEDRLQPPSLDHPFGTDDLGRDILSRVILGA
FT                   AVSLRVGFLAVAFALVVGALIGLLAGYYGRWVDDVLMRFMDVLFAFPAVLLAIAVLAVR
FT                   GPGAGNTALAIGIVYIPVFARVTRASVLGVREEVYVRASRSVGASDFRLLTRHVLPNAA
FT                   PPIIVQTSISLAFAVLAEAALSFLGLGTQPPNPSWGLMLAEGRGFIDLAWWLAFFPGMA
FT                   IFLTVLCFNLLGDGLRDVLDPRQRTLMAGSGR"
FT   gene            335158..336156
FT                   /locus_tag="Gobs_0313"
FT   CDS_pept        335158..336156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0313"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: kra:Krad_3860 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73114"
FT                   /db_xref="GOA:D2S503"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S503"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB73114.1"
FT                   /translation="MSAPLLEVEDLRVRLRTPRGPAEVVNGLSYTVGRGETVAVVGESG
FT                   SGKSVSVLALLGLLPARVATVTGAARLDGEDLLTMPPERLRQVRGPGVGMVFQDPMTSL
FT                   NPVLTIGRQLIEGIRAHGEVSKAEARDRAAGLLAEVGLPDPQRALDRYPHELSGGMRQR
FT                   VVIAIALANNPSLLIADEATTALDVTVQAQILDLVAELQSEHGTGVIWITHDLGVVAGI
FT                   ADRVLVMYGGRCVEDGSVDDVLERPAHPYTRGLLGALPDLASSGDGELATVPGTPPAPT
FT                   ALPAGCVFWPRCPVRSDPRCETEQPPLAVVGASTGGLPHRAATWCSEGSSR"
FT   gene            336153..337265
FT                   /locus_tag="Gobs_0314"
FT   CDS_pept        336153..337265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0314"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: kra:Krad_3859 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73115"
FT                   /db_xref="GOA:D2S504"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S504"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB73115.1"
FT                   /translation="MTDLPQGPTAHARGVPASDVPASRVPASDVLVSARGLEVHFPVRS
FT                   GSALRRTTGLLRAVDGVDLDIRRGETLGLVGESGCGKSTLGNALLRLVEPTGGTVTFDG
FT                   TDVTGLDRRGLRDLRRRAGMVFQDPFASLDPRRTVRQTVSEPLEVHGLRSGRQERSARV
FT                   AELLELVGLDPAVADRYPHEFSGGQRQRVGIARALAGEPDFLVCDEAIASLDVSVQAQV
FT                   LNLLRRLQRQLGLTLLFISHDLSAVRHVSDRIAVMYLGRVVEVGPAAAVGSDPKMPYTQ
FT                   ALLSAVPVPHPALERTRQRIVLGGDVPSPANVPSGCRFRTRCPYVFEPCPDVDPALQPV
FT                   GAPGQHAACHLHGVVGRPVEREDAAPAPAD"
FT   gene            337567..337980
FT                   /locus_tag="Gobs_0315"
FT   CDS_pept        337567..337980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0315"
FT                   /product="PPOX class putative F420-dependent enzyme"
FT                   /note="TIGRFAM: PPOX class probable F420-dependent enzyme;
FT                   PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: sen:SACE_4416 pyridoxamine 5'-phosphate
FT                   oxidase-related,FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73116"
FT                   /db_xref="GOA:D2S505"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019967"
FT                   /db_xref="UniProtKB/TrEMBL:D2S505"
FT                   /inference="protein motif:TFAM:TIGR03668"
FT                   /protein_id="ADB73116.1"
FT                   /translation="MRTVELRRRFASSAVARLATVRPDGAPHLVPLVFALVDGTVYSAV
FT                   DAKPKRTSRLQRLANVRVEPRCALLVDHYEDDWSHLWWVRADGTATVVDDPPATHPGLA
FT                   ALAERHPQYREQPPAGPLLVVTVQQWSGWSSTT"
FT   gene            337995..338854
FT                   /pseudo
FT                   /locus_tag="Gobs_0316"
FT   gene            338912..339637
FT                   /locus_tag="Gobs_0317"
FT   CDS_pept        338912..339637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0317"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; Methionine biosynthesis MetW protein; KEGG:
FT                   ana:alr5231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73117"
FT                   /db_xref="GOA:D2S506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2S506"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADB73117.1"
FT                   /translation="MCQGGPMAGVEQRSGRRTAAHGYYAGHSVHAAPGVHEYAVELVRA
FT                   ALPQGGRVLEVGAGCGALALRLRDAGLDVVPTDLDPPHDWIHRLDLDDPQWTDETQGPF
FT                   DMVVCVETLEHVENPRQVLRSIRSLLRPGDKLLVSTPNVTHPHSRLKMLLRGAPYIFGP
FT                   KHYHQPGHITILPDWMLTEHVRLAGFGSIEVRTGGDTFYRGVVRLAYRVEIALLALLGV
FT                   RQRADSGQGICTFVTAVAV"
FT   gene            339932..340564
FT                   /locus_tag="Gobs_0318"
FT   CDS_pept        339932..340564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73118"
FT                   /db_xref="UniProtKB/TrEMBL:D2S507"
FT                   /inference="similar to AA sequence:KEGG:Francci3_0140"
FT                   /protein_id="ADB73118.1"
FT                   /translation="MSSIVGTRFNEVVLGGVVRQGWWLVVDEEDGSGFVLDGPFGDRDE
FT                   AVWALDDLEDAPAGLHPVYGVRRADGLLRRRSSPQDRTWWSFLGEQVDRLPEGWDADLD
FT                   DEHPLPGLVVEVVAVLAEAGLFLYDPSGADGELGGVCLTPEATLDGVVVSWRQHDRMSL
FT                   DQLHGAAADALVQQVMNRALAEVLSVRGFAVEPLGGACVVREGELPE"
FT   gene            340773..341012
FT                   /locus_tag="Gobs_0319"
FT   CDS_pept        340773..341012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73119"
FT                   /db_xref="GOA:D2S508"
FT                   /db_xref="UniProtKB/TrEMBL:D2S508"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73119.1"
FT                   /translation="MAATPFRPPWFGNRGVQVLAGGALAYCLVQLVVQLVDGLWAQAFL
FT                   NFAWSVLFGYVLVESLRFRREQDAAPGGPVEPGD"
FT   gene            341069..341155
FT                   /locus_tag="Gobs_R0007"
FT                   /note="tRNA-Ser1"
FT   tRNA            341069..341155
FT                   /locus_tag="Gobs_R0007"
FT                   /product="tRNA-Ser"
FT   gene            complement(341371..342015)
FT                   /pseudo
FT                   /locus_tag="Gobs_0320"
FT   gene            complement(342657..344162)
FT                   /locus_tag="Gobs_0321"
FT   CDS_pept        complement(342657..344162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0321"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: mlu:Mlut_00860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73120"
FT                   /db_xref="GOA:D2S509"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D2S509"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADB73120.1"
FT                   /translation="MEQLSNLIGGFGDILSPSALLFVLIGALLGTAVGVLPGLGSAMAV
FT                   ALLLPLTFVLEPTNALIMFTGIYFGGLFGDSISGILMNTPGNSTAIASAFEGYRMAQSG
FT                   RAAQALATAAIGAFIGGTVASVLVVFFAPTLAELATGFGPAEFFALAVLAFIAISAVVT
FT                   DSAVRGLAALAIGLVLAMIGIDQPTGTARFSFGSSALLDGIPIVVITVSLLALGEVFHQ
FT                   AAKAGGRGTQDTVLPSGRPWLSGSEFRAALPAWLRGTGYGLPFGVIPAGGAEVPTFLSY
FT                   GTERRLDRRRAKPMFGRGAIQGVAGPEAAGNATAGTAMGALLALGLPTSATAALLLAAF
FT                   QQYGLQPGPLLLERSGDIVWPLLAGFFLAMVVLLILNLPFAPLWAQLLRVPKSYLYAGI
FT                   AVFASFGVYAAGASIIDLVIMLVIGVLGLAMRLYDIPIAPVLIAVILGPLAEYSLRDAM
FT                   ANSENDPAVLVSSPITIGLYVLLLAGLGFAAWRRVAERRRADV"
FT   gene            complement(344167..344745)
FT                   /locus_tag="Gobs_0322"
FT   CDS_pept        complement(344167..344745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlu:Mlut_00850 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73121"
FT                   /db_xref="GOA:D2S510"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:D2S510"
FT                   /inference="similar to AA sequence:KEGG:Mlut_00850"
FT                   /protein_id="ADB73121.1"
FT                   /translation="MMSEVPRATAATTPRRRPRPAHLSKGALVVPAVLVALGIFLVTGT
FT                   ATMDVVGEGGLFGPTVMPWAVAAICFVVAVFLAVDILRPRPEYDPAFGAGSRAAADSSD
FT                   GSDEIGPDTVNAAAVGTAIGGVVVFIAVLPWLGWILSATLLFAAVAIALGNRKFVTCLL
FT                   AGLALASVIQIVFSGLLGISLPAGFVGGF"
FT   gene            complement(344742..345737)
FT                   /locus_tag="Gobs_0323"
FT   CDS_pept        complement(344742..345737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cgb:cg3127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73122"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D2S511"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ADB73122.1"
FT                   /translation="MPRRRVVATLGILLVAALAVTAFTDAARSGEGQAARASLTLIAPA
FT                   AAGGGWDLVAREGQQAMRTGNIVNTVQVVNIPGAAGTIGLNQLAGLTGQGTTMMVTGTV
FT                   MLGGISQSGSGIGMQDTTPIARLAEDFEVIAVPAESPFRTFDDFVQAWAANPAAVPIGG
FT                   GSAGGIDHMVAAQVAQAAGIPVETVQYTAHAGGGELTLSLLSTAAGTVGVGISGYNDFA
FT                   DLVDGGQLRVLAVVAPERLAGIDAPTMTELGLPEVDLVNWRGLVAPQGITDAQRTELEQ
FT                   IVREMVATESWSEAVERNRWVRSEIYGEDFEQFLVEEQRRIDALLEELGL"
FT   gene            345886..346302
FT                   /locus_tag="Gobs_0324"
FT   CDS_pept        345886..346302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0324"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: ach:Achl_0593 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73123"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2S512"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADB73123.1"
FT                   /translation="MTICVAYGPTPEGAAALALAVHEARLRGTSLVALATDRQERFEHD
FT                   HATDDRALREEIERQLAELRVAGDPEMEVRVVDDGGDAAEAIIDLAVGADAELLVLGLK
FT                   RRSPVSKLLTGSIAQRIILDSPMPVLVTHAARSS"
FT   gene            complement(346995..347523)
FT                   /pseudo
FT                   /locus_tag="Gobs_0325"
FT   gene            347707..348794
FT                   /pseudo
FT                   /locus_tag="Gobs_0326"
FT   gene            complement(348739..349860)
FT                   /locus_tag="Gobs_0327"
FT   CDS_pept        complement(348739..349860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0327"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; FAD dependent oxidoreductase;
FT                   KEGG: stp:Strop_0862 geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73124"
FT                   /db_xref="GOA:D2S513"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2S513"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADB73124.1"
FT                   /translation="MERWDVVVVGGGPAGAAAALAVRRTGASVLVVDRADFPRDKVCGD
FT                   GVAPEALDVLAGLGADPGELVAGYPPVPRLSLRSPGGAVVERDTHRPSYVVPREVLDAR
FT                   LLAAARAAGAHFRRHAVRTVTVDADGATVDGGLRAEVLIGADGAESVVRRALGLSSNRP
FT                   DRLAVAIRGYAPALPAQGLTQVLVTTEQRWPAYAWSFPLGDGRANVGYGELVSGGATRA
FT                   ALVDGLHRLLPGVVPAALRAHRLPLSTGRPRLPDGRVLLAGDAASLVNPLTGEGIFYAV
FT                   LSGALAGTAATAGAGAGARYRRLLRRRLAGHLRASRLASELSRWPPVMDAAVRAAGADQ
FT                   RVFDDVVALGLSDGRLTGRTVAAAARRLAGGRD"
FT   gene            complement(349960..350529)
FT                   /locus_tag="Gobs_0328"
FT   CDS_pept        complement(349960..350529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bur:Bcep18194_A5601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73125"
FT                   /db_xref="GOA:D2S514"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D2S514"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADB73125.1"
FT                   /translation="MRVAVFTGSQSGPPSHRSAVAEFAAGLARAGVGIVYGGGRAGLMG
FT                   VVADAALAAGGDVVGVIPQHLVDDELAHPGLPQLEVVASMHERKARMAELADAFVALPG
FT                   AAGTLEELFEAWTWGMLGLHAKPAVLVDVDGFWQPLLAQLRRMVDDGYLDARRLDALGV
FT                   VTEPAELLAFVERYEHPVRKWAPTPP"
FT   gene            350608..351051
FT                   /pseudo
FT                   /locus_tag="Gobs_0329"
FT   gene            complement(351066..351854)
FT                   /locus_tag="Gobs_0330"
FT   CDS_pept        complement(351066..351854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0330"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   fra:Francci3_3798 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73126"
FT                   /db_xref="GOA:D2S515"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2S515"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADB73126.1"
FT                   /translation="MRLGTVNTASGRSPGGPVLDAAGLEKAVAGLDVDVLAVQEVDAGQ
FT                   PRSHGVDQAAALAAGLGAADWRGAATVAGTPDPFRSWSPAGPLLRGPHTPADGPLYGIA
FT                   LLSRLPVLEWSVLDLGAGRARLPVQGPDPRTGRVRWWWFPDEPRAAVAARLGSLTVVAT
FT                   HLSFAPPTAVRQLLRLRRWIAGMPGPVVLAGDLNLPGALPGRLLRATPLVREPSFPASG
FT                   PRVQLDHLLAVGNGLRGRDAEASTLPVGDHRALTVTVTPA"
FT   gene            352135..353025
FT                   /locus_tag="Gobs_0331"
FT   CDS_pept        352135..353025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0331"
FT                   /product="naphthoate synthase"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: nca:Noca_0258
FT                   1,4-dihydroxy-2-naphthoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73127"
FT                   /db_xref="GOA:D2S516"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D2S516"
FT                   /inference="protein motif:TFAM:TIGR01929"
FT                   /protein_id="ADB73127.1"
FT                   /translation="MTARDDVSEIFDSAAWQPVEGFDFSDITYHRAVDAGVVRIAFDRP
FT                   EVRNAFRPQTVDELITALEHARLSTDVGCVLLTGNGPSPRDGGWAFCSGGDQRVRGRYG
FT                   YEHDTGRSSGRLHVLEAQRLIRFMPKVVVCVVPGWAAGGGHSLHVVADLTLASAEHARF
FT                   KQTDADVGSFDGGFGSAYLARQVGQKFAREVFFLGQEYSAEDAHRMGMVNRVVPHAELE
FT                   TTALEWGRRIVAKSPTAQRMLKYSFNLIDDGLVGQQLFAGETTRLAYMAEEAVEGRDAF
FT                   LEKRDPDFSRFPWHV"
FT   gene            353119..353451
FT                   /locus_tag="Gobs_0332"
FT   CDS_pept        353119..353451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73128"
FT                   /db_xref="UniProtKB/TrEMBL:D2S517"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73128.1"
FT                   /translation="MIVEVVGGADELPEVRVVDVDDLTALQLALGAVTDEEADQALRDA
FT                   GLGRVQDADTGVLDLAALRAAAEPQAGSHDWAQRWDGMVGQAREAGRLVDDGAGLQVRV
FT                   ESAAGA"
FT   gene            353592..354185
FT                   /locus_tag="Gobs_0333"
FT   CDS_pept        353592..354185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0333"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: kra:Krad_2037
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73129"
FT                   /db_xref="GOA:D2S518"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D2S518"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB73129.1"
FT                   /translation="MSGTPGRPLSAELSEQLLTVAVDILADEGWGKLNSDRVAARARAG
FT                   KAGIYRRWPTMAAMARSAVGRFTLVRVPPDQGSLRDDLAALVDRWRRPLDREERAAASL
FT                   VGAARHEEDLRAGLDAALVQPLAEAIRAIGARAAERGQQVPEARLAMLCSVIEAFWWQR
FT                   YTSDRGALSREEVQRVLDEVLLPVVVPDSERATV"
FT   gene            complement(354202..354882)
FT                   /locus_tag="Gobs_0334"
FT   CDS_pept        complement(354202..354882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0334"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   mrd:Mrad2831_4515 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73130"
FT                   /db_xref="GOA:D2S519"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2S519"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB73130.1"
FT                   /translation="MDRRARKKAQTRSLIRETAQALFAERGFEAVTIADIAGAADVAVQ
FT                   TVFNHFPTKEDLFFDGHTPWVDGAADSVRSRAPGTTPLEALHAYLIERVAVHARQLATR
FT                   DGRVFDATLEASPALRARERELQHEATARLADALFETWTVEGGAPPVPTDVRTAASVTA
FT                   AVWLAAVRTLIVQHRRLLAGPAGALPADPEEGVALACSVADQVFSGLGSTLPPPTSGRL
FT                   RRIG"
FT   gene            355165..356136
FT                   /locus_tag="Gobs_0335"
FT   CDS_pept        355165..356136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0335"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: mkm:Mkms_3978 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73131"
FT                   /db_xref="GOA:D2S520"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S520"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADB73131.1"
FT                   /translation="MGDPRTGSRVRIGLVGAGGVGARHARTLAGFPDVELVGVTDLVPE
FT                   AADVLAGELGVPVVADVDRLLGRPLDGVWLCVPPFAHGELELAAVRAGIPFFVEKPLAT
FT                   GVEVAEEVAGAVAGTGLPTATGYHWRHLDTVAVARAVCAAHRPRLVDATWLDEVPPPAW
FT                   WSSRERSGGQVVEQLTHVLDLARLLVGEVAEVRATAAPSTAEGRDVDDATAALLSFDSG
FT                   AVGTVTAACSLPGKLAAGLAVVCDGAAVELTETSLTVTTADGADRSEPRVDGRTAVDRA
FT                   FVDVLAGGAPAAGLVDYAEALRTHRVAVAIAESVRTRDAVRP"
FT   gene            complement(356144..357346)
FT                   /locus_tag="Gobs_0336"
FT   CDS_pept        complement(356144..357346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0336"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mjl:Mjls_3920 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73132"
FT                   /db_xref="GOA:D2S521"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S521"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73132.1"
FT                   /translation="MKILMDAGPWLPVPPPGYGGLENVVATLTAELRAREHTVVLASVG
FT                   DSTLPVDGLVSAFPTGRFEQLGGPYPQVVGTAHAHEQVALATLAEHALAGEPFDLVHSH
FT                   VEVVGPALLAGLGDAAPPTLATLHWDTGRNADFWATFDGGGRVWFAGVSDTQVAQAPAQ
FT                   LRGQVVGVVPLSVPVDGPPPARRTDRSDAVLVLARLCEAKGIDTALRSCRAAGVPLVLA
FT                   GPVGGLPDREALEAALATPGHPACSHPDVAWFLEHVEPHLDGVTARWVGSVGGAAKDEL
FT                   LRTSRAVLFPVRWEEPGGTAVCEALAAGTPVVAMARGCLPSLVDDGRTGFLAADEAGFT
FT                   AALNRLDEIDPEACAAEARRRFAPAVMADGYERLYGETLARARRRSRPRLPAPRGQRAL
FT                   R"
FT   gene            complement(357343..358305)
FT                   /locus_tag="Gobs_0337"
FT   CDS_pept        complement(357343..358305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0337"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   tfu:Tfu_1730 putative glucosyl-3- phosphoglycerate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73133"
FT                   /db_xref="GOA:D2S522"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S522"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73133.1"
FT                   /translation="MRPDVRRWLHSRTFAAETWAAPDLVAVKGTRGCTVSVVLPALDEE
FT                   RTVGTIVATIRDHLVERCPLVDEVVVVDSGSSDRTAEVAAAAGARVVAADTVLPRHGSR
FT                   PGKGEALWKSLHVTSGDLLVFIDADLVAFDPRFVVGLLGPLLTDPTVGYVKALYDRPLT
FT                   TTDGIVPSGGGRVTELVARPLLNAFWPELAGFVQPLSGEYAGRRELLEQVPFVSGYGVE
FT                   LGLLVDLAALAGLDALAQVDFGTRQHTHQADAALGRMAGQILHTALARRPGAGRPKREL
FT                   LQFLRTADGLEGVSWDVGVVERPPMRSVRAVEGGRRGRA"
FT   gene            complement(358501..359475)
FT                   /locus_tag="Gobs_0338"
FT   CDS_pept        complement(358501..359475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0338"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   stp:Strop_2961 putative glucosyl-3- phosphoglycerate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73134"
FT                   /db_xref="GOA:D2S523"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S523"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73134.1"
FT                   /translation="MRPDARAWFELRTSSAPSLDALDLDALLRAKRRGQHRVSVVLPAR
FT                   DEEATVGRLVGDLHEHWVRRTPLVDELLVVDSDSTDATAAVARAAGADVVATADVLPCH
FT                   GSRRGKGEALWKSLAATTGDLVVFLDADLLGDVPHFVPGLLAPLLTDPQVDYVKGCYTR
FT                   PLEVDGSSVPAGGGRVTELTARPLLNALWPELAGFVQPLGGEYAGRRSALERVPFVSGY
FT                   GVEVGLLVDLLELCGLAGLAQVDLGVRRHTSQDQEALGRMAGQVVSTVLARAGRGWAGG
FT                   LLTQFRHDGTGFVPHSTAVAVDERPPMVSVPEYRALLDVVVVG"
FT   gene            complement(359561..361708)
FT                   /locus_tag="Gobs_0339"
FT   CDS_pept        complement(359561..361708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0339"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   sco:SCO6527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73135"
FT                   /db_xref="GOA:D2S524"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D2S524"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ADB73135.1"
FT                   /translation="MTAPSGRVLQRGRTPARVLLTWAASTAALVVLDRWLGAFTMPSWW
FT                   QPPLIALLLGLLTGVVWPLVMRVALPLAFFTLGLGSFLLLGAAVLGLSFLVPGVVIADL
FT                   RTAVVVGAAMAGVSGLVSSVLALDEDELFFRRARRRARGTADAAPCPPGVLFLQIDALS
FT                   HDTARRAVRDGSMPNLAAWLRSGSHVLTSWHTDWSSQTGASVCGILHGSNADIPGFRWY
FT                   DKDRDRIVRVSSPTDAAEIERAHSDGRGLLAGGGAGHGNLFTGDATHVSLTMSSLAHVV
FT                   PAASRRARQRRDRPGTGYYAYFANPGNALRTLAVSLVDVYRELVAAARERRDDVRPRVS
FT                   RGGIYPLARPGTTVVSRDVVVFALLEDMLAGRPVAYADFLGYDEAAHHGGLERADSLAV
FT                   LHSIDQQIGRLHRAAQLAPREYHLVCLSDHGQTQGESFATRFGETVEQLVGQLCGGPGD
FT                   LPDRHLTGPRDSRRLTEGWQVGAALAEGGGPIARRLRERVERAEGVPHAHQLPTDREGR
FT                   VPRVAPGVVVAVSGHTAMVSFADIPGRVSLEEIERHWPALLPGLVDHDGVGFLLVHSEE
FT                   HGPVALGRDGLHRLASGTVLGEDPLLPYGPHAARLVARASTFPHCPDVVVNSRYDPATD
FT                   EASAFEPHVGSHGGLGGPQQHAFLLHPRSFRPPGEVVGAEQLHRVLRGWLTDLGHPEPT
FT                   GDGAAVGALSATALRSSDVPV"
FT   gene            complement(361705..362340)
FT                   /locus_tag="Gobs_0340"
FT   CDS_pept        complement(361705..362340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0340"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   sgr:SGR_1143 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73136"
FT                   /db_xref="GOA:D2S525"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D2S525"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADB73136.1"
FT                   /translation="MSAGALAAGWTDGSSIGYPVLFGAVLLGSVVPVVPTGAVVGAGAA
FT                   FAVTAHELNLTLVVLVATLGAWAGDLVTFAICRFGGPAAVRWVARGQHADRIEEVREQF
FT                   RRHGWQIVVVGRLLPAGRIPVLLAAGALAYPWRRLLPASLLAAFLWAVAYATLGVVSGG
FT                   IFDSPLVAVLLATVLVLIVGAVLNAVGSQRRRTPDPEPEPDPSACGPA"
FT   gene            complement(362337..363212)
FT                   /locus_tag="Gobs_0341"
FT   CDS_pept        complement(362337..363212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0341"
FT                   /product="Zn-dependent hydrolase of the beta-lactamase
FT                   fold-like protein"
FT                   /note="KEGG: sgr:SGR_1142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73137"
FT                   /db_xref="GOA:D2S526"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2S526"
FT                   /inference="protein motif:COG:COG2220"
FT                   /protein_id="ADB73137.1"
FT                   /translation="MVGRGGGDAPQGSNRCRIVGPAVDTGRVGRPHLHFLGHSTVRVEL
FT                   AGHVVLTDPLLTGRVGPLRRVVPVPASETYAGVDLVLLSHLHGDHLHLPSLRLLGPDVR
FT                   VVAPRGAGAWLRARGLRHVTEVLPGESLTHGALRVTAVPAEHAGHRWGPRLTHGPDTPA
FT                   VGHLVEGGGRTVYAAGDTDLTDAMDLLGERGVDVALLPVWSWGLTLGPGHLDPAGAAEA
FT                   VARLRPRVAVPVHWGTLALRGVAHLPRMRRLLTDPPRDFAAAVAARGLDTAVVVAEPGQ
FT                   PVPLPVGTTS"
FT   gene            363413..364282
FT                   /locus_tag="Gobs_0342"
FT   CDS_pept        363413..364282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_1197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73138"
FT                   /db_xref="UniProtKB/TrEMBL:D2S527"
FT                   /inference="similar to AA sequence:KEGG:AAur_1197"
FT                   /protein_id="ADB73138.1"
FT                   /translation="MTDIDLGTAYTWDDARSRGATRGQIAQDGVRLGRGLYLSSVVEPD
FT                   LATRCRAWQLVLPRDAAFGLGTAARLHGAPIAEPPTVHVVVPSRRQLPRRAGLTVHERL
FT                   LAEEDVVVVGGLSLTSGPQTFLDLAAGLPPAELVAAGDALLRAERMDAASLARRLERAD
FT                   RVRGVVRARGCAPRLDGRAASRPESLVRYWLAISDLPDPQLQVPVHDRWGREVTHADLG
FT                   YSEWKVALEYEGRQHADPDQFGRDVDRYSLMAADGWLVLRFAGRHLGSPVVVVDRTRRA
FT                   LSSRGWRP"
FT   gene            364558..365118
FT                   /locus_tag="Gobs_0343"
FT   CDS_pept        364558..365118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0343"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   KEGG: kra:Krad_1601 molybdopterin oxidoreductase Fe4s4
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73139"
FT                   /db_xref="GOA:D2S528"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="UniProtKB/TrEMBL:D2S528"
FT                   /inference="protein motif:PFAM:PF04879"
FT                   /protein_id="ADB73139.1"
FT                   /translation="MKTWLDAWPVFRQLTGADPLGRGLAARSKATENVVSRTATADRVV
FT                   QSVCPYCAVGCGQRIYVKDEQIVQIEGDPDSPISRGRLCPKGSASKQLVTSPTRVTTVK
FT                   YRRPFGTEWEDLELDTAMEMIADRVLEARRKGWQDENDGKRVNRTMGVASLGGATLDNE
FT                   ENYLMKKLYSALGAIQIENQARI"
FT   gene            365131..367848
FT                   /locus_tag="Gobs_0344"
FT   CDS_pept        365131..367848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0344"
FT                   /product="molybdopterin dinucleotide-binding region"
FT                   /note="PFAM: molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase; KEGG: rxy:Rxyl_2724 formate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73140"
FT                   /db_xref="GOA:D2S529"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D2S529"
FT                   /inference="protein motif:PFAM:PF01568"
FT                   /protein_id="ADB73140.1"
FT                   /translation="MPGLGATFGRGGATNFQEDLANSDCIVIEGSNMAECHPVGFQWVS
FT                   EAKARGAKVIHIDPRFTRTSAIADLHVPLRIGTDIAFLGGLIRYVLDNDLYFKEYVVAY
FT                   TNAAALVSEQFVDSEDLDGLFSGFDPESNTYDEASWQYEPEEPPHSGSDDPAGAAAQDR
FT                   KEQDPEIKKTDKAQAAGSGGPPIAAKPKRDETLQHPRSVFQVLKRHFDRYTPEMVAEVC
FT                   GIEPEVFLQVARWVTENSGRERTTAWVYSVGWTQHSVGAQYIRTCSILQTLLGNIGRPG
FT                   GGILALRGHASIQGSTDVPTLYNLLPGYLPMPHALQHGDLDEYCADAAGKAGFWGNKRA
FT                   YMTSLLKAWWGDAATPENDFAFDYLPKIDGDHSSYRTIADMIQGKVSGYFLVGENPTVG
FT                   HPNGRMNRFGLANLDWLVVRDLQMIESATFWKESPEIETGELAPETIGTEVFFVPAASH
FT                   AEKEGTFTQTQRLLQWRHKAVEPPGDAKSDLWFYFHLGRLLRERLAGSTDPRDRPLLDL
FT                   TWDYPTHGHDQEPSADAILREINGTGPDGRAVSGYLELKDDGSTSCGCWIYSGVYADEV
FT                   NQAARRKPGREQGSVASEWGWAWPYNRRILYNRASADPDGKPWSERKKYVWWDEGAGRW
FT                   TGADNPDFEATKRPDYVPPDGAKAQDAIGGADPFVMQGDGKAWLFAPAGVVDGPLPTHY
FT                   EPAESVVENALYKQQANPTLEHIEGPWNRENPPLSDVFPFQVTTYRLTEHHTAGGMSRT
FT                   LPYLSELQPEFFVEVSPELAELRGLTNGEYATLVSSRTAIEAKVLVTERIRPIRLRDGQ
FT                   VVHQIGMPYHWSYSGISTGDGANDLLGIVLDPNTHIQEDKVSTADIRPGRRPRGPELIE
FT                   FVEGYRQRAGVPSGRVGVNGRDPVAAEAGEGSKL"
FT   gene            367901..368968
FT                   /locus_tag="Gobs_0345"
FT   CDS_pept        367901..368968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0345"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: msm:MSMEG_1847 4Fe-4S ferredoxin,
FT                   iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73141"
FT                   /db_xref="GOA:D2S530"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D2S530"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADB73141.1"
FT                   /translation="MTSVSSASPAFTGRDPDNRLYGPLPDVQGEAGYDGDHPARVGFFT
FT                   DTSVCIGCKACEVACKEWNFLPMDDAHGVRDVMGLSGMSYDNTGQLGANSWRHVAFIEQ
FT                   TRTVDLPMPTFGRPGDDRQDHGRSVTDGPNDESLATAQQSSVLNAEALSEFDPQTGQSG
FT                   TDKQIRWLMSSDVCKHCTHAGCLDVCPTGALFRTEFGTVVVQGDICNGCGYCVPSCPYG
FT                   VIEQRKGDGRVFKCTMCYDRLTDGLQPACATACPTQSIQFGNLDELQARADARLATLKS
FT                   QGVETARLYGRDEDDGVGGAGAFFLLLDEPEVYGLPPDPIVTTRDLPAMWKSAGAAAAM
FT                   ILGVALSAVLGSRRK"
FT   gene            368973..370013
FT                   /locus_tag="Gobs_0346"
FT   CDS_pept        368973..370013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0346"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   sen:SACE_3564 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73142"
FT                   /db_xref="GOA:D2S531"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D2S531"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ADB73142.1"
FT                   /translation="MTEGITTPGAGWRRADGPPAQKRQKRRRRRGGGRPGGEVAMVEEA
FT                   EFTSYYGRPIIKPPVWKTPDVPLYLFLGGAAGSSSIMAALTDLTDRPALTRNARYVSGG
FT                   AAIASVVFLVHDLGRPERFLHMLRVIKPTSPLSIGSYILAPFSAAAGATAAVELLGWFP
FT                   RLKRFGGVVAALFGGPLATYTGVLFSNTAVPSWHAAYKELPFVFGASGMAAGGGITMAL
FT                   SPIEEAGPSRKMAVAGAAIELAAMHRVETGFGIVSEPYHEGKAGRLLRAAKSCTAAGAA
FT                   LTVVAGRRRAGAVAAGALLAAGSLLTRFGVFEAGMASARDPKYTVVPQRERLAARGNGP
FT                   APSVTR"
FT   gene            370186..371055
FT                   /locus_tag="Gobs_0347"
FT   CDS_pept        370186..371055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0347"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bcv:Bcav_2376 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73143"
FT                   /db_xref="GOA:D2S532"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S532"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB73143.1"
FT                   /translation="MRSNGWAGRVRSPLPAWCRVVDLGGQVALVTGASAGIGRRLTEGL
FT                   AVRGVTVAGVARGGERLTRAMAEVADVTGGRTLAVPADVTDRAAVEAAMARVQEECGPI
FT                   DLLVNNAGLVDAAEVSLWEADPDQWWDVVESHVRGALLVSRAVVPTMVARSSGSIVNLA
FT                   SGSGLRARPEYSAYSVAKTGLMRITEALAGSLAGTGVRVFDLAPGVVETDMTRSMAMWR
FT                   GKTDWTDPDLVVRWVVAIAEGQLDQWSGRFLHAAADNVDVLARVDGLNDDARRLRLCEW
FT                   GPEDTFRR"
FT   gene            371351..373570
FT                   /locus_tag="Gobs_0348"
FT   CDS_pept        371351..373570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0348"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; glycosyl
FT                   transferase family 2; KEGG: cyn:Cyan7425_3212 glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73144"
FT                   /db_xref="GOA:D2S533"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S533"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73144.1"
FT                   /translation="MSHLYPVRLLVYCGATEWGGAEIVLGHLLTTLSDRYEVRLLGVDD
FT                   TVLERLAARRPGITHTVLPPVRGRWDLAAARAHRRAMARAGADLVHLNLSVPYADPYTV
FT                   LGATTLRHTPTVAVVHLPMPSPGPRLARIVRFNATRTTAVVGVSAGSARPLEQVLGLPP
FT                   GRVRVVWNGVPTPRGSPLPVAAPPGRLVVGAVGRLDRQKGFDVLMRAIADLPAAHLVLI
FT                   GDGPEWEALEALATDLGLKGRVTMAGWSDEAPTLMRSFDVLAVPSRWEGLPLVVLEAML
FT                   GGVPVVATPVGGIPDAVRHEETGLLVEVEDPAGLAAALNRLGTDPALRRRLAAAAAAEA
FT                   ARRFTVEAMTRSFEALHHEILSRRAERSLRRPWGRPRPGEEGGSAVPSDAQVAAVPAGG
FT                   PWPVLAPPPAAAGVNRAAGPPSFSVVIAAHQAEATIAAAVASALEQTHPPLEVVVCDDG
FT                   SIDGTADVLASLGDTVRVVRQPNRGESAAKNAAVAAARGDYVVVLDADDVFHPRRLEAL
FT                   AWFAQERPDLDVITTDAIVEADGVPVRRAYHSDWSFPADDQRVAILDRNFILGMCAVPR
FT                   KRWLEVGGFDESLSITADWEFWQRMVLDGSPVGLVDAPLARYRLTYGTLSSDPVRMTEA
FT                   RLQVLDRATARTDLDRHEREVLARARIRAHGERRWRLLAHSLGENGRDVRRHAFAVFVG
FT                   RQERLRTRLGALLAVVAPGLARRRRLRRLGDTVEIGSGIRVPRRN"
FT   gene            373855..374841
FT                   /locus_tag="Gobs_0349"
FT   CDS_pept        373855..374841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0349"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cag:Cagg_1558
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73145"
FT                   /db_xref="GOA:D2S534"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2S534"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB73145.1"
FT                   /translation="MHPSGAAIHHLRLLVQPGAVGDAARTIYGTIPRWWADELMQRLPS
FT                   LHAMSNVSAVEPEPWQENTPRGLSLGPPWRVLWRSRELVGYLALRDLKLRYRQAALGVL
FT                   WVLIQPVASVVVFTVVRNGLAGISAEGVPYPLFALVGIVTWTYFSSSVEAASTALVSNV
FT                   SLVTKVRFPRVTAPAACLLSPAVDLGISLALVVATMAYFRVFPGLQLLGAVAWLLLLAA
FT                   TTMGIGLWLSALNVRFRDVQHAVGPAMQLWFFASPVAYPSTLFTGWHELVYAVNPMAGV
FT                   IELGRWALLGAAWPGWSLAVSSASTLLVLLTGLWYFDRAQRSFADVI"
FT   gene            374999..376084
FT                   /locus_tag="Gobs_0350"
FT   CDS_pept        374999..376084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_5905 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73146"
FT                   /db_xref="UniProtKB/TrEMBL:D2S535"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73146.1"
FT                   /translation="MDRCWLTDRVDDVFVRRWSAAPRRVETPRQVGGAIAPGRVRETRQ
FT                   IGADQQLRGLPEREGPTQPPGSAFQDPSALLAGHRQHEVRLVRHPRQEGLGTEVVGADA
FT                   VPGHRSCRLRGHRPTGCRGQSGAGDLDVGPPGLLTERIASPGPDEALRHGRAALVARAD
FT                   EEKAHAATLGRPGRGAHDGFRGRCTGHPVTGEQPPTRPSAPVASRRPAVRSSAGTGRRM
FT                   SSTGRRVEPHGYRPDAAPPSRPGPTCPCPISTTRPRRTAVPDSIPHRAAQQPGGQDTCG
FT                   HGHGLRCRCAHARSDHGRVCSDAAHRSGWHHGVARGELGPDTTWSSRRGDVAEPTKALT
FT                   GAGLPVSEVDGELDARTGPRR"
FT   gene            376081..377295
FT                   /locus_tag="Gobs_0351"
FT   CDS_pept        376081..377295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0351"
FT                   /product="Glycosyltransferase-like protein"
FT                   /note="KEGG: gur:Gura_3796 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73147"
FT                   /db_xref="GOA:D2S536"
FT                   /db_xref="UniProtKB/TrEMBL:D2S536"
FT                   /inference="protein motif:COG:COG0438"
FT                   /protein_id="ADB73147.1"
FT                   /translation="MIVTFTWAIPYPGIDHAGGEYVLRHTTALADRWPVLLVAENSAAN
FT                   DRAVAMRPRPDRVGVSLTRPYNRWTVRQLGWRVIRKLTAVTPSRALADHIRRDVSLQCR
FT                   LREADLVEFQWTDTFGLATVVREFAGEVPLVGIAHDVISQRQDRRVSSLPLPEPIRRAY
FT                   RRWVRVHERRVLAGLDVVITFSEKDAALVHQIAPDVVTEVVAPPVAAAPSARARVRPAG
FT                   MPQVVAFVGALYRPENEEAVHWFLREVWPRVRRAEASAQFHISGAGPSADLRRSATGRD
FT                   DVVLWGYRDDLDEAYQQADVVVIPVLKGAGVKFKTITALSWGLPVVTTTVGAEGIPEAA
FT                   EAAAIADDPAAFAEGVVRALRGGVEVGRRAHVTDIVRQRYSEAAFVRRLQELYEGLMRR
FT                   SGNGG"
FT   gene            377883..379095
FT                   /pseudo
FT                   /locus_tag="Gobs_0352"
FT   gene            379348..380301
FT                   /locus_tag="Gobs_0353"
FT   CDS_pept        379348..380301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0353"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   art:Arth_3199 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73148"
FT                   /db_xref="GOA:D2S537"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S537"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73148.1"
FT                   /translation="MSQLAIVIVNYRSADLVRGCLATVSPAPEVSRIVIVNNDTESGCE
FT                   RAKLTEIARDDARVRVLESPRNTGFGPGVNQGVREAQRLGCDTVWILNPDVEVRDGCLT
FT                   RLQAVLQQNPDALVSPVITSGRPPDEQVWFGGGRLDARRGRPEHLGYRAPTETLDEATR
FT                   PASFLTGTALMTRVDTFRRLGGFREDLFLYWEDVDLSMRAVQMGIPMLVVGGARLWHKQ
FT                   GGSVDDRLDMFFFYAQRNRLVVSWSTAHHSLTAMLVGPGVLETLRLLGRPLLRERRYRL
FT                   KKFTRSVQGLMAGIVAVRRLQRDPGAAVGGLVERRR"
FT   gene            380264..381295
FT                   /locus_tag="Gobs_0354"
FT   CDS_pept        380264..381295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0354"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   nar:Saro_0752 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73149"
FT                   /db_xref="GOA:D2S538"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S538"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73149.1"
FT                   /translation="MQQSEVWLSAAADLVFDARSAVASRHSGWERYSRSLRSALHDQFR
FT                   VVDYVGPRWRGEPILPAANVVQPSIVVRGHAGTPVHYPTFPPPPAVSLALGRRLVYTLH
FT                   DLTWWKYPETASRLGRAVYRKWAETAVRCTTILTVSEAVAREVQSSFGVPADRLFVASL
FT                   ASDLPICEPGRRPARDRPYLLSVAAIEPRKNIDRLVEAFRISGLAESHDLVLVGRRAWG
FT                   EMPAGTSLLSDVDDDMLAGLYAGASATVLVSLYEGFGLPILESLAQGTTVVCSDLDVFR
FT                   EVSDGAGIFVDPLDPASIARGLRAAAAGGSPPTSAVLAARARSWADTARQAGAAYASAR
FT                   RNG"
FT   gene            381288..382064
FT                   /locus_tag="Gobs_0355"
FT   CDS_pept        381288..382064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0355"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   bav:BAV2638 capsular polysaccharide biosynthesis
FT                   glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73150"
FT                   /db_xref="GOA:D2S539"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:D2S539"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ADB73150.1"
FT                   /translation="MADTPVRRQRVGYFDVSLISPRAACETVLRWASAGQATHLVVTPN
FT                   LSMYLVWERHPEFRRACARASLVLADGWPVAVLGSIATRRIVPRVTGSDLLRNVVAGAA
FT                   GEHIRIGIIGGRGPEEAVRRCRLVHPGVDMRVIDDAQHYSLSESLAEHLAERARREGVD
FT                   VLVLAYGAPRQEVFGMRLAHHLPHGVILCLGGAVDFLSGHQRRAPAIVRRLCLEGFWRM
FT                   ALDPSRVLPRYVLPAAAFARSLLEQTRPGRVSSERA"
FT   gene            complement(382140..383660)
FT                   /locus_tag="Gobs_0356"
FT   CDS_pept        complement(382140..383660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0356"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC0048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73151"
FT                   /db_xref="GOA:D2S540"
FT                   /db_xref="UniProtKB/TrEMBL:D2S540"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73151.1"
FT                   /translation="MGHRVAMRRRDAAWLVLTAVIATMLGVALVLQPLLGAAAVGLLVV
FT                   AGWLQLCHRWPGLALTVIIAIVVFSSHVFALAHVAGVPSSLIRPMIGAKDLLAWTLLAV
FT                   LALRTMQQKRQAWAVPLLVGAFLSLCAVVYVLFDSPAPLAVQLAAMRGASLPVLALGCV
FT                   ALLSRDERRRVAVASVYVVLAGAVYALVELAFPRSFVSETVGVGRYWVEVKDQPLFVDP
FT                   VTDLPGNFFTSAGFPRLTGTFGDPLSAGEVLGSALVLAVAHRSALRYPHLVILPITAAL
FT                   LLTFTRNGWLLAAAGLTALAALRYGVGRTLLRVAAAVVALLLVTAVVRPLGDYIGKILS
FT                   GEDASTLGHYSALEYSLQLFQSFPFFGYGWGTGGSAALNSFAEAVTAENAYVAVLTQTG
FT                   WLVGTMLGILILGLGHQAVRGQPLAAVGATVLLVQAVTAFISENVLTFNAGFFPFLTAG
FT                   LVAAADPVRELIERPFPLAAHGRSSPEGRSSPRTRPVGRWTPASPAGT"
FT   gene            383910..385301
FT                   /locus_tag="Gobs_0357"
FT   CDS_pept        383910..385301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC2151 YapH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73152"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D2S541"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73152.1"
FT                   /translation="MLAAGGVVIGLDSRVADAPSPRQPANQGLAVTAPEPSGEDDSATL
FT                   AALCVGRRDVHLRSGATYVIGARDAISETGFRGRIVGHGATLKFAYAGPWSETSSAING
FT                   LRDVTLRDLSITAPDANLFSVFRDCTNLRLEHVTVYACSPKLTYALPRDFSAHRIRWTS
FT                   QGDDPEVLDGSLYVPDAGRFSLTDFDYDAGFNGRTGAIVSAVATRTAPGATVHVSNGRA
FT                   FTADLPGHSADGFIDIEPVGATPLDHVTIRDVVLYNTSCYLTGARNITVDNCTFVYTAN
FT                   NASGRAIPFVVYNNNVVKPPLGALNVRDCRVEWTAGNPADQKIGVMTYQSHPGAVVRFT
FT                   DNSYHFDPAGGQVAQDLYWVKDGAPAIMVIRGDAILDAGDLAESQAMIRTDSTVGRLLV
FT                   RDMSVSGTFARKLRAGATGGGGDGHLVVFESNDFTGATFTGPDSVESGVTLNRQHSADN
FT                   AGIEY"
FT   gene            385504..386976
FT                   /locus_tag="Gobs_0358"
FT   CDS_pept        385504..386976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0358"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: rha:RHA1_ro05453 protein-tyrosine kinase;
FT                   TIGRFAM: capsular exopolysaccharide family; PFAM:
FT                   lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73153"
FT                   /db_xref="GOA:D2S542"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S542"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ADB73153.1"
FT                   /translation="MDLQGVLAALRSGWWLLVIGMLFGGAAGLGGSLLQTPVYVSSTQF
FT                   FVSTTGSASTSEAYQGSQFSQERVTSYVRLLTGDELAGRVVDRLNLDMGPEELVQRMSA
FT                   TAASNTVLIDVSISDPSPEQAQRVATVLGQEFPQLVSELETPDGGGSSPVKVTVTERPE
FT                   APATPVAPRPRRNAALGVAIGLLVGIGLAVTRVRLDRTVKALDEAASLVGAPVIGTVVR
FT                   DAHLEKRHIADRRGNRRTAEDYRQLRTNLQFLNVDAPPRVIMVSSALPSEGKTTVVVNL
FT                   ALALADVGQRVTLVDADLRRPQVTSYLGLVGGVGLTNVLAGTADIDDVKQTYGEGLSVV
FT                   AAGPTPPNPGELLASSNMARLVEKLRGTGDFVIMDAPPLLPVADAIGLAPALDGVLLSV
FT                   RFGCTRRDQLQQAAAALSRVGATTLGVILNMLPPQDELAAAYGYGYGYERSAAGNPGTR
FT                   EGAVPQRFFRRVRSSRRRHGQPRRLSATGQDS"
FT   gene            387228..388687
FT                   /pseudo
FT                   /locus_tag="Gobs_0359"
FT   gene            388911..390641
FT                   /locus_tag="Gobs_0360"
FT   CDS_pept        388911..390641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0360"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   noc:Noc_1968 UbiE/COQ5 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73154"
FT                   /db_xref="GOA:D2S543"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D2S543"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ADB73154.1"
FT                   /translation="MGSAPPSDDSGTRPRPPSVVGRGAPVTAEPSPSLQLHSWRRLDWR
FT                   FLLPALGDGPVVLAGRPDEELRAALPLLGLPVHRVTSDQDWEAVGGTASLVVLIDPTPK
FT                   DLGSATGACRPGASVYAEVRRSLCRLQGPWTLMGWRRAFAAAGLEEVSAHWHARTIDRS
FT                   ARIIPVEARGAMRHALAQHQGSWLRRILAATARAAVGVGLLPALIPEGSVVGRYPEVAE
FT                   GAGKNLVERVLAENVDRLGLSAVGLGAALETAFLTPRFVTSRHVVVLVYAKGESRPRLV
FT                   VKVPRQPDDSRGVRREADMMRRLAALLGPDRLRVPAVLGTVACDGLSLLVESAIRGAVL
FT                   TPPQAHRHFRTVLAAGTSFIGALPVVRPAGENADWYGPAVERPLARLAEIAPLAGETAA
FT                   LCARTHELLAPLRSVPLPAVFEHGDLAFPNLYFGGRDTRLGVIDWERSTTSGVPGHDLV
FT                   FFLQFVSESRWSASTWPAQVAAFRDAFVGPDAWAVPVLREHLRHRGVDPTSWGRLVVMT
FT                   WARTSATLADRLVLDEDRDDLCPSAAVEAAVRLERETRLWRLAVELAERGELGDRAGSA
FT                   "
FT   gene            390924..391952
FT                   /locus_tag="Gobs_0361"
FT   CDS_pept        390924..391952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0361"
FT                   /product="HPr kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73155"
FT                   /db_xref="GOA:D2S544"
FT                   /db_xref="UniProtKB/TrEMBL:D2S544"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73155.1"
FT                   /translation="MTRELGPSDGAPSGEPDITVTFTDEPRPVGPLRLLGLRQAAFDDA
FT                   HFYLLDGAGHRARLDFSRLGDRCEVVCDRRISHIPLLIPIVGLRLLLKEHVLLHAASFV
FT                   HHGTGVLVTGWQKGGKTETMLPFMAAGADFVADEWTIVGGREPTLSGVSGVARLWDWHL
FT                   RQFPQYWPLIRPRARARLRLWRLYRRLYGLAPGLDRLPGRPGRGLRRLSMDGGTDWQGV
FT                   DQIDPAALFGDRVRRGHVSLDRVFLPVVGQEDRIEILPVAGAEVAKRMVSSLAFERAAL
FT                   TTAYLQFRFAFPDRTSPLIETAREREERVLGRTLADVPAFELRHPYPVALQDLYEAAAP
FT                   YC"
FT   gene            complement(391977..392606)
FT                   /locus_tag="Gobs_0362"
FT   CDS_pept        complement(391977..392606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0362"
FT                   /product="thymidylate kinase"
FT                   /note="KEGG: xca:xccb100_4118 thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73156"
FT                   /db_xref="GOA:D2S545"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S545"
FT                   /inference="similar to AA sequence:KEGG:xccb100_4118"
FT                   /protein_id="ADB73156.1"
FT                   /translation="MVRRGMCIALLGPDGAGKTTLARSLAAALPVRVHYVYSGLWQRRE
FT                   RRSWVDGVRGGPRLRRLLRVARIGMAARWYRGLGHLVVLDRTPHEVRLRATGLNGRLNA
FT                   LAVRLLAPTPDLMILLDAPPEVLFARKGEHSVEVLDGLRRSYRMMLEQFPAHATVDARA
FT                   DAETVRRQAIEVIREHWPAGRAWRAGTTATRRVPQQARAESAESRG"
FT   gene            393194..394444
FT                   /locus_tag="Gobs_0363"
FT   CDS_pept        393194..394444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0363"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; Methyltransferase domain
FT                   protein; Methyltransferase type 12; KEGG: sco:SCO0392
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73157"
FT                   /db_xref="GOA:D2S546"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:D2S546"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADB73157.1"
FT                   /translation="MLDLTARGGGSCRLCGRQLTDVFVDLGMSPPCESYVPAEKLESPE
FT                   VFYPLRVWICAECLLVQLPAHLPAEEIFSDYAYFSSYSTSWVEHARVFTQHAAERAGLT
FT                   TDSLVVEVASNDGYLLQHLVARSIPVLGIEPAANIAAVAVERGVPTHVAFLGEEEGRRV
FT                   RADRGPADLVVANNVFAHVPDVRDFSLGLAALLADDGWLSIEVPHLMRLIEFAQYDTIY
FT                   HEHFQYYSLLTAQRVLATAGLVVVDVEELASHGGSLRIWARHEPAAGGEVSDAVRDVLA
FT                   EEERRGLHTLAGHCGFAGAVAKVKRDLVGFLLSAAEQGKRVAGYGAPGKGNTLLNHCGI
FT                   RSDLVRYTVDRNPFKQGKYLPGTHIPILAPEAITEDRPDYVLLLPWNLRAEITQQLAYV
FT                   REWGGRIVVPIPRLAID"
FT   gene            394462..395511
FT                   /locus_tag="Gobs_0364"
FT   CDS_pept        394462..395511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO4833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73158"
FT                   /db_xref="UniProtKB/TrEMBL:D2S547"
FT                   /inference="similar to AA sequence:KEGG:BRADO4833"
FT                   /protein_id="ADB73158.1"
FT                   /translation="MEISRTTKPRSLRAGDVIEVRSEEEILATLGPDSTIDGLPFMPEM
FT                   LRQCGSRFTVDSRADTTCFYGALRGMESAVHLTGIRCDGSGHGGCQAGCLVYWKEEWLR
FT                   PVDPSRDDARTSRPIALAPPVRRDGCTRDDVFRAVHPPESPDGEELWSCQATQVRAATR
FT                   PIRSWDLRHYVRDVRNGNLRPGTVLRRILPSLLFMYQGMSRRRLPRWLQVASGADIPLI
FT                   HGTLTRTPSVDLDLQPGDLVRVKSRRKIRTTVDRKARNRGLAFDVEMTPYCGKSMRVKR
FT                   VVRQIIDEWTGRMLRLPGHCVVLEGGVCQALYHGLCQRKTESYWREIWLERETPAGAEE
FT                   SARAAAAQS"
FT   gene            complement(395521..396651)
FT                   /locus_tag="Gobs_0365"
FT   CDS_pept        complement(395521..396651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0365"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; KEGG: rha:RHA1_ro05743
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73159"
FT                   /db_xref="GOA:D2S548"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:D2S548"
FT                   /inference="protein motif:PFAM:PF08484"
FT                   /protein_id="ADB73159.1"
FT                   /translation="MASCRWCGSGHGETVLDLGLQPACDDFPRPGDPPAPVHPLRLWAC
FT                   DGCGLAQLPDRSPVPQEPRAVEPAALSAHARDSVAWALSQGLLVAGTSAREFGSPHGGS
FT                   WVELLAAAGLEVRQDDGAGPVDAVIDVFGLMHEEDQRAGLGHRVECLTTDGVLVLVFPP
FT                   LETVVELGQWNALRHGHHAYPSTAVAARQLAECGLTVVASVLHPLYGGTRLLAARRSSA
FT                   VAPRAVSVPLPGDVPRAALTALAESVAAGVAALRAHLQQAAAEGRRVIGYGAASRAVPL
FT                   LVGAGIGPELLPAVADASPAKQGRLIPGVGLPVVGPDELVAARADEVLLFLPDLLDEVR
FT                   SALPEVEHSGACWRSVETLMPTRAECPPRPTSTPAS"
FT   gene            396690..397253
FT                   /locus_tag="Gobs_0366"
FT   CDS_pept        396690..397253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0366"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="PFAM: dTDP-4-dehydrorhamnose 35-epimerase related;
FT                   KEGG: msm:MSMEG_5977 dTDP-4-dehydrorhamnose 3,5- epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73160"
FT                   /db_xref="GOA:D2S549"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2S549"
FT                   /inference="protein motif:PRIAM:5.1.3.13"
FT                   /protein_id="ADB73160.1"
FT                   /translation="MLIERSELADVVCFLPETRHEDERGWFVRTLDVAVADRAGVDARA
FT                   FLQDSQSRSRQGVLRGMHGRAGAGEAKLVRCARGAVLDVLVDTRPSSPTFGRSATFRLD
FT                   DETGRHLYVPPGFLHGFQVLTPEADVCYRIDREHDPSEDLAVRYDDPDLALPWPLPVTA
FT                   ISPRDAAAGTWHDLVQQLDGAPGR"
FT   gene            complement(397265..398287)
FT                   /locus_tag="Gobs_0367"
FT   CDS_pept        complement(397265..398287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0367"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; dTDP-4-
FT                   dehydrorhamnose reductase; KEGG: sco:SCO0395
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73161"
FT                   /db_xref="GOA:D2S550"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S550"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADB73161.1"
FT                   /translation="MRVLITGSEGYLGTVMAEVVAGAGHDVVGLDSGLFIGATLGPEPT
FT                   RPPLVRQDLRDVTVDDLAGFDAVCHLAALSNDPLGSLAPEVTFDINHAASTRLARLARD
FT                   AGVRRFLYASTCSVYGASGTEEPLDETAPLAPVTPYAESKVRVEADLHDLADDDFEPVS
FT                   LRNATAFGFSPRLRADIVLNDLVASAVLDGEIVVKSDGTPWRPLVHARDIAEAFLACLE
FT                   APRQAVHDQAFNVGMDSENRRVAEIAEVVAEAVPGSTVRITGEFGGDPRSYRVDFGRIA
FT                   TAVPAFKPTWTTLEGARELATAYRRYGLTRSMLRERFTRLAWLKHLQHQGRLAEDMRWR
FT                   "
FT   gene            complement(398275..398982)
FT                   /locus_tag="Gobs_0368"
FT   CDS_pept        complement(398275..398982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0368"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: sco:SCO0394
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73162"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:D2S551"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ADB73162.1"
FT                   /translation="MGGLTLLSRGDGRPPVVVALGAHCDDVEIGAGALLLQLAESCPGA
FT                   LLQVLVLSSTPDRESEAHASLKAFGAGLDLEVTVLDLPDGRLPAHWDAVKEALEGAGAR
FT                   ARAAGGADLVLSPCRQDLHQDHRLVAELTPTVFRDHLVLGYEIAKWDGDLGRPAVHLPV
FT                   PAEVAARKFELLAEHYPSQRDRDWFDREAFLGLMRLRGVECHQRYAEAYWCDKIIVGLP
FT                   PATRSDREVPCAS"
FT   gene            complement(398984..399790)
FT                   /locus_tag="Gobs_0369"
FT   CDS_pept        complement(398984..399790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0369"
FT                   /product="Glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /note="KEGG: sco:SCO0393 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73163"
FT                   /db_xref="GOA:D2S552"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S552"
FT                   /inference="protein motif:PRIAM:2.7.7.33"
FT                   /protein_id="ADB73163.1"
FT                   /translation="MKVVLFCGGYGLRMRDGTTEVSKPMIMVGHRPLIWHVMRYYAHYG
FT                   HDEFILCLGYGAHHIKDYFLNYRETASNDFVLREGGRRIDLLSTDIANWTIHFVDTGVD
FT                   SAIGERLRRVRHLVADEDVFLANYSDVLTDAPLPIMIDRFRDSDATASLLAARPDPSFH
FT                   CVDIDGSGRIRQIRAAGDLDLWVNGGFFVLRQGVFDHIPKGGDLVGDACTALAERGQLL
FT                   SYRYTGFWHPTDTIKERNNLEALFSQGERPWMVWENDSTRAPAPAV"
FT   gene            complement(400181..401386)
FT                   /locus_tag="Gobs_0370"
FT   CDS_pept        complement(400181..401386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0370"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   kra:Krad_0892 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73164"
FT                   /db_xref="GOA:D2S553"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S553"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73164.1"
FT                   /translation="MSRPCSILIVVDTLTDNGSLRWVHKLAALWLEASWAVVYLSLKRG
FT                   VDGRPPLMPPAGASLTYGDTAERRFRRGLPGAVLRALRAARAADAVMVISEVELSLPFA
FT                   YVIARLVRRPFVVYVQNVPERSHEIHLNRWRSPLWRHCLTHADAVLCVAPAGAESAARM
FT                   GVDRSKLTVASTGIDVDMVRRLGSPDGPGRPQHTSAPLVACGELYHRKGYDLLLRALAD
FT                   VRRMGHPVRLVLIGEGQEGPTLKRLAQDLGLSEAVTFTGHLGNPLPEIAQSAAFVHCAR
FT                   VEGVPQVLLEAIALGVPTIATDCDGGGPRMILGGGAYGRLVEPESVPALVEAILAHLND
FT                   PSQLTQQAAEGEIHLREHFSPARTAEIVLDVLARVDESRPRRRGALSRWRERRLSAAVP
FT                   TP"
FT   gene            complement(401406..402701)
FT                   /locus_tag="Gobs_0371"
FT   CDS_pept        complement(401406..402701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73165"
FT                   /db_xref="GOA:D2S554"
FT                   /db_xref="UniProtKB/TrEMBL:D2S554"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1794"
FT                   /protein_id="ADB73165.1"
FT                   /translation="METRVDRPQTPRRRFGGGGVARLVRRAGWSTSDQVVSSLSSFALG
FT                   VLVAREVSAAEFGAFALSFTVYGYLVIVTRVLVSQPLTVRFSDAAPSAARQAARQSTGA
FT                   AIVVGLPPAAALALTGVLLGGTVGPTLVLTAVLLPGLLLQDAWRMVFFAAGRPRAAAAI
FT                   DSAWAVVQVCLMLMLSTTDQGSAVAYLGVWGLSGWLAALLGALLAGLVPAPRATWQWLK
FT                   AHWDLSRYFVTEYVLINGSTQLMLVLVAATGGLAVAGALRGAQVLTGPVGILVTSGMAF
FT                   AIPELARRPWTVGRRLIRAGVGISGTVVVLATVWGALLLVLPEEVGRQLMGDTWTGVDA
FT                   ILVPTVLGLVMSASGLGPTCGILAAQRPKVLFWLQIIAAPAYLIGGLVGVLTGGAFGAA
FT                   VGIALAHTLGAGFAWIRLVVVARQAAEAREHA"
FT   gene            complement(402975..403928)
FT                   /locus_tag="Gobs_0372"
FT   CDS_pept        complement(402975..403928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0372"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   kra:Krad_0566 glycosyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73166"
FT                   /db_xref="GOA:D2S555"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S555"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73166.1"
FT                   /translation="MHVEPSQSTGTPDVELVVVAYRSRAQVTEMLAGLPADIPLAVVDN
FT                   FNDGDGLAQVVLDRPNGRYMKGGGIGYSRAANLAARSSQAEFLVFLNPDTRPDIEAITT
FT                   LVEDVATDPLCSASAGVVVDSHGRPEWAVGGWEPTLPRAVVHAFGAHRAFPRLGIYCHP
FT                   EIGQPLNVDWVSGSVMAVRRQTFLGLDCFDEDFYVYNDDVAFGRQSRAHGLYQRLRTDV
FT                   AIPSAGGSGAPSLEMGRLHGSSMSRYLHKYHHPVAATTIIMSLGLGYIGRALGRLLLGH
FT                   INRAREDWAHALGLFTARATVAGRLVADGRRGRPVP"
FT   gene            complement(405160..406770)
FT                   /locus_tag="Gobs_0373"
FT   CDS_pept        complement(405160..406770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0373"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="KEGG: kra:Krad_1048 undecaprenyl-phosphate galactose
FT                   phosphotransferase; TIGRFAM: exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73167"
FT                   /db_xref="GOA:D2S556"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D2S556"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADB73167.1"
FT                   /translation="MSDAFMERLDNVLAPDPSPATIPAAATHQFGADDSLELRRLAEPS
FT                   TAPPLTKTSAVLPTHGRPVYDPFTARRRQNPEWLVAYTATLVTGDVVASITAACVLMPF
FT                   TGPISVYGLALAAIGALAWPALLMSLSTYAERLHGTGAIEYRRVAIAGVIAVAVAGYAA
FT                   QVPALVGLTRLLLIGVPVATVLTLLNRALNRWRLHAARRRGFMTKRVVLVGRDSAVLDL
FT                   AKRLRRDPACGLQVVGACVPQQSASQSLEQHGVAVLGDLTHVVPAVDEVGADAIVVASA
FT                   SETAGQYLRDLSWRLEGTNIDVLAAPGLLEVAPHRLQIRPTTTVPLIQIREPEFRGHRR
FT                   VVKGILDRVAAAALLVLGLPLLLAVGAAVRFSSPGPALYRQRRVGKRGVCFDVLKFRSM
FT                   VVDADRKLEELLPQNEGNAVLFKLHRDPRVTPVGRFLRRYSLDELPQLINVLKGQMSFV
FT                   GPRPALEREIARYGPDMHRRLLVKPGITGLWQVSGRSNLSWDEAVELDIRYVENWSLGL
FT                   DLAILLRTIRAVLRRAGAY"
FT   gene            complement(407145..409361)
FT                   /locus_tag="Gobs_0374"
FT   CDS_pept        complement(407145..409361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73168"
FT                   /db_xref="UniProtKB/TrEMBL:D2S557"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73168.1"
FT                   /translation="MLASGVSARHEATNRRTPPGRYWRHRVLIGVLLMVGVWMLLASLA
FT                   AAAQAGAPSLSADSSQATDPGTSAGGNRVSSGETATPANTGGTAAETSADESPAASAES
FT                   EAKQESSSGASATPAGSPADDREKPATPAEDRSSAPDNDGATQPPRLDTPEPPAPPAKP
FT                   ATPAGDRPAPPAKPATPAGDRPAPPAEDRPAKPATPAGDRPAPPAEDRPAPPAKPATPA
FT                   GDRPAPPAEDRPAPPAKPATPAEDRPAPPAKPATPAGDRPAPPAEDRPAPPAKPATPAG
FT                   DRPAPPAEDRPAPPAEDRPAKPATPAGDRPAPPAEDRPAPPAEDRPAKPATPAGDRPAP
FT                   PAEDRPAPPAGDRPAPPAEDRPAPPAKPATPAGDRPAPPAKPATPAGDRPAPPAEDRPA
FT                   KPATPAGDRPAPPAEDRPAKPATPAGDRPAPPAEDRPAKPATPAGDRPAPPAADGAIQP
FT                   LRQDTSSASATRTPEVSLTSQAHGTGTSVSANTGVTSQHTSLVPGGSLEAGIPAPGTHD
FT                   RSVVSDLRAVAPSTISDPATLATQGAMSGSEGDTDPTRGPTTAPRSSDLPPRTGYSPAV
FT                   ATASASSISVVTSAGDQLLALRSLVTALTHAGRQVCQAPDDGVDRSRPPVGIAGGSTGG
FT                   RGSPHAADHVVAVGAIDVPLTSPVGAPPLPAPPAAPVPVGPVTSASVTGTASGGGQHHH
FT                   SWDDLAVLDEGLAASVALMAAARVAAGVAGHVLGAATDPGSRPD"
FT   gene            409906..411138
FT                   /locus_tag="Gobs_0375"
FT   CDS_pept        409906..411138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0375"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; MULE transposase,
FT                   conserved domain; KEGG: mav:MAV_4319 transposase, mutator
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73169"
FT                   /db_xref="GOA:D2S558"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D2S558"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADB73169.1"
FT                   /translation="MALDQSALLEVLDALKAADVDDRIRSAATTIYQALIEAELTAVIG
FT                   AAPHERTEGRTAQRNGSRPRTLSTTAGDLELRIPKLRAGSFFPSLLERRRRIDQALFAV
FT                   VMEAYLHGVSTRKVDDLVRALGADTGISKSEVSRICADLDAEVSSFQDRSLAEQAFPYV
FT                   FLDATYCKARVNRRVVSQAVVIATGVAADGHREVLGFAVGDSEDGAFWTAFLRSLKARG
FT                   LAGPQLVISDAHTGLKAAIGAVLLGASWQRCRVHFMRNVLARVPRGNSEMVAAAIRTVF
FT                   AQPDAEHVRSQLDVIAGMLGRQFPQVEAMLHEAADDLLAFTAFPVAHWKKIWSTNPLER
FT                   LNKEIKRRTDVVGVFPNPAALLRLAGAVLVEAHDEWQVSDRRYLAESSMALLASRSDSA
FT                   EEVAQPALIAS"
FT   gene            complement(411227..411463)
FT                   /pseudo
FT                   /locus_tag="Gobs_0376"
FT   gene            412027..412302
FT                   /locus_tag="Gobs_0377"
FT   CDS_pept        412027..412302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73170"
FT                   /db_xref="GOA:D2S559"
FT                   /db_xref="UniProtKB/TrEMBL:D2S559"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73170.1"
FT                   /translation="MGVFVFVVPVLLVVVLGYAIGYTVWEAIGLGGNPEVPGWLTGLAL
FT                   LAAVSWPLVSRRARLKRALRRARGRGDDAETARLGAALARRRRGRG"
FT   gene            complement(412336..412689)
FT                   /pseudo
FT                   /locus_tag="Gobs_0378"
FT   gene            complement(412692..413000)
FT                   /locus_tag="Gobs_0379"
FT   CDS_pept        complement(412692..413000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73171"
FT                   /db_xref="UniProtKB/TrEMBL:D2S560"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73171.1"
FT                   /translation="MPTPGPGVSSGETRGPGRRWGASTGHGLSPLDHPSGWDPLQRNDT
FT                   GIDGEVIYIAHNPVPVSLPVSALLPPEDDVTSLLSGPNSVSAHLAERLAAVATSPAR"
FT   gene            413124..414170
FT                   /locus_tag="Gobs_0380"
FT   CDS_pept        413124..414170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0380"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: rca:Rcas_3084
FT                   NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73172"
FT                   /db_xref="GOA:D2S561"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S561"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADB73172.1"
FT                   /translation="MRGSDPAGVDAARLRDMPVLVAGGTGFLGASVVTRLLSAGCRVVV
FT                   VGPDPGWREPVRRAIREGVVELVQEPEWWRPEAARRVARRAAGTEQLVHLATAPVPAGE
FT                   RTATGAARDAVAVDVAGTLELLAALGDGLGHVVLGSSVEVYGRAPVTPVDESMRPTPED
FT                   PVAAAWLALEDQLRIVAAAGGPEATVLRFTTLYGPGETMPWAVPTFIQAGLAGHPAMIA
FT                   GDGQELRDYLHVADAADLVLRAVARPPAVSPAGERFRLVNAGSGTAERTVALAHRVRRA
FT                   VAGQRGELPPPPRHVGERRAGGVVCRTDRARDLLGFRPTVDLDRGLAEEVAWFARLAES
FT                   WPDLSAAG"
FT   gene            complement(414177..414395)
FT                   /pseudo
FT                   /locus_tag="Gobs_0381"
FT   gene            414605..414712
FT                   /locus_tag="Gobs_0382"
FT   CDS_pept        414605..414712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73173"
FT                   /db_xref="UniProtKB/TrEMBL:D2S562"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73173.1"
FT                   /translation="MRRRLARLRPGFDVDRRVYELCEGCNARHAVELVA"
FT   gene            414721..415737
FT                   /locus_tag="Gobs_0383"
FT   CDS_pept        414721..415737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0383"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   mlu:Mlut_08810 cell envelope-related function
FT                   transcriptional attenuator common domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73174"
FT                   /db_xref="GOA:D2S563"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D2S563"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADB73174.1"
FT                   /translation="MTDEPDRTDDGAQTTPRAGDGRRRARYRAHRSPTRTVLFALLAVL
FT                   VVVAGLTIGLGTLQVDPVAKDVARVSDAFPDEQDRPEVAEAAQEARTLLVVGVDPAAGA
FT                   TGATRAEAVLLVRLTGDRRHAQMVTFPLDTWVAEQSTTLEGVFGVDGRQGVVGAVETLT
FT                   DVRVDHYAELDYAGFATVTDALGGVTVDVPEEYSNRGRTVPPGPQQMDGAAAVAYVRDA
FT                   SAATRAAAPERQQRVVQALFGRIGELGALADLGRLSGLLDLVTGALRVDESLADEDLVA
FT                   TAWEFRGVAEPEFVAAPVGSTGEEQGQPITRLDEDGAAALWGHLQADDLAAHLGRFR"
FT   gene            415743..415988
FT                   /pseudo
FT                   /locus_tag="Gobs_0384"
FT   gene            complement(416007..417179)
FT                   /locus_tag="Gobs_0385"
FT   CDS_pept        complement(416007..417179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0385"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bcv:Bcav_3777 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73175"
FT                   /db_xref="GOA:D2S564"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D2S564"
FT                   /inference="protein motif:PRIAM:3.2.1.52"
FT                   /protein_id="ADB73175.1"
FT                   /translation="MRSPRLGAVLGSLLCLLSTACAAPTADTGTAPSTPSAAPSPTLSP
FT                   EIDLVDAALVELDRRGQVAQLIVVGVALADLSPADDFGAEGVGGVFLQGRSSIPADQLA
FT                   AETARWAESAQGPRLWVGVDQEGGAVQTLSGPGFADLPSALLQGRMPAEELAALADDMG
FT                   ASLSSAGINLNLAPVADVVPSGTEDGNAAIGAWDRQYGSTAEDVVRAAGTIADGLAAHG
FT                   VTPTLKHFPGLGRVPENPDKSRDATDDVTTRDDEQVAAFGALAGSDADPFVMMSSATYT
FT                   QIDASTPAVFSPVVVNDLLRGQLGFDGVVISDDIGAAQAVQDTPIDERAVRFLEAGGTL
FT                   MLTMDADAVDEMIDAVLARAESDPEFAATVDAAVRTALTAKADAGLLPDD"
FT   gene            417320..418072
FT                   /locus_tag="Gobs_0386"
FT   CDS_pept        417320..418072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0386"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   ach:Achl_1336 protein serine/threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73176"
FT                   /db_xref="GOA:D2S565"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2S565"
FT                   /inference="protein motif:SMART:SM00331"
FT                   /protein_id="ADB73176.1"
FT                   /translation="MPPVELTWGAATAVGQREDNQDRYLAAPPVFAVADGMGGHVGGAA
FT                   AAEAVVEALRSLTGGETTTVEAIRLALQRADGEIRAFQGPDKAGAGTTVAGVALVDEGN
FT                   GPQWAVFHVGDSRVYRWHEGRLDQLTTDHSVVQELLDAGYISDASAATHPQRHIITRAL
FT                   GVGPRPEADVVLLPVMAGERFLACSDGLTGELSDAQIAALVGAGNDVEKTVARLTSEAE
FT                   SAGARDNVTVVAVQVGHPGTSTGATAPR"
FT   gene            418687..419796
FT                   /locus_tag="Gobs_0387"
FT   CDS_pept        418687..419796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0387"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: cmi:CMM_2512 putative
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73177"
FT                   /db_xref="GOA:D2S566"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D2S566"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADB73177.1"
FT                   /translation="MEIGGDESERLRWIDAVRGIAILLIVLWHAYLFTKFTGLDVGYWE
FT                   TINQSLRLIRMPLFFLASGILVAGALDRPWRHLRRTKLATWLWMYVLWALITVGVFSIV
FT                   RWDRPDPPADSPWDLVQIIVWPNTGLWYLYALAVFLGVSKLTRTWPALVVLGLAAALSI
FT                   TTFTWLPIGNFALDSMAKFFVFYAIGARSDQFLKARVSRLGRGRALVVLVTGSLLGGGG
FT                   LMALQATGITGDDLQQIPAVPLLLCIIACVVGVCLAVVLAEYRLGRPLVALGRRTLPVY
FT                   VSNEIVLGCLTALMVLAVPHVAERIGWLAVPALVIVALPLTLLLQRVSSFAPWLYEAPI
FT                   RMTRPVPGRNALAGRGASRGCLLHRRVRS"
FT   gene            complement(419847..420340)
FT                   /pseudo
FT                   /locus_tag="Gobs_0388"
FT   gene            420441..421405
FT                   /pseudo
FT                   /locus_tag="Gobs_0389"
FT   gene            complement(421428..421742)
FT                   /pseudo
FT                   /locus_tag="Gobs_0390"
FT   gene            complement(421760..422336)
FT                   /pseudo
FT                   /locus_tag="Gobs_0391"
FT   gene            422549..424624
FT                   /locus_tag="Gobs_0392"
FT   CDS_pept        422549..424624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0392"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; KEGG:
FT                   gdj:Gdia_1873 glycoside hydrolase family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73178"
FT                   /db_xref="GOA:D2S567"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D2S567"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADB73178.1"
FT                   /translation="MPSRKRLLVLSAVVVAAFVVAVVVVVLRTPAAPSVTASSGTDPAD
FT                   LVGNEDRDVGWRTDEETVGAWVELAYPEPTAVDRVQLLGPGGGDTGATSALLTFDGGGE
FT                   LLVTTDDAGDASVDFPERTVSWVRVTVAGVPDGATSVALAGLTVDGSADDPPRRGSRGP
FT                   VTAETSSEGSAPAAALSDGTPAEGDTGDEWTPADGDDRPWARLTWDTPREVASVQVFGP
FT                   SSAGDDADVPLSGVLRFDDGSSVRVSAIASGGHEGTTIAFAPRMATAVRLELDAAAGLR
FT                   EFAVYDAGTTPPRWPQDGDTYAVSPQPAGTCEASSDPFVQPEPGRLTLVCPSPGSVVDG
FT                   RTDVVVAADPGTAVEARVWTGGPATGTNAVDVVATAVSDGNGRALLTLDTAAAPRGPLT
FT                   IRVDRASAIPDPATVGAGAPVYVQLYNRAGQDPATPDTAPEGMTLQWAEEFTGPLSVSA
FT                   TGAGADYAALKPDASSSGQFGDAPFADPASEAGTLTTVDDEYLRIRTQPIPSASSRDGT
FT                   ANVAGLLASTDVDGAGFAAQYGYFEARMLGAPGPGTWPAFWMLNTESAARPSRTAAEVD
FT                   VVELYGHNTLGSCHTVHNWGAEDEVESDAGAPSCLDRNDFADWAVAWHTYGARITPDAV
FT                   TFTIDGEVVATAGRLQLTSEPFFFLLNLALGGGWPVDLSATGGISDLYVDWVRVYS"
FT   gene            424745..426151
FT                   /locus_tag="Gobs_0393"
FT   CDS_pept        424745..426151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0393"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   cms:CMS_0167 putative Wzz-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73179"
FT                   /db_xref="GOA:D2S568"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S568"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ADB73179.1"
FT                   /translation="MTLQDYLRVLRRSWWVVLSLTVLGALAGLVVTVAATPTYSAQATV
FT                   YVSVSGDESPTDLSTGQSFATQRAITYADLAETRTVLERAAATLGRGTSVNDLRASVAA
FT                   TAREGTSLIDVGASGSSPEVVVARADAVADALTTEVPLVDALGPTSPVRLSVVQAAETP
FT                   EAPESPRPRNNLVIGIAVGLVLGVAVVVVADALSTRIRSTTDLPPAPGLVTLTSMPTGP
FT                   KKRSRHVSRTDARLESFRQLRANLLFGSDVRDTIAVAGVTAASDAQGVARQLAAAFAEI
FT                   GSNVVVVDVDLRTEDGRRARPGERSDAGPPAPGVADVLGGAAKVDDVVTLVPGEKVFEV
FT                   PAGRVDASSAQRMSTPAMQKLLDELREPFDYVVLACPPLVERSESAVAAKLAGSALVVV
FT                   ESGVTKRTEFLLALELLAGVRVTSVSVAIDHVREQDLGGGRTARSVPLDEGGQTALPST
FT                   SDRSHPSSAL"
FT   gene            complement(426210..427304)
FT                   /locus_tag="Gobs_0394"
FT   CDS_pept        complement(426210..427304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0394"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rpd:RPD_1648 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73180"
FT                   /db_xref="GOA:D2S569"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S569"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73180.1"
FT                   /translation="MPNVTPVLPVSVVMPVRNGARFLDEAIGSVLAQTYTHVELVVVDD
FT                   GSIDGSAFLLESWRRRDSRVRVVARPEPGGIARALNDGVHRSTGDLLARLDADDRAAPD
FT                   RIRQQVEQFCARPRLGLLGTGVRYLDEASRVIGTDAAATGPTAAQGLHRGNPFFHPSVM
FT                   MRRSHYEAAGGYRPQVEPAEDLDLWLRISERFEVDNLKEPLTDYRIHREQSSLQRAAAQ
FT                   AVATAAAHWAADVRATGATDPLAGLQVVDEKLLLSLGLSSSALLQEQIAVHRWAAELCE
FT                   MAGYKREALVAWQAALAAAASLDRTEAARLLLLRARLRRAQGRLVARRVDQLRALALAP
FT                   RLATTGLVQKLHAAGRPGSRTGHE"
FT   gene            427355..428191
FT                   /locus_tag="Gobs_0395"
FT   CDS_pept        427355..428191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0395"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cag:Cagg_1558
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73181"
FT                   /db_xref="GOA:D2S570"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D2S570"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADB73181.1"
FT                   /translation="MRTVSADSGSPWTVNSAQGKLVDWRELWNAREIAAFLALRDLRIR
FT                   YKQAILGAAWVVLQPLVTVAAFTLVFDHLAGVDTRGVPYVAFALAGLLSWSYVSRCIAR
FT                   GSEVLVGDSALVTKVYFPRLAAPLATLLPPLVDLVVGLVALAVVCVVLDVVPTAGLLLL
FT                   PVWLLLLALTALGPTCFLSAVNVRFRDAGQMVPTALQVLLFLSPVAYSAASLEGAARYA
FT                   YALNPVVGVIEFGRFVLVGGPWPGTVIAVSTAVSVLLAVLGIRYFLRASRAFADVI"
FT   gene            428193..429380
FT                   /locus_tag="Gobs_0396"
FT   CDS_pept        428193..429380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0396"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ote:Oter_2770 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73182"
FT                   /db_xref="GOA:D2S571"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:D2S571"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB73182.1"
FT                   /translation="MDRVQVDRVSKRYVLGEQRNLRESLAAAVRQHRQERRELWSLRDV
FT                   DLTVGDGEAVGFVGRNGAGKSTLLKILMRITTPTRGEARMRGRVAGLLEVGTGFHPELT
FT                   GRENVFLNAAVLGMSRADTVRRFDEIVDFSGVEQFLDTPVKRYSSGMYLRLAFAVAAHL
FT                   EPDVLVVDEVLAVGDAEFQRKCMNRMSEAGAEGRTVIFVSHDLAALSRLCSRAVWLEAG
FT                   VIRDDGPTASIVRGYLTSGFAGSTANAPRGGSAAGHILQVRVEPLDGSSRPLFRDEPIR
FT                   IVVQFEVLEERLGLDVAVSLTNHRGIGVLDETLSHVQTNQFPVGKHEVALEVPPVLAHG
FT                   DYTIGVWLGTPHEDVQHERSVLRFTLHGEESVQRDRVVVLGLPFRVRQLDGEPSS"
FT   gene            complement(429699..430559)
FT                   /locus_tag="Gobs_0397"
FT   CDS_pept        complement(429699..430559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0397"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   lxx:Lxx04970 rhamnosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73183"
FT                   /db_xref="GOA:D2S572"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S572"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73183.1"
FT                   /translation="MAGPAPLHRPIMRSLPNRLWQPLVTHALHSRAAWLLGWRLLVPLL
FT                   RRRARMRLGRLTPGAVTVITVNWNGLPYLRVLLDVVRRRSPDSVRIVVVDNGSTDGSRD
FT                   FLRARRDVEPVLLPANLGHDLALDLAVLTCQTEFFITLDVDAFPLTTGWIEKLLAPLVG
FT                   GTAEISGARLWRPYVHPCCLAMRTARFVRAGHTFRSRYQPGTDTEPARGDVGEEMSARE
FT                   APRLHFFEVTSQRGPGDVGTVFGDLVYHNFYGTRFGAGHTTLDGGIQPDDPRRAWAEAV
FT                   QRYVR"
FT   gene            complement(430664..431806)
FT                   /locus_tag="Gobs_0398"
FT   CDS_pept        complement(430664..431806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sil:SPO3864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73184"
FT                   /db_xref="GOA:D2S573"
FT                   /db_xref="InterPro:IPR007657"
FT                   /db_xref="UniProtKB/TrEMBL:D2S573"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73184.1"
FT                   /translation="MTKALDPRISVHHDVISIPLAPGRDRDLRGGLVDSGTLRLVDPAV
FT                   LRSGSEWRQEDPVDERSALNRELQSERRVPVVYGGVLFSHFGHLMLESLGRLWAYEHLR
FT                   HLDPYIAFHEGFGRVDWSDQRTVAHQVLRGVGIPLDRVLLLSRPVRLAQALVPTQLYGY
FT                   GFSSNPDQTFVEHMRRFTFPRTVPDGFAGVKRVYVSRSGLPDGFGRPIGETLFEDYLRG
FT                   QGYAIFHPQRYSLHEQLTVYSAADELIFCDGAALHGCVLLPDLAARVAVVSRRHDPRWD
FT                   GSGIVDQFRGYGQDATWIDAVRYQYQFGLESWDARSFVDWYDVSTTLVEHGFTDTAFDA
FT                   FRAVDTTKLVATELHDYVRAIRDDPRFTHYLMQLRTKPVR"
FT   gene            complement(432062..433426)
FT                   /locus_tag="Gobs_0399"
FT   CDS_pept        complement(432062..433426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0399"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fal:FRAAL6117 putative glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73185"
FT                   /db_xref="GOA:D2S574"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S574"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73185.1"
FT                   /translation="MFKKAWRLGQRMCRPGTSRLFRCLAVADVDLDAGTATALSPLTPY
FT                   ASPAEGVHALVWLHGVPVAELTVDGDPEGVLARLPELAARAAHDAVEMHQVQHRDSARW
FT                   LLQDRSPCLAEKQWRSRAGTSTLTVAVCTRDRPTDLARCLHSLRNQTVDVEVLVVDNDP
FT                   GGDGARLVVEEHPGVRYVREPRRGTAWARNRALVEASTTLIAFVDDDVQAHPRWAEALL
FT                   MTFDAHPEAGAVTGLVAPAELSTPAQVVFEAAGGFGRGYRQRRLRSESQDPRESAKAVY
FT                   HIGAMGTGANMAFRRERLLAAGGFDPALGPGTPTAGGEDHEALCRLLTTGALIVYEPAA
FT                   VVRHRHRRTMAELRKQRRADGTGSASMLIGASRKLGSAHHRQWRILAAQWFVKSAAWTV
FT                   AASLVRPAARPPSLTVANLAGWTFALASDPYRRAVVQVRRQAREHPDEPLLAPLP"
FT   gene            433706..434695
FT                   /locus_tag="Gobs_0400"
FT   CDS_pept        433706..434695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0400"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mpt:Mpe_A0735 putative glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73186"
FT                   /db_xref="GOA:D2S575"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S575"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73186.1"
FT                   /translation="MRRLSVVITNYNYARFVGTAVESALGLRWDDIEVVVVDDGSTDDS
FT                   PEVLRRYADRVQLHFTANGGQREAANHGFAACSGDVVIFLDADDVLPPELAERLAAVWS
FT                   PTVSKVQFRMQRIDAAGVPFGRPFPEWRRVPTPGQVRRWVERTSAQPTPPGSGNAYARW
FT                   FLERIFPLDPSLGRAADSGCLAAAPLHGDVLTLPDVVVGYRQHGGNDSDLLADDTRFSR
FT                   EVVTARARWRFAQRSVGVPEDQINERPLRRSRELLQLRIAGSRLAPGRALLPDDGRRRL
FT                   LLDVLVSPAHPGPEPLRTRLLIAGWCLSVLTAPQALVRGLVIRRWRRP"
FT   gene            434769..436142
FT                   /locus_tag="Gobs_0401"
FT   CDS_pept        434769..436142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gdj:Gdia_0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73187"
FT                   /db_xref="GOA:D2S576"
FT                   /db_xref="UniProtKB/TrEMBL:D2S576"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73187.1"
FT                   /translation="MTTLTLVTVAVVVYGVLNTRGYGRALALGAATPVGAAAVVGAIAV
FT                   PTFYAVAVGAVVGVGLRLLRAQGHQPGAAPLPVPASRPLVLLVVTSVLVTLVSPLLFDG
FT                   LPVLNPAGGVGTLVAGVVTKSNIAQIVYLVLSVGVVAYLARSRWTGPEIVGTAACLTTM
FT                   LSFWAWTHMAAGIPFPEGLFDNSPAFTFQNTLPGGAPRVRGIFSEPAGLAISCLVTIAY
FT                   CASRMRHVRGPRSLGVLIIGGAALYLGSISTSTTFLVAGVMLAGLATVVHVASFVLGRG
FT                   SLSTVVVAVLCAAALTAVWLLPYVANTVGAEIEAKVGTSSYNDRSSADSTSYQLVMDTW
FT                   GFGTGLGSNRGSSFAASLLSTVGIVGAALFVAAVVILVRRTWRLVEVRPVIWALAATLT
FT                   AKVVSGPDLSDPSGILWLSLGVLAHAALRDQGRGSTRAVLDHSRGSTTGSSRSQPAEG"
FT   gene            436147..437139
FT                   /locus_tag="Gobs_0402"
FT   CDS_pept        436147..437139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rle:RL3827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73188"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S577"
FT                   /inference="similar to AA sequence:KEGG:RL3827"
FT                   /protein_id="ADB73188.1"
FT                   /translation="MSERVVLFRERVGFALLEPVKAHVRRILKRRQIRPVVIRPGLQSA
FT                   HLVAAVMVKNEAHRLPALLRHYRRLGVEHFIFIDNESTDTLLSLLIGVNDVSIYRAEGS
FT                   FSSARYGLDWLNTVLSRHCSGKWVVHVDADEFLVFDSELPDLLSVCAWLKKSGRRSLQA
FT                   IMIDMYSDRKATQNVVREGQDPLEVCSLFDATGYERHHHWASATTWVKGGVRGRLFFPD
FT                   RWEGPALNKTPLVLWRRRYAYLRAAHLIWPRNLNGGLKTAELALLHFKFTPSASALMVD
FT                   EGHRAQHTTEYRAYDNIRDVIMVGDETRQYRQPADLTGHGLIARIGSTF"
FT   gene            complement(437317..437961)
FT                   /pseudo
FT                   /locus_tag="Gobs_0403"
FT   gene            438162..439493
FT                   /locus_tag="Gobs_0404"
FT   CDS_pept        438162..439493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0404"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ara:Arad_9376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73189"
FT                   /db_xref="GOA:D2S578"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2S578"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADB73189.1"
FT                   /translation="MSDARDEDPLSADAVVLGAGISGLVSASVLLAQGARRVIVLDEYA
FT                   HVGGNHIDRTIGDYTFDIGSLIFQDDSPLLGHFPEMLPRYVPIEPSWSRLNPQGLVTHY
FT                   PFSIRDDVLGAGVPELLRMVSSAITGRLAKRRQRNVRDFAEHLLGAYFVERSGLGYYMQ
FT                   RLCGLPPEQIDLEFARSRLGWLEDQSSARNLVRRLLRSMTGNPEPPSHNRQLARPREGY
FT                   GYLYGPAVRSLSERGVVFLLDTAMREIRKDGDRFVVTTERGSVAAPRVVSTIPLDRALR
FT                   LCGLEAPGAPLPTVTLLSLFCSFSGSKGFQTPILYNFSREGAWKRITVYSDFYGSSGGR
FT                   EFFTVEVIGERVNNSVDVAVEDFRAHCAANGLLVGDLRLEGHHVLDNAYPIYTQGSGQR
FT                   ARDSVRTLRDFGLESLGRQGAFQYQPTARASTVEAERALRPAGP"
FT   gene            439531..440586
FT                   /locus_tag="Gobs_0405"
FT   CDS_pept        439531..440586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0405"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mno:Mnod_0871 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73190"
FT                   /db_xref="GOA:D2S579"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S579"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73190.1"
FT                   /translation="MRIMHVLKHSQRSNGHVHVAVDLACAQADAGHEVTFVHAHGSYDE
FT                   LLRDHGVAIATVPEASSPMSALQSERALLHVARRARPQVVHAHMMSSAVLAYPVSKLVA
FT                   SPLVTTMHNSFDGHSWLMRLGTVVVAVSQAERQRLIDRGFPVRKVRCVLNGAVASPREA
FT                   LPDDATIGPLARPSVVSLCGLHARKAVGDAIAAFSKAQPSAPGWHMHVIGSGPDQGRLE
FT                   ALTRDLGMSDSVHFTGPSLTPWRLLEQADVFVSSSLDEPFGLSIAEARAAGCAVVATAV
FT                   GGVPEVLDHGRAGQLVPASAPEAMATVLRRLMTDSEELARWRARARDNAEYFSVRRMAE
FT                   DYDEVYRLVLR"
FT   gene            440645..442021
FT                   /locus_tag="Gobs_0406"
FT   CDS_pept        440645..442021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0406"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   mlu:Mlut_05840 membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73191"
FT                   /db_xref="GOA:D2S580"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D2S580"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADB73191.1"
FT                   /translation="MSDAPGGPGASLRRAVLLTSASSALVPLAGLLTQPVLARALGATG
FT                   RGEMAAAIVPAVLAGSVATLGLPDALTYLAAKRPWTVRRALAWSALLSVAMGILCFFVA
FT                   WALLPFLSDGDAALGRLMLLAMALSIPMLIVGALRGAAMGHQMWGAVALESIVTTSLRV
FT                   LVFVGLWLSGDLTPLIGVLVTFLAPAVAGLCYWPLLRKPPGVAAESVHGDAERVLVPLV
FT                   SYGGRTWFGSVASMLAATIHQILMTPLASVRDLGLYSVAATVMDVPVIFSRAVAGALQG
FT                   VNSKTSNADQVATACRVTTLLGLVGCVVLGLSAPLWMVPLFGESFADAVLPTQLLLISV
FT                   VCYIPGPLAGAGLASFGRPGLRSLAFGLTLLINISVFVVLVPRFGILGACLTGIVASAL
FT                   QSLFLVLAASRVLGIPAHRFVVPGPGDVALVWRESLRVLETLLTPLRGRLTGRKTAGRG
FT                   "
FT   gene            complement(442143..444395)
FT                   /locus_tag="Gobs_0407"
FT   CDS_pept        complement(442143..444395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0407"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; glycosyl
FT                   transferase family 2; KEGG: cyn:Cyan7425_3212 glycosyl
FT                   transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73192"
FT                   /db_xref="GOA:D2S581"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S581"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73192.1"
FT                   /translation="MTEPRRVRLLVYCGAVEWGGAETVLGHLLAGLPDHYDVRLLGVED
FT                   TVLDRLAARRPGTPSTVLPRVGGWQDLRAVLAHRRALAGAGADLVHINLPVPYADAYTV
FT                   LAASTLWHTPVVAVEHLPMPSPGPRIDRVVRFAARRLSAVVAVSEGSARELERLVGLPP
FT                   GAARVVCNGVPEPGSSDAVPLPSGRFVVGAVGRLDRQKAFDVLVRAVAGLPDVHLVLVG
FT                   DGPERAALEALVDELDLQQRVTMTGWSTEAPALMRSLDVLAVPSRWEGLPLVVLEAMLA
FT                   GIPVVATPVGGVPDTVRHEQTGLLVPVDDTAGLTAALDRLARDPALRRRLAAAAADAAR
FT                   RRFTVDAMVGSYVALHDELLGRRGDGEGLQPTDEVVATVPPGGPWPVLAPPPAAPVRRA
FT                   PEPPTFSVVIAAYQAEHTVAEAIESALGQTHPPLEVVVCDDGSTDRTADVLAGFGDAIR
FT                   VVRRPNGGESAAKNTAVAAARGDYVVVLDADDVFHPRRLEALAWLAQKRPDLDVLTTDA
FT                   IVEAGAVPVRRAYHADWPFQVKDQRAAILDGNFVLGMCAVPRERWLQAGGFDESLAVTA
FT                   DWEFWQRLVLSGSRVGLVDAPLARYRLAQGTLSSNPVGMTEARLRVLDRAAARTDLDPH
FT                   EREVVARARTRELRELRRRLLIHLLAEGGRDVRRAALAVLIDTGQRSWSRAVALLALVA
FT                   PGLASRQRRRRVGDTVEIGSGIRVQRARSDVANPPLPEARTPVHPEHRAWRGVDTA"
FT   gene            444413..445645
FT                   /locus_tag="Gobs_0408"
FT   CDS_pept        444413..445645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0408"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tro:trd_0452 glycosyl transferases group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73193"
FT                   /db_xref="GOA:D2S582"
FT                   /db_xref="UniProtKB/TrEMBL:D2S582"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73193.1"
FT                   /translation="MKFLVTADEYPWPARSGYRQRLHWTVRALSGLGSVDLLVARDRPL
FT                   AAAEDPPPEVGLGRSTVVTAGYATRSSLSRAARWLASGRPRRLVGQDWTQVRGVAQQWA
FT                   TAGYDLVWFAHTPTYLALADRFPVPHVVDLDNLESSMARHRRAGRDRLSSGRSVARHLA
FT                   SAGADLLDEWLWRRAEREIAARAAVTVVCSDLDRARLALPRVAVLPNGYELSTRAAGSP
FT                   ARPTPDGGVLLFIGPLTYEPNHDAVAWFAREALPLVRARRPDACFRVVGDHDADVVDGV
FT                   GEIPGVKLTGEVPDVTAELAEASVVVVPLRFGGGTRIKVIEAFAHGVPVVSTTVGCEGL
FT                   NVEDGRHVLLADDPPSLAAACLRLLEDEERRTALSAQAGDLWQRRYRWTVIAPTVGQIV
FT                   ETALARPGSPP"
FT   gene            445642..447030
FT                   /locus_tag="Gobs_0409"
FT   CDS_pept        445642..447030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0409"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cyn:Cyan7425_1730 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73194"
FT                   /db_xref="GOA:D2S583"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2S583"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73194.1"
FT                   /translation="MSDRPGQDGPVVSVVMPFLDAAPHIRQATGSVLRQSWTNLELLLV
FT                   DDGGTDGSDRIARRLAEADPRVRVLSHEGRRNRGTGPSRALAIGHARGDLVAFLDADDA
FT                   WEPHHVADQIALLEAHPEADIVCGRAWVWRSWRHPAATDVLSDLAFVPGAVVSGRQLLA
FT                   AVLRNGAVATSTCSLLARRETLLGVVPHVEAFTGLFEDQVVNAWLQLRGTAVMSGATSA
FT                   WYRMHDRSISARLGSQEEARVYLRFLAWVRDQLGEGEGEGDAELVELIDRASRRTTESL
FT                   PPPQQPRPGHLLRAVVPTAVRRQIGRVRRALHRPRTPEPEVGPQEVAEALHRHGADLRG
FT                   DVLVLGDGTAVVGSTATTSVRALPLPGPQAAAGPAHVLADLASDAYDCVLLVEDAGSVE
FT                   AGDRGLRHLRRALRPGGVLLVVPRRDDPSLAEDLQAVFEWDAVSRDAPGGPYATVLRAF
FT                   VPAP"
FT   gene            447089..447790
FT                   /locus_tag="Gobs_0410"
FT   CDS_pept        447089..447790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0410"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: met:M446_3307
FT                   glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73195"
FT                   /db_xref="GOA:D2S584"
FT                   /db_xref="InterPro:IPR003105"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2S584"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB73195.1"
FT                   /translation="MDSAPTRLPIRVLRAVERRSALARRAKFRIRWAGTRRLDPLSEWG
FT                   FDRGTAVDRYYIERFLQEHRDLVHGRTLEVKEDLYASSLGAEQVDVLDIDPTNPEATIV
FT                   GDVCDPATLPEGTFDAAIVTQTLQLVPDPVAGLQNVLRALRPRATALVTAPAMSRLAGD
FT                   WDRWRWTARGLQDLVDRAGGTGAVVAHGNQVVCRAFLLGAAIDDLPSAVRDVDDPDFPL
FT                   IVTAVVRRGAT"
FT   gene            complement(447813..448763)
FT                   /locus_tag="Gobs_0411"
FT   CDS_pept        complement(447813..448763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0411"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   nar:Saro_2628 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73196"
FT                   /db_xref="GOA:D2S585"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S585"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73196.1"
FT                   /translation="MTAPWPYLAPPGELVEPATPLTIGVLVTAHDVAPLLPAALQSVFA
FT                   QTRPPDQVVVCDDASSDDVDGALRPFRDRVRLVRHPAQRGEGAAKNTAVAALDTDLVVV
FT                   LDGDDEMASQRLEALGWLAEHRPDLTLLTTTWEAFGPGVEATDWSLADHFPTTDQRAAI
FT                   LRWNFLPAPAMRRTALLEAGGFDETLRYGPDWECYLRMFLRGAAAALVPVPLYRYRQWS
FT                   GQQTADRERVLAGRVRVAEMIAANALLEPDDRRIADRSLWELRYEYWTWRLDHGAATRP
FT                   ESLALLRSGCTSGRRTALLALATVAPGLARRWRAR"
FT   gene            complement(448760..449734)
FT                   /locus_tag="Gobs_0412"
FT   CDS_pept        complement(448760..449734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0412"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   met:M446_3306 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73197"
FT                   /db_xref="GOA:D2S586"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2S586"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADB73197.1"
FT                   /translation="MAAGIRRRWQQRPVWPRRWRPRGQHVVLLYHRIADVDQADDPGGM
FT                   VVPPELFRQHMTALRDWFDLVPAREVLAPHERPTAAVTLDDGYLDNLEQAVPLLRQLGV
FT                   PATFFIVADALQPDPPEYWWDRLEHLVLEPGPGADRVRVTAGRRVLELDLATRSSAVQA
FT                   YRDLSAVLQRQGHGAAVQALTTLEAARPRPQSCARHRRLSAEQVRALAEEPLFDVGSHT
FT                   CTHSALAALPRQVSREELTRSRQRLADLLGEAPELVAYPYGSVGAVVRRNAGDARSAGY
FT                   RAAFTNVAGPVEGSPAYAVPRITVGRWSVEQLHAAVTAFRRPE"
FT   gene            complement(449865..450755)
FT                   /locus_tag="Gobs_0413"
FT   CDS_pept        complement(449865..450755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0413"
FT                   /product="glycosyl transferase family protein"
FT                   /note="KEGG: bcm:Bcenmc03_6751 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73198"
FT                   /db_xref="GOA:D2S587"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S587"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_6751"
FT                   /protein_id="ADB73198.1"
FT                   /translation="MTGPTPRDRQVAVVLASAGRPELLAEVVADLGRQTVQDFTLVVSV
FT                   PDRDSLPPRPLPEGTLLVHDRGLAAQRNAGLAAVPDATHVFCFDDDAVVREDYLERGVA
FT                   FFDAHPDVVALTGRVLLDGATGDAIPRDESDEALAASLTEPLTGAWEPSRELYGCNFAF
FT                   RPDAVAGERFDARLPLYSWLEDHDFARRAMRHGKLARVHDCVIVHRGVKSGGRTAHERL
FT                   GYSQVMNPAYLHHVGSFPLWLTVYETLPRVGKNAVRAVRGPETAWRRERLRGNLVALRD
FT                   VVRRRFTPERILELR"
FT   gene            450893..451984
FT                   /locus_tag="Gobs_0414"
FT   CDS_pept        450893..451984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0414"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rha:RHA1_ro05732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73199"
FT                   /db_xref="GOA:D2S588"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S588"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73199.1"
FT                   /translation="MTLVHERFTEYAGSEMVVEQLAREWPDAPILAPVARPGVLPADVE
FT                   PRVRSTWLSRLLRGSTYAHLLPALPVAMSRLPVPPSDVVIASHHAFATQVVHATTAPVV
FT                   AYVHSPARWVWDPSMRANEAGGRLGAAGLGAFSAAFRPVDLRAAARVHTLVGNSRAVAE
FT                   RIRDWWGREATVVHPPVDTQYYCPDPAVPREDFFLLAGRLVPYKRSDLAVRAARQAGVP
FT                   LVVAGEGRARAEVEQLAGPGTTFVGRVDDEGLRDLFRRCRALLMPGVEDFGIVPVEAQA
FT                   CGAPVLAIDAGGARDSVLPGVTGELVPAAGEDEEVDVWARALASFDGASYDPAAIRRHA
FT                   ESFSRAHFRGAMADVVDRVLSSS"
FT   gene            complement(451971..453119)
FT                   /locus_tag="Gobs_0415"
FT   CDS_pept        complement(451971..453119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0415"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   rca:Rcas_4314 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73200"
FT                   /db_xref="GOA:D2S589"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S589"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73200.1"
FT                   /translation="MEQRDADDRRDRRMSGPVRWLLMAGHVPPGIRGGGIVRYTVELAR
FT                   ALVRRDDVELHLLASPAAAGSLADLVGGPERIVTLPAVPEAVIPAFERLALGRRLGSRF
FT                   DVVQGTKHLLPRGVRARTALTVHDLLLFDRPQDFPLPKRLLLARPYAASLRQADSLVCV
FT                   STATRDRLVRWDPELAPRATVAPLTTSPQLLDSEPVPVPSLTGRPFALVVGDPGPRKNL
FT                   SVAVSAWARVVRRHPDAVLALVGPPAWGSQSYGPDHAGLVADGRLVQLTGVDDGTLRWC
FT                   YEHCAVALAPSLAEGFGLPAVEALDLGAPLVTSMDPALVEVSGDAAEHLPADDVAGWAE
FT                   AALRRLEHTGARDPASRQRRTWDDVAAETVAAVLGSGPVSSS"
FT   gene            complement(453151..454179)
FT                   /locus_tag="Gobs_0416"
FT   CDS_pept        complement(453151..454179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0416"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mpt:Mpe_A0735 putative glycosyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73201"
FT                   /db_xref="GOA:D2S590"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S590"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73201.1"
FT                   /translation="MQERTLQRISVVIANHNYGRYVGQAIDSALTLDWDDVEVIVVDDG
FT                   STDDSREVIARYEDRITILYQDNATQRVARNRGYELSTGDVVIHLDSDDVLFPSVGREL
FT                   ARVWHEGISKVQFQMLRIDEHGRSLGSVFPRYSRESTPQEIRAWADSTTAYPTPPGSGN
FT                   AYSRAFLDRIFPLDDSCGPATDSACLAVAPFLGDVVTVAKPLVGYRVHGSNTSDLLADP
FT                   EKFPRAVERARQRYEYANRVRGDMADGRALRRSRPLLELRIASYRLCPDDRPLAGESFR
FT                   RLLWDTLRSPAHPGPESIPKRVQVLVWSLLTLLAPDGTARRLVRVRFRRDRRPLRLAAG
FT                   GR"
FT   gene            454664..456169
FT                   /locus_tag="Gobs_0417"
FT   CDS_pept        454664..456169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0417"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="KEGG: kra:Krad_1048 undecaprenyl-phosphate galactose
FT                   phosphotransferase; TIGRFAM: exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73202"
FT                   /db_xref="GOA:D2S591"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D2S591"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADB73202.1"
FT                   /translation="MTLPETHNAAVRRTAPSISRRWLWLADRLRGEGTLARRAWRGSYV
FT                   RRLVVLDVLAAFVAALVGSRVPEDGVLGVHEAFPWMVAALPVVWVGAMVAARAYEERFL
FT                   WVGPEEFRRVFFAAALLLATVGTVSWAFKLEVARSFVVVALPLATLLTLGQRWVLRSRL
FT                   HRQRAHGRHQQTTLLVGHRSGVAALSAQMEREAYHGYRVIGCCLPLSEDDRDVFDGLPV
FT                   LGDLEEVVDVVHRYEVDTVAVLPSPELDGPQLRKLGWDLEETQAELLLAPAVTEVAGPR
FT                   VRIRPIAGLPLVHVERPEFSGVRRVIKGVVDRSLAGLGLLVVLPVLVSLALLVKITSRG
FT                   PVLFKHERIGRDGQPFEVYKFRSMVVDADKVEMDLFDQNEGNDVQFKMRRDPRVTRIGA
FT                   VMRRYSLDELPQLLNVLGGTMSLVGPRPHVTREVEQYGFDMQRRLLVKPGITGLWQVSG
FT                   RSDLSWDDAVRLDVRYVENWSLALDFMILWKTIGAVLRGSGAY"
FT   gene            456559..458046
FT                   /locus_tag="Gobs_0418"
FT   CDS_pept        456559..458046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0418"
FT                   /product="exopolysaccharide biosynthesis polyprenyl
FT                   glycosylphosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="KEGG: kra:Krad_0013 undecaprenyl-phosphate galactose
FT                   phosphotransferase; TIGRFAM: exopolysaccharide biosynthesis
FT                   polyprenyl glycosylphosphotransferase; PFAM: sugar
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73203"
FT                   /db_xref="GOA:D2S592"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S592"
FT                   /inference="protein motif:TFAM:TIGR03025"
FT                   /protein_id="ADB73203.1"
FT                   /translation="MADATEGKATPRAVARVWTGVRVGTVSSEGAASTVRTWPTLEAHA
FT                   RRHEAWWLRRGVGPYLILVDVLAFTLATVITLPGSAVAHGLALVCLLLVFWRAGLYRSR
FT                   LELSLLDDLPYVLAAVVVAWTFKVALFSVLPGVDPPVQQVVHVVVLLAVLLAARGIAYR
FT                   VVHTARCRGVVRHRTLIVGAGPVGVRIANTLLERRNYGLDPLGFLDADLPEDTRALLPI
FT                   PLLGGYEQLGAVIRELGARDVIVAYGGVDEDELVDILRTCDRLDVEVFVVPRLFELHNA
FT                   NRHTDEIWGIPLLRVRRAVYRSPWWRVKRLIDVVVSALTLLVISPVLVACAVAVRYEGG
FT                   PGIIFRQERVGLDGRPFQVLKLRSLKPVNETESQTNWNIKHDDRLGPVGRFLRATSLDE
FT                   LPQLWNILRGDMSLVGPRPERPHFVQQFSTHIPRYTARHRVPAGLTGWAQAHGLRGDTS
FT                   IEDRARFDNYYIENWSPWLDMKIVLKTVGQVLRRQGG"
FT   gene            complement(458211..458387)
FT                   /locus_tag="Gobs_0419"
FT   CDS_pept        complement(458211..458387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73204"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Y7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73204.1"
FT                   /translation="MGWVWTAVAVWVLLSVPTAVLLGRAIHRAERPELAQLTGSPTPVA
FT                   RSREPDRPPPLPH"
FT   gene            458601..458717
FT                   /locus_tag="Gobs_0420"
FT   CDS_pept        458601..458717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73205"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Y8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73205.1"
FT                   /translation="MAVLSGRVHRHRFRWTEDDAFSGSSLYACHCGVVRPAL"
FT   gene            458842..460161
FT                   /locus_tag="Gobs_0421"
FT   CDS_pept        458842..460161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0421"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: kra:Krad_3900 UDP-glucose 6-dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73206"
FT                   /db_xref="GOA:D2S5Y9"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Y9"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADB73206.1"
FT                   /translation="MRVSVIGCGYLGAVHAASMAELGHEVIGVDVDQRKVAALNEARAP
FT                   FYEPGFEDLLARTLATGRLRFSTDISDATGSQVHFVCVGTPQKRGEYAADMRYVEAAVE
FT                   SMLGVLAPGELVVGKSTVPVGTAGRLAELVGEKAPGAMLAWNPEFLREGFAVQDTLHPD
FT                   RLVYGLPADQGRETAERMLDEVYAAIVARRTPKVVTDYATAEMVKTAANSFLATKISFI
FT                   NAMAELCEATGADVKQLADAIGYDDRIGRKFLNAGLGFGGGCLPKDIRAFMARAGELGA
FT                   DQALTFLREVDNINMRRRIRMVELAREVCDGSLLGKHIAVLGAAFKPDSDDIRDSPALN
FT                   VAAQLQLQGADVRVTDPAAIESSRRLWPQLDYAATPEEAAERADAVLVLTEWRQYRELD
FT                   PVAFGRVVAQKRVLDGRNALDREAWTAAGWSYRALGRRAG"
FT   gene            460563..462269
FT                   /locus_tag="Gobs_0422"
FT   CDS_pept        460563..462269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0422"
FT                   /product="GMC oxidoreductase"
FT                   /note="PFAM: GMC oxidoreductase; FAD dependent
FT                   oxidoreductase; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: bra:BRADO2203
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73207"
FT                   /db_xref="GOA:D2S5Z0"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z0"
FT                   /inference="protein motif:PFAM:PF05199"
FT                   /protein_id="ADB73207.1"
FT                   /translation="MTSPPPDGAAVDVCVVGAGPVGLSLALEAARSGLQVLLVEAGHRT
FT                   RKPSGTPLDETIATVLDPGVHAPFSATTRLGLGGTSWLWGGRCVPFELADLAPRDHVPF
FT                   SGWPLFRSDIAPYEAEAAHYLDCGSAAFHADPVGGWDETVVRTTQLERWSRRPAVARRL
FT                   GAQVLSHPGIAVVSEALVTGVVVDDTGTSVRHLRVWRDRREVTVEAAAYVLACGGVATT
FT                   RLLLNTQRSNPALFGGPSGALGRYYMGHLTGSIASIVLTHPDDVADWGLVRTEDGTVVR
FT                   RRFTLSEQAQQDHRLLNTAFYLGNLPFSDARHGSGALSLFSLCLAAPVLGRVLGRPETR
FT                   RRDVGGGARDWRSHLRNLTRRPGRVIRDVAAVVRLRLLSPRRGAEFLLRTDTGAYALRY
FT                   HAEQEPDPGSRITLNDRTGSDGLPGIDVDLRYSDQDVDSVLRAHSLLDEHLQTTGFGRL
FT                   VYRHPLDQRAAAVRAQAMDGYHQIGTTRMSDDPQSGVVDADCRVHGTTNLYVASSSVFP
FT                   TAGEANPTFMAVTLAVRLARHLADRVGVCDPASGMRRRDRGEPVTPTRFPH"
FT   gene            complement(462446..462709)
FT                   /pseudo
FT                   /locus_tag="Gobs_0423"
FT   gene            complement(462891..464023)
FT                   /pseudo
FT                   /locus_tag="Gobs_0424"
FT   gene            464435..466613
FT                   /pseudo
FT                   /locus_tag="Gobs_0425"
FT   gene            465308..466399
FT                   /locus_tag="Gobs_0426"
FT   CDS_pept        465308..466399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0426"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: sma:SAV_364 IS110 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73208"
FT                   /db_xref="GOA:D2S5Z1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADB73208.1"
FT                   /translation="MTSMSPAAEVVQRRHRAVIGVDTHKYIHVAVALDEFGGVIDAQRF
FT                   AADRAGYTQLIDWALGLGRKLTFGIEGTGSYGAGLTAAVRRRDIGVIEVLRTDRRDRRL
FT                   RGKNDTLDAENAARAVLGGQATAVPESNDGVVEMLRQIKVAKDIAVKARTAAMISLKAV
FT                   VVNAPPELRETLQPLSKMALIDRCAGLRPGPVTTVAAATKHTLRSIARRWQQLHEEIKA
FT                   HEVLLTELTGQLVPQLVAAFGIGADTAAELLIVAGDNIDRVRSEAAWARLCGVAPVPAS
FT                   SGLTTRHRLNRGGHRQANAALYRALIVRMQHHEPTRTYVTRRTREGKTKAEIIRCLKRL
FT                   LARETWALPRPLRTPSRTAPTPA"
FT   gene            466841..467683
FT                   /locus_tag="Gobs_0427"
FT   CDS_pept        466841..467683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK21299 gene product from transcript GK21299-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73209"
FT                   /db_xref="GOA:D2S5Z2"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73209.1"
FT                   /translation="MWIWIVGGLLLWVLLAFAVAVVIGRGIRMADMLSGPPLTAADATG
FT                   EVRLRTARRRVPLPPVGIALAATAVLLETTGYITRLAGATGPVARALSMDAPFSVPRTF
FT                   VAALFAVAAVAAVAGAVRAPGRRAWWIAVGLVSAGIAVVKFGGTVHVDVMTALSDAVGA
FT                   AGAVVVSVAVVVAVLAVLAFVSRAERRDRRRVLTGLAAYGAASVGLSTISTLAVGQWAV
FT                   TATYLEESGEALAGVAVLVAVLVGVAPRLVLPAPWVLRRHSDAATLDVPEQLPRALRG"
FT   gene            467821..469137
FT                   /locus_tag="Gobs_0428"
FT   CDS_pept        467821..469137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0428"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fra:Francci3_1586 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73210"
FT                   /db_xref="GOA:D2S5Z3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73210.1"
FT                   /translation="MRLLTTPRNSTEAPGTWCCEFELSGDAPSRAVSAPAGQQQARVLV
FT                   RLHGEPLGYLDLPLPSAGLDVGDLVRRAHAAFAPRIAAHLDQEAIEVEGRPAPAGEGCP
FT                   NRVDSDGLVTVVVCTRERSAVLAVCLQRLQQLSHRDVEVLVVDNAPSDDSTRRVVEAAA
FT                   ATDPRIRYTREPRPGLSAARNRGLAEARGRHVLYTDDDVSVDLDWVQGVLRGFRRRPDV
FT                   ACVTGLVCTADITSPAEAYFDARAAAWSARTEPRLFDLAAERDGSTLYPYAPGLFGTGA
FT                   NFAFDRDHLRALGGFDEALGAGARTRGGEDIDVFVRVLRSGRAIAYEPAAIVWHHHRAD
FT                   DAALLAQLYGYGTGLSAFVAKYLLSRETRGEVLRRVVAGARRLATIPADTDARLGDQAV
FT                   RPPGARRRELFGVAVGPLLYLGALRDVRRRAGDVAAAVC"
FT   gene            469418..470788
FT                   /locus_tag="Gobs_0429"
FT   CDS_pept        469418..470788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73211"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73211.1"
FT                   /translation="MVGIADPLAAVPAVLPPLRRPRPRSLLLGLLLTAGLWVLLVTTAD
FT                   SAQAAGARPMATAGQHSPIGDAGWQPGSGPGDDHSHAWDHGPSDGSPASEDEEVPAPVE
FT                   EPAPAPAVSAPAPAVPAPAPAVPAPTADAGATPPPVQPAPAVPAGVPAATPPTTPGITP
FT                   AAPTPPAPAVGAGATQPSTEPAPAVPGGAPVATPPTTAGSTPSTTTPGTSRPPAQATPA
FT                   ADKGATDKALERAAAQKAAADKAAADKAAADKAAADKAAADKAAADKAAADKAAADKAA
FT                   ADKAAAGEPAPVSGQSVPTVAAVTCPAPPVPGAPTPPASPAVVEDDGAPSEDLSSLRDQ
FT                   HTRTTGTAHVGAPPAPVVVAPAQGVVIDAQDAPPSAPVPVSPPPAPPAAPAAPCTTGAA
FT                   ASGTYASGAGQHGLASIPLAILGTEIAAPVPLTAELRWIDVPARVIGGGDDPGCSPD"
FT   gene            470950..471855
FT                   /locus_tag="Gobs_0430"
FT   CDS_pept        470950..471855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0430"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fal:FRAAL6118 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73212"
FT                   /db_xref="GOA:D2S5Z5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73212.1"
FT                   /translation="MREAKSIVDVRPPAEVVPHPSAYAGQVRTTVPRVSVIIPTFNEAK
FT                   NLPHVFSRLPDVHEVIVVDGRSVDDTIEVARTLWPDVRIVLQNRRGKGNAMACGFAHAT
FT                   GDIVVMLDADGSADPREIPRFVQALTDGADFAKGTRFANGGGSADITRTRKWGNRWLNR
FT                   IANLFFGTRYTDLCYGYNAFWAHCLPALELDAGDRGSDAKLWGDGFEIETIINTRMAKA
FT                   GMRITEVPSYEFERIHGESNLNTWRDGVRVLRALIVERVNGKGRRSRRNLLAHAAESAR
FT                   DVHRIQPNFAVQPEDEARWG"
FT   gene            471959..472936
FT                   /locus_tag="Gobs_0431"
FT   CDS_pept        471959..472936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0431"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; Male sterility domain;
FT                   polysaccharide biosynthesis protein CapD; short- chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: sco:SCO2988 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73213"
FT                   /db_xref="GOA:D2S5Z6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z6"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ADB73213.1"
FT                   /translation="MTWLVTGGAGYIGAHIISAMREGGQDVVVLDDLSSGDLARIPGTH
FT                   VVQGSVLDAERVARTLRDNDVRGVVHVAAKKQVEESVNRPLYYYRENVEGLRVLLEAAT
FT                   DAGVGSFIFSSSAAVYGSPDVDVVDEDTPCLPVNPYGTTKYVGERMVEEVSAATGLRYV
FT                   NLRYFNVAGAGTPELTDRGVSNLVPMVFQRLAQRQAPRIFGDDYATPDGTCIRDFIHVA
FT                   DVASAHVAAAQALADGRVERLTANIGRGEGVSVQEMIATIRRVSGTAGEDWSQPVVEPR
FT                   RAGDPARVVASADRIRDALGWKARYGVEEMVASAWAGWTARTAG"
FT   gene            complement(473022..474110)
FT                   /locus_tag="Gobs_0432"
FT   CDS_pept        complement(473022..474110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0432"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: ach:Achl_2626
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73214"
FT                   /db_xref="GOA:D2S5Z7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z7"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADB73214.1"
FT                   /translation="MSRGTALPRLTSLRLFAAAVVVVFHLDQWGIASLPASLSTLGFVG
FT                   VSFFFVLSGFVLAWGTDPALPARRFYRHRFARVWPSHAVMVGVAALVPVVPVARSWEAA
FT                   VPNLLLVQSWWTDPEVVFGMNGVAWSLSCELFFYAMFPLTVWALRRVPGVVQWALPLTA
FT                   LVVAGYVGVQDAALGEHLPALRFSEFLLGVVAGLALRGGWRPRVHPLVAAVAVVVGLAI
FT                   SYRTPFPLPNVVMPLPFLLVLLSAAARDLDGRTGWLRSRALVFAGEASFALYLVHELVI
FT                   VNLAPYLWEVGPQWVIALLIAAIACALAVLLHLGVERPCNKLLRGRSRSVALAPPGALA
FT                   HDAAEAEAVGRADATPREGGRV"
FT   gene            474327..476231
FT                   /locus_tag="Gobs_0433"
FT   CDS_pept        474327..476231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0433"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; KEGG: fal:FRAAL1880 mixed type
FT                   I polyketide synthase-non ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73215"
FT                   /db_xref="GOA:D2S5Z8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADB73215.1"
FT                   /translation="MSAATTSEGVPPLVMPGPYTSVAERLREVSDHLADRPAVVAADGD
FT                   LTYRELQQHVDAVVRALAALPVVDGDGTRQPIGLLAEQGSASVVAMLGIMAAGHPCVLL
FT                   DVLLPPARLGVVTERAGVTVVLADDERRDVAAGLPGVGTVADLVPSDDATSDIPAPAIT
FT                   LDDPASLVFTSGSTGLPKGVVWTQRTSLAIGHTSRVTLRATPEDRMALVVPQAFAVGQL
FT                   MILAALLNGATLCVRDPRIHGIRDLAEWLDATRVTILSCTPSLLRAIHGALPEGHVLET
FT                   VRMVTTAGEKVYGNDVTDFRTHLRLGASFLNWMGSSETEALTGFEIRPEDPVPDGAVPI
FT                   GRAVPLRDLAILGPDEEPVPAGEVGVLYATSAYFSAGYWRDPAATAVRFRAEPDGRTRY
FT                   CTGDRARMSADGLVEILGRADDSVKIRGYLVEPGEVEVALRALPAVVDAVVRGVGVDDE
FT                   TRLVAWVVPDPHRPRPTEAALRSDVGRALPDWMVPRDVVFLPELPRNERGKVDVGALPP
FT                   PPERRETAAPETETEVALAGIWEPILKTEGIGREDSFTALGGESLAIEEMLAAVEQQYR
FT                   LRLAADDLIDHPTLAEFAAFVDSRRSSGLAGRLAAVTPRLEAAGKAVGGLLRGRNRRS"
FT   gene            complement(476405..477787)
FT                   /locus_tag="Gobs_0434"
FT   CDS_pept        complement(476405..477787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0434"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fra:Francci3_1581 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73216"
FT                   /db_xref="GOA:D2S5Z9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S5Z9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73216.1"
FT                   /translation="MNPERVIEQPAPAGPTPLREAPSPAGGPAGPRAFRPRRVLAVDLG
FT                   TGAVEYPDPDRRPEHPDARVLVRWLGEQVDVVEVTAPDAEVAAAAADAVWASSRAEVLA
FT                   VAERIGVPAPTSAEDLLAARPDAPSTAGLPTHRPLVTVTIASLRNVEPTIACVRRILTS
FT                   SWEPLEVVVVDNDANGEPLRTAVEAAFGDDERVRWVHEPRQGLSFARNAGLEAARGEIV
FT                   VFTDDDVLVDHRWLERLVAAFDATEGVACVTGAILPAEQETQAQVFLEEYGGFHKGFQR
FT                   QVFNLTTHRRDTPLYPYDSGQFGSGANMAFRREALREMGAFPLDLGAGTVAHGGEDLDV
FT                   LRRAITAGHTVVYEPAALMWHYHRRSMEALRKQMYRYGVGLSATVTKWLLEDRAVAVEV
FT                   LRRIPRGVLHVARPGSAKNSGKSAEFPTVLTLLELLGVLYGPIAYLRSRRRTPQRVAAG
FT                   TR"
FT   gene            complement(477873..478100)
FT                   /locus_tag="Gobs_0435"
FT   CDS_pept        complement(477873..478100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73217"
FT                   /db_xref="GOA:D2S600"
FT                   /db_xref="UniProtKB/TrEMBL:D2S600"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73217.1"
FT                   /translation="MVDALTGWLGMVLIGLTVVLALAIEVRDERAATDGGAVPGGRRSR
FT                   RSRRVWLLVLAVLVVASLAATGIRLATMAF"
FT   gene            complement(478103..480304)
FT                   /locus_tag="Gobs_0436"
FT   CDS_pept        complement(478103..480304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0436"
FT                   /product="putative serine/threonine protein kinase;
FT                   putative membrane protein"
FT                   /note="KEGG: fal:FRAAL6112 putative serine/threonine
FT                   protein kinase; putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73218"
FT                   /db_xref="GOA:D2S601"
FT                   /db_xref="UniProtKB/TrEMBL:D2S601"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6112"
FT                   /protein_id="ADB73218.1"
FT                   /translation="MSATGTAAGDSAPAIAEAVPPPRQQPTSGDGVPAHERVVLLAAAV
FT                   VALAVPVVAAVDADLPGRGLLAVLFVLTVPGVPLASLLRLPGKLLPAALAVALSLATAL
FT                   LLATAGLAAGWWSPVGWATVTAAIGLLATAWALRRLPATTSPAVARPAGTARGGSDPWS
FT                   RVAAAVPLTLALGLWGLATRWTDLDDAGATGVIGVVAWPYVVAIVLVVAVAGVHLVRPR
FT                   LDPVVLGAAAVVLALVVYAFVNVTDGQASVPTGWLHVGFADFIAANERSFDGLDARASW
FT                   PAFFAVAAQLVHLGGVADATSFLALAPFAYNVLAIPAVLVIARGLTRSGRLGWLAVFLY
FT                   LGANWVQQDYFAPQATAFLLYLAVLATLVWEATSAPVAPLTGSLSAKAAQVWRRRPGLP
FT                   AGTTSGQSLARLAALVYLSAALVVGHQLTPISLVVTAFVFALTGWTRHRLLWLVASLLF
FT                   VGWFSYAASGYWVGHLDTVLGDVGQLFGNLDSALSSRVEAGDETYQLMQNLRIGWSLLY
FT                   GVLALVGLWAIRRRPEALLVGLLLAGSGALVAMQSYGGEVMLRTFLFAAPLLAPLAALA
FT                   LARLTARQAVTGGVALAVVLTVWALLGTAARGVNVAFERVTADDVAAARVLWEELDAGD
FT                   TVGLVATAGAYGADRVGDYEPLVMDEEFCGMPALDCALDRQPDFIVVGRTQDAQRELAA
FT                   GGPPGASTALAEDLVRSGLYEPIYSGTDARVLRLVPQGG"
FT   gene            complement(480459..481760)
FT                   /locus_tag="Gobs_0437"
FT   CDS_pept        complement(480459..481760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0437"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   mva:Mvan_2675 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73219"
FT                   /db_xref="GOA:D2S602"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D2S602"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADB73219.1"
FT                   /translation="MSGAGAAGRRHLERNALYLMAGTVLTAGVGMVFWVAAARYYPTAE
FT                   VGRASAVISTATFLGNLSHLNLGNVYARFLPAAGRRTRHLVTRGLLMTGGIGLLVGAGF
FT                   VLLWQGDVLFASDAEAAFFPLAVAVLTVFTVQDFVLLGLRSASWIPIENLAFSIGKLVL
FT                   LIALAFVVPEGGLVIAWVVPAAVAVAVVQVLIHRRLLPRRMDGVGPDRLPPVRGLVGYA
FT                   SAEFATGVMAHVIPMILPLIILHELGAEQNAYFAIPWVINSALNMLTWNIATSFVVEAS
FT                   TDEDQTQALTRRSLRLGLLVGGSGALGLLVFAPLILHVFGGEYASEGVELLRIMAVAEP
FT                   FCIITTVYSGVLRVRRQAGRVVIVQGFIAASIVTLTVLLIPTMGINGAGVAYLLAEGTA
FT                   GLVLLIPLIRSLRHRKPVGAPRPDAVPAVPGADR"
FT   gene            complement(481757..483046)
FT                   /locus_tag="Gobs_0438"
FT   CDS_pept        complement(481757..483046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_58310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73220"
FT                   /db_xref="UniProtKB/TrEMBL:D2S603"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73220.1"
FT                   /translation="MNATPGTTPASGRSLRVQAHNAQWVDLSSVTLLAGLDPTVDPAAL
FT                   RAALRRLHDVDPTAPILCRVAPDPLRWVPVPPEEIDAWLEELVVDVRGTAKEDAEDVVE
FT                   RLLREADPMVPFRLHVHDDHHAWQLSHVLGDGVYANRHVIAELVRCAATGEVPVGLARG
FT                   PHRPRLLAKAVWRTFLRRPRAATWREAVSRLRSAPPSSAPQRAPAERQIALSVVSRTSA
FT                   PGVRDEVRRWRDAHAADTSVAIATMAAVRAALGAEGAVPPGTDTVVLFDGRRYLPPGTH
FT                   VVGNFSAALRLRPGNATDPQLMARQMRRDAALGLPLVSLLVATAGQALTRFPRAAKGGS
FT                   GSVVLTHLGALTEVQELPWQAPEGEQQVIQAPAPSPVVSMTAAISEWHDRLLLTVSFDS
FT                   RRVHRAAVTRALERVLADPAAFLPGTGTAA"
FT   gene            483430..484266
FT                   /locus_tag="Gobs_0439"
FT   CDS_pept        483430..484266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_54530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73221"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2S604"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73221.1"
FT                   /translation="MPGHLSAPGPGGRAPSGGARRRMAAALAATALLAGCGSDARSPAA
FT                   PEVEPEVAELTVNGQEAVAIAPGEGDPQGLVVFLHGLDDDHGALAEEQKRVDMVEHLLA
FT                   QGYVVGASDGHFNAFGNEASQDGYVALAAELAERYGTTETYLVAESMGAVAGLQILADD
FT                   RIPDVRGMALISPLVDLDVVLDTPQEPQVFQAFEGTFPTGTRNPALRPSSDWAGTSMRF
FT                   YLATEDEVVVSARNAEPFVERVQDVADVSVVECEGEHVAPSCFQGDDLVEWFEQLD"
FT   gene            complement(484285..485136)
FT                   /locus_tag="Gobs_0440"
FT   CDS_pept        complement(484285..485136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0440"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: sma:SAV_6571
FT                   polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73222"
FT                   /db_xref="GOA:D2S605"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D2S605"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADB73222.1"
FT                   /translation="MSRAMEDQAATRRRPAVPILLYHAVTETPGTHIAPFAVPPSAFAQ
FT                   QLDLLLEAGYRCVTFGELVAAEVAGRPLGDPDDGRKTAVITFDDGFADFATAALPALRE
FT                   RSLVSTLYVTTGWLEGGRDRRPGPSDRMLDFAQLPGLLAEGVELGAHSHSHLQMDTLGA
FT                   AQLRDELVRPKELLEDVLDRPVTTFAYPHGYNGPRVRRATRQAGYENACGVRNVLHCAG
FT                   EDVFAVSRLMLRRTTTLDELSRWLEDVECRPAGRESWATRGWRAYRRARAVARRRPGSV
FT                   YA"
FT   gene            complement(485153..486100)
FT                   /locus_tag="Gobs_0441"
FT   CDS_pept        complement(485153..486100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0441"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fal:FRAAL6119 putative succinoglycan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73223"
FT                   /db_xref="GOA:D2S606"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S606"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73223.1"
FT                   /translation="MHHSLTVVICAYTLDRWSDIEDAVASLRRQDHRPDQVVLVVDHNE
FT                   ELLERARAAFPDVSVVANTGSRGLSGARNTGVEVAIGDVVAFLDDDAAADPRWTAQLLA
FT                   AFAADDDVIGVGGWVEPDWRAPRPAWFPDEFLWVVGCSYTGLPTTRTEIRNPIGANMAF
FT                   RRDVFTKAGGFDSDMGRMGADAAGCEETEFAIRARRTLPRTRVVLEPSAVCRHGVSPDR
FT                   VTRAYFRRRCQAEGRSKALVSRLAGADSALETERTYVSRTLPRGVLRGLRRLARGDRAG
FT                   GAQAWTIIEGTALTAGSYALARVKQRRTGTAPVS"
FT   gene            486309..486530
FT                   /locus_tag="Gobs_0442"
FT   CDS_pept        486309..486530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73224"
FT                   /db_xref="UniProtKB/TrEMBL:D2S607"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73224.1"
FT                   /translation="MHPLGSDPVPAPLVSRPPSLRLVEAAVSAVAADGRSCGCGHGRQA
FT                   HEHYRRGTDCALCACARYRRPRFGLFSR"
FT   gene            complement(486585..489551)
FT                   /locus_tag="Gobs_0443"
FT   CDS_pept        complement(486585..489551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0443"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; Thioesterase; KEGG:
FT                   cti:RALTA_B0309 putative acetoacetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73225"
FT                   /db_xref="GOA:D2S608"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2S608"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ADB73225.1"
FT                   /translation="MADFRDRAEVAAGRDLGNAVALHEWSVQEFRDFWRLFLDWAGPAW
FT                   EGSADPVCTGDDVETAVFFPAVSLNYAENLLRPLPGVDDGAVCLTSVHGDGSRDRWTRA
FT                   ELREDVDRTATALARLGVGAGDRVVVVAANNGHAVVAALATAALGATLSSGMPDMGPAA
FT                   LLGRFTQVEPALMALDRTGATGWDGTDGDLLDQVVAGLPTVRTVVVLDVLPLPSLRGVR
FT                   VVRLADLLSDLGPDTPRTPWPRMPFNDPLFVMFSSGTTGPPKAMVHGIGGTLLEHLKEH
FT                   RLHGDLDARDTLYFQTTTAWMMWNWQLSALAVGAGIVLYDGPVPGPETLWRLAAEERVT
FT                   VFGTSPAHQQLSQDTGLRPAEVFDLSALRAVMSTGSVLHDWQFDWFAAAVGPQPLQSIS
FT                   GGTDIIGCFVLGHPELPVVRGRSQALSLGLDVAALDAGGHAVVGPPGELVCRRPFPSRP
FT                   VRFLRDPDGSRLHGAYYTEHPGVWTHGDVVDLAPDGTARVHGRSDGVLNIDGIRIGPAE
FT                   IYRILKGLPEIAQAVAVEQRHPTTPGATRLVLLVQLHGGAVLDGELERRIRTTLRSQAT
FT                   AAHVPALVLAVPEVPLTHSGKVSEKAARDTVNGDRVVNVDALRNPGSLAGITAALRTAT
FT                   ERTALPVPEPRSGSGRPPAAPRPAVPPGDTAAVTAVVSTIWRDLGVVPHAGITDFFDLG
FT                   GTSRQSMTLLRRLQLELDADVTMEQFLADPTIPGLAAAVAAAADATAVLLLAAGNPAAP
FT                   PLFLLNDAWGGVEVYRTLAELLVGVGPVYGVRADLVHPDGSRKPIDDLADEHAATIVAA
FT                   RPEGPLRLAGFSFGGLVAFETARRLRAAGREVEFLGLLDPLPPEDSLPPVRRRLHRLTG
FT                   EIGALIPGLADRPLRDVVRQRLRPETRPADQQALDRSGAVYARHRLQHYDGRATYFRAR
FT                   RRIPVSGHFMSAWRAAAPRLEVVSVPGPHHDLLAGRHVVALAVQMSLALRTAAQLRRS"
FT   gene            complement(489602..490306)
FT                   /locus_tag="Gobs_0444"
FT   CDS_pept        complement(489602..490306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0444"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   ppd:Ppro_3119 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73226"
FT                   /db_xref="GOA:D2S609"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D2S609"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ADB73226.1"
FT                   /translation="MSSTAGPTAPTGVAGDLLLRLVDLTPGGRATGSARSSLTPAECAH
FT                   ADRGTAEVAARRLLLRAALRETLGAVLGLAPADVPLTLPPGRPELTGAAAGSGLDVSCS
FT                   ASAGLGVVAVASGARVGVDIERVRDLPLADTAAEGWLTAGEHAAVAALPAAQQPEVLTR
FT                   CWTQKEAVLKGLGVGLRSHPATVVTPSAGRAPGRTGDWELRSIDLPEGWVGSVALRLTR
FT                   PAAAAADPLGTP"
FT   gene            complement(490419..491267)
FT                   /locus_tag="Gobs_0445"
FT   CDS_pept        complement(490419..491267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0445"
FT                   /product="glycoside hydrolase family 16"
FT                   /note="PFAM: glycoside hydrolase family 16; KEGG:
FT                   fal:FRAAL6120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73227"
FT                   /db_xref="GOA:D2S610"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D2S610"
FT                   /inference="protein motif:PFAM:PF00722"
FT                   /protein_id="ADB73227.1"
FT                   /translation="MFRDSRRRRRGPLLVGGAAVVALVVAGIVVLQDEEVLTPRPTSPA
FT                   PASDLPGWELVLAEDFDADADLGEFTDVYPGWAEYDGARDTSRDLGRRESHQGVYNSAT
FT                   TTTVQDGLVDVRVHTRDDTPQVMALTPTPDGQWWDGQVHGRYAVRFRADQVPGYKIAWL
FT                   LWPSSDDWSEGEIDFPEGGLGDEIVGNSHDITGDPSVNAFSIRTGASMDDWHTATIEWA
FT                   PGRVTFVLDDRAWTTTDPAAIPVDPMRWVLQIETELSVEAPPADAEGHVLIDWVAAWRA
FT                   V"
FT   gene            complement(491324..491929)
FT                   /locus_tag="Gobs_0446"
FT   CDS_pept        complement(491324..491929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0446"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: tro:trd_1797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73228"
FT                   /db_xref="GOA:D2S611"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D2S611"
FT                   /inference="protein motif:PFAM:PF04307"
FT                   /protein_id="ADB73228.1"
FT                   /translation="MTPAGGSAPADRQRPERRARRPWGRAALPFVALAVVAVLDLVAES
FT                   RRWPLPVVGLLDEPAHLITAGLVLVALPAGTRPLWSWALVGAVAIDVDHGPLYLYGDAV
FT                   AGDGGRPVTHSMATVLLLLAAAAAVRRYRCALAGLACGVALHLVRDLATGPGVPLLWPL
FT                   PGAAQVPYPLYAAALVGVTLVAVARQLRTPTRSVVTRP"
FT   gene            complement(491926..492780)
FT                   /locus_tag="Gobs_0447"
FT   CDS_pept        complement(491926..492780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0447"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   fal:FRAAL6118 putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73229"
FT                   /db_xref="GOA:D2S612"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2S612"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB73229.1"
FT                   /translation="MPSRQVIELRPHSLPHHPTVTRIGAPRVSVVVPTFNEAKNLPHVF
FT                   ALIPEDVHEVIVVDGRSVDDTIEVARSLRPDVRIVLQNRRGKGNAMACGFAAVTGDIVV
FT                   MLDADGSADPREIPRFVQALTDGADFAKGTRFANGGGSADITRTRKWGNRWLNRIANLF
FT                   FGTRYTDLCYGYNAFWSDCLPALELDAGDRGREDKLWGDGFEIETIINTRMAKARMHIV
FT                   EVPSYEFERIHGESNLNTWRDGVRVLRALVVERSNRRGRAPQAEVVPVRPQVATAETPV
FT                   RTA"
FT   gene            complement(493346..494419)
FT                   /locus_tag="Gobs_0448"
FT   CDS_pept        complement(493346..494419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0448"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: sma:SAV_7440 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73230"
FT                   /db_xref="GOA:D2S613"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR017078"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:D2S613"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADB73230.1"
FT                   /translation="MSHPLPPAAALRRIAFLLERAREPTHRVSAFRTAAAVVDTLGPEE
FT                   LDRRIRTRTLTDLRGIGPKTGAAIVQAHAGEVPEYLARLEESYGELVPLADDVADFRAL
FT                   LRGDLHVHSDWSDGGSPIREMAEAAIGLGHEYMALTDHSPRLTVANGLSAERLERQLDV
FT                   VAALNEELAPFRILTGIECDINVDGSLDQTDELLGRLDVVVASVHSDLRADSAAMTERM
FT                   LTAVADPHTDVLGHCTGRLLVSREQREGRRQRPRPESTFDAEAVFSACIEHGTAVEINS
FT                   RPERLDPPLRLLNLAVDLGCEFAVDTDAHAPGQLDWQGNGCERAVECGVPAERVVNTRS
FT                   AEDLLAWTVDRGSSEAG"
FT   gene            complement(494416..494964)
FT                   /locus_tag="Gobs_0449"
FT   CDS_pept        complement(494416..494964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0449"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: sen:SACE_0149 DoxX"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73231"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D2S614"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADB73231.1"
FT                   /translation="MLVRRIARPLLASSFVYGGIDTLRNPQSRVPGAAPVVDQIAAKAD
FT                   QQLPVQLPRDVEQYVKVNAGAQVAAGSLLALGRLPRLSALVLSASLVPTTLAGHRFWEH
FT                   DDPKERFGQTAHFVKNLSMLGGLLIAAVDTEGKPSVGYRARRAASRAADSTEKSLERAQ
FT                   KRAAKAQRKAEKQYKKGSR"
FT   gene            complement(495000..495617)
FT                   /locus_tag="Gobs_0450"
FT   CDS_pept        complement(495000..495617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0450"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: sen:SACE_2253
FT                   putative glycerophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73232"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D2S615"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADB73232.1"
FT                   /translation="MVSARHWDARLHSLVGGLPNSPADLWLRRLTTAADHGRLWMAAGV
FT                   LMALRRGALRRGAVRGLASMAVSSGLVNTALKPVFGRRRPDLGAHPVHRLLQETMTTHS
FT                   FPSGHSSSAGAFVTGVALECPAAAAVLAPLALTVGYSRVHVGVHYPGDVVGGLAVGAAV
FT                   AVGLRRCWPGEAGPLPVRAVDPAEWRPPHYGPVRVSRRGSGH"
FT   gene            complement(495736..496269)
FT                   /locus_tag="Gobs_0451"
FT   CDS_pept        complement(495736..496269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0451"
FT                   /product="protein of unknown function DUF1470"
FT                   /note="PFAM: protein of unknown function DUF1470; KEGG:
FT                   sen:SACE_5922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73233"
FT                   /db_xref="InterPro:IPR010852"
FT                   /db_xref="InterPro:IPR021005"
FT                   /db_xref="InterPro:IPR023286"
FT                   /db_xref="UniProtKB/TrEMBL:D2S616"
FT                   /inference="protein motif:PFAM:PF07336"
FT                   /protein_id="ADB73233.1"
FT                   /translation="MDYDTYGSTAVELAIDLTNADRDAGPDWATAFLRAHDEWFEPGTV
FT                   VELSPAETGQAATTADLVRAVAVATTQPEVLERLNALLALAHPQPYATDHDGELHLHYA
FT                   RPDAPLMEQLTTTVAMGLSQVVVQHGWQRIGVCSAEGCDDVYVDTSRNASRRYCSNTCA
FT                   SRSTVAAYRARRRT"
FT   gene            496370..497623
FT                   /locus_tag="Gobs_0452"
FT   CDS_pept        496370..497623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0452"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cmi:CMM_2809 putative sugar MFS permease"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73234"
FT                   /db_xref="GOA:D2S617"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2S617"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB73234.1"
FT                   /translation="MTPYFFPSACYRSEFVVRSYLSVWRLPSAPVLLVAGFAGRLPSAM
FT                   VPLALLLMVQQQTGSYAVAGLAAATYGLAMAGMAPVLGRLADRRSPRPVLLAQAGAFPL
FT                   LLTLLVAVVLGGAPTVAVVAASAAAGAGTPLVSGVVRALWSRVDPRVRGTAYALDATAT
FT                   ELVFVAGPTLVAALAVLATPAWAVAVAGSLAVAGALGVATSSAMRGWVPVPAAHRASPF
FT                   ATVLTPGMPRVLLSGSALMLGFGALEVAVPAFADAAGAPGMSGVLLALWSLGSVAGGLW
FT                   FGARVVSVSLPRQYRWLLLGVTIGLAPLAAASDPWVLGALLFLGGTAIAPTLTVQNSLV
FT                   GAIAPAHATTEAFTWLSTMATGASAVGAALGGALIEGPAGVSGSLLLAVAGAALAVLVT
FT                   LVPGRRPARERVSEPVAA"
FT   gene            497766..497854
FT                   /locus_tag="Gobs_R0008"
FT                   /note="tRNA-Ser2"
FT   tRNA            497766..497854
FT                   /locus_tag="Gobs_R0008"
FT                   /product="tRNA-Ser"
FT   gene            497876..497948
FT                   /locus_tag="Gobs_R0009"
FT                   /note="tRNA-Arg1"
FT   tRNA            497876..497948
FT                   /locus_tag="Gobs_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(498413..499498)
FT                   /locus_tag="Gobs_0453"
FT   CDS_pept        complement(498413..499498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0453"
FT                   /product="Lactate 2-monooxygenase"
FT                   /EC_number="1.13.12.4"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: rxy:Rxyl_1052 lactate 2-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73235"
FT                   /db_xref="GOA:D2S618"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:D2S618"
FT                   /inference="protein motif:PRIAM:1.13.12.4"
FT                   /protein_id="ADB73235.1"
FT                   /translation="MTQRSLPCRRGLSSGHRTPPVLLGPVGALELVHPAADLAVARAAA
FT                   SLGVPMVFSNQASVSMEECAAVMGSSPRWFQLYWSTSDELVESLVGRAEASGCDALVVT
FT                   LDTTMLGWRPRDLDLGHLPFALGKGIAQYTSDPVFRRLTEQRAAASAAPAPARPGAAAG
FT                   RDRQPRPTLAAVRALVGMARAWPGPLLQNLRSPLPRAAVETFLSIYSRPSITWADLAWL
FT                   RARTRLPIVLKGVLHPDDARRALDEGVDGVVVSTHGGRQVDRSIAALDALPDVVAAVGG
FT                   QAPVLLDSGVRSGADVLTAVALGARAVLLGRPFAWGLALAGEEGVRQVVSDVLGEFDLT
FT                   LGLSGHTAVDRLSPEVLRRVG"
FT   gene            499656..500351
FT                   /locus_tag="Gobs_0454"
FT   CDS_pept        499656..500351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK19423 gene product from transcript GK19423-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73236"
FT                   /db_xref="GOA:D2S619"
FT                   /db_xref="UniProtKB/TrEMBL:D2S619"
FT                   /inference="similar to AA sequence:KEGG:Dwil_GK19423"
FT                   /protein_id="ADB73236.1"
FT                   /translation="MQVATRPASVAVTALALLCAGIALAGPAAAVDDDARPDARVTHGP
FT                   SCRPGGVVVEVAGGTVGHAVTLGTSRRPAGEQTAEVAPGAVVVLNTGPVDWGETIDPFL
FT                   QYTALDGSGAGWVDELIGYDFTRPAAEDCAAISPPAGAAVVPQHGEAVPMPVPGLPDPS
FT                   STGPAGPSDGTPTAPVSAQEAAAVPGGVHWPVLAAGGALVAASTGLVLVAGSRRPGGRS
FT                   RAPRSLGSA"
FT   gene            500377..500892
FT                   /locus_tag="Gobs_0455"
FT   CDS_pept        500377..500892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0455"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: fre:Franean1_1577 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73237"
FT                   /db_xref="GOA:D2S620"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S620"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADB73237.1"
FT                   /translation="MARPEDALAPDLPAEHVPGDVADVPGATPGPAETWLRIVQVHDRI
FT                   TRRVDSALHRRHDLSLTGYEALRRIAEAPGERATMGEVAEALGISRAGVTSTVSRLVAE
FT                   GYVVRERSSGDKRLLHARLTPAGRAKVEEARPTHDGLVAHLLTLLGDDAAVVTDALARV
FT                   SAAARTRR"
FT   gene            501047..502546
FT                   /locus_tag="Gobs_0456"
FT   CDS_pept        501047..502546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0456"
FT                   /product="hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /note="TIGRFAM: hydrolase, HAD-superfamily, subfamily IIIA;
FT                   histidinol-phosphate phosphatase family protein; HAD-
FT                   superfamily hydrolase, subfamily IA, variant 3; HAD-
FT                   superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   glycosyl transferase family 2; Haloacid dehalogenase domain
FT                   protein hydrolase; KEGG: rxy:Rxyl_0716 HAD family
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73238"
FT                   /db_xref="GOA:D2S621"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2S621"
FT                   /inference="protein motif:TFAM:TIGR01662"
FT                   /protein_id="ADB73238.1"
FT                   /translation="MQVGIEQCSVVVPTVGRPSLDVLLDALAQAPGPRPAELVLVDDRP
FT                   TGEPLRPERPGLPPVRVVRTGGGGPARARNLGWRSVRTEWVAFLDDDVVPDPDWYQRLA
FT                   EDLSDLPADVAGSQGRVRVPLPADRRPTDWERGTAGLATSSWITADLAYRRAALAAVGG
FT                   FDERFPRAFREDSDLALRVMDTGARLVRGRRLITHPVRPVDRWVSVRVQAGNADDVLMR
FT                   RLHGPGWRERADAPLGRRPRHLAVTVAGLTAVGLAAARRPRAALGAALAWAAGTGEFAW
FT                   ARIAPGPRDRAEVGTMLATSALIPPLATWHFLRGAVQHRRVRPWRGLPDLVLFDRDGTL
FT                   VRDYPYNGDPALVKPVPGAREAVDALRARGVRVGVVSNQSGVARGLITRAQVDACMARL
FT                   DELLGPFDTVQVCPHGPDDGCTCRKPAPGMVKAACAELDVDPARCVVIGDIGADVEAAA
FT                   AAGASGVLVPTPVTRRAEVEAAPRRAATITEAVEQVLAGGW"
FT   gene            502540..503565
FT                   /locus_tag="Gobs_0457"
FT   CDS_pept        502540..503565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0457"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   sen:SACE_5573 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73239"
FT                   /db_xref="GOA:D2S622"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D2S622"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADB73239.1"
FT                   /translation="MVRRTVLVARLDSVGDVLVQGPLVRAVAAGADRVVFLAGPAGAEA
FT                   ARLLPGVDEVETWACPWILGDPPPVDPADLAALTERIRALAPDEAVVSTSFHQSPLPLA
FT                   LVLRTAGVPRISAISVDYPGSLLDVRHRVDDDLPEPERALSLARAAGFDLPAGDDGRLA
FT                   VRRPLPPVAPEPRGPDLPPGYVVVHPGASVPARAWPAHRCAEAVEALADAGHRVLVTGG
FT                   PGERALTAAVAGTRGVDLGGALGLAELAALLDGAAAVVVGNTGPAHLAAAVGTPVVSLF
FT                   SPVVPAARWAPYGVPTVLLGDQEAPCRLTRARECPVPGHPCLTSVTADDVVAAVEKVGS
FT                   A"
FT   gene            503562..504542
FT                   /locus_tag="Gobs_0458"
FT   CDS_pept        503562..504542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0458"
FT                   /product="transferase"
FT                   /note="KEGG: sco:SCO6184 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73240"
FT                   /db_xref="GOA:D2S623"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D2S623"
FT                   /inference="similar to AA sequence:KEGG:SCO6184"
FT                   /protein_id="ADB73240.1"
FT                   /translation="MRVLLWHVHGSWTTAFVQGQHEYLLPVTPDRGPDGLGRARTWDWP
FT                   ASAREVPPDQLRDEDVDVVVLQRTRDLDLVREWLGREPGRDLPAVFLEHNAPGLEPGDG
FT                   PVPHTRHPLADRDDIPIAHVTHFNQLFYDNGRAPTTVIEHGIVDPGERYTGELARAAVV
FT                   TNEPVRRGRTVGADLLPGLAAVAPVDVFGMGLAGLHERYGLDPGRVALHDDPPQAAMHT
FT                   ELARRRVYVHPVRWTSLGLSLLEAMHLGLPVVALATTEAVEAVPAEAGVLSTRPGVLWD
FT                   AVRTYLHDEDAARLAGKAARAAALERYGLPRFLRDWDALLEEVTR"
FT   gene            504539..505795
FT                   /locus_tag="Gobs_0459"
FT   CDS_pept        504539..505795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0459"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mav:MAV_4082 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73241"
FT                   /db_xref="GOA:D2S624"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2S624"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADB73241.1"
FT                   /translation="MITDRLGAWPLTIDMVSEHASPLAAIGGVDAGGQNVHVAALAAGL
FT                   ARRGHAVTVHTRREDPDQPDRVSTADGYDVAHVTAGPARVLPKDDLLRHMPEFASVLRR
FT                   EWAQRPPDLVHAHFWMSGLAAVAAAGDIPVVQTFHALGSVKRRHQGAADTSPPQRVELE
FT                   RSLCRTVGHVVATCSDEVFELRRLGLDSDRVSVVPCGVDTTVFTPRGPVAPRGDRKRLL
FT                   VLGRLVERKGQEDAVRALAAVPDAELVVVGGPPAAQLDDDAEVRRLRAVAASLGVADRL
FT                   VLTGAVARADVPAWIRSADVVLAVPWYEPFGITPLEAMACGRPVVATAVGGLQDSVADG
FT                   VTGDLVPARDPARLGEALAALLADDARRAAYGTAGVRRARNRYRWARVVADTDTVYRQV
FT                   LAGPVRTDDGDRSPVEAAR"
FT   gene            505792..506472
FT                   /locus_tag="Gobs_0460"
FT   CDS_pept        505792..506472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0460"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sco:SCO6186
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73242"
FT                   /db_xref="GOA:D2S625"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D2S625"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ADB73242.1"
FT                   /translation="MNPAPLSEAPHSTSEVVSPDTCTHLTGADHVASLTVALGSLNGQL
FT                   DALDRWGRLIADVLCGEDRGRLLAAGNGGSAAQAQHLTAELVGRYRADRPPFSAICLTA
FT                   ETSSLTAIANDYPADELFARQVEAHGRAGDVLVLLSTSGRSPNAVAAARRARECGITVL
FT                   AMTGPAPNPLAAVCDDAVCIDSPWTATVQECHLVALHLVCAAFDAAVLAEPARVPETRL
FT                   GVAQ"
FT   gene            506469..507863
FT                   /locus_tag="Gobs_0461"
FT   CDS_pept        506469..507863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0461"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; PfkB domain protein; KEGG:
FT                   sco:SCO6187 bifunctional synthase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73243"
FT                   /db_xref="GOA:D2S626"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2S626"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ADB73243.1"
FT                   /translation="MSATGPLVVVGDALLDVDLVGTASRLTPDAPVPVVEDVEARERPG
FT                   GAALAAVIAARATRREVVLVTPMADDEDADRLRALLAGRVRLVEIPATGGTAVKRRVRV
FT                   GDHSVARIDSGAPVAGLGTLPAEAAAVVRDAAAVLVADYGRGTTADRAVRAVLAEAGGP
FT                   VVWDPHPRGADPVPNARLVTPNGAEAARVASAAGTAAGVAAQGEGLAAVGARAEALIRH
FT                   WGVGAVSVTLGARGALLSYGEGAPMVVPAVPVTGGDPCGAGDSFAAAAAIALADGAVTG
FT                   EAVAAAVAFAGRFVARGGASAWDVEAAPEPSPAAEPGADGVIARVRAAGGTVVATGGCF
FT                   DLLHPGHVATLRAARGLGDCLVVCINSDDSVRRLKGSSRPLVTAADRARVLEALEFVDA
FT                   VVVFDEDTPAEVIGRLRPDVWAKGGDYAGADLPEAAVLRRWGGQAVVLPYLDGHSTTAL
FT                   VERSRV"
FT   gene            507962..508897
FT                   /locus_tag="Gobs_0462"
FT   CDS_pept        507962..508897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0462"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   sco:SCO6188 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73244"
FT                   /db_xref="GOA:D2S627"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D2S627"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADB73244.1"
FT                   /translation="MAVVLRPLGLGDLLTGVPAIRAVRAAVPGHRLVLATTAALEPLAS
FT                   LIDAVDEVLPARELEPLDWSGPPPELAVDLHGKGPASHVVVADLRPGRLLTFDSPGYPG
FT                   PTWHPDEHEVRRWCRLVAEGLDVDADPDALDLAVPSVPPPAPAGVALVHPGAAFPGRRW
FT                   PADRFAAVARHLAARGLDVRITGGPAEVPLARAVAEGAGLGEGCVLAGRTTTLELAAVV
FT                   AGARVVVSGDTGLAHLATAYRRPSVVLFGPVSPALWGPPLRARERGPLHVVLWHGDGTG
FT                   DPWGTELDPALGRITVDEVTAALDALLART"
FT   gene            complement(509018..510661)
FT                   /locus_tag="Gobs_0463"
FT   CDS_pept        complement(509018..510661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0463"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   tfu:Tfu_2266 von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73245"
FT                   /db_xref="GOA:D2S628"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D2S628"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ADB73245.1"
FT                   /translation="MGRHAATPAARRPAPLTPQVLIALAVAAMVLLAGGITWWAVGAGS
FT                   GNCDGTAVVRVAVAPELAPVAEQVLTDAEGLRPEDCASAQVTAQEPVQTVGDLGALDAG
FT                   DLPHLWVPDSSLWPARAGHAALETAGSVATSPVVLATSRAAVDALGWTAEAPGWGAALV
FT                   SEQGIAVPDLATSAEALAALGAVRTSLGGGEDADNAVVQAVLAAERGPSVSPADALAAG
FT                   GEGAADAPLVPVSEQEVWAANADAEDPQLVAVYPEEGSPGLDYPLVRVGTASATDAAVV
FT                   DAAVRALTSDAARSAVTEAGFRDADGTAPPGAEAAGIREAAPRSLQLDPAEVQGLLAQL
FT                   SELAAPSRILTVFDISTSMEAPAGDGTRATLARDAAKSTLTLVPGNFALGLWFFAAELD
FT                   GERDWTEVVPTRQLEAEVEGTVQRDLLDEELDTIPDRLSPGGTGLYDTTLDAVRAARSD
FT                   FDPRAVNSVLVVTDGTNEDSGGVDLDELLATLRSEADPDRPIKVIGVALGPDADLGALE
FT                   RIADVTGGAAYSAVDPTDLQTVLFDALRQR"
FT   gene            complement(510753..511730)
FT                   /locus_tag="Gobs_0464"
FT   CDS_pept        complement(510753..511730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0464"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; dTDP-4-dehydrorhamnose reductase;
FT                   KEGG: fal:FRAAL5747 dTDP-glucose 4-6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73246"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S629"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADB73246.1"
FT                   /translation="MVRAARTIRRAVVTGGAGFLGSHLCEHLLERGVEVVCLDNFLTGS
FT                   PQNVVHLMEHPGFRLVRCDVTDFVHVPGDVDLVLHFASPASPLDYLRMPIETLKVGSLG
FT                   TLHTLGLAHEKGARYVLASTSEVYGDPLVHPQTEEYWGNVNPVGPRGVYDEAKRFSEAM
FT                   TTAYRTSKGTDTGIVRIFNTYGPRMRPDDGRAIPAFVGQALAGRPLTVAGDGSQTRSIC
FT                   YVDDTVRGILAMAFSGEAGPVNIGNPDELSMLRLAEWIVELTGSSSEISFIDLPVDDPK
FT                   VRRPDTTRAEQLLGWRPTVPSEEGLRSTVAWFAAQLQAADVRAG"
FT   gene            complement(511938..512171)
FT                   /locus_tag="Gobs_0465"
FT   CDS_pept        complement(511938..512171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73247"
FT                   /db_xref="InterPro:IPR020311"
FT                   /db_xref="UniProtKB/TrEMBL:D2S630"
FT                   /inference="similar to AA sequence:KEGG:AAur_0071"
FT                   /protein_id="ADB73247.1"
FT                   /translation="MDDSEIRGRIEALVEEERRLRDSGEHTDEQRARLRQIEEDRDQLW
FT                   DLIRQRDAKRQYGEDPDEASPRPEQQVEGYLQ"
FT   gene            complement(512291..513211)
FT                   /locus_tag="Gobs_0466"
FT   CDS_pept        complement(512291..513211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0466"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; 3-hydroxyacyl-CoA
FT                   dehydrogenase NAD-binding; 6-phosphogluconate dehydrogenase
FT                   NAD-binding; KEGG: sen:SACE_0231 prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73248"
FT                   /db_xref="GOA:D2S631"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S631"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ADB73248.1"
FT                   /translation="MTSFPVPTMPAPPVGVVGLGQLGGSLAAALVAAGRQVTGWDVDPA
FT                   AREAAATRGVRTARELTGIVVLAVPLPAMAAALEGLDVDPDATVTDLGSVKAPVLAELG
FT                   SALGGRYVGGHPMCGTERSGPEATDPGLFTGARWALCLEPGTELPRWLRVAEVALAVGA
FT                   EVVPATAAEHDDAVAAVSHVPHLLAAALAAAAGDAGPLALALAAGSFRDGTRVIGSDPG
FT                   FVTAMVQGNAGPTTAALARVLEQLARPWPELVAAGHAVRAGGPAGRRPVRVPLERAALL
FT                   SLGRAGGAVTRRLAAFVEGYVPDVG"
FT   gene            complement(513208..513648)
FT                   /locus_tag="Gobs_0467"
FT   CDS_pept        complement(513208..513648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0467"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mta:Moth_0402 phenylacetic acid degradation protein PaaD"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73249"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2S632"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADB73249.1"
FT                   /translation="MADPAPDDGADVAPALFSRLAADPLADLLGIVLEQVRPGYARAAM
FT                   TVGPQLLNAVGTAHGGATMALLDVVHAAVSNSHGTVAVAQDVHTEFLAPGRPGDRLVAE
FT                   GTEVHRSRRTAVYRIEARAQDGRLVATALARVFRTETAWEDR"
FT   gene            513707..514369
FT                   /locus_tag="Gobs_0468"
FT   CDS_pept        513707..514369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0468"
FT                   /product="Caffeoyl-CoA O-methyltransferase"
FT                   /EC_number="2.1.1.104"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   fal:FRAAL5009 caffeoyl O-methyltransferase (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73250"
FT                   /db_xref="GOA:D2S633"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2S633"
FT                   /inference="protein motif:PRIAM:2.1.1.104"
FT                   /protein_id="ADB73250.1"
FT                   /translation="MTPRSFLLTRELADYVRANSEPPDDVAADLLAETAALADRGDVPP
FT                   TFQIAPEQGTFMQLLTRALGVRRAIEIGTFTGYSALCVARGLPEDGSLLCLDTSEEWTA
FT                   VARRYWARAGLADRIGLRLGDAHESLRALPVEPTFDLAFVDADKAGYADYVDQLHPRMT
FT                   DGGVVLLDNTLRNGRVLDPRNDDDRALVELNAALATDPRWETVLLPLSDGLTMLRRR"
FT   gene            514366..514863
FT                   /locus_tag="Gobs_0469"
FT   CDS_pept        514366..514863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73251"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:D2S634"
FT                   /inference="similar to AA sequence:KEGG:MAB_0267"
FT                   /protein_id="ADB73251.1"
FT                   /translation="MSGPGTPASWAVRVSRPDGAWRVELLAADAGDELPALERALGDPG
FT                   AGDWPGPFVVVVDSRLYFVVLRHGPGGLVRALISDATMQEWLLAAEVVERYGIAVDAEG
FT                   AFDDDETGWPGGDLDVFADDGLPADQLRPIVTSDDLWADEMVTAIAARLGFADELAAAV
FT                   RS"
FT   gene            514860..515519
FT                   /locus_tag="Gobs_0470"
FT   CDS_pept        514860..515519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0470"
FT                   /product="HAD-superfamily hydrolase, phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   sal:Sala_2121 epoxide hydrolase domain- containing
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73252"
FT                   /db_xref="GOA:D2S635"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011945"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2S635"
FT                   /inference="protein motif:TFAM:TIGR02247"
FT                   /protein_id="ADB73252.1"
FT                   /translation="MSAVASAVVFDLGGVITESPMTAFTAYEAEAGLPEGLIVRLNSAD
FT                   PDTNAWARFERNELDAAGFTDAFEAEALAAGHRLDARRVLAALAGEVRPEMVDAVRRLR
FT                   AAGVPLALLSNNVAPMERTGRLGELLELFDAVVESSLEGVRKPEPEIYRRALARLSEAV
FT                   GREVVASDCAYLDDLGINLKPARAMGMHTIKVVDPAAALAELSALVGIDLRDGVGS"
FT   gene            515671..516135
FT                   /locus_tag="Gobs_0471"
FT   CDS_pept        515671..516135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0471"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   fal:FRAAL0635 tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73253"
FT                   /db_xref="GOA:D2S636"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D2S636"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADB73253.1"
FT                   /translation="MTPDVDAAMGRALALAAAAVEWGDTPIGAVVLGPDGTVLAEAANE
FT                   REKQGDPTAHAEVLALRAAARVHGDGWRLTGTTLVVTLEPCTMCAGASVLARVDRIVYG
FT                   ADDPKAGAAGSLWDVVRDRRLNHRPQVTGGVRAEESATLLRAFFRRQRGL"
FT   gene            516146..516233
FT                   /locus_tag="Gobs_R0010"
FT                   /note="tRNA-Ser3"
FT   tRNA            516146..516233
FT                   /locus_tag="Gobs_R0010"
FT                   /product="tRNA-Ser"
FT   gene            complement(516290..517954)
FT                   /locus_tag="Gobs_0472"
FT   CDS_pept        complement(516290..517954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0472"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: nfa:nfa31920
FT                   putative serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73254"
FT                   /db_xref="GOA:D2S637"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D2S637"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB73254.1"
FT                   /translation="MSGPGHVVAGRYRLLERIGGGGMGAVWLASDELLGRRVAVKQVLP
FT                   PPTADESVIAQQRQRALREGRIAARLSHPHAVVVYDVAVEDGAPWLVMEYLPSRSLAEV
FT                   LHQDGVLPVDQVAQIGAQVADALSATHAAGIVHRDVKPANVLIGQGPRVEGLVKITDFG
FT                   ISHARDDVTLTQTGQITGTPAFLAPEVARGGEVTPGSDVFSLGATLYTCLEGQPPFGMD
FT                   DNALRLLHRVAGGELIPPRRAGSMTAPLMRMLAVDPADRPTTTQVRDELARLAVGRDGD
FT                   PTTVLLARTKLRSSSNRERTEELSSGVLPAAGAGAAAAAGYRDPGTAVHVSPTGPPPAP
FT                   PPRRAEDRPPVTPAPSPRRRRGPLLAALLLLGVLLLGGALWLSTRGGDVGTSAEAPASS
FT                   SPPVDDATPRAEDAPAPETPDAEPTPSTGAEAPSSEPPSDEPTDDPADDPAEVVEETLG
FT                   RYYELLPDDPDAAYDMTGPYLRSQASRSYYRDFWAPWDEVDLREVRGAQQSGNGVVTAT
FT                   TEVEFTGDDGREQTERHQVRLVQDDDGGWLVDLDLVA"
FT   gene            complement(517995..518342)
FT                   /locus_tag="Gobs_0473"
FT   CDS_pept        complement(517995..518342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73255"
FT                   /db_xref="UniProtKB/TrEMBL:D2S638"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73255.1"
FT                   /translation="MSETDRLRPDVVEAIVAVLKGADPSELPASATKEEKDAAKDRYLS
FT                   EFVAERSKRDRQTRAWELLLTRSYDEPPTWERLFDDLSSDVVEELGELYDVLPAGAQEE
FT                   YARRYGVPTGV"
FT   gene            518491..518575
FT                   /locus_tag="Gobs_R0011"
FT                   /note="tRNA-Ser4"
FT   tRNA            518491..518575
FT                   /locus_tag="Gobs_R0011"
FT                   /product="tRNA-Ser"
FT   gene            complement(518626..519582)
FT                   /locus_tag="Gobs_0474"
FT   CDS_pept        complement(518626..519582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0474"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sco:SCO1362 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73256"
FT                   /db_xref="GOA:D2S639"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D2S639"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADB73256.1"
FT                   /translation="MPTPSTTSAASRGFPLVVLAALCWGTAGVSGRIVSERTDLGPLDI
FT                   AWHRMAVGAVVLLAGYLLTRHREPVTVPLTRPVAVRLGLVSAGLAVYQLAYFAAVATAG
FT                   VSVATLVALGLAPLLIALGGAALGSGRPDRATFAALVVALVGLVLLVGLTAGASAGTAV
FT                   LLGALLACGSALGYAVVTLAGGDVPAGLPVTLVGFAGGALLLTPVALTAGLSLTTEPVA
FT                   LATLLYLGAVPSAAAYALFFRGLQTVPGAVAGIVTLLEPVTATVLATVFLGERLPLGAL
FT                   AGGLLVLAAVAGLYLRRPAAAEREAATERQAVAEPHD"
FT   gene            520048..522345
FT                   /locus_tag="Gobs_0475"
FT   CDS_pept        520048..522345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0475"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sen:SACE_0251 putative DNA polymerase III
FT                   gamma subunit; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73257"
FT                   /db_xref="GOA:D2S640"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S640"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADB73257.1"
FT                   /translation="MALALYRKYRPATFAEVVGQEHVTAPLVNAVDGGRINHAYLFSGP
FT                   RGCGKTSSARILARSLNCEQGPTSTPCGTCGSCVALAPDGPGSLDVIEIDAASHGGVDD
FT                   ARDLRERAFFAPVNSRFKVYIIDEAHMVTTQGFNALLKVVEEPPEFLVFVFATTEPDKV
FT                   LSTIRSRTHHYPFRLVPPTTLRGLLEKTCAAEGVQVEPTVFPLVVRAGGGSVRDSLSIL
FT                   DQLLAGAGEEGVTYKSAVGLLGVTDDALLDETIDALAAHDAPGVFRAVDRVVEAGHDPR
FT                   RFATDLLDRLRDLILLDAVPDAGGNGNGLLDCPPDRLDLMSSQASALGSATLSRMADTV
FT                   HAGLTEMRGTTGPRLLLELVCARMLLPGTDGSAAATLQRLERLERRMSIAGEHAGRPVA
FT                   EPAVLGAPVRESRPEPAAAPPPADQPGRPVREFVRRSQVAAQAPSVPAAPAQPAPRPAP
FT                   EPPRAAPERPEPPRPEPARAEPVAARPPADDGWPETTPPGSGAPPRPPAPAATPPTPAA
FT                   TPPAAAPAAVGEPRRAPVAVGEPDIPLPPEPTDDEDWPHPAQPAAAAAAAARVEQPRPT
FT                   ASSAPRAAAESSPAPRGSEPMPVVTANPPQPDAADGELDAGDVRRVWPELLAVVRRHKR
FT                   TTEALLKSAQVHDVAAGTLTLSMTSPALAKMLGDDLNKDVVRTALQELLGVRWKVQAVV
FT                   DAPGRPAPGRTVSPEAAREAAHAAEAAEASELMAERAAEGAGSDGPHEPAVDPEQAALS
FT                   LLRTHLGARPLD"
FT   gene            complement(522408..522890)
FT                   /locus_tag="Gobs_0476"
FT   CDS_pept        complement(522408..522890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0476"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   Polyketide cyclase/dehydrase; KEGG: fre:Franean1_4113
FT                   activator of HSP90 ATPase 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73258"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D2S641"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADB73258.1"
FT                   /translation="MTTTHRNETRIDVDPEVPLVRITREFDAPPAKVFRAHTDPELFAQ
FT                   WVGPRDTETRVDVFDCHTGGSYRFVTISDGEEYGFRGCFHEVRPDELIVQTFTFEGEPD
FT                   GVALEKLVLEDLGDGRTRLTSTSLVDSFAGRDAFVASGMEVGVREGYERLDEVLAR"
FT   gene            complement(522887..523309)
FT                   /locus_tag="Gobs_0477"
FT   CDS_pept        complement(522887..523309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0477"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: fre:Franean1_4112 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73259"
FT                   /db_xref="GOA:D2S642"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S642"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADB73259.1"
FT                   /translation="MAADPLSRVFAALADPTRRDMVARLAVTDATVGELAEPYDVSVQA
FT                   VSKHLRVLEDAGLVSRSRDAQRRPVHLEAEVLDLMTKWIERYRRQAEERYRRLDDVLAS
FT                   MPDDVSPTHPTDVSPTHPADVSPTPHRCTRPGGNRS"
FT   gene            523437..523772
FT                   /locus_tag="Gobs_0478"
FT   CDS_pept        523437..523772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rop:ROP_41370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73260"
FT                   /db_xref="GOA:D2S643"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D2S643"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADB73260.1"
FT                   /translation="MFPGGQPDMARLLEQAQQMQQQLAAAQEQLAQEEVTGTAGGNLVS
FT                   VTMTGQGEVTAVTIAPAAVDPDDVESLQDLIVAAFRDASRAVNELTASRMGPLAGGLGG
FT                   GLGLPGL"
FT   gene            523808..524407
FT                   /locus_tag="Gobs_0479"
FT   CDS_pept        523808..524407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0479"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: tfu:Tfu_0044 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73261"
FT                   /db_xref="GOA:D2S644"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D2S644"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADB73261.1"
FT                   /translation="MYEGAVQDLIDELGRLPGVGPKSAQRIAFHLLAAESADVGRLVAA
FT                   LQRVQAEVRFCSTCYNVAEGEQCRICRDPRRADDVICVVEEPKDVVAIERTREFRGRYH
FT                   VLGGAISPIEGVGPDDLRVKELMTRLMSGAVTELIIATDPNLEGEATAAYLARLVGPLG
FT                   LAVSRLASGLPVGGDLEYADEVTLGRAFEGRRRIDA"
FT   gene            524598..526307
FT                   /locus_tag="Gobs_0480"
FT   CDS_pept        524598..526307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0480"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: sen:SACE_0257 dipeptide ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73262"
FT                   /db_xref="GOA:D2S645"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D2S645"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADB73262.1"
FT                   /translation="MQRRPQRALAASAAALTAVTLAACASSDRDTGGGGEGGGEARSGG
FT                   TMVFGATGDPAMLDPAFGSDGETFRVSRQVFEGLLGNELGGTDPVPELAEDWEVSEDGL
FT                   EYTFNLQQGVQFHDGTNFNAEAVCFNFDRWYNFEGLATSPSASYYYQAVFGGFASTPDT
FT                   PSIYESCEATDENTAVIRLTQVTSKFPAALALPAFSIQSPTALQEYDADNLSGAEDALA
FT                   YPEYALEHPTGTGPFRFESWDRGNGQVTLVRNEDYWGEPALLDELIIRTIPDGNTRRQE
FT                   LQAGSIDGYDFVAPADYQSLQDEGHQVLVRDPFNILYLGFNGGNVPGTSANPALQDPRV
FT                   RQAIAHAIDRDTIVSSLLPEGAEAAIEFMPPTVDGYAEDVTTYDHDPNRARQLLQEAGA
FT                   EGTTLRFYYPTEVSRPYLPDPAAMFQVISQDLTDAGFTIEPVALPWNPDYLNAVQSGQA
FT                   DIHLLGWTGDYNDAYNFIGTFFAEASNNQASAEFGAFSAPEIFQALARADQEPDPAART
FT                   ALYQEANRLIMDYLPGVPISHSPPALVVAENVTGLEPSPLTAEVFSTVSISE"
FT   gene            526400..527404
FT                   /locus_tag="Gobs_0481"
FT   CDS_pept        526400..527404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0481"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: kra:Krad_2997
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73263"
FT                   /db_xref="GOA:D2S646"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2S646"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB73263.1"
FT                   /translation="MLRFIVRRLLQLVPILLGLSVLLFAWLRALPGGPAQAALGERATP
FT                   EAIARYNELFGLDQPLWVQYLRFLGRAVQLDFGTSARTGRTVTTEFLERMPGTVELTLF
FT                   AMVFAIGVGIPLGYLAARRHGSWLDSSAVIGSLLGVAIPVFFLAYLLRLLFAVELGWLP
FT                   GSGRQEVRIDATHITNFYVLDGLLTREWDAAWDALLHLVLPGVALGTIPLAIIVRITRA
FT                   SVLDVVNEDYVRTANAKGLSADTVRRRHVIRNALLPVSTTIGLQTGLLLSGAVLTETVF
FT                   AFGGVGSAIYDAIFTRDFAVLQGFILMLAVVYVLVNLLVDISYGLLDPRVRVR"
FT   gene            527433..528374
FT                   /locus_tag="Gobs_0482"
FT   CDS_pept        527433..528374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0482"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sen:SACE_0259 oligopeptide
FT                   ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73264"
FT                   /db_xref="GOA:D2S647"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2S647"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB73264.1"
FT                   /translation="MTALGDVRRQRIDELAARAGQVPEGEGGVSLVRSAFRRLRRNPVA
FT                   ILGAVIVVVFLFVAAFAPWLAPRDPLAQTLLSEVRPGFIPGAQEGFPLGADQLGRDLLS
FT                   RLVYGSRQSLLIGVVSTVLGAVVGMVLGVLAGAFGGWVDTVVMRFIDIVLSIPSLLMAI
FT                   SISVLLGQNQYALMIAIAVTQVPVFARLLRGSMLAQRGSDYVLAARALGVKRGRIVFGH
FT                   VLPNSLSPVIVQGTLSLATAIIEAAALSFLGLGDPDIARPEWGAMLSTAQDFLSIRPGL
FT                   AVWPAVCIIVVALGFTLLGESLREALDPKFRR"
FT   gene            528487..529509
FT                   /locus_tag="Gobs_0483"
FT   CDS_pept        528487..529509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0483"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: stp:Strop_0219 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73265"
FT                   /db_xref="GOA:D2S648"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S648"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB73265.1"
FT                   /translation="MLEVDDLSVTFARRGEQPTLAVDGVSFSVSAGETIGLVGESGCGK
FT                   SVTSLAVMGLLPKRGVQVGGSVRLAGTELLGAPDRTLRRLRGSEMAMVFQDPLSSLNPT
FT                   VPIGTQVTEVLVEHRDMGKKEAAAEATDLLDRVGIPDPARRLKEYPHQLSGGMRQRALI
FT                   AMSLACSPRLLIADEPTTALDVTIQAQILELLRELVVDTGTALVMITHDLGVVAGLCDR
FT                   VHVMYAGKVIETADRHELFARPRQPYTGGLLASVPRLDAGRGVPLTPIRGSARDTIPWA
FT                   EGCAFAPRCDNAQDDCLTEVAGSTVPLEYDGPGRELRCRHPLTYPEQTPAGATASGAGR
FT                   "
FT   gene            529506..530669
FT                   /locus_tag="Gobs_0484"
FT   CDS_pept        529506..530669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0484"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: sen:SACE_0261 oligopeptide ABC transporter
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73266"
FT                   /db_xref="GOA:D2S649"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S649"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB73266.1"
FT                   /translation="MTAASEPLLRVEGLQVHFPIKRGVFVDRTVGHVRAVDGVDLAIDR
FT                   GTTYGLVGESGCGKSTLGRAVLRLVEPTAGRVLFDGTDVASLGGEPLRHMRRRMQMVFQ
FT                   DPLGSLDPRQDVESLLSEPLKAHGLGGGKAGIATRVRELLDAVGLPSAALRRYPHEFSG
FT                   GQRQRIGIARAISLEPDLLIADEPVSALDVSVQAQVVNLLEELQQRLGLTYLVIAHDLA
FT                   VVRHISDVVGVMYLGSLVEQAPADALYDEPLHPYTRALMSAVPVPDPVVEERRERILLA
FT                   GDLPSPADPPSGCRFHTRCPWRQETRCDDEVPVLRELAPGHSAAPHPPRHLVSCHWAEE
FT                   IRDGVLRPRSADEVAATQGVSVRATGADGAFETDALVQGVDEPIERR"
FT   gene            complement(530778..531134)
FT                   /locus_tag="Gobs_0485"
FT   CDS_pept        complement(530778..531134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0485"
FT                   /product="Rieske (2Fe-2S) iron-sulphur domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   mpl:Mpal_1282 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73267"
FT                   /db_xref="GOA:D2S650"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D2S650"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADB73267.1"
FT                   /translation="MTEPDRIPAADLPPGAVHRVGDWAVGNRVGRYFAVSRRCRHQLAD
FT                   LSEGTVDADGCLVCPWHQSRYDVRTGEMVEGPHGFLGYHGPTPGYTQFVRAYARILRLR
FT                   VRRALRRGDDVVLE"
FT   gene            531235..533310
FT                   /locus_tag="Gobs_0486"
FT   CDS_pept        531235..533310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0486"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   kra:Krad_1453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73268"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D2S651"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ADB73268.1"
FT                   /translation="MRRLLAVLAPLAAVVLLGGGPALAEPPFDVPAQVTDRAGVLVGNE
FT                   SAVEAAVTELQAEEQLQLFVVYVDSFDGLDPDEWATRTAELSGLGGNDVLFAVAVEDRR
FT                   YTYNPPADFRLSDQEIEELIASDVEPELTAGDFDGAAVAFAEGLGGGGGDGGSGLGTVA
FT                   VVGGIAAVAGGAYLVTRSRRRRQGPPPAQRLERPDPHAGVPTEQLEAQASTALLELDEA
FT                   VKTSRLDLDYARLQYGQEAVAGFAEALTASEQELARAFALRQQLDDEVGGREAGTAELT
FT                   KRRLLTEMLQLTAAADARLDEQAEAFDRLRDLERTAPQALDALASRATALRGRLPADEE
FT                   RFAALQRRYAPAALAPVADNLAQARARLDAAEQEITEARGEIAAGRAGAAVGDIRVAED
FT                   ALAQTGTLLDAVARLGTDLQAAEARVAQVRAETEEDLAEARALLAGGTGGGLRPQVARA
FT                   EAALTAADAALRPADGGRPDPMAALRRLEEADIALEQALGLARDADQRARRAAASLDQA
FT                   LLTARSGVAAAGDFIGTRRGAVGPEARTRLAEAQRHLDLAVAQGRTDPVGALREAQMAD
FT                   TLAQQALQQAQSDVAGWGGGGYGPGGYGPGGYGGGYGPGGFGGGYGGGRGGVDLGSLVL
FT                   GGILFGGGRGAGGYGGSYGGGVGGGFGGGGGSRGGGRRSGSFGGSRSRGRSGSGRF"
FT   gene            533373..534134
FT                   /locus_tag="Gobs_0487"
FT   CDS_pept        533373..534134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0487"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mul:MUL_0158 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73269"
FT                   /db_xref="GOA:D2S652"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2S652"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB73269.1"
FT                   /translation="MPTRNTPWPAGTPCWVDYGASEIDAAKDFYGRLFGWEFEGGDPEY
FT                   GGYLNATRNGEPAAGLGPLMNPGDSPGWTTYFATDDAAATAARIREAGGTVVVEPMEVG
FT                   PMGTMVIATDPQGNAFGLWQSGEHTGYRVFNEHGSLVWCDAAVDDPAAAREFYSAVFGF
FT                   TFAEVPGAEGYTTFAIGADPLGGLGGHQPGSPKGWAVCFAVDSTDDAVATVEAGGGKVT
FT                   MAPMDTEYGRIAVVEDPWGAPLSVMEPPKGS"
FT   gene            complement(534187..534621)
FT                   /locus_tag="Gobs_0488"
FT   CDS_pept        complement(534187..534621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0488"
FT                   /product="PPOX class putative F420-dependent enzyme"
FT                   /note="TIGRFAM: PPOX class probable F420-dependent enzyme;
FT                   PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: rha:RHA1_ro02455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73270"
FT                   /db_xref="GOA:D2S653"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:D2S653"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADB73270.1"
FT                   /translation="MSAAVDPRMLAFVATQHAGVLATLKRDGRPQLSNLFYAWDDEQQL
FT                   ARISVTADRAKTRNLRADPRATLHVTSPDFWTWVAVEGTAELTAVATDPHDATVEELVA
FT                   YYRALSGEHDDWDAYRAAMVADHRLVVRLRPEHTYGQVRG"
FT   gene            complement(534688..535773)
FT                   /locus_tag="Gobs_0489"
FT   CDS_pept        complement(534688..535773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0489"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: tmz:Tmz1t_1382 diguanylate cyclase with
FT                   PAS/PAC sensor; TIGRFAM: diguanylate cyclase; PFAM: GGDEF
FT                   domain containing protein; SMART: GGDEF domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73271"
FT                   /db_xref="GOA:D2S654"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2S654"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB73271.1"
FT                   /translation="MSMRALAQDEERVAFWRRHTVSGIVLCEVLPAIIAVRTLTIDPPR
FT                   AGLVLAVAAVVAATAPLLALIPVDRLVRHPRGRLFFDAWEAAGIALVTAFCLLDGGVDS
FT                   PYVLFLFVLLAHAALAYPPVGVALAGSTILVGYLGVGLGVGGAPADDVLVGALALAVAT
FT                   ATCAFASANHQRAYQRTAAYARQVALLAERDGLTGALNHRTFHERLRTEAARTTADRPL
FT                   SLLLVDVDEFKTVNDSLGHLAGDAVLRLVGETLAGLTRSEDVSGRLGGDEFALLLPDTD
FT                   LSEATGIAERLVASVRTTAAPYAATVSVGAATVTWGDAVGLQAAADAAVYRAKRSGRNR
FT                   VCVPPAASDGPRSATLTPSGR"
FT   gene            complement(535859..536827)
FT                   /locus_tag="Gobs_0490"
FT   CDS_pept        complement(535859..536827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0490"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: sma:SAV_7355
FT                   pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73272"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2S655"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ADB73272.1"
FT                   /translation="MSNLDRRPPARELGGLAGTPAGPVLDLLPGKEVLLGESTRVRRLL
FT                   PTLGRRLVGAWAFVDHYGPDDISSFPGMQVPPHPHTGLQTVSWLLEGEVHHRDSLGSDA
FT                   RIRPKELALMTAGHGIAHSEQSPAVHPRYLHGAQLWVALPEAARETAPDFAHHPSLPGF
FT                   TSDGLTATVLMGGLGGATSPGIAHTPLVGADLDLAAGADVELSLEPDFEYALLASSGSA
FT                   GVEDAPLEVGAMLYLGTGRRRVRVRAAEPARLLLLGGEPFEERIVMWWNFVGRSGEEII
FT                   EYAQAWNAEDERFGAVVGHDGDRLEAPPLPPVPLKARGRVR"
FT   gene            complement(536850..537761)
FT                   /locus_tag="Gobs_0491"
FT   CDS_pept        complement(536850..537761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fre:Franean1_5413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73273"
FT                   /db_xref="UniProtKB/TrEMBL:D2S656"
FT                   /inference="similar to AA sequence:KEGG:Franean1_5413"
FT                   /protein_id="ADB73273.1"
FT                   /translation="MPVFPPMPLAEWADTKETVHRFLQIVGKLRLANAPRRNHWWHIPF
FT                   HLTGRGLTTRPMGFDPVFAVDLDLVDHRLEVAVADGRRASFPLPGLSVAAFYRQLLDTL
FT                   ATLGLPATVDIPIPFDLADRTPFAEDEHHTSYDRAMVTRYWVVLGQVAQVLEEFAGRSY
FT                   AKTSPVHHFWHTFDLAVTRFSDRRVEQPAGVDPVTREAYSHEVVSAGFWFGDDQVPEPA
FT                   FYSYTAPEPAGLVEEPLRPAAARWIDSRGAHLALLPYEDVRTATDPRAVVLDFLESAYV
FT                   AGARRAGWDLDALRCPTAPEYR"
FT   gene            complement(537918..539444)
FT                   /locus_tag="Gobs_0492"
FT   CDS_pept        complement(537918..539444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0492"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   kra:Krad_3204 UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73274"
FT                   /db_xref="GOA:D2S657"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2S657"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ADB73274.1"
FT                   /translation="MRLPSIPWSEVEHRARTVPGSPVTRAGGADDLTVRGLVTDSRRVV
FT                   PGSLFACVRGATSDGHRHVPAAAAAGAMALLVDRPVETSLPQLCVPSVRAQLGPLGALL
FT                   AGDPARALGLVGVTGSNGKTTTSALVRGVLEAAGTCTGVVGTLGAQVAGLSRETALTTP
FT                   EAPELHELLGAMVEAGARRAVVEASSIALDMGRMDGLAFEVAVFTGFEEDHLDHHGTVE
FT                   QYWASKARLFEPGRTAAGVVVTDDPWGRRLADQAAVRVTRVGSGADADVRVLGWRTGAA
FT                   GTEVLLGDDAGGHRVRSPLVGRVHVTNLAAAWATGRVLGVPPDRIAAGLAAVAPPRGRN
FT                   TVLGGSGRPVVVVDYAHTPRALAAAVDTVRDLTGPGGRVHLVVGARGRRDRYKRQGLGE
FT                   SARAADCVWLTNEGSHGEDPAAIRAELRLGLLGTPAAVRTVPDRREAITAAVRAAGPAD
FT                   VVLVVGRGHETRLLDTTDPRDAVHLDDAEVVAAALAAAHDGDDGLRERAS"
FT   gene            539664..541472
FT                   /locus_tag="Gobs_0493"
FT   CDS_pept        539664..541472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0493"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: stp:Strop_0784 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73275"
FT                   /db_xref="GOA:D2S658"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D2S658"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB73275.1"
FT                   /translation="MSAPLNLVNLERVHKAHGTTVILDDVSLGVAAGERIGVVGRNGGG
FT                   KSTLLSLMTGADQPDSGRVTRRGDLAMGVLDQSGTLPPGTTVRDVVLPPSMFAAEHEWA
FT                   GDPAVRSVLTGLELDRLGLDAPVAPMSGGERRRVALAAQLIRPLDLLVLDEPTNHLDVE
FT                   GVAWLAEYVKARAGGLVVVTHDRWFLDEVSTTTWEVADGKVHAYDGGYSAYTLARAERA
FT                   RISAVQEQRRLDLVRKELAWLRRGPPARTSKPKFRIEAAQALIADEPPARDSMALKGFA
FT                   ARRLGKTVYDVEDVDYAVPTEDGPRPLFEDLTWHVGPGDRIGVVGVNGAGKTSLLRLLV
FT                   GETEPDRGRVVRGQTVAPAYLSQHVTELPGRLRVLEAVQEIARIARIGNQEISASSLAE
FT                   RFGFAANRQWTPVGDLSGGERRRLQLLRLLMAEPNVLLLDEPTNDLDIDTLTALEDLLD
FT                   GFPGTVLVVSHDRYFVDRVCDKVVALLGDGTLAELPGGVEEYLQRRAAGGAPLTTTAGT
FT                   AAGAPPASRPAVSAADSRAAKKEASRLERRMLKLDADEKQLHEQLAAAATDYAKAAELD
FT                   GQLRAVRAEKEQVEEDWLTAAEVAEG"
FT   gene            541648..544524
FT                   /locus_tag="Gobs_0494"
FT   CDS_pept        541648..544524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0494"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   Na+/H+ antiporter MnhB subunit-related protein; KEGG:
FT                   kra:Krad_0046 putative monovalent cation/H+ antiporter
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73276"
FT                   /db_xref="GOA:D2S659"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:D2S659"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADB73276.1"
FT                   /translation="MLVLLLLHLFASVLAPVLVRWWGRQAFLALALVPAAGFAWVLSRL
FT                   GPVLAGQEPRETLPWIPALQLDVALRLDALALTFAALVTGVGALVLVYCARYFSPGEEG
FT                   TGRFAGSLTAFAGSMLGLVLADDMLLLYVFWELTTVFSFLLIGGSGRRLAARRAASQAL
FT                   ILTTAGGLAMLVGLILIGRASGSFLLSEVVAEPGSGTGVTVGVALVLAGAVTKSALVPF
FT                   HFWLPAAMEAPTPVSAYLHAAAMVKAGVYLVARLAPGFADVPGWRPVVLGLGVATMLVG
FT                   GYRALRQKDLKLLLAFGTVSQLGFLVTLVGAGSSELAAAGLAMTLAHALFKSTLFLTVG
FT                   VVDHATGTRDLRRLSGLGRRLPLLAAIGAAAAASMAGLPPLLGFVGKEAAFTALLDGGV
FT                   PDRTVALVVLTGVVAGSVLTAAYTARFVWGAFARKPGVEDSELEHPPEPLFLAAPAVLA
FT                   LTGLVLGPASPLLDPLVVAYAETLPLLAPEAEHLALWHGWQPALALSALTVAGGAALFA
FT                   VRGPVQRLQRRVAVGASADEGYWNVVQGIDRLSVLVTGTTQRGSLPAYLGTILVVVLAL
FT                   PGTLLLTRAPWPGEWRAWDTPVQAVVGVVVVTAAALTLRIRQRLSAVLVVGVTGYGIAV
FT                   VFALQGAPDLALTQFLVETLTLVVFVLVLRKLPKDISERHRPRERAVRGVIAVAVGAFM
FT                   AAAGAVALSARTATPVSAGWPGPAYDFGGGKNVVNVTLVDIRAWDTLGEISLLVVAATG
FT                   VASLVFLRGRTGGVDRVTRADLAQRRERGRRAPRDRWLAATATLDPARRSVVLEVVTRL
FT                   LFHTIMVFSLYLLFSGHNEPGGGFAGGLVAGLALVLRYLAGGRYELGEAAPVAPGLLLG
FT                   GGLLFAGGTGVAGLLLGAGVLQTAILQTTLPVLGDVKLVTSLFFDIGVYLIVVGLILDV
FT                   LRSLGAELDRQEDQEDEIELAPGEVVLR"
FT   gene            544521..545012
FT                   /locus_tag="Gobs_0495"
FT   CDS_pept        544521..545012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0495"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   rsa:RSal33209_2209 potassium efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73277"
FT                   /db_xref="GOA:D2S660"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D2S660"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADB73277.1"
FT                   /translation="MTPTIVLPVMIGGLYAAGVYLLLDRSLTRVLLGFVLLGNATNLLL
FT                   LSTGGPAGLAPILGYSDPEQFNDPLPQALILTAIVITFGVSAFVLAIIHRSWRLARNEA
FT                   VGTDEEDRRVAARKAPDADELDPDDLAPEDRAAMHADSRAGVLEDLADDVDLPAGSGAR
FT                   "
FT   gene            545009..546706
FT                   /locus_tag="Gobs_0496"
FT   CDS_pept        545009..546706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0496"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: ach:Achl_3658 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73278"
FT                   /db_xref="GOA:D2S661"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:D2S661"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADB73278.1"
FT                   /translation="MIEVLAPLPVLLPLLGAAGALLVSGHPTFQRALSTSVLTAVLAVS
FT                   VVLLFVADAEGATSVSVGGWQVPLGIVLVVDRLSALMLVVASTVALGVLVFAVGQGAAD
FT                   GSEETPLSIFHPTFLVLVAGVGNAFLAGDLFNLYVGFEILLMASYVLLTLGGTAGRIRG
FT                   GITYIVVSLTSSLVFLAAIGLVYAATGTVNMAQLAVRLGELPEGTQVLLQSMLLIAFGI
FT                   KAAVFPLSAWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRTQTLLFPGGALDDLLMWAA
FT                   LATMLVGILGAVAQRDLRRMLSFTLVSHIGYMVFGIALGTAAGLAGALFYVAHHIAIQT
FT                   TLFLVAGLVERQGGTTSVDRLGGLARRSPLLAVLFFVPAMNLAGIPPLSGFIGKVGLLQ
FT                   AGVAEGSAVAFTLVAGGVVTSLLTLLAVARVWTRAFWRSPSQSPAEDTAAAAAAAAAVR
FT                   HRPESDGVASDGEAADGGSRTALQDAWRRHTAVATAAEPDLPPAAGAVRALRPLPGTMV
FT                   GATTALVALTVALTGLAGPLYGLADRAATDLIDRTPYTTSVFGTEEVP"
FT   gene            546703..547269
FT                   /locus_tag="Gobs_0497"
FT   CDS_pept        546703..547269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0497"
FT                   /product="multisubunit Na+/H+ antiporter MnhE subunit-like
FT                   protein"
FT                   /note="KEGG: kra:Krad_0043 multisubunit Na+/H+ antiporter
FT                   MnhE subunit-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73279"
FT                   /db_xref="GOA:D2S662"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:D2S662"
FT                   /inference="similar to AA sequence:KEGG:Krad_0043"
FT                   /protein_id="ADB73279.1"
FT                   /translation="MTVEPAATRLRHQVPLMAWLVVVWMLLWGTWSWANLISGLLVALT
FT                   VLTLLPLPHVVGGARVRPLPLLVFLGHFVVDLFASGAEVAWQALRPGGVHRTAIVQVQL
FT                   RADSDLLLTMVAEATSLVPGSLVLDLDREHRVMTLHMLPARDLEDVARKKANVLVVEER
FT                   LVRAFGSPADLAALDGYGRAEVRTS"
FT   gene            547266..547595
FT                   /locus_tag="Gobs_0498"
FT   CDS_pept        547266..547595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0498"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: kra:Krad_0042 multiple resistance and pH
FT                   regulation protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73280"
FT                   /db_xref="GOA:D2S663"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:D2S663"
FT                   /inference="protein motif:PFAM:PF04066"
FT                   /protein_id="ADB73280.1"
FT                   /translation="MMIVSSLLYALIGGGALLALVRLARGPSLLDRVVATDTLLVIIAA
FT                   GLAVHAALQRDPTLVPVLVVVSLLAFVGSVSVARYIGGMLLRSRTGDGSDLGLPVAAEV
FT                   REEQP"
FT   gene            547592..548002
FT                   /locus_tag="Gobs_0499"
FT   CDS_pept        547592..548002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0499"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="TIGRFAM: monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit; PFAM: Na+/H+ antiporter subunit; KEGG:
FT                   bcv:Bcav_3813 monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73281"
FT                   /db_xref="GOA:D2S664"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:D2S664"
FT                   /inference="protein motif:TFAM:TIGR01300"
FT                   /protein_id="ADB73281.1"
FT                   /translation="MTALADVVAFACLLAGAVLCLTAGLGLVRFPDVLSRMHAGTKPQV
FT                   LGVLLVMVGAAIRLDGWANAWMLLLVAAFQMLTAPVSAHLISRVAYRRRHVRRDLLLID
FT                   EFGPAGHQDLRYRGDEPGDAPPEEDGVLPQSS"
FT   gene            complement(547990..548727)
FT                   /locus_tag="Gobs_0500"
FT   CDS_pept        complement(547990..548727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0500"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mgi:Mflv_5064
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73282"
FT                   /db_xref="GOA:D2S665"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2S665"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB73282.1"
FT                   /translation="MAQLTPYLTVRDARAATAWYADALGARVVGELHVMDDDRIGHAEL
FT                   DVGGATLYLADEYPELGLVAPDAGRVGVTLHLSVSDVEAAVDRAAAAGATVERPSDGPG
FT                   GRTGVVVDPFGHRWMLQTPSRGPAAARPPVRPGDTVHLTLRVPDGARARDFYEAVLGWS
FT                   LSPGRVDDGWEAPGQTPTVGLHGGQASDPGAVPVYAVDDIEVAVAAVQTAGGQAGAVER
FT                   QDSGSSAYCRDDQGLPFRLAQLD"
FT   gene            complement(548791..550536)
FT                   /locus_tag="Gobs_0501"
FT   CDS_pept        complement(548791..550536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0501"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: kra:Krad_3377 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73283"
FT                   /db_xref="GOA:D2S666"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:D2S666"
FT                   /inference="protein motif:TFAM:TIGR00970"
FT                   /protein_id="ADB73283.1"
FT                   /translation="MSRNLSENHPHVRHPQQPSGMPISRYAPFTPIVLPDRTWPETVIT
FT                   QAPRWCAVDLRDGNQALIDPMTPDRKRRMFELLVRMGYKEIEVGFPAASQTDFDFVRQL
FT                   IEDDLVPDDVTIQVLTQARDELIERTFESLRGARQAIVHLYNSTSTLQRRVVFGSDRAG
FT                   IVDIAVHGAQVVRKLAEQMAGTEVFYEYSPESFTGTELDFAVEVCNAVTDVWEPTPDRP
FT                   TIINLPATVEMAEPTVYADQIEWMHRNLGRRDAVVLSLHPHNDRGTAVAAAELGYRAGA
FT                   DRIEGCLFGNGERTGNVDLVTLGLNLFSQGIDPQIDFSDVDDIRRTVEYCNQLGVHERH
FT                   PYGGDLVYTAFSGSHQDAINKGLKALEVDAEAAGKPVAEMPWAVPYLPIDPKDVGRTYE
FT                   AVIRVNSQSGKGGVAYIMKTENQLDLPRRLQIEFSAVVQRHTDDEGGEVTAQQMWAAFS
FT                   SEYLPDPDAPWGRFSLTGHRHRAHGDQLDEMVVELVDDGVPMTVEGRGNGPIAAFVDAL
FT                   RSVDVDLRVLDYAEHAMSAGGDARAAAYVECAVGDRVLWGVGIDPNIVTASLRAVVSAV
FT                   NRAQR"
FT   gene            complement(550711..551352)
FT                   /locus_tag="Gobs_0502"
FT   CDS_pept        complement(550711..551352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0502"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bcv:Bcav_3642
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73284"
FT                   /db_xref="GOA:D2S667"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2S667"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB73284.1"
FT                   /translation="MTGAEHSGMLRRIRRTADLSQRELAARIGISKSAVAAAESGRSGI
FT                   DVRALARAAEVAGLRLALLDASGREVAGMDGDAVRDQAGRFYPAHLDTRYGDEEWWYTH
FT                   QGHGHDREQPWYTFDRTRWIRDWHRARDGTPHDHQQPRPGDSPSARAEARRAAHRRAVG
FT                   EERQRRFLAGEFAHVDDGLTCTCPPGCDEVDDGSGPPGHAADCPCGCDLA"
FT   gene            complement(551594..553234)
FT                   /locus_tag="Gobs_0503"
FT   CDS_pept        complement(551594..553234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0503"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: msm:MSMEG_0375
FT                   phospholipase D family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73285"
FT                   /db_xref="GOA:D2S668"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D2S668"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADB73285.1"
FT                   /translation="MAAVLASPWAGRCDHRVDDVERWLLTAEERGNPATSLPAYTEGNL
FT                   VEALVHGVPYFDRLVECVERLDAGDHLFFTDWRGDPDEQLRPGGPTVARLFTDAVRRGV
FT                   CVRGLVWRSHVDWMSFSADENRALDDEVEHGGGEVILDQRVRRGGSHHQKLVVLRHDQD
FT                   ATQDVAFVGGIDLCHGRRDDAEHRGDPQPLAMSVAYGETPPWHDVQLMLRGPTVGVLDT
FT                   VFRERWDDPTNADSGNPIAWVLDRLRGARLKGDPLPPQLPPPPPCGPHVVQNLRTYPAI
FT                   RPPYDFAPHGERSVARGYSKAIERARRLVYLEDQYMWSADIARLFARALADNPGLHLVV
FT                   VVPRVPDQDGAVAERSQYVGRWQALEMCRRAGSGRVHVFDVENHEGTPVYVHAKVCVVD
FT                   DVWASVGSDNFNRRSWTHDSELSSAVLDTTRDPREPRDPAGTGDGARTFARDLRLELAR
FT                   EHLDRAADGSEDDDLVDPEAFVRTLESSAAELDAWHAGGRRGPRPRGRLREHSPRRLSL
FT                   PTRLWATPVYRLVDDPDGRPWRMRLAREF"
FT   gene            553261..554529
FT                   /locus_tag="Gobs_0504"
FT   CDS_pept        553261..554529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0504"
FT                   /product="aspartate kinase"
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   saq:Sare_0265 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73286"
FT                   /db_xref="GOA:D2S669"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D2S669"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ADB73286.1"
FT                   /translation="MALVVQKYGGSSVASAAHIKRVAERIVAAKEAGDDVVVVVSAMGD
FT                   TTDELLDQAAQITDNPAGRELDMLLTAGERISMALLAIAINTHGYEARSFTGSQAGVIT
FT                   TSSHGKARIIDVTPGRLRDALDEGSIVIVAGFQGVSQDTKDVTTLGRGGSDTTAVAVAA
FT                   ALQADVCEIYTDVDGVFTADPRIVPNARRLDTVTYEEMLELAASGAKVLVLRCVEYARR
FT                   YGIPVHVRSSYSQLPGTTVAGSMEDLTVEQAIITGVAHDRSEGKITVFGVPDRPGEAAQ
FT                   LFRVLAEAEVNVDMIVQNVSAAASKLADISFTLPKSDGPAALAALEKVKNTIGYTDVTF
FT                   DQHIGKVSLVGAGMRSHPGVSARFFGALADAGVNLELISTSEIRISVVCRDTDVDVAVR
FT                   AVHDAFDLGTDEALAVVYGGTGR"
FT   gene            554526..555596
FT                   /locus_tag="Gobs_0505"
FT   CDS_pept        554526..555596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0505"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: ace:Acel_2011 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73287"
FT                   /db_xref="GOA:D2S670"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S670"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ADB73287.1"
FT                   /translation="MSTLSSGHGSSDGLRVGIVGATGQVGGVVRQILAERGFPMSELRF
FT                   FASARSAGSTLPWGDGEITVEDATTADPTGLDIAIFSAGASTSRVQAPRFAEAGVTVID
FT                   NSSAWRRDADVPLVVAEVNPDALASVPKGIIANPNCTTMAAMPVLKPLHDEAQLVRVVA
FT                   STYQAVSGSGLAGVDELDTQVKAVVDKAAELTHDGSAVPFPEPAKYVRPIAFNVLPMAG
FT                   SLVDDGTFETDEEQKLRNESRKILGIPELRVSGTCVRVPVFTGHSLSLNLEFERALTVE
FT                   RATELLSSAPGVELTAVPTPLQAAGRDPSYVGRIRQDPGVDGDRGLALFVSNDNLRKGA
FT                   ALNTVQIAELILASRR"
FT   gene            complement(555660..557447)
FT                   /locus_tag="Gobs_0506"
FT   CDS_pept        complement(555660..557447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0506"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: sen:SACE_0309 peptide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73288"
FT                   /db_xref="GOA:D2S671"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2S671"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ADB73288.1"
FT                   /translation="MSSEPTALSPEVTARWQARFRAPRVSLPDWALEAPQRSLYASDVS
FT                   GVVEQYAWDRTTDAHRQATDRANGTLIGTLSPDGETIWWFADTDGDEFGVWMTQPFAGG
FT                   EDRVAVPEVGPAYPAGLEVGTSVVAVGRSTDDGSELWLAPAGGTPRVVYRHEDPASVDA
FT                   LTHDEDLLVISHSEHGDPRYPALRLLRTDDDSVVAEKWDGEGRGLHALEFAPLPGDRRL
FT                   LVGHERRGREELLVWDVGTDTETEIVLDLPGDVTAGWYPDGSALLVGHDHAARSELYRY
FT                   DLGSGALERLDTPRGVVRGATARPDGTVELAWSNSERPPVIRRADGPVVLAAPGEEPPA
FT                   AYPVEDRWVPGPGGDVHALVVRPAGPPPYAAAFLVHGGPEAADDDSYRARRAAYVDAGY
FT                   AVVHVNYRGSTGYGSAWRDALTGRPGLTELEDVAAVYDALVEEGFLDPSRALLSGGSWG
FT                   GFLTLLGLGTQPERWAAGIAEVPVADYLAAYEDEMEGLRAYDRALFGGSPDEVRDVYVR
FT                   SSPITYAQAVAAPVLVVAGANDPRCPIRQIDNYLARLEELGKPHEVYRFDAGHGSLVVE
FT                   ETIRQVEVALDFALRHVKP"
FT   gene            complement(557452..558552)
FT                   /locus_tag="Gobs_0507"
FT   CDS_pept        complement(557452..558552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0507"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; SMART: CBS domain containing protein;
FT                   KEGG: nca:Noca_2719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73289"
FT                   /db_xref="GOA:D2S672"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D2S672"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADB73289.1"
FT                   /translation="MSDVLSLLVLVALLLGNAFFVAAEFALVTARPDQLEPRAAAGSAR
FT                   ARKTIRAMRNVSAMMAGAQLGITLCSLGLGAVGEPAVAHLIETPMAALGVPEGLLHPIA
FT                   LVIALSLVTVLHMVLGEMVPKNITIAGPDRAALLLGPPLAAFVRLLGPVIRLFNAAANA
FT                   MVRLAGVQPTDEVAASFDEAEIRSMISQSRREGRLGSEVGELAAGALTFDQDELEAVLL
FT                   PLDRLVTVPRSTTPRRLEAVVAEHGFSRYPVRDHDGALLGYVHVKDVLGVEPEARDRPI
FT                   ADEHVIPFIPLQPGAALPDVLTAMRDAGAHLGRVLDGGRTVGLVALEDVLERLIGDIRD
FT                   AAAETSRRLEEPARGGAGAGAGAGGR"
FT   gene            complement(558549..559904)
FT                   /locus_tag="Gobs_0508"
FT   CDS_pept        complement(558549..559904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0508"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   fre:Franean1_1954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73290"
FT                   /db_xref="GOA:D2S673"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D2S673"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADB73290.1"
FT                   /translation="MTEWLLLLAAVALTALTGFFVAAEFSLTTVDRGRAEQAAASGDRG
FT                   ARGVVAALRTLSTQLSAAQLGITITTLVVGYLAEPALGQLLRGPLEAAGLPAGWVTGVS
FT                   YGLALALATTLQMLIGELGPKNLAIARPLPVAAAVAPGMRAFTRVTGVVVHALQALANA
FT                   IVRRLGFEPREELESARGADELAAVARRSAEEGDLSPRAARLLERSLALRDKVAADVMT
FT                   PRTQMWALRADATAADVIGAAVASGSSRFPLYGAGLDEVTGVVHVKHAVAVPEDQRGVV
FT                   PAEELAVPILTAPSLLRVERLLDLLREEGLQMALVVDEWGATHGIVTLEDIVEEVVGEI
FT                   ADETDRPLRLLRRVDPQTWLLSGLLRPDEVRERTGVPVPEGRYETLGGYLAEQLQRLPA
FT                   VGDTVPVEGGELTVETIEGRRVARVRALMRDGYASGATAVRLVEDDEKEPAA"
FT   gene            complement(560008..560081)
FT                   /locus_tag="Gobs_R0012"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(560008..560081)
FT                   /locus_tag="Gobs_R0012"
FT                   /product="tRNA-Pro"
FT   gene            complement(560113..561078)
FT                   /locus_tag="Gobs_0509"
FT   CDS_pept        complement(560113..561078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0509"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: nfa:nfa3370
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73291"
FT                   /db_xref="GOA:D2S674"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2S674"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADB73291.1"
FT                   /translation="MRQPRTARSGDAPVISAAVRATTALPTAVLGSATAGIAYASLYER
FT                   TRWTLRRFDVPVLAPGSAPLRVLHLSDLHMTAGQRSKQEWVASLADLQPDLVVDTGDNL
FT                   AGMDAVPGTLRALEPLLDLPGAFVLASNDYYAPRPKNPLKYFKREHKRVHGDELPWRDL
FT                   RDAMAARGWLDLTNARGELVVDGRRIVFAGVDDSHLRLDRYDLVAGPADPTADLRIGLA
FT                   HSPEPRVLDRFAADGHDLLLCGHTHGGQLRVPFYGALVTNCGIDRDRVRWLHRWAEPSA
FT                   THPHGTWLHVSAGLGTSPYAPYRFACPPEATLLTLTARRT"
FT   gene            561079..561531
FT                   /locus_tag="Gobs_0510"
FT   CDS_pept        561079..561531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0510"
FT                   /product="Protein of unknown function"
FT                   /note="PFAM: Protein of unknown function YOR215C,
FT                   mitochondrial; KEGG: nca:Noca_0325 GatB/YqeY
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73292"
FT                   /db_xref="GOA:D2S675"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D2S675"
FT                   /inference="protein motif:PFAM:PF09424"
FT                   /protein_id="ADB73292.1"
FT                   /translation="MSDLKEQLRTDLTTAMKSRDELRTATLRMVLAAVSAEEVAGKEAR
FT                   ELSDDEVQAVLRREAKKRREAADAFATAGRTEQADRERAEGDVVAAYLPAQLADADLAA
FT                   LVADVVTRTGAGGRKDMGRVMGAVQKEVAGRAEGGRVAAEVRRQLG"
FT   gene            complement(561600..563780)
FT                   /locus_tag="Gobs_0511"
FT   CDS_pept        complement(561600..563780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0511"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; KEGG: rop:ROP_42240
FT                   penicillin-binding protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73293"
FT                   /db_xref="GOA:D2S676"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D2S676"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ADB73293.1"
FT                   /translation="MSADASDRPRVLAKLAATIVLAGALVAGMLLPFVGGTGLAARNSA
FT                   SLLDALPVELTDETPAGNTRVLAADGSLITMFYRNDRTPVPSDRIAPVMKQALVAIEDA
FT                   RFELHNGLDVQGTLRALATNVAAGSVQEGGSTLTQQLVKQTLAQTADTAEERQAATEES
FT                   VGRKLREARMALALEEEYSKDEILTRYLNLVYFGQGAYGVQAAAQRYFSVDAADLTLPQ
FT                   AAMLAGLVQSPSNDDPITNPENGQTRRNQVLQAMVGAGQIDQAQVDEISAQPVQVAPGA
FT                   AAPNGCIDATVGGFFCAYLADYLRNTLGLSQELLDDGGLTIQTTLRPDLQRSGDQAVLG
FT                   ELAMGDSLAGTFTAVEPGTGHVLAMSANRRFGCAGPECESVNLNVVPGQGSGSTYKVFT
FT                   AAAALEQGLPISHVITASEPYVSRVYKDGAGRYDVENVGNSYPRTLSMAEALVRSSNTY
FT                   FLALEDRLGSVEGPVRAAERMGLFQFSDPGLPQQIIDENRGSFTFGPESTSPLALASAY
FT                   STLAANGTQCDPSPVTAVLDRDGQPLTGDDGRPVVRDDRCTPGAVSTEVATTLNQVLVG
FT                   DTESPFGTGRNAAIPGHDIAGKTGTSQDNLSVAFVGYTPQYAASVMVYNPKEREQVRGF
FT                   GGGMPATIFYHAMAPILAGQPAVPFTAPAPAPAPAAPAASGSAPDAAPAPEAAPAPGDA
FT                   PAPEAAPAADGATPADPAGAPAPVDPAAAPAG"
FT   gene            complement(563824..565068)
FT                   /locus_tag="Gobs_0512"
FT   CDS_pept        complement(563824..565068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0512"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: rer:RER_04650
FT                   anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73294"
FT                   /db_xref="GOA:D2S677"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S677"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ADB73294.1"
FT                   /translation="MSAATEATTGRTRRSPRPPAPPTAEALPLELAELITDPDTRIVVC
FT                   CGAGGVGKTTTSAALALAAAEAGRTVVVLTIDPARRLAQSLGLVELDNEPRRVDVPGAR
FT                   GELHAMMLDMKRTFDDIVVAHSTPERAQQILENPFYQTLSSSFAGTQEYMAMEKLGQLR
FT                   AGDRWDLIIVDTPPSRSALDFLDAPNRMSRFLDGTMIRLLTAPSRTGFRIASAGFLFFS
FT                   RIISKILGGQLLRDISAFVSALDTMFGGFRERATATYELLRRPGTWFVVVATPEPDALR
FT                   EASYFVDRLSAEQMPLAGLVVNRTHPPTTTALSATRADGAAEEALESGREGAELAAGAL
FT                   RVHAERMTLATREQHLADRFTSAHPEVAVRTVPAAAGDVHDLDGLRVMADALTGPDGDT
FT                   PTGVPRRRILPARRR"
FT   gene            complement(565065..566057)
FT                   /locus_tag="Gobs_0513"
FT   CDS_pept        complement(565065..566057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0513"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: fal:FRAAL6550
FT                   putative ion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73295"
FT                   /db_xref="GOA:D2S678"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S678"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ADB73295.1"
FT                   /translation="MSPVPSSVRCHVVTGKGGTGKTTVAAALALALAADGRQVLLVETE
FT                   GRQGIAQLFDTPPLPYEERRVAVARGGGVVKALAIDVEEALLEYLEMFYNLRRAGRALR
FT                   RVGAVDFATTIAPGLRDVLLTGKVKEAVTRRHDGRPVYDAVVVDAPPTGRITRFLNVTG
FT                   EMAGLTRSGPIKTQSDGVMAVLKSPQTAVHLVTLLEDMPVQETADAIAELTAAGLPVGS
FT                   VVVNMATEPALPEPALARAAQDGLTGADLAPALAAAGLQDVAGLADALAAEATDHARRW
FT                   AAQDELRDEVEALDRPTVELPLLPGPMDLGALFELAGRLEEHLRTEVAA"
FT   gene            566151..566324
FT                   /locus_tag="Gobs_0514"
FT   CDS_pept        566151..566324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlu:Mlut_18310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73296"
FT                   /db_xref="UniProtKB/TrEMBL:D2S679"
FT                   /inference="similar to AA sequence:KEGG:Mlut_18310"
FT                   /protein_id="ADB73296.1"
FT                   /translation="MSESARVRWEYATIPLLIHNTKAILDSWGVDGWELVTVLPGPGGA
FT                   DQPVAYLKRPVG"
FT   gene            566332..566805
FT                   /locus_tag="Gobs_0515"
FT   CDS_pept        566332..566805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0515"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rer:RER_04680
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73297"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2S680"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADB73297.1"
FT                   /translation="MTSPQTSSWHARLVELGIRLPAVAAPVAAYVPAVRSGQLVYTSGQ
FT                   LPFVDGGLRRTGKVGGSVDPEDAAHDAKLCALNALAAIDDLVGLDSVARVVRVVGYVAS
FT                   AEGFTGQPRVVNGASELLGRVFGDAGRHARSAIGVAELPLGAPVEVELTVELR"
FT   gene            566802..567596
FT                   /locus_tag="Gobs_0516"
FT   CDS_pept        566802..567596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0516"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: tfu:Tfu_0115
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73298"
FT                   /db_xref="GOA:D2S681"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:D2S681"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB73298.1"
FT                   /translation="MSAEPRQAATVLLLRNGVPGLEVYLLRRTRGMPFAGGMTAYPGGG
FT                   VDPRDGDVETAWAGPSPAEWAHAFGCDERTARELVCAAVRETFEEAGVLLAGTADGGDV
FT                   VPDVSGEDWEVQRQALLARELSLAELLADRGLALRSDLLRPFAHWITPPAEPRRYDTKF
FT                   FAAALPVGQEARHVTGEADEVSWLTPPAALAEMAAGTRPMLPPTIHTLGQLEPFADVAA
FT                   ALAGSPPEPLHPICPWFADEPDGRWAVLPDGTRIRIVVPLPS"
FT   gene            complement(567679..568353)
FT                   /locus_tag="Gobs_0517"
FT   CDS_pept        complement(567679..568353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0517"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: saq:Sare_4762 Crp/FNR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73299"
FT                   /db_xref="GOA:D2S682"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S682"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADB73299.1"
FT                   /translation="MDEVLGQSGLFQGLPEEAVDPVASRLETVTLPRGRVVFNEGEPGD
FT                   SLYIVLSGKIKLSRRAPDGRENVLAVMGPSDQFGELSVFDPGPRTATATAVTDVKLARM
FT                   PQSVLRPWIEAHPEVGERLLHVLARRLRRTNDSVADLIFTDVPGRVAKALLQMADRFGS
FT                   REGEGLRVKHDLTQEELAQLVGASRETVNKALADFVHRGWIQLQGKSVVVLDEERLRRR
FT                   AR"
FT   gene            complement(568531..568773)
FT                   /locus_tag="Gobs_0518"
FT   CDS_pept        complement(568531..568773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rop:ROP_42320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73300"
FT                   /db_xref="UniProtKB/TrEMBL:D2S683"
FT                   /inference="similar to AA sequence:KEGG:ROP_42320"
FT                   /protein_id="ADB73300.1"
FT                   /translation="MVALIVILFPPLVIAFLLVMERVEEPLRRPAGPREVAEFLSTASA
FT                   GEVDTLANSGIRRAMVRWRRRRASRVRRGAEPPVV"
FT   gene            568885..569715
FT                   /locus_tag="Gobs_0519"
FT   CDS_pept        568885..569715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0519"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: ach:Achl_3166 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; iron-sulfur cluster loop; SMART:
FT                   HhH-GPD family protein; iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73301"
FT                   /db_xref="GOA:D2S684"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D2S684"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADB73301.1"
FT                   /translation="MMARALSAGPPTLDRVSSPAYARPVPPRARRAAARGGSPFDPQET
FT                   PLARTRRARRMARELAVIHPDAHCELDFTNAFELLVATVLSAQTTDKTVNRVTPVLFAK
FT                   YPDAQALAGADRAELEEVLKPTGFFRAKANSVLGLAQALLERFDGEVPGRMADLVTLPG
FT                   VGRKTANVVLGNAFDVPGLTVDTHFGRLVRRFGWTAEEDPVRVEAEVAELIPKREWTMF
FT                   SHRVIFHGRRVCHAKKAACGACGLARWCPSYGIGPTDPEVATKLVKTPAASDTE"
FT   gene            569712..570302
FT                   /locus_tag="Gobs_0520"
FT   CDS_pept        569712..570302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0520"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   saq:Sare_4758 redoxin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73302"
FT                   /db_xref="GOA:D2S685"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2S685"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ADB73302.1"
FT                   /translation="MSTGDRTAAGVLALGLALAGCTADATEEPDGAAASPSPDPLTVLG
FT                   ACPEQPDRPAEGADTLPALDLACPGGGSLDLGRAPGVPTVVNLWASWCGPCREELPLVQ
FT                   QLADAGGDRLAVVGVISRDGAPQAASFAADAGATFPSAFDGEGELMAELGLGALPYTYL
FT                   LDADGGIAHVQVGPVADVAELEGLVAEHLGVTL"
FT   gene            570299..571063
FT                   /locus_tag="Gobs_0521"
FT   CDS_pept        570299..571063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0521"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: fre:Franean1_0325 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73303"
FT                   /db_xref="GOA:D2S686"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2S686"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB73303.1"
FT                   /translation="MTDAATPGAALPEYLRRLLDVGDDLPLRHRMPRPTATARRSAVLI
FT                   LFGEGPRGADVLLIEKSAHLRTHAGQPAFPGGGADPGDDYPVGTALREAEEEAGIDPDG
FT                   VRVLATLPELFLGPSDNLVVPVVAWWDDPRDVTVGDPREVARVARVPLADLADPANRFR
FT                   IRHPSGYVGPAFGVAGMVVWGFTGGLLDAILEAAGLARPWDATDVRPLPALGARRPQLP
FT                   GTLDPTDDEDAAAPTVADPAPDGPPASTVPPR"
FT   gene            571075..571518
FT                   /locus_tag="Gobs_0522"
FT   CDS_pept        571075..571518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0522"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   fre:Franean1_0324 blue (type1) copper domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73304"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D2S687"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADB73304.1"
FT                   /translation="MSRRGGALLAGGVLAVTVLTGCGGGGGTAGQEAAPSSGPALGTVT
FT                   TAPDGVQEVTLQTQDDYVFTPSTFTVAPGPVRLTVVNVAEQMTHNFRFTPDDGPAPIDP
FT                   EIPLLTPGETRTVEFTATTPGEYGFECSFHTQLQQFGTMTVSG"
FT   gene            571527..572708
FT                   /locus_tag="Gobs_0523"
FT   CDS_pept        571527..572708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0523"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: saq:Sare_4756 peptidase S1 and
FT                   S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73305"
FT                   /db_xref="GOA:D2S688"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D2S688"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ADB73305.1"
FT                   /translation="MSIVDLVLIGLALVFAFSGFRQGVIVSATSFFGFFGGAVLGAQLS
FT                   RPVADRLDGTATTRVFAALVVVLAAALLGQVLAGAIGRAVRRRVTWQPAEVVDSVAGAV
FT                   LSALAVLLVAWMVATPLANAPFPQVASQVKQSALVQAVDRSVPAGVRGVYDSLREAIDH
FT                   NGLPDVLDPLTPTQVPDVAAPDQALRESPVVSSVQGSVVQISGVAPSCSRQIDGSGFVY
FT                   APERVMTNAHVLAGVSDPVVAAEGEEYEAIPVYVDEATDVAVLSVPGLPQVPLTFAPEP
FT                   ADSGDDAIIMGYPGGGGLFVGPARVRDHTDISGPDFRNEETVVRDVYALYGEVRAGNSG
FT                   GPLFDPQGQVLGVVFASAIDDPLTGYALTYEQVEGAAVTGQASSSAVATGACE"
FT   gene            complement(572743..573669)
FT                   /locus_tag="Gobs_0524"
FT   CDS_pept        complement(572743..573669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0524"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: fal:FRAAL6562
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73306"
FT                   /db_xref="GOA:D2S689"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2S689"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADB73306.1"
FT                   /translation="MSTPDTERPDATSVLLPGPWTHRDLSANGVRLHVAEAGEGPLVLL
FT                   LHGFPEFWWAWRAQLPALAAAGFRAVAPDLRGYGGSDKPPRGYDLPTAAADVAALVRAL
FT                   GERDAVVVGHDWGGLVAWTMAALHPRSVRRLAVLSMAHPRQLRAALADRAQRKALRHIL
FT                   GFQVPRLPERRMTRADDDPVADLMRRWAGPAWTATAGFAEAVSRYRSAARIPQAAYGSM
FT                   EYFRWAGRSQLRPDGLRYARRMAAPVTAPTLQLHGVLDPCVLPSSARGSGRYVAGAYQW
FT                   RELPGVGHFPHEEVPGEVNAALVGWAR"
FT   gene            complement(573696..574202)
FT                   /locus_tag="Gobs_0525"
FT   CDS_pept        complement(573696..574202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0525"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   cjk:jk1966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73307"
FT                   /db_xref="GOA:D2S690"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D2S690"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ADB73307.1"
FT                   /translation="MAHSASSNPSGARSTTRTEEPSVGALVQSAMADVSTLIRSEIELA
FT                   KAEVGKSAKKAGIGAGAFGAAAVLLAFSGIFLFVTIAEFLTWLGLERWISYLIVWLLLV
FT                   VLAGIAALVGRSSLKKIEKPERTIETLRDLPEVIHREAPGQRRREVPTVSNGRVQLRGS
FT                   ENYTV"
FT   gene            complement(574555..576504)
FT                   /locus_tag="Gobs_0526"
FT   CDS_pept        complement(574555..576504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0526"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: sma:SAV_4599 acetyl-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73308"
FT                   /db_xref="GOA:D2S691"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2S691"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADB73308.1"
FT                   /translation="MSESTELEGRRFPAPEQLAAQANVGPDAYERAAQDRLGFWAEAAD
FT                   RLSWAQKWDEVLDWSNPPFAKWFVGGKLNVAYNCVDRHVEAGHGEQVAYHWEGEPGDTR
FT                   TITYAQLKDDVCKAANALLELGVQAGDRVAIYMPMIPEAVVAMLACARIGAVHMVVFGG
FT                   FSADALASRITDSGAVLVVTSDGGYRRGSPSALKPAVDDAVARTESVRNVLVVRRTKQD
FT                   VEWSEGRDLWWHDVVDRQSTEHTPEAFDAEHPLYIMYTSGTTASPKGILHTSGGYLTQV
FT                   AFTHWASFDLKADTDVFWTSADIGWVTGHSYIVYGPLANRATSIMYEGTPETPHRGRWF
FT                   ELIEKYKVTIMYTAPTVIRTFMKWGEDIPAGFDLSSLRLLGSVGEPINPEAWLWYHKNI
FT                   GGGRCPIVDTWWQTETGAHMINPLPGVTALKPGSAQTPFPGISAKVVDDEGNELGDDSS
FT                   GLLVLTEPWPSMLRTIWGDDDRYVDTYWSRFGKEVYFAGDGAKKDADGDIWLLGRVDDV
FT                   MNVSGHRISTTEVESSLVAHPTVAEAAVVGASDPTTGQGIVAFVILRGNAEDSGDELVQ
FT                   QLRTHVAKDIGPIAKPRQIMVVQELPKTRSGKIMRRLLRDIAENRELGDVTTLTDSSVM
FT                   NLIKDKLPASSSED"
FT   gene            576655..577416
FT                   /locus_tag="Gobs_0527"
FT   CDS_pept        576655..577416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0527"
FT                   /product="ferric iron reductase"
FT                   /note="PFAM: ferric iron reductase; KEGG: rop:ROP_62850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73309"
FT                   /db_xref="GOA:D2S692"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:D2S692"
FT                   /inference="protein motif:PFAM:PF06276"
FT                   /protein_id="ADB73309.1"
FT                   /translation="MGAAERVVRAAPGRQTGGVTAGVQAAVAARVPGAAALGLLAPPSA
FT                   VAVPAALLADADWTSARLAALGARYASDDRRVLATVWWYSASSVLLTPVLAGLVTGRPL
FT                   SARLADTSVALLAGGTLVAATSSAPGGDTAAELRDALAEVVDVVAAAGRMRARPLWAIA
FT                   ADSLANRLLALGRALGEERRVTALAAPLAAAVGPPLPVPRYVDVAGVRFTRRVSCCLLY
FT                   RLPPEPLCTSCPRRPAAEREVLLEDTAARMR"
FT   gene            complement(577417..578571)
FT                   /locus_tag="Gobs_0528"
FT   CDS_pept        complement(577417..578571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0528"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: tfu:Tfu_0820 small GTP-binding
FT                   protein domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73310"
FT                   /db_xref="GOA:D2S693"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D2S693"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADB73310.1"
FT                   /translation="MPGTWLLGSEVAQDGNRDGDGGPDGARAVLLGLRDGGRGAADPLD
FT                   ELERLAETDGVAVVGRLVQPRDRPDPATYLGSGKVAELADLVRDRDAGLVIADGELSPA
FT                   QVRNLEERLGARVVDRTALILDIFAQHARSSEGKAQVELAQLAYQLPRLTGHGVEMSRV
FT                   GGGRTAGGAGIGVRGPGEQQLESRRRHLRRRMTLLRRQVQDTARRRERTRSRRRRNRVP
FT                   SVALTGYTNAGKSALLNRLAGADVLVQDALFATLDPTVRRTRTPDGRPYTLTDTVGFVR
FT                   HLPHQLVDAFRSTLEEVVDADLVLHVVDASAPDAMDQVTAVRGVLHEIGARDHPELLAL
FT                   NKVDVAPEGWLAALRAAYPDAVPVSALTGEGAEELRRAIGERLD"
FT   gene            complement(578749..579768)
FT                   /locus_tag="Gobs_0529"
FT   CDS_pept        complement(578749..579768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0529"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   rxy:Rxyl_2617 putative S- adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73311"
FT                   /db_xref="GOA:D2S694"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D2S694"
FT                   /inference="protein motif:PFAM:PF02547"
FT                   /protein_id="ADB73311.1"
FT                   /translation="MTAFTMGAEASAPPERRGLARDGVRLMAVRPGGTTETTFRDLPEL
FT                   LEPGDLVVVNTSATLPARLDARRADGVRAPLHVSTALDDGDWVVELRRPDNDGPDRGVE
FT                   PGTVLDLPGRVRLRLLEGFPAPARASRLWRARPDPDVAVAELLRRHGTPIRYGHLSAAV
FT                   PLAEAQNVYATEPGSAENASAGRPFTDRVLVRLMARGVPVVPVVLHAGVSSPELHEPPM
FT                   PERYRVPEVTARLVNATRAAGSRVVAVGTTVTRALETATGEDGVTRAAAGWTDLVLGPD
FT                   RPARAVSGLLTGLHAPDASHLLLLEAVAGRELVDEAYARAAAGGYLWHEFGDTMLFLP"
FT   gene            complement(579765..580511)
FT                   /locus_tag="Gobs_0530"
FT   CDS_pept        complement(579765..580511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0530"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rha:RHA1_ro00215 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73312"
FT                   /db_xref="GOA:D2S695"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S695"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB73312.1"
FT                   /translation="MTPSTALVTGASRGLGAALAEALNRRGWRLVVDGRDPDRLAAGVA
FT                   ALPRPDLVTAVAGDVADPAHRAALAAAVPGRLDLLVNNASELGPTPLPRLAELPPTALE
FT                   RVLAVNTVAPLALVQAVLPALERARGVVLDVSSDAAVEAYEGWGGYGASKAALDRLSAV
FT                   LAVEHPGLRVYAVDPGDMATDMHRAADPGATGLPEPAAVVPALLRLIDGDLPSGRYRVA
FT                   SLQGPAASLRAAGGSEVLPLAAEAVR"
FT   gene            580560..581027
FT                   /locus_tag="Gobs_0531"
FT   CDS_pept        580560..581027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0531"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: fra:Francci3_3453 MerR family transcriptional
FT                   regulator; TIGRFAM: redox-sensitive transcriptional
FT                   activator SoxR; PFAM: Transcription regulator MerR DNA
FT                   binding; regulatory protein MerR; SMART: regulatory protein
FT                   MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73313"
FT                   /db_xref="GOA:D2S696"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D2S696"
FT                   /inference="protein motif:TFAM:TIGR01950"
FT                   /protein_id="ADB73313.1"
FT                   /translation="MDGLTIGQVAERSGMAVSALRYYEAQGLVTATRTAGGARRFPRSV
FT                   LRRLAFVRAAQNVGLTLPEIREALATLPDGRTPSGRDWARLSESWRERLDERIAALVQL
FT                   RDGLSSCIGCGCLSLTRCGLYNPGDVAGAEGPGARRLSPALRREPPTSNAG"
FT   gene            581120..581920
FT                   /locus_tag="Gobs_0532"
FT   CDS_pept        581120..581920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0532"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: msm:MSMEG_0043 extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73314"
FT                   /db_xref="GOA:D2S697"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:D2S697"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ADB73314.1"
FT                   /translation="MTVMPAAFLGHGNPMNAIEDNRYTRAWRVFGQAVPRPRAILVVSA
FT                   HWYLHATAMTAMPRPRTIHDFYGFPRELYDVDYGAPGLPELYEEVADVVHPTWVGADLD
FT                   SWGIDHGAWSVLRHAFPDADVPVVQLSVNALEPADHHLRLGAALAPLREDGVLVIGSGN
FT                   VVHNLAAVSRTMPDSGYDWAHRFDERVRELMLERPTEVAALDGHPDATLAVPTPEHLLP
FT                   LLYVAGIAGATGTTAELLVDGFTDGSLSMASYTVGMTPPVVDVG"
FT   gene            complement(581928..582200)
FT                   /locus_tag="Gobs_0533"
FT   CDS_pept        complement(581928..582200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0533"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: stp:Strop_3164
FT                   helix-turn-helix domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73315"
FT                   /db_xref="GOA:D2S698"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2S698"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB73315.1"
FT                   /translation="MSGDKSGDAVYNRIALLRAEQGVTRRELADALGVHYQTVGYLERG
FT                   EYNPSLHLALRIAEFFGLPVEVVFSTRPFPRISDAGTPEPPAAAG"
FT   gene            complement(582197..582667)
FT                   /pseudo
FT                   /locus_tag="Gobs_0534"
FT   gene            582691..583467
FT                   /locus_tag="Gobs_0535"
FT   CDS_pept        582691..583467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_5218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73316"
FT                   /db_xref="GOA:D2S699"
FT                   /db_xref="UniProtKB/TrEMBL:D2S699"
FT                   /inference="similar to AA sequence:KEGG:SGR_5218"
FT                   /protein_id="ADB73316.1"
FT                   /translation="MDVALALSGVLSLRTGIVVALVLEALFAVVLVVEAAAFRRAYRAT
FT                   RQRGAGRRTGLVAGAEAVWPPVLLRLVRAEAGVIRALWWAVRRRSAVGPDDVPLPYAGR
FT                   FGLVLGAVTALGVLETAVVHVLLPWEIARWVLLVVSFYGLVRVLGSGLSLFQHPHVLRD
FT                   GELVLRSGHLHPIAVPLAGLVSARRSTESEHGRTVVRNGDRLVLSVMGDTDVELRFDPP
FT                   VPVAGQDEPVARVAFWADDPQAVVRLLRDRAVPAGR"
FT   gene            complement(583560..584819)
FT                   /locus_tag="Gobs_0536"
FT   CDS_pept        complement(583560..584819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0536"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase;
FT                   siroheme synthase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: nca:Noca_2600
FT                   uroporphyrinogen-III C- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73317"
FT                   /db_xref="GOA:D2S6A0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A0"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADB73317.1"
FT                   /translation="MSATPVDPASGVVYPVGLRLLDREVVVVGGGQVAHRRVAGLLEAR
FT                   ARVTVVSPEVTPALEALVGPGAVTWVRRRYEAGDLDGAWYAVAATDDPVVNAAVAEEAE
FT                   RSRVFCARADDRSASSVWTPAVGRQGDLVVGVHGGGDPQRAVGVRDAVLAGLTDGTIRD
FT                   HAGREAPGGRPGSVVLVGGGPGDPGLITVRGQQAVSQADVVLADHLAPQSLLASLPADV
FT                   EVIDASKLPRGRYMAQEQINALLVEHARAGKRVVRLKGGDPFVFGRGMEELEACVAAGV
FT                   PVEVVPGVTSAIGVPGLAGIPVTHRGLTHEFVVVSGHVPPGHPQSLVDWAALGRLRGTI
FT                   VVLMGVDTAPAIAAALVEHGRAPETPVAVVADGSTPTQHAVRTTLAGLGKTLADEGIRP
FT                   PAVWVVGEVVRLTAGLAHPR"
FT   gene            complement(584893..585957)
FT                   /locus_tag="Gobs_0537"
FT   CDS_pept        complement(584893..585957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0537"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="KEGG: tfu:Tfu_2222 cob(II)yrinic acid a,c-diamide
FT                   reductase;
FT                   TIGRFAM:nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73318"
FT                   /db_xref="GOA:D2S6A1"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A1"
FT                   /inference="protein motif:TFAM:TIGR03160"
FT                   /protein_id="ADB73318.1"
FT                   /translation="MLGDTIAAIAPRDAAAERAARDRLDRMTKPPGSLGVLEDVAAQLS
FT                   GTAGTCPPPLPTPAAVAVFAGDHGVHAQGVTPWPQEVTAQMVANFARGGAVVNAFAAQL
FT                   GADVVVVDVGVATPYAVEPSPALLSRKVRHGTDDLAVGPAMTLEEAQRAVEVGIEVATE
FT                   LAAEHSCLVTGDMGITNTTASAALVCAFTGATSAAATGRGTGVDDPTLARKVEVVARAT
FT                   TRVPERPSTPEAALAALAEVGGLEHAALAGFVLGAAAARVPVLLDGVIAGSAALVAAAL
FT                   CPAALEHALAGHTSAEPGHGIALRALGLRPLLGLDLRLGEGTGALLALPLVASAARALR
FT                   EVATFDSAGVTEKS"
FT   gene            complement(586002..587078)
FT                   /locus_tag="Gobs_0538"
FT   CDS_pept        complement(586002..587078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0538"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II;
FT                   aminotransferase class V; KEGG: stp:Strop_3547 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73319"
FT                   /db_xref="GOA:D2S6A2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A2"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADB73319.1"
FT                   /translation="MDSVTDLDHHGDAELAPGLVDLAVNVRAGTPPSWLRAVLHEALDD
FT                   AAAYPDARPARAAVAAAHGRPADEVLLTAGAAEAFTLLARAVQPGRAVVVHPSFTEPEA
FT                   ALRAAGHPVERLLLEPPGYLLRDVPEDADLVVLGNPTNPTSVLHPAEDVAALARPGRVL
FT                   LVDEAFADTVPGEPASLAGRRDLPGLLVVRSLTKTWGLAGLRVGYALGPPELVAALATQ
FT                   QPHWPVSTPALAALVACTTPAARAEAEAAARALTGDRAALLAALPPVVEVVAAPRSSFV
FT                   LLRVPDGARVRAALRDRGWAVRRGDTFPGLSPDHLRVAVRDPATSVAFAADLAAILDPA
FT                   LPVTPAFRDLPRIPEEIR"
FT   gene            complement(587066..587488)
FT                   /locus_tag="Gobs_0539"
FT   CDS_pept        complement(587066..587488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa40800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73320"
FT                   /db_xref="GOA:D2S6A3"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A3"
FT                   /inference="similar to AA sequence:KEGG:nfa40800"
FT                   /protein_id="ADB73320.1"
FT                   /translation="MIVVGIGARPGVSVDEVLAAVDAVLPAGAEGVRLATLDARAAEPG
FT                   LVEAAVARGWPVTGHPAAALAAVTVPSPSSRVAAAVGTPSVAEAAALLDGGTLLVGRTV
FT                   VGRVTVAVAVSGQGREHRSEVRARSGAPRGSEPWTA"
FT   gene            complement(587485..588324)
FT                   /locus_tag="Gobs_0540"
FT   CDS_pept        complement(587485..588324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0540"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: sco:SCO5958 cobalt transport system ATP
FT                   binding protein; TIGRFAM: cobalt ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73321"
FT                   /db_xref="GOA:D2S6A4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A4"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /protein_id="ADB73321.1"
FT                   /translation="MSHRTLTAERLVAGYERGRRVLDGASLTVPAGRRLALLGANGSGK
FT                   TTLLRCLSGALEPVAGTVAVDGERLQHTRRGLRAHRQEVQLVLQDPDDQLFSASVAQDV
FT                   SFGPLNLGLPEDAVRGRVAEALALLGVGHLAGRPTHQLSYGERKRVAIAGAVAMRPCVL
FT                   LLDEPTAGLDPSAVAEALAALERLRASGSTVVMSTHDVDLALRWADDVAVVVDRAVVQG
FT                   APAEVLADDALLARARLDRPWALTVGARLRSLGLLPDGALPRDVASLLAALPEGVTP"
FT   gene            complement(588321..589055)
FT                   /locus_tag="Gobs_0541"
FT   CDS_pept        complement(588321..589055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0541"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   sco:SCO5959 cobalt transport integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73322"
FT                   /db_xref="GOA:D2S6A5"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A5"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADB73322.1"
FT                   /translation="MTGLAVDDAAWASAWRRRSPADKLLLCGGLVGCALALPAWPGSVL
FT                   VGLTAVVLALGPARVPARTFGRAVRWPLAFIAVGALTSVVTVGTGGLGWAPDAAARAGS
FT                   LAGHALAGSAAVLLLATTTPVSDLLPALRGLRVPAAVVEVAAVTYRLLFVLLASLHTIR
FT                   EAQTARMGYSTPARGWRSSGALAAAVLTRSWDRARRMQEGLAGRGMETGLRVLPEVLPS
FT                   SRAFLAASAAGLAAIVAVGLAA"
FT   gene            complement(589144..589449)
FT                   /locus_tag="Gobs_0542"
FT   CDS_pept        complement(589144..589449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0542"
FT                   /product="Cobalt transport protein CbiN"
FT                   /note="PFAM: Cobalt transport protein CbiN; KEGG:
FT                   pac:PPA0432 cobalt transport protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73323"
FT                   /db_xref="GOA:D2S6A6"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A6"
FT                   /inference="protein motif:PFAM:PF02553"
FT                   /protein_id="ADB73323.1"
FT                   /translation="MTRSRLVTALLVLGVLALVALPLVLDGGTAEFAGTDATAAELAEE
FT                   QGAQPWFESVFSPSSAEVESGLFALQAALGGGVLGYVLGRLRGRRLAERSREDGGT"
FT   gene            complement(589446..590126)
FT                   /locus_tag="Gobs_0543"
FT   CDS_pept        complement(589446..590126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0543"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; KEGG:
FT                   sco:SCO5961 cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73324"
FT                   /db_xref="GOA:D2S6A7"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A7"
FT                   /inference="protein motif:TFAM:TIGR00123"
FT                   /protein_id="ADB73324.1"
FT                   /translation="MHIAEGFLPATHAVGWTLAAAPFVVHGARQVVTEVRERPENTLLL
FT                   GAAGAFTFVLSAVKLPSFTGSSSHPTGTGAGAVLFRPPVMALLGTIVLLFQALLLAHGG
FT                   LTTLGANAFAMAVVGPWAGYGAYRLVRRLGGGLLPGVFAAMAVADLATYVTTAGQLALA
FT                   LPDAETGVAGALVKFLSVFALTQVPLAVGEGLLGVLLFRTLTVNARPELERLGLLAAAP
FT                   EPTR"
FT   gene            complement(590113..591498)
FT                   /locus_tag="Gobs_0544"
FT   CDS_pept        complement(590113..591498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0544"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: sgr:SGR_5641
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73325"
FT                   /db_xref="GOA:D2S6A8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A8"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ADB73325.1"
FT                   /translation="MTLPRVVVAAPSSNAGKTSVATGLVAALAARGLTVSPHKVGPDYI
FT                   DPGYTGLAAGRPGRNLDAVLVGEERVVPLFLHGARGADVAVVEGVMGLFDGATRPGLEP
FT                   GFASTAHVARLLRAPVVLVVDASAQAQSVAALVHGFATYDPTVRLGGVVLNRVGSDRHE
FT                   EILREALGGSGVPVLGAVRRMEALGTPSRHLGLVPAAERSAEALATVGRLGEVVAGAVD
FT                   LDAVLRLARTAPALDAVPWDPAAEVTPVERRPRIAVAGGAAFTFGYAENTELLEAAGAE
FT                   VVTVDPLRDEALPEGTTGLVVGGGFPEVHAADLSANDSLRADVAALAARGAPVAAECAG
FT                   LLYLARSLDGVPMCGVLATDAVMSARLTLGYREAVALSDSVLAPGGTRVRGHEFHRTVT
FT                   TPAAGSAPAWRWAGAEPEGFVSGSVHASYLHLNWAGSPALAERFAAACAAAALPEGARH
FT                   AHR"
FT   gene            complement(591584..592198)
FT                   /locus_tag="Gobs_0545"
FT   CDS_pept        complement(591584..592198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0545"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: mgi:Mflv_4049 cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73326"
FT                   /db_xref="GOA:D2S6A9"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6A9"
FT                   /inference="protein motif:TFAM:TIGR00708"
FT                   /protein_id="ADB73326.1"
FT                   /translation="MPQGQVSVVPQDGLTTRQRRNRPLLAVHTGEMKGKSTAAFGMAMR
FT                   AWNQGWSIAVYQFVKSAKWRVGEENALTALGRLHEQTGEGGPVVWHKMGSGWSWSRRQG
FT                   TEVDHAADAAEGWAQIKRDLAAEAHRFYVLDEFTYPLKWGWVDVDEVVETLTNRPGNQH
FT                   VVITGRDAPRALVEAADLVVEMTKVKHPMDAGQKGQRGIEW"
FT   gene            complement(592275..594299)
FT                   /locus_tag="Gobs_0546"
FT   CDS_pept        complement(592275..594299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0546"
FT                   /product="cobaltochelatase subunit"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: sco:SCO1850 chelatase; TIGRFAM:
FT                   cobaltochelatase subunit; PFAM: ATPase associated with
FT                   various cellular activities AAA_5; von Willebrand factor
FT                   type A; SMART: von Willebrand factor type A; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73327"
FT                   /db_xref="GOA:D2S6B0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012804"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="InterPro:IPR041702"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6B0"
FT                   /inference="protein motif:TFAM:TIGR02442"
FT                   /protein_id="ADB73327.1"
FT                   /translation="MTYPFGAVVGMDDMRLALLLNAVSPAVGGVLVRGEKGTAKSTTVR
FT                   ALSAVLPPVDVVAGCRFACDPAAPDPACPDGPHDAGAPGSTRPARLVELPVGASEDRVV
FT                   GSLDLERALTEGVKAFEPGLLAAAHRGVLYVDEVNLLHDHLVDLLLDAAALGTAYVERE
FT                   GVSVRHAARFLLVGTMNPEEGELRPQLLDRFGLTVEVAAPRDPVERAEVVRRRFAHDAD
FT                   PAGFAASWADEEAGLARRIAEARARLPHVVLSDDALRQVTAVCAAFDVDGLRADLVTAR
FT                   AAIAHAAWCGRDEVTEDDVRVAARLALPHRRRRNPFDAPGLDEETLEQALDDARPDDDP
FT                   PEGPDDGGGTPPPPPLGPSGDGGAPEAPGADDGTGSSPPSTAPRGEGGGSAEAAPAPDR
FT                   AAVAPGDPFRTRRLEVPGIGAGVAGRRSRARGDRGRVVGATRPSGTVTRLHLTGTVLAA
FT                   APHQVARGRTGPGLRIAREDLRQAVLEGREGNLVLFVVDASGSMGSRSRMTAVKGAVLS
FT                   LLLDAYQRRDKVGLVTFRGAEAELALPPTWSVEAAAARLTALPTGGRTPLAAGLLRAHE
FT                   TLRVERVRDAQRRPLLVVVTDGRATGARGSAAVADAHAAAALLAAQGTAAVVVDCESGP
FT                   VRLGLAGALGTALGAQTLRLEELAAESLAATVRSLREVA"
FT   gene            594537..594995
FT                   /locus_tag="Gobs_0547"
FT   CDS_pept        594537..594995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_03497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73328"
FT                   /db_xref="GOA:D2S6B1"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6B1"
FT                   /inference="similar to AA sequence:KEGG:CCNA_03497"
FT                   /protein_id="ADB73328.1"
FT                   /translation="MESDEAFDRDAARAELAALQSQRAALADRAMQPWWYDALLGLLLF
FT                   GFVSSYALHDNWVSLAAVVVFLLCLRGLVEVYERRTGFWVDAFRKGPTWRALAVWMAFA
FT                   LGVLLAGFAVDEHWGGAMVVAGAVLGVGVAVISRWWTRIYVAELRGER"
FT   gene            594992..595285
FT                   /locus_tag="Gobs_0548"
FT   CDS_pept        594992..595285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0548"
FT                   /product="transcriptional regulator"
FT                   /note="KEGG: gox:GOX1145 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73329"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6B2"
FT                   /inference="similar to AA sequence:KEGG:GOX1145"
FT                   /protein_id="ADB73329.1"
FT                   /translation="MTTVAPRFDAVIHPPPRLQVCGLLAAVDTMDFAAVRDTVGVSDSV
FT                   LSKHVKQLEEAGYVRVRKATRASRLRTSLALTEEGRAAFDAHVAELRRITGG"
FT   gene            595339..596406
FT                   /locus_tag="Gobs_0549"
FT   CDS_pept        595339..596406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0549"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   putative ammonia monooxygenase; KEGG: kra:Krad_3869
FT                   putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73330"
FT                   /db_xref="GOA:D2S6B3"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6B3"
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /protein_id="ADB73330.1"
FT                   /translation="MADAGRAARAADLALVVATALAVTLALDVLDLPSPSLFGGLVAGL
FT                   VRGLAGRRRLAVPRPATTAAQGLIGVSIGALVDLDTLEAIGRDWLPVLLVTVGTLLLSV
FT                   LAGLLMRLQPGVSPVTGAFAMVAGGASGITAMSRELGADERMVAVLQYLRVLLIVVLMP
FT                   VAAVALFGAEPGSGGTTVDDAGPGWPAGLLFAAVCLLAGTPLARLLRIPVPTLLGPLLV
FT                   AAGLDLGGLSGGADVPAPLGTAAFLVIGLVVGLNFDRDSLRTVGRAMPLALAVILGLVA
FT                   ACAGLGAVLAATTGASALDAYLATTPGGLYAVLATAQDGGADATFVLAVQVLRLFVMLL
FT                   SAPLLARWLRRSEGG"
FT   gene            596501..596812
FT                   /locus_tag="Gobs_0550"
FT   CDS_pept        596501..596812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sen:SACE_5636 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73331"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6B4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73331.1"
FT                   /translation="MPRRPSAPTLDRVSEEVRELSEDQTGADAGTQDAVLLFVGGPLDG
FT                   RVEIREARHGEPLPTVTHVHLHGGPKVVHRYDLTPLGPQAGVYHLRPRQMVRDQSVAE"
FT   gene            596887..597360
FT                   /locus_tag="Gobs_0551"
FT   CDS_pept        596887..597360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kra:Krad_1943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73332"
FT                   /db_xref="GOA:D2S6B5"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6B5"
FT                   /inference="similar to AA sequence:KEGG:Krad_1943"
FT                   /protein_id="ADB73332.1"
FT                   /translation="MTGDPLLLLHVTAGTAGLLLGPVWLVARLAGARARGPAGAYQAAV
FT                   AGVAASGAVLAVSAPGLGWLLPVAVATEALAVTGALARRQAWPHWRTLQPHLLGGSYIA
FT                   LVTGLLVASTGNPVWWVLPALVGQAPIAVAKRRLHGAAVAAPVAQVRRSTSAR"
FT   gene            complement(597330..598073)
FT                   /locus_tag="Gobs_0552"
FT   CDS_pept        complement(597330..598073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0552"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; methyltransferase
FT                   small; Methyltransferase type 12; KEGG: fre:Franean1_4877
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73333"
FT                   /db_xref="GOA:D2S6B6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2S6B6"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB73333.1"
FT                   /translation="MDAAEVFRALHGDLPREGVGSDATTRTLLELTAPLPASRRALDIG
FT                   CGPGRASLVLAGAGVRVTAVDLHEPFLRRTRSAAQDAGLAGRVAVERASMTALPHPDGT
FT                   FELLWCEGAAYLMGVDRALHEWRRLLRPGGALVLTDAVWTTAAPSAEARRFWARYPAMR
FT                   DEAALVGAARSAGWEVLATHLLPDADWTDEYHRPLAAAIDAVIEALPDPDPGTAAVLAE
FT                   ARSEVEVRRAHRDEFGYLALVLRRT"
FT   gene            complement(598079..598696)
FT                   /locus_tag="Gobs_0553"
FT   CDS_pept        complement(598079..598696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kra:Krad_3034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73334"
FT                   /db_xref="GOA:D2S734"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="UniProtKB/TrEMBL:D2S734"
FT                   /inference="similar to AA sequence:KEGG:Krad_3034"
FT                   /protein_id="ADB73334.1"
FT                   /translation="MCHTEHPTSTTRPTRTVPGMAGPSLPRVLRSLLRAVVRPPATRPG
FT                   PPAARHRPPAARPAPSVARGPGGPVRDLTGGLDGVDLAFRPQDDGEPDPGEVVWAWVPY
FT                   DEGDGRGKDRPVLVVGRRGADLVGLMLSSQDHDRDAADEARHGRTWMDVGRGGWDPRGR
FT                   PSEVRLDRLLLLPPGSARREGAALGRAVFDDVVTALHALHRR"
FT   gene            598797..598994
FT                   /locus_tag="Gobs_0554"
FT   CDS_pept        598797..598994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73335"
FT                   /db_xref="UniProtKB/TrEMBL:D2S735"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73335.1"
FT                   /translation="MTSAEPLPPALPRGREVKASVLAAFQLVEDARYLGTGRRSRRGRR
FT                   RAIAERTVAYRRLARDLRVG"
FT   gene            complement(599039..599464)
FT                   /locus_tag="Gobs_0555"
FT   CDS_pept        complement(599039..599464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_46760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73336"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:D2S736"
FT                   /inference="similar to AA sequence:KEGG:RER_46760"
FT                   /protein_id="ADB73336.1"
FT                   /translation="MATDIQIVIDSADPHGQADWWAEVLGWQVEPQDEAFIRRMVTTGA
FT                   ATEADTTTHRGALVWRSGAAITSPDPDRPRVLFQLVPEAKTVKNRVHLDVHVGADGRED
FT                   EVGRLLGLGATELHRASQGPFEWVTLADPEGNEFCVA"
FT   gene            complement(599553..600152)
FT                   /locus_tag="Gobs_0556"
FT   CDS_pept        complement(599553..600152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0556"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: bbt:BBta_6238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73337"
FT                   /db_xref="GOA:D2S737"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024029"
FT                   /db_xref="UniProtKB/TrEMBL:D2S737"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADB73337.1"
FT                   /translation="MDTAPDVLAGYRPPSRLVQDKVVDHLDRHCRAFIALSPFATLSTA
FT                   GADGWPDVSPRGGDPGFARVLDERTLALPDRQGNNRVDSLRNTVGNPRAALLFFVPGFE
FT                   ETLKVFGTTTLVGPDDVGVDLTEFGRPPRSVLVLTVERAYFQCGKAVMRSGLWDPQRQV
FT                   ERSTFPSLGEVMRDHCGLSTPLPGQEEMRAELAQEL"
FT   gene            600186..600575
FT                   /locus_tag="Gobs_0557"
FT   CDS_pept        600186..600575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0557"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mva:Mvan_3023 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73338"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2S738"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADB73338.1"
FT                   /translation="MAARWSSPVRYVECDQQGVVFNAHYLTWADEASNAWWAAHGLPWD
FT                   ELVARGVDPVVKASSLEWSSSARFGDTVTVDAETGKVGRTSVTVRFTVRVGERLCCVVS
FT                   TTYVCLTEAGKAPWPDDVRARITGG"
FT   gene            complement(600562..602097)
FT                   /locus_tag="Gobs_0558"
FT   CDS_pept        complement(600562..602097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0558"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: CobB/CobQ
FT                   domain protein glutamine amidotransferase; Cobyrinic acid
FT                   ac-diamide synthase; KEGG: sco:SCO1848 cobyric acid
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73339"
FT                   /db_xref="GOA:D2S739"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D2S739"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ADB73339.1"
FT                   /translation="MSGTVPRRPASGGALLVAGTTSDAGKSVVTAGICRWLVRQGVSVA
FT                   PFKAQNMSNNSMVTPDGAEIGRAQVMQAAAARVEPEAAMNPVLLKPGGEDSSQVVVLGH
FT                   AVADVTALSYRPMKAALMEQVLASLEDLRSRFDVVVCEGAGSPTEINLRADDIANMGLA
FT                   TAAGLPVVVVGDIDRGGVFPALYGTVALMPPADQRLVAGFLVNKFRGDVRLLGPGLEQL
FT                   TALTGRPTLGVLPWLPGAAVDVEDSLGVPTGASPTGPPHGEEVLRVAVARLPRLSNFTD
FT                   LDALAAEPGVLVRYATSPEELGDADLVVLPGTRATVADLGWLRATGLADAVARHAAAGR
FT                   PVLGVCGGSQMLARTITDDVESRAGTVPGLGLLPADVRFAPEKTLGRPVGTAFGQEVRG
FT                   YEIHHGVVIVDDAAERFLDGARAGSVFGTTWHGALEGDGFRRAFLTEVARVAGRRFVAA
FT                   PDTDFAAVRERRLDALGDLVAEHADTDALWRLVEDGVPAGLPLLPPGDGLSPR"
FT   gene            complement(602094..602753)
FT                   /locus_tag="Gobs_0559"
FT   CDS_pept        complement(602094..602753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0559"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: nca:Noca_1494
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73340"
FT                   /db_xref="GOA:D2S740"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D2S740"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADB73340.1"
FT                   /translation="MLYVVVRFLLRPLFHVVLRMHVTGRENVPATGPVILASNHLSFID
FT                   SMVIPLSAPRRVHYLAKAEYFTGTGIGGWLTRTLFTALGAMPVQRQTSRAAQEALDTAL
FT                   AVLRRGEGFGIYPEGTRSRDGRLARGKTGVAWLALTADCPVVPVAVHGTDRVQPVDSRW
FT                   PRPHKVSVTFGEPLTFPEQRGMARNGRARRVVTDRVMEAIAELSGQEKAGWGQPAA"
FT   gene            complement(602859..603593)
FT                   /locus_tag="Gobs_0560"
FT   CDS_pept        complement(602859..603593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0560"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: ANTAR domain protein; PAS fold-3 domain
FT                   protein; KEGG: nfa:nfa20280 putative transcription
FT                   antitermination regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73341"
FT                   /db_xref="GOA:D2S741"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2S741"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ADB73341.1"
FT                   /translation="MTATHPPALTRSTAPRNRPTPQPARSASPRRLAGRYRYDRRAGTW
FT                   TWSPEMSALLNLARNGAHPCTELLARSIHPGDRPRVLDAIAGACSAGVPFALRVRLGSR
FT                   GGAERPAVLVGEPVVDAAGAVDALEGVLVELPPEPRPPAARPGGGESEDDRVQALETEV
FT                   TQLRTAMSSRAAIEQAKGILMLLTSCGEQVAFDLLAHISSNSHRKVRDVAVAIVESAAG
FT                   HAGLPEDIQTLMRDVCPPRPHS"
FT   gene            complement(603830..604786)
FT                   /locus_tag="Gobs_0561"
FT   CDS_pept        complement(603830..604786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0561"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: stp:Strop_3555
FT                   cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73342"
FT                   /db_xref="GOA:D2S742"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D2S742"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ADB73342.1"
FT                   /translation="MCRVLPPRDLPTAAGLALGAAADLLLADPRRWHPVAGFGRAAAAL
FT                   ERRTWRDSRTAGVAHAGLLTGAAAALGVALDRATRGRPRARTLVTAAATWAVLGGTSLG
FT                   RAGTAMVRTLDAGDLPAARALLPTLAGRDPAGLEVPELARATVESVAENTSDAAVAPLV
FT                   WGALAGLPGLLGYRAVNTLDAMVGHRSPRYARFGWASARADDVANWLPARLTAALTVAT
FT                   APLAGGSARGAWRVWHRDGAAHPSPNAGRCEAALAGALDLRLGGRNVYGSRVEDRPVLG
FT                   SGRTPSARDVPRAVRLSRAVWTAAAALAAAARALPRP"
FT   gene            604822..605379
FT                   /locus_tag="Gobs_0562"
FT   CDS_pept        604822..605379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0562"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: kra:Krad_0402 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73343"
FT                   /db_xref="GOA:D2S743"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:D2S743"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ADB73343.1"
FT                   /translation="MRLPGRYSGVARPIVTYGSNPVLHRPCAPVTAFGKDLRRLVLDMF
FT                   ASMEAADGVGLAANQIGVDARVFVIDCPDADGEDVVGYVVNPELTVLEPREGEPAEEVT
FT                   DEGCLSVPGPYAELPRAFRARVDGVDADGAPVSIEATGMAARCLQHEVDHLDGTVYVDR
FT                   LPGDLRERLLAEAAGPVGELPA"
FT   gene            605376..606620
FT                   /locus_tag="Gobs_0563"
FT   CDS_pept        605376..606620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0563"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: sen:SACE_5944 precorrin-6Y C(5,15)-
FT                   methyltransferase (decarboxylating); TIGRFAM: precorrin-6y
FT                   C5,15-methyltransferase (decarboxylating), CbiE subunit;
FT                   precorrin-6Y C5,15- methyltransferase (decarboxylating),
FT                   CbiT subunit; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Methyltransferase
FT                   type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73344"
FT                   /db_xref="GOA:D2S744"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2S744"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADB73344.1"
FT                   /translation="MSTPVVVVGIGADGWDGLSPRARRAVEDADVLRGSARQLALVPDD
FT                   VPAERVPWPSPMAPALAGLLDAHPGRRVVVLASGDPMLSGVGASLVRLHGAGAVEVLPH
FT                   PSSVTLACARLGWAVEDTQVVSVVGRPVDLVAAHATPGRRLLVLGSDGRTPAEIARLLA
FT                   GHGYGASRVVALAQLGGPAERSFRGTAAGWSHAGTDPLVVTAVEVVADPGTEPLPAVPG
FT                   LPDGAYAHDGQLTKRDVRAVTLARLAPVPGQLLWDVGAGAGSIGIEWMRVHPSCRAVAV
FT                   ESSAERARRIAENAARLGVPGLQVVEGRAPAALDRLPEPDAVFVGGGLTSEGLLETCWA
FT                   ALRPGGRLVANAVTIEGEAVLAAWRSRAGGELIRLSVAHAAPVGGYTGWRPAMPVTIWS
FT                   AVRPAVPAGTAGGVA"
FT   gene            606617..607357
FT                   /locus_tag="Gobs_0564"
FT   CDS_pept        606617..607357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0564"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="KEGG: sen:SACE_5945 precorrin-4 C11-
FT                   methyltransferase; TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73345"
FT                   /db_xref="GOA:D2S745"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2S745"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADB73345.1"
FT                   /translation="MTVHFIGAGPGAADLVTLRAARLIASAPVCLYAGALVPRELLDTA
FT                   PAGARLVDTADLDLDQITAELVAAHEAGLDVARLHSGDPSIWSAVAEQMRRLDAAGVPY
FT                   EVVPGVPAFAAAAAALKRELTVPGVAQTVVLTRTSARSTPMPPGEELAAYAATGATLVL
FT                   HLAVQRIAELAPELAEHYGDDGPVAVVARASRDDELVLRGTLADIAGQVEAAGVKRTAV
FT                   VVVGPVLAAAEFPDSHLYSTTRAR"
FT   gene            complement(607480..608571)
FT                   /locus_tag="Gobs_0565"
FT   CDS_pept        complement(607480..608571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0565"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   sen:SACE_5949 cobalt-precorrin-6A synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73346"
FT                   /db_xref="GOA:D2S746"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:D2S746"
FT                   /inference="protein motif:TFAM:TIGR00312"
FT                   /protein_id="ADB73346.1"
FT                   /translation="MTEAGREGSTGLRYGWTTGACATAATTAAYTALLTGEFPDPVQID
FT                   LPHDKHPSFALATERLEDGAATVGVVKDAGDDPDVTHGALVSARVTHGERGSGVVFRAG
FT                   EGVGTVTKPGLPLPVGEPAINPMPRQFVREHVTAVAARYGGTGDVVVEVSVENGAELAR
FT                   RTWNPRLGILGGLSILGTTGVVVPYSCSSWIDSIRRGIDVARAAGHLHVAGCTGSTSER
FT                   VVTELYGLPEDALLDMGDFAGAVLKYLRRHPVPRLTVAGGIGKLAKLADGHLDLHSGRS
FT                   QVSTESLAAMVRDAGGAAELVEGVRGANTALDALQQCQAAGLPLGDLVAAGARRTALGV
FT                   LRGAPVEVDVVVIDRAGTVVGQA"
FT   gene            608598..609359
FT                   /locus_tag="Gobs_0566"
FT   CDS_pept        608598..609359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0566"
FT                   /product="precorrin-6x reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="KEGG: sen:SACE_5950 precorrin-6A reductase; TIGRFAM:
FT                   precorrin-6x reductase; PFAM: Precorrin-6x reductase
FT                   CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73347"
FT                   /db_xref="GOA:D2S747"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D2S747"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ADB73347.1"
FT                   /translation="MTGRVLVLGGTAEARRLAERLVAEGIDVLSSLAGRVADPVLPPGE
FT                   VRIGGFGGTAGLVAALDGVAALVDATHPFAATMTAHAAAAAAVTGTPLLRLQRPGWTAQ
FT                   PGDDWRWVDSLEQAATAVAGARSVLLTTGRQGLAAFAGLSAHCVVRSVDPPEPPLPVRA
FT                   TVVLARGPFGVEEERALMTAHDVDVVVTKDSGGPMTAAKLTAARELGVPVVLVRRPPLP
FT                   GGVPVAATVDQAAAWLRERGTTGRPATPSRP"
FT   gene            complement(609310..609696)
FT                   /locus_tag="Gobs_0567"
FT   CDS_pept        complement(609310..609696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_2014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73348"
FT                   /db_xref="GOA:D2S748"
FT                   /db_xref="UniProtKB/TrEMBL:D2S748"
FT                   /inference="similar to AA sequence:KEGG:Mflv_2014"
FT                   /protein_id="ADB73348.1"
FT                   /translation="MTRTRDTTVVTPPSTIRPVQAAAALALLVLFWQFLSAGRIMVGED
FT                   ATGGHGAGAIALHVTTGLLLAATALHGRRTRVWWPAALAAAVFVLTFVQAALGSSGSIA
FT                   THVPLALVITVGTVWLAARSFRAP"
FT   gene            609738..610418
FT                   /locus_tag="Gobs_0568"
FT   CDS_pept        609738..610418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0568"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ach:Achl_1821 haloacid dehalogenase domain
FT                   protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73349"
FT                   /db_xref="GOA:D2S749"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2S749"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADB73349.1"
FT                   /translation="MEAADHSPHQGLTRRLVLFDLDGTLVDSTPGIWASVRAAAAALGL
FT                   PEPTPEQLRGMVGPPLQDGFALVLGVPPDDVPRAVAAYRAHYSAGALLDAAVYPGIPGL
FT                   LTALVDAGATLAVATSKPEPFAVRLLAHAGLLPAFASVHGATFDGTVRHKDQVVAAALA
FT                   AHPDGERPVLVGDRAHDVLGAAAHGLPCIGAGWGPAPPGELADAGAAVVAATPAEVRTA
FT                   LQRT"
FT   gene            610486..611124
FT                   /locus_tag="Gobs_0569"
FT   CDS_pept        610486..611124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0569"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: sfu:Sfum_2512
FT                   ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73350"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2S750"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ADB73350.1"
FT                   /translation="MLSNERAGTRSDVVLYATDTMADWEYSYVTAGLAMAAEQGAESFR
FT                   LRVLADGQSEVTTKGRLRLRADADLGEVDPEDVALLVLPGADTWSDGHEKVLDLARVLL
FT                   ERHTPVAGICGATYGLARAGLLDDRAHTSNAPDFLVPSGYAGAARYRDERVVEDGDVIT
FT                   APATAPVDFGAAVFRRLELFPPATIDAWYGLYTTGERRWFDALVGRSTA"
FT   gene            611156..611704
FT                   /locus_tag="Gobs_0570"
FT   CDS_pept        611156..611704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0570"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="SMART: regulatory protein MarR; KEGG: sma:SAV_4553
FT                   MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73351"
FT                   /db_xref="GOA:D2S751"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2S751"
FT                   /inference="protein motif:SMART:SM00347"
FT                   /protein_id="ADB73351.1"
FT                   /translation="MGEPGVPGGDHPVRTPAGDALTDLVLPVFELNGEFLAAAETMTGP
FT                   VGLTPAWWQVLGATLDEALPVAEIARRVGLGLARQSVQRVADLLVEHGWAVYSDNPAHR
FT                   RAKLLAPTPQGRSALRRLTSAQHRWADTVAEAVGEEELRRALATIRKVIDSSREYRDGL
FT                   AGGGVPPADVTTTREPETG"
FT   gene            611767..612258
FT                   /locus_tag="Gobs_0571"
FT   CDS_pept        611767..612258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0571"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa31350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73352"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="UniProtKB/TrEMBL:D2S752"
FT                   /inference="similar to AA sequence:KEGG:nfa31350"
FT                   /protein_id="ADB73352.1"
FT                   /translation="MHALTEKQVRRSLVNCSRSEAESMTLPRTFAETPWEELVVLGWRD
FT                   PRAPLRGYLVVEREGRPVGVAVRAADTRMSSGTPAMCLLCQTAQAGSDVSLFTARRAGE
FT                   AGRNGNTVGTYVCADLACAVRARVEIPPWLRERDPEEVAAERTAELEQRVHGFLDAVLR
FT                   "
FT   gene            complement(612418..613662)
FT                   /locus_tag="Gobs_0572"
FT   CDS_pept        complement(612418..613662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0572"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   fra:Francci3_2282 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73353"
FT                   /db_xref="GOA:D2S753"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2S753"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADB73353.1"
FT                   /translation="MRTRRAGLRCCVPARRASRAVSFWTAAALLVLVLAASGVPSPLYR
FT                   VYQERFGFSAGVLTTVFGIYALALLATLLVVGALSDHVGRRPVIVAGMLLQVVAMALFW
FT                   AADSVGWLLAARVVQGLSVGSLTGALGATLLDHQRSDRPLGALVNSASPGFALALGAVS
FT                   AGLSVEFVPAPTDWVFGTLTALFAVAAGVALLLPESSPRIPGALASLWPRVHVPAAQRV
FT                   PFLVVAPCLVAMWALGGLYLSLGPSVAAGVFGLEDHLVGSLVIVAMQGMGAVGGITLRN
FT                   TAPHTAMTTGCLVFAAGVSGTIVSLATGSAALFFAAAVVSGFGFGAAFLGAVATVTAGV
FT                   APGERGGLLSSVFVVGYLAFSIPAVAAGLASGAVGLRPTAAVYGVAVIVLALAAVAGLL
FT                   RHRRAAERRPEPVAV"
FT   gene            complement(613689..614858)
FT                   /locus_tag="Gobs_0573"
FT   CDS_pept        complement(613689..614858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0573"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: fal:FRAAL3579 putative FMN-dependent
FT                   alpha- hydroxy acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73354"
FT                   /db_xref="GOA:D2S754"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023989"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:D2S754"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ADB73354.1"
FT                   /translation="MASTRDWFETVEEAQHRARKRLPRSVYLALVAGTEKGLTAGDNVA
FT                   AFDEITWRPHVADLHAKRETATTVMGQEVSMPVLVSPTGVQAVHPDGEVAVARAAAAED
FT                   VAMGLSSFASKPVEEVGAAHSKLFFQMYWVGSRETILARADRARAAGAKGLIMTLDWSF
FT                   ASRRDWGSPPIPDKIDLKNAVKFAPEVLRKPRWLATYLRSGGIPELSVPNLALGGEEPP
FT                   NFFGAYGQWMGTPLPTWEDVAWLRQQWGGPFMLKGITRPDDARRAVDAGVSAISVSTHG
FT                   GNNLDGTPGAIRSLPGVVDAVGDQVEVVMDGGVRRGSDVVKAMALGARAVMIGRAYLWG
FT                   MAASGERGVQNVLSILRQGIDEALLGLGKASVHDLTREDVVLPPHFTRD"
FT   gene            complement(614991..616562)
FT                   /locus_tag="Gobs_0574"
FT   CDS_pept        complement(614991..616562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0574"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase;
FT                   precorrin-2 C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   sen:SACE_5951 precorrin-3B C17- methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73355"
FT                   /db_xref="GOA:D2S755"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D2S755"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADB73355.1"
FT                   /translation="MTGRLYGVGLGPGDPELVTVKAARLIAAADVVAFHAAQHGRSVAR
FT                   AVAAPYLRAGQVEELLVYPVTTGTTDHPGGYQGAIDEFYEAAAARLAAHLDAGRDVVVL
FT                   AEGDPFFYGSYMHMHKRLAHRYPTEVVPGVTSVSGAAAAVGRPLVERDEVLTVLPGTLP
FT                   AEELAEWLATTDAAAVLKLGRTFGNVREAFDAAGVLDRALYVERASTDRQRTLPLADVD
FT                   PATVPYFSLALLPSPLTGPVPGSAQHDEAAPRTGEVVVVGLGPGARCWTTPEAAEALAA
FT                   ADDLVGYGPYLDRVPANPRQTRYPSDNRVEAERAAHALDLARSGRRVAVVSSGDPGVFA
FT                   MAAAVLEVAERPEYAGVPVRVLPGLTAAQAVAARVGAPLGHDFAVVSLSDVRKPWDVVV
FT                   DRLRHASAADLVLALYNPRSKARPHQLAEAQQVLLEGREPDTVVVVGRDVGGPEESIRI
FT                   TTLGELDPETVDMRCCVVVGSSQTRVSRTGAVYSPRTHEGPRPPREGPPCPPPLASSRR
FT                   DPAREP"
FT   gene            complement(616559..617179)
FT                   /locus_tag="Gobs_0575"
FT   CDS_pept        complement(616559..617179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0575"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   sco:SCO3282 precorrin-8X methylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73356"
FT                   /db_xref="GOA:D2S756"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D2S756"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADB73356.1"
FT                   /translation="MYEYEKDGAEIYRRSFATIRAETDLTGLPEDVARVAVRMVHACGQ
FT                   VDLVEDLAYSPAVVARAREALDAGAPVLCDAEMVASGVTRRRLPEDNEVVCTLNDPRTP
FT                   ALAADLGTTRTAAALELWRDRLDGAVVAIGNAPTALFHLLEMVAAGAPRPAAVLGIPVG
FT                   FIGAVESKDALAASGLEHLVVRGRRGGSAITAAAVNAIASDVE"
FT   gene            complement(617179..618348)
FT                   /locus_tag="Gobs_0576"
FT   CDS_pept        complement(617179..618348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0576"
FT                   /product="precorrin-3B synthase"
FT                   /note="TIGRFAM: precorrin-3B synthase; PFAM:
FT                   nitrite/sulfite reductase hemoprotein beta- component
FT                   ferrodoxin domain protein; KEGG: nfa:nfa31400 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73357"
FT                   /db_xref="GOA:D2S757"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR012798"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D2S757"
FT                   /inference="protein motif:TFAM:TIGR02435"
FT                   /protein_id="ADB73357.1"
FT                   /translation="MTARATPAARVRADACPGALQTHAAADGALARVRVPGGLLTGDQL
FT                   RSLAAAARDLGDGALELTSRGNVQLRGLAAGAAAELGDRLAAAGLLPSATHERVRNVLA
FT                   SALTGRAGGHVDVRPWVRALDAAVCADPALAALPGRYLATLDDGRGDVAGLGGDVGLLT
FT                   LSPAEVALTLAGADSGLRAHPDDAVALALAATRAFLAERTAQGGTAWRLAELDDGAIRV
FT                   GARLDGRRGVAVDVPPVPVPGPVGAAPQHDGRVALVAVVPLGRLDAAQAELLARLADEV
FT                   QLTSWRSIVVPDLAEDAVDDAAVALHRTGMVFDAASPWTRVTACAGRPGCAKSLADVRA
FT                   DAAAAVATGTLPVDGARQHWAGCERRCGRPQGEVVDVVATGTGYRVGKG"
FT   gene            complement(618404..619114)
FT                   /locus_tag="Gobs_0577"
FT   CDS_pept        complement(618404..619114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_1735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73358"
FT                   /db_xref="GOA:D2S758"
FT                   /db_xref="InterPro:IPR025492"
FT                   /db_xref="UniProtKB/TrEMBL:D2S758"
FT                   /inference="similar to AA sequence:KEGG:SACE_1735"
FT                   /protein_id="ADB73358.1"
FT                   /translation="MALRLHLPHRTKPSSGPAGDPHLGARVFAVQRAGAVLVALVLLVF
FT                   GLLGFADNLDYFSTEGERILGLSSNGLLSTISVVVALVLLAAAARSPRTVSTVMLVIGA
FT                   LFLLSALVNLAVLRTSFNLLAFEFENVVFSVVVGLLLLTLGAYGRISGHLPADSPYARL
FT                   RPGDDEDIDLTSDLPSTPAEVEAERAMREAEVAVVQHVATNDQRRRVAAMASQHSRADR
FT                   RRVWMSFDDAHRLG"
FT   gene            619233..619553
FT                   /locus_tag="Gobs_0578"
FT   CDS_pept        619233..619553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0578"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73359"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D2S759"
FT                   /inference="similar to AA sequence:KEGG:Tfu_2133"
FT                   /protein_id="ADB73359.1"
FT                   /translation="MTQRDLHSEFLRADLFLAMGRPIEAARLLQPLVEAEPANEAALEL
FT                   LARSYFGSAQLARAEEALTRLVEMAPANGWARRALARTLERQSRAGEAVAHHRVADALG
FT                   AG"
FT   gene            complement(619557..620429)
FT                   /locus_tag="Gobs_0579"
FT   CDS_pept        complement(619557..620429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0579"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: saq:Sare_0041 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73360"
FT                   /db_xref="GOA:D2S760"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2S760"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADB73360.1"
FT                   /translation="MVDRDTPSVRERRLARELRQLRTGLHLHAKEVAARLGWSPSKVSR
FT                   IETARTGITADDLDRLLELYRVPDDHADLLRRLAPSARPRGWWDAYADTLSAGYANLIR
FT                   LEAGSRALRCFGALVPHALLQTPDYVRQVVLSTWERPAPPEVERRVQVCRRRQEVLDAA
FT                   DPMQLWAVLDESVLHRAAGAPGTSDGATVLRGQLEWLAEVAGRPNVTLQVLPFDAGLPP
FT                   VTAGSFSVLESRATGTPDVVYLENKTRIGFVDGEAEVHRYGRAFELLTEMALDPDASVD
FT                   LIRRLAADQ"
FT   gene            620548..621216
FT                   /locus_tag="Gobs_0580"
FT   CDS_pept        620548..621216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2019 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73361"
FT                   /db_xref="InterPro:IPR026467"
FT                   /db_xref="UniProtKB/TrEMBL:D2S761"
FT                   /inference="similar to AA sequence:KEGG:M446_2019"
FT                   /protein_id="ADB73361.1"
FT                   /translation="MTGTHVPLLRSDLYEIAYLAGGPRRVVETAVVALVENGRLRVDRA
FT                   TGRLHVVDPHRRHPVEAVVLDAVGPRGRSVWGLVWRARSDPRLATVADGLARDGLLTRR
FT                   GGVGAREPSFWTLSGLTRAGRAALRQVRQSPPFPTGTGGNPALAVALAGPSAWDAELHT
FT                   AVFDPPPPYLLTPPGQSVREVRRSRSGAYAHGGSGGWAGGGWGGDCGGGGGGGGGDGGC
FT                   "
FT   gene            621377..621631
FT                   /locus_tag="Gobs_0581"
FT   CDS_pept        621377..621631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73362"
FT                   /db_xref="GOA:D2S762"
FT                   /db_xref="UniProtKB/TrEMBL:D2S762"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73362.1"
FT                   /translation="MAKPAKPAKKPGHLYNAAGWFISGLLVAGIAWDVRQPNNVEWNDD
FT                   AWWPLFGLAAIGCWLMAVRALSLWARERQAAEDAGKGAA"
FT   gene            621628..621759
FT                   /locus_tag="Gobs_0582"
FT   CDS_pept        621628..621759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73363"
FT                   /db_xref="UniProtKB/TrEMBL:D2S763"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73363.1"
FT                   /translation="MSVIGEVRDAAVERARAAKERKVQAATGTDDEAGTDLLAVVEG"
FT   gene            622040..625660
FT                   /locus_tag="Gobs_0583"
FT   CDS_pept        622040..625660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0583"
FT                   /product="cobaltochelatase, CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: sen:SACE_5955 cobaltochelatase subunit CobN;
FT                   TIGRFAM: cobaltochelatase, CobN subunit; PFAM:
FT                   CobN/magnesium chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73364"
FT                   /db_xref="GOA:D2S764"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:D2S764"
FT                   /inference="protein motif:TFAM:TIGR02257"
FT                   /protein_id="ADB73364.1"
FT                   /translation="MPLVFTLLSTSDTDLLSARASGADWRLGNPARLDDAGTAALTEGA
FT                   DLVVVRLLGVRRQYEELLAPLLAGPAPVVVLGGEALPDAELMELSTVPMGVATEAHGYL
FT                   AQGGPDNLVQLHRFLSDTVLLTGEGFEPPVVAPDWGVLERQSRGTGPTVAVLYYRAHHL
FT                   AGNTAFVEALCTAVEDAGGSALPVFTSSLRNVSHELLGTLRGADALVVTVLAAGGSRPA
FT                   TAQAGGDDGAWDVGALASLDVPVVQGLCLTRSREEWLADDDGLSPLDVGNQVAIPEFDG
FT                   RLISVPFSFKETDEDGLSTYVADPERAARVAGTAVAHARLRHTPPADRRIVVMLSAYPT
FT                   KHARIGNAVGLDTPASVVRLLAAMSGAGYDVGPFDGPDALPGVADLDGDALVHALIAAG
FT                   GQDADWLTEEQLSGNPVRIPAAEYRAFFDTLPADLRDAMVEHWGQPPGALFVDGSGNDQ
FT                   AIVFAALRAGNVVVMVQPPRGFGENPIAIYHDPDLPPSHHYLAAYWWLRSVFGAHALVH
FT                   VGKHGNLEWLPGKTVGLSASCAPDAAIGDLPLVYPFLVNDPGEGSQAKRRAHATLVDHM
FT                   VPPMARADSYGDIARLEQLLDEHANVAAMDPAKLPAVRAQIWTLLQAARLDHDLGLSER
FT                   PEDDHFDEMVLHVDGWLCEIKDSQIRDGLHVLGTPPSGQDRVDLVLAMLRARQIWGGAV
FT                   ALPGLREALGLPEGASRTETDVVEARAEALVAAMETAGWVPDAVQSVVAEVLGRSDEGV
FT                   EAVLRFAVDEVVPRLERTTDEMDATLHALEGGYVPAGPSGSPLRGLVNVLPTGRNFYSV
FT                   DPRAIPSRLAWETGSAMADSLVERYLADTGSYPASVGLSVWGTSAMRTSGDDVGEVLAL
FT                   LGVRPVWDDASRRVTGLEPVPLEELGRPRIDVTVRISGFFRDAFPHVVTMLDDAVTLVA
FT                   ALDEPADRNFVRAHVDADVAGHGDRRRATTRVFGSKPGAYGAGLLPLIDSRNWRGDADL
FT                   AEVYAVWGGYAYGRGLDGVQARPDMEAAYRRIAVAAKNVDTREHDIADSDDYFQYHGGM
FT                   VATVRALTGSAPRAYIGDSTRPESVRTRSLTEETARVFRARVVNPKWLQAMRRHGYKGA
FT                   FELAATVDYLFGYDATTGVVADWMYEKLAQTYVLDPENRAFLEQSNPWALHGIAERLLE
FT                   AVDRKMWAEPDASLLAELQQAYLDTEGDLEGGETPASSRS"
FT   gene            625701..625925
FT                   /locus_tag="Gobs_0584"
FT   CDS_pept        625701..625925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0584"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73365"
FT                   /db_xref="UniProtKB/TrEMBL:D2S765"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73365.1"
FT                   /translation="MSILGRLMGTAENTARSAGRSAGRSGRGMPRSTGRMSTGRGYGRT
FT                   TTGRAGRGRATPAASGGLGGLLGGLLRRR"
FT   gene            complement(626038..626775)
FT                   /locus_tag="Gobs_0585"
FT   CDS_pept        complement(626038..626775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0585"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /note="PFAM: cobalamin-5-phosphate synthase CobS; KEGG:
FT                   sgr:SGR_5332 putative cobalamin 5'-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73366"
FT                   /db_xref="GOA:D2S766"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D2S766"
FT                   /inference="protein motif:PFAM:PF02654"
FT                   /protein_id="ADB73366.1"
FT                   /translation="MRWAGPLESAALLTVLRVPARAASSTRGVLPWAPLVGLVLGGVAA
FT                   GVGLAGARLVSPLTGAVLAVAVLAALTRGLHLDGLADTADGLGPLRGRERALQVMRQGD
FT                   VGPFGVVTLLLTVLLQVAAAATLLGAGRGWTALVAAPLVARLAMARTGLPGVPMAAGSA
FT                   LGQSVAGTVSARWLAGWVFVAAALLTVADQALLVSAVAGLLAAELLLRRARARLGGVTG
FT                   DVMGAMGETAATVTLLVAAAALD"
FT   gene            complement(626772..627293)
FT                   /locus_tag="Gobs_0586"
FT   CDS_pept        complement(626772..627293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0586"
FT                   /product="Adenosylcobinamide-phosphateguanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="PFAM: cobalbumin biosynthesis protein; KEGG:
FT                   sen:SACE_1651 cobinamide kinase / conamide phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73367"
FT                   /db_xref="GOA:D2S767"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S767"
FT                   /inference="protein motif:PRIAM:2.7.7.62"
FT                   /protein_id="ADB73367.1"
FT                   /translation="MSRVLVLGGSRSGKSAHAEALLADAGDVTYLATAPPVPGDAEWAE
FT                   RVAAHRARRPPGWTTLETTAPSDLLRRGTVLVDSVTTWVAALMDETGVWTDEPGARDRL
FT                   ARRCDALVEAWTTTPAHVVAVSDEVGLGVVPETRSGRLFRDTLGSVNQRLAGTADEVWF
FT                   VVAGLPQRLR"
FT   gene            complement(627373..627924)
FT                   /locus_tag="Gobs_0587"
FT   CDS_pept        complement(627373..627924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0587"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pac:PPA0417
FT                   phosphoglycerate mutase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73368"
FT                   /db_xref="GOA:D2S768"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2S768"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADB73368.1"
FT                   /translation="MARPLTLLLVRHGQSEWNAAGLMQGQTAHVPLTELGHAQAAGAAR
FT                   ELAELHPGALVSSDLRRAVQTAEHCARATGLPVTTTPALREQGYGVLEGRPSRELWGVV
FT                   DWTDPHWAAQGGESLAELHARVGAYLEQLCADPPAEVVALVTHGDTIRAALAVAAGLGP
FT                   DAMPAVTPHNGTVTALELVL"
FT   gene            628222..629010
FT                   /locus_tag="Gobs_0588"
FT   CDS_pept        628222..629010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73369"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D2S769"
FT                   /inference="similar to AA sequence:KEGG:Tfu_0130"
FT                   /protein_id="ADB73369.1"
FT                   /translation="MTIPVRPGAGRPGTRPAAADPLAALLDLPGVRDAAEGARAGIDRL
FT                   LRHRLMRNRSAEVSTESALRGARASAALEGVDVPLADLRAGQVDDPVVQGSLRTSVALG
FT                   SMMETWSRAPGQVLARLHVLAAADLADRAGLGRPGAHAGPRLAGLFSLVTGESSVPAVV
FT                   LAAVVHGELAAIAPFGTADGVVARAAARLTGITRGLDPKAVSVPEVGFAELGREEYARA
FT                   LAGYASGQPEGVAGWLVHCCRATEHGALEGLAIAEALLRG"
FT   gene            629059..630027
FT                   /locus_tag="Gobs_0589"
FT   CDS_pept        629059..630027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0589"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mmi:MMAR_3520
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73370"
FT                   /db_xref="GOA:D2S770"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2S770"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADB73370.1"
FT                   /translation="MRYLDVDGLGAVSRVGLGTWQFGSREWGYGDAYASGEAKAIVRRA
FT                   RELGTTLFDTAEVYGFGRSERILGEALGEERAEVVVASKVFPVAPFPPVVRHRLAGSAR
FT                   RLELDRVPLYQVHQPNPVVPDTVTMPGMRQLLDAGRIGAVGVSNYSLARWQAADAALGR
FT                   PVVSNQVHFSLAAPSALDDLVPFAEREGRMVMAYSPLAQGLLGGRYGVDNRPGGVRAAN
FT                   PLFGTENLRRAEPLLGVLREVAAAHAVAPAQIALAWLVSLPRVVVIPGASSVAQVEANA
FT                   AAADIDLRPDEQAALTAAARAFRPVSAVRTLVERVRERLPV"
FT   gene            complement(630173..631015)
FT                   /locus_tag="Gobs_0590"
FT   CDS_pept        complement(630173..631015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0590"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sen:SACE_0365 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73371"
FT                   /db_xref="GOA:D2S771"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2S771"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADB73371.1"
FT                   /translation="MTRAAAFFDLDKTVIAKSSTLAFGRPFFQGGLINRRAVLKGAYAQ
FT                   FVFSLAGADAPQMERMRAQITEMCTGWDVATVHEIVRETLHDIVEPMVYAEAADLIEEH
FT                   RAAGREIVIVSSSGAEMVEPIGEMLGVDRVVATRMVTVDGHYTGEIDFYAYGANKAVAV
FT                   REVAAESGYDLADCYAYSDSITDLPMLKAVGHPTAVNPDRALRKAATEHGWPVLEFTWP
FT                   VTMGSRFPVPSAPVVTGAAMSVGAAVVGLAWYARRRALRVAAATPPAPVPGRWRRRGA"
FT   gene            631143..632216
FT                   /locus_tag="Gobs_0591"
FT   CDS_pept        631143..632216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0591"
FT                   /product="septum site determining protein"
FT                   /note="KEGG: sma:SAV_4605 septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73372"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S772"
FT                   /inference="similar to AA sequence:KEGG:SAV_4605"
FT                   /protein_id="ADB73372.1"
FT                   /translation="MSAFRSPPTRLLVASADEELLDDLLRLLAAAGTEPEVATAGPALR
FT                   RAHREAPLVLLGADVLTSAPVRGLPRRAGVVVVAPGELPAPVWAAAVEQGAERVAVLPA
FT                   DEGWLVSRVASALRRPVDRGRLVAVGGSCGGAGVSTLAAALALAAAPGSDGVLLVDTDG
FT                   WGGGLDLLLGAERDEGLRWPELAGLRGRVAGDALMAALPEVAGVSVLAASRSAPGEVPA
FT                   EALTAVVEAARAGGRPVVVDLPRTAGAEATAAVLAEADLAVLVVPARLLVEPAGAGRSV
FT                   PWSAAQLVVRPVPGGLSTDEVADVVGRPVLGELGTDRSALPRGEQGRPPQVGARSPLGA
FT                   LSRRLLAELARVDGAAA"
FT   gene            632213..633352
FT                   /locus_tag="Gobs_0592"
FT   CDS_pept        632213..633352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0592"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rha:RHA1_ro04340 conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73373"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S773"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADB73373.1"
FT                   /translation="MSGVLVDRVRARLVLEPGVPTRAAVAALVREESGGLLGDDDVLQA
FT                   VRDAVDELAGAGPLEPLLREPGVSDVLVNGPDQVWVDRGGGLERTLVRFPDEDAVRRLA
FT                   VRLAAAAGRRLDDAAPWVDAGLPDGTRLHAVLPPVSGSGTCLSLRVLRRASLSLADLAA
FT                   RGAFPGTSGDLLQALVAGRRAFLVTGGTGSGKTTLLSALLGLVPSGERLVLCEDAPELV
FT                   PAHPHVVRLATRPPNVEGVGEVTLRDLVRQALRMRPDRLVVGEVRGAEVTDLLTALNTG
FT                   HDGGCGTLHANRPAEVPARLEALGVAAGLDRLAVHSQAAAALSAVVHLRRTPSGRRVEE
FT                   VGVVRRAGDLVVVESGWRADGGSCPGAPLLADLLSAGRG"
FT   gene            633349..634143
FT                   /locus_tag="Gobs_0593"
FT   CDS_pept        633349..634143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa3600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73374"
FT                   /db_xref="GOA:D2S774"
FT                   /db_xref="UniProtKB/TrEMBL:D2S774"
FT                   /inference="similar to AA sequence:KEGG:nfa3600"
FT                   /protein_id="ADB73374.1"
FT                   /translation="MTGGLLLLAGALLLWPGPAALARQRWRSVVRSADVGLRPALGVPL
FT                   PAVAATAAGAVAALLSTPLVAALAGGCAALAARAELRRRAGAQEEARLAALVEALTGLG
FT                   AELRSGRSLDEATRAAVAACADDDSGRALARAVRSPGDGAGEADDGGELGRALGRVAAA
FT                   ARLSARTGCSLAAVVGAVEDDLRARSRHRLELRSATAGSRASAALLAGLPVLGLVMGGG
FT                   VGADPWRVLTTTGTGQLLLVAGVGLEVAGLVWSARLVRRAVR"
FT   gene            634152..634865
FT                   /locus_tag="Gobs_0594"
FT   CDS_pept        634152..634865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0594"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   tfu:Tfu_0126 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73375"
FT                   /db_xref="GOA:D2S775"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D2S775"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADB73375.1"
FT                   /translation="MVALVLASALLCWPVRSPVAVRARWLAARDGAGRPPQPSGPGAVR
FT                   RRWLLAGATGLAAGLLVGGGAGVGVAGLVAVGGERLLRRGSREGARAGPTPEADLPVAC
FT                   DLLAVCLEAGLPVGGALAAVAAALAGPLGPELTTVAGLYRLGAAPRRAWADVPAELAVL
FT                   GRVLVRAGESGSTVVPALRSLAGDARAEQRSRADAAVRRAGVWVLAPLGVCFLPAFLCL
FT                   GVVPLVLGIAADVFG"
FT   gene            634987..635256
FT                   /locus_tag="Gobs_0595"
FT   CDS_pept        634987..635256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0595"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ace:Acel_1979 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73376"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D2S776"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73376.1"
FT                   /translation="MTAPCTTRTGDEELPDADGTPAEEGRPRGLRERWARVRAAGEAGM
FT                   STAEYAVGTVAACAFAAVLYRVVTGGSVVDGLSALVADALATLS"
FT   gene            635256..635642
FT                   /locus_tag="Gobs_0596"
FT   CDS_pept        635256..635642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0596"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: kra:Krad_0480 TadE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73377"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:D2S777"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ADB73377.1"
FT                   /translation="MVRRRRRGRLRGEAGMVTAETAVVLPVLLFVLAGAVAAVTVVGAQ
FT                   LRCVDAAREGARAAARGEDTSLVTTLAGQAAPDGAATTVAVGGATVTVTVAAQVAPLGP
FT                   VPLRVPVSASAVAQREPGTAEAPG"
FT   gene            635639..636007
FT                   /locus_tag="Gobs_0597"
FT   CDS_pept        635639..636007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mab:MAB_0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73378"
FT                   /db_xref="GOA:D2S778"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="UniProtKB/TrEMBL:D2S778"
FT                   /inference="similar to AA sequence:KEGG:MAB_0475"
FT                   /protein_id="ADB73378.1"
FT                   /translation="MSAGSRPAGERGSATVWVVALAGVLAAIGVAAVLVGAAVVGRHRA
FT                   AAAADLAALAAAEHAVRGDPGACAAAGEVAGANGARLTACTVGGGAVVEVAVEVPVRLG
FT                   PLGVSRASGRARAGPVAP"
FT   gene            complement(635961..636452)
FT                   /locus_tag="Gobs_0598"
FT   CDS_pept        complement(635961..636452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0598"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_4458 transmembrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73379"
FT                   /db_xref="UniProtKB/TrEMBL:D2S779"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB73379.1"
FT                   /translation="MSGAEVAGPAAEQRRPRATEVEQHGIDTIPDAERTSRPLDLFRIQ
FT                   FGPAGPRLVPAQEAVAPPVTDDPRASVHRVDRRGPVQPAAGDGRPVTPRADAAAEVRTT
FT                   ASTRAGRDELRERMTIVFDREPSGQWPAVHEHLPPAPATAGWPELTAPPDRHGHGRWPG
FT                   "
FT   gene            636593..637174
FT                   /locus_tag="Gobs_0599"
FT   CDS_pept        636593..637174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0599"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; KEGG: art:Arth_0847 XRE family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73380"
FT                   /db_xref="GOA:D2S780"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D2S780"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADB73380.1"
FT                   /translation="MAGEVRRLTRPSHPADARVGARLRAARQAAGLTLAAVAAEAGLTK
FT                   GFLSRLERDEVSPSVASLVTVCGVLGIGVGQLFEPPATSLVRAAEAPPINFGGQGVREV
FT                   LLTAGAQRDLHVIRSVIEPGGGGGEELYSLACDVEFVHVLRGRLRLLLPGEVVELEAGD
FT                   AFTMPGATPHTWLNPSAATCEVLWVLTPAP"
FT   gene            637197..637879
FT                   /pseudo
FT                   /locus_tag="Gobs_0600"
FT   gene            complement(638003..640549)
FT                   /locus_tag="Gobs_0601"
FT   CDS_pept        complement(638003..640549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0601"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein; Protein
FT                   of unknown function DUF1998; helicase domain protein;
FT                   SMART: DEAD-like helicase ; helicase domain protein; KEGG:
FT                   saq:Sare_4414 DEAD/DEAH box helicase domain- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73381"
FT                   /db_xref="GOA:D2S781"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S781"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADB73381.1"
FT                   /translation="MTTLHPVRPAPPPGTDPLPQGGSPSPAGTPPPGADLLAAVLSGTP
FT                   EEEQPVTHVHRMPVRDSRTLPWPAWVSPELRGRLEAQGVHAPWRHQVEAAQLARDGSHV
FT                   VVATGTASGKSLAYQVPALTRLAEDPRACVLYLAPTKALARDQLASVAELADPSVRPAA
FT                   YDGDTPMEEREWVRRHSRWIVTNPDMLHRGVLPAHQKWSSTLRRLAYVVVDECHAYRGV
FT                   FGSHVGHVLRRLRRICRRYGAEPVFLLASATVAEPAAAATRLVGAPVVAVTEDGSPRPG
FT                   ATFALWEPPLTERTGEHGAPLRRSAAADAATLLADLVERGARTLAFVRSRRSAESVAEQ
FT                   ARHVLRDRGRADLARRVDSYRGGYLPEERRELERALSAGELLGVATTNALELGIDIAGL
FT                   DAVVLAGYPGTLASLWQQAGRAGRAQRESLVVFVARDDPLDHYLAHHPRAVFGRPVEAT
FT                   VTDPGNPYVLGPQLCCAAAELPLVPEDLADFGGAVAEARVEELVAEGSLRRRPTGWYWA
FT                   GRGRPDVDIRGSGLAPVTIIEGDTGRLLGTVDGDAAHATVHTGAVYVHRGETYVVDEFC
FT                   VDDAVAVVHPESPEWTTVARDVTDLAIVAVDRSRSLGTVTAHTGVVDVTNQVVAYQRRR
FT                   LGSGEVLAEFPLDLPPRQLRTRAVWLTLDERAVARAKVDDAELPGSLHAAEHAAIGLLP
FT                   LLATCDRWDLGGVSTALHPDTGAATVVVYDGHPGGAGFAERGFAVLRRWLQATRATVAS
FT                   CECESGCPSCVQSPKCGNGNEPLDKAGAVRVLDVVLDELATAEAADEAVPDGTPDEDDS
FT                   GDADRPCAPTDEVTPGTTRVGGPDAEPPTVEGDLVF"
FT   gene            640745..643006
FT                   /locus_tag="Gobs_0602"
FT   CDS_pept        640745..643006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0602"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: stp:Strop_4030 membrane-bound proton-
FT                   translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73382"
FT                   /db_xref="GOA:D2S782"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D2S782"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADB73382.1"
FT                   /translation="MPDSSLSGGDVVLVTIVLAISLAALAFAAYLVRAVMAAEQGTTKM
FT                   REIAQAVQEGAAAYLRRQFRTLGVFAIIVFLLLLVLPVADGGWGTRIGRALFFLVGALF
FT                   SAAVGFIGMTLATRGNVRVAAAARGGGYQPSFRIAYRTGGVVGMITIGLGLFGSALALL
FT                   LFDETAPIVLEGFGFGGALLAMFMRVGGGIFTKAADVGADLVGKVEAGIPEDDPRNAAT
FT                   IADNVGDNVGDCAGMAADLFESYAVTLVAALILGQVFFGNVGMVFPLLVAAIGVIASVV
FT                   GVLATRPGKSDASGMVPINRGFFASAAVSLVLVAAASFTYLPSIADVADLSVSPQVVGF
FT                   VSVLIGVVLAATIQQLTGYFTETSRKPVKDIGRSSLTGPATVILSGISLGLESAVYAAL
FT                   LIGGAVYGAFLIGGGAALYAVALAGCGLLTTAGVIVAMDTFGPVSDNAQGIAEMSGDID
FT                   EDGARVLTDLDAVGNTTKAITKGIAIATAVLAATALFGSYNAQVGVALDEAGATLGGAF
FT                   SLVNPNNVVGAVLGAAVVFFFSGLAISAVSRAAGRVVFEVREQFRTRPGIMDYSERPDY
FT                   SRVVDICTKDSLRELATPGLLAVLAPVAVGFGLGIGPLAAYLVGAIAAGTLMAVFLANS
FT                   GGAWDNAKKMVEDGAYGGKGSEAHAATVIGDTVGDPFKDTAGPAINPLIKVMNLVALII
FT                   APAVVTMSVGEDASTGLRVAIALGAVLVIVVAVVVSKRRSVVVGDSSSDTSTSLTTSVP
FT                   "
FT   gene            643178..643495
FT                   /locus_tag="Gobs_0603"
FT   CDS_pept        643178..643495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_0800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73383"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D2S783"
FT                   /inference="similar to AA sequence:KEGG:Acel_0800"
FT                   /protein_id="ADB73383.1"
FT                   /translation="MSGTIAAHFDAIDTLAAELAGLAAELAGEAQLCRSTAVSLGTAVS
FT                   GGAAESAGAAGSGWGTALELLGKQTGALAATLSAAVDSYRAADAALADRVLARRHSTAA
FT                   R"
FT   gene            643492..645015
FT                   /locus_tag="Gobs_0604"
FT   CDS_pept        643492..645015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0604"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   sgr:SGR_3828 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73384"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="UniProtKB/TrEMBL:D2S784"
FT                   /inference="protein motif:PFAM:PF06259"
FT                   /protein_id="ADB73384.1"
FT                   /translation="MSAPTLAEVAGWDVPLLRGAVWTLDSVAGGLPAWRARVEAVGRSL
FT                   EDASCWYGPAAQAAGAALVEVSTVATAVTAALDESLEHAQRLLAEADTAQELAERALAA
FT                   AASVPVVLDGAGRLVSLPAVQVGAEPGLGADQTAVALQAQELAEEALAAAVRGDRAAGE
FT                   AEAALARLGMGGGSAPATSMDLVGTVVAGTGMAAVLPPPGGPGEQAAWWAGLSTADRLT
FT                   AISEVPSRIGRLDGLPAWARNQANRVLVERTLTEPSLPGHAVAVSVAAEITRREVAGEE
FT                   VQLHLFQPEEGLVALAVGDLDTADHVALLVPGTGIDPIEDLDGLVGDAAAVAGATRAAA
FT                   PAAAVATIAWMGYRAPSNLVKAPSPHYSWPGGRALDATLGGLASARAATSGGRPHTTVI
FT                   GHSYGTLVIDRAADASGQLAADDVVLLGSPGMDNRAVELEVDGVYEASAPVDPITWGEF
FT                   HGQYRTWEDSFGAEELPTDWRNWHTGYYDEDGSTLTPIGEVVGGVREPA"
FT   gene            645210..648074
FT                   /locus_tag="Gobs_0605"
FT   CDS_pept        645210..648074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0605"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: fre:Franean1_0309 DNA topoisomerase I;
FT                   TIGRFAM: DNA topoisomerase I; PFAM: DNA topoisomerase type
FT                   IA central domain protein; TOPRIM domain protein; SMART:
FT                   DNA topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73385"
FT                   /db_xref="GOA:D2S785"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:D2S785"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ADB73385.1"
FT                   /translation="MAPTKTTHTGTRTAAATAGGTSTPARRRTAAGGGRPLVIVESPTK
FT                   AGKIAGYLGSGYVVEASVGHIRDLPRNAADVPAEHKGASWARLGVDVDNAFEPLYVVSP
FT                   DRKQQVSRLKQLVKDASEVYLATDEDREGEAIAWHLVDTLKPRVPVRRMVFHEITPEAI
FT                   ARAVANPRELDTALVDAQETRRILDRLYGYEVSPVLWKKVLPKLSAGRVQSVATRIVVE
FT                   RERERMAFHSADYWSLEGTFTVTGRRTSADEGEPTTLRARLVSVDDSRVATGRDFDPAT
FT                   GRATGEVVHLDEAGARGLAARLEGRQVTVSRVDEKPYRRRPYAPFTTSTLQMEAGRKLG
FT                   WSSAQVMRVAQRLYENGHITYMRTDSTNLSNEAVNAARTQARQLYGDAYVPAEARRYAK
FT                   KAKGAQEAHEAIRPAGDSFRTPGQLAGQLARDEFRLYELIWQRTIASQMADAVGQSVSI
FT                   RLAGRSSTDEAVEFTASGRTITFPGFLRAYVESRDEGAAADDDHGSDDAERRLPRVERG
FT                   QQLDTRELEAKGHSTTPPSRYTEPSLVARLEELGIGRPSTYASIMQTIQDRGYVWKKGS
FT                   ALVPTFVAFAVINLLEQHFAQLVDYDFTASLEQELDEIAAGDLGRVDWLTEFYFGGEGR
FT                   HAGGIAASGGLKSVIGQRLEEIDARGVNSIPLQATGPNGERVVVRVGRYGPYLQVGGED
FT                   GPRVSLPEDLAPDELTQEKVEELLAAPSGDRTLGTDPVSGLPVVVKAGRYGPYVTTVVP
FT                   EGSKEAPRTASLFSSMSPESVTLDDALKLLTLPRTVGAAPDGEEIQALNGRYGPYLKKG
FT                   TDSRSLESEDRLFTVTLDEALAVFAQPKQRGRRAAAAPLKELGADPVTQGTVTVREGRF
FT                   GPYVTDGETNASLRKGDDVESITLERAAELLADRRNNPSTKKATKKKATAKKTTAKKAT
FT                   TTGKTTAKKATKKATAGSDAVPAG"
FT   gene            648082..648846
FT                   /locus_tag="Gobs_0606"
FT   CDS_pept        648082..648846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0606"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: kra:Krad_0454 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73386"
FT                   /db_xref="GOA:D2S786"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2S786"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADB73386.1"
FT                   /translation="MPAGEPDPDTWRQRRTSFGSVAAGYAAHRPDYPADAVAFLVGTSP
FT                   RRVLDLGAGTGLLTGVLLTAGHEVVAVDPAGEMLAELRARYPQVTAHVGDAEAVPLPDG
FT                   SVDAVVAGQAAHWFDPEPAAAQLRRVLRPGGVVGLVWNTRDEEVPWVAAPGRVLADEAR
FT                   GHEADRGVVDAFARALGARVEHHRSGIVQRLSPEQVVAGIATRSYVATMDDARREAFLG
FT                   EVRAVLDAHPDTRGRDVVDLPYRTDAHRLTPA"
FT   gene            649016..649774
FT                   /locus_tag="Gobs_0607"
FT   CDS_pept        649016..649774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0607"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: msm:MSMEG_4913 LpqM
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73387"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:D2S787"
FT                   /inference="protein motif:PFAM:PF04228"
FT                   /protein_id="ADB73387.1"
FT                   /translation="MATRAGRLLIALVAAVLFGAGTPAAAATPGPTGSASPPVLVTGPD
FT                   GAATDDLDADYATALRAVDTWWRSSWSEYFPGSYTAPGLAPAARAPGLFDAPQEQVYCG
FT                   DLLLPEGNAFHCPIGDFLAFEVDLMLRSQELGDAFVYLVVAHEWAHSVVSHIDPALVSE
FT                   AYELQADCLAGAALQGAVDAGLLRLEPGDAEELTASLTAVASDNAWGTVYVDAAGQPQT
FT                   ETHGSAQERVDAFERGSTDGVRACLPNSVG"
FT   gene            complement(649779..650567)
FT                   /locus_tag="Gobs_0608"
FT   CDS_pept        complement(649779..650567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0608"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: sma:SAV_3570 trans-aconitate
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73388"
FT                   /db_xref="GOA:D2S788"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D2S788"
FT                   /inference="protein motif:PRIAM:2.1.1.144"
FT                   /protein_id="ADB73388.1"
FT                   /translation="MTSTAAWDPAGYLRFGDERARPFVDLLARVGAQEPRAVVDLGCGE
FT                   GALTASLAQRWPCARVTGVDSSPEMLAAAAAHAVPGRVAFEVGDVREWRPDAPVDVLFS
FT                   NAVLHWVPGHADLLHRWAGALAPGGWLAVQVPGNWRAPTHALLAGLCRSPRWAGLVGDA
FT                   APAEDAVLDPAGYLEVLTAAGLTVDAWETTYSHVLRGDDPVLGWVRSTVLRPVLARLGE
FT                   DDAAELTEEYAAALRAAYPRRPDGTTLLPFRRVFAVGHAA"
FT   gene            650674..651351
FT                   /locus_tag="Gobs_0609"
FT   CDS_pept        650674..651351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0609"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: stp:Strop_4023 thymidylate kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73389"
FT                   /db_xref="GOA:D2S789"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D2S789"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADB73389.1"
FT                   /translation="MSDDGPPVLSVESAGRPRGLFIAFEGGEGAGKSTQVRLLCEWLTA
FT                   QGRPARATFEPGGTPAGAAVRAIVLDRAHTGLSPRAEALLYAADRAQHAHAVLRPALEA
FT                   GEVVVTDRYVDSSLAYQGAGRTIGLDDVAAISRWATLGLRPDLTVLLDLPPETGLARAR
FT                   GRAAADRLESESLEFHQRVRDTFRTLAAAEPGRYLVLDATRGVDELAADVRARVGALLG
FT                   ERA"
FT   gene            651348..652508
FT                   /locus_tag="Gobs_0610"
FT   CDS_pept        651348..652508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0610"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: nfa:nfa3680 DNA polymerase III subunit delta';
FT                   TIGRFAM: DNA polymerase III, delta prime subunit; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73390"
FT                   /db_xref="GOA:D2S790"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S790"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADB73390.1"
FT                   /translation="MSGVWEQVIGQSAVVAELQAAVADPTAMTHAWLFTGPPGSGRSVA
FT                   ARAFAAALQCPDGGDGTCHACRTVLAGTHADVQTVVPEGLSIGVAEVRELVRIAGRAPS
FT                   QGRWQVVLVEDADRMTEQASNTVLKMLEEPPARTVFLLCAPSLHPDDVPVTIRSRCRVV
FT                   GLRTPPVDAVADVLVRRDGVDPALAAWSAAAAGGHVGRARHLARDETARLARKAVLDVP
FT                   LSLVSLAACLNAADDLVGAAKEESDRASTELDGAETEAVKQSLGVGARGPGVAAASRGA
FT                   GQLKELEKRQKSRATRLGRDSLDRALVDLAALYRDALVVATSGTEGVTLAHPDRRADAE
FT                   ELARRIGPEGALRRIDAVLDCRRALEQNVKPQVAVEALTVALRLPG"
FT   gene            652567..652642
FT                   /locus_tag="Gobs_R0013"
FT                   /note="tRNA-Thr1"
FT   tRNA            652567..652642
FT                   /locus_tag="Gobs_R0013"
FT                   /product="tRNA-Thr"
FT   gene            complement(652792..653286)
FT                   /locus_tag="Gobs_0611"
FT   CDS_pept        complement(652792..653286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0611"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: nca:Noca_0438
FT                   inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73391"
FT                   /db_xref="GOA:D2S791"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D2S791"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ADB73391.1"
FT                   /translation="MQFDVTVEIPKGQRNKYELDHATGRIRLDRMLFTSTRYPADYGYI
FT                   ENTLGQDGDPLDALVILDEPTFPGCLITCRAIGMFRMTDEAGGDDKVLCVPATDPRMAH
FT                   LTDILDVSEFDRLEIQHFFETYKDLEPGKSVEGAEWVGHADAEAEIHASLRRAEEAEPH
FT                   H"
FT   gene            653297..654760
FT                   /locus_tag="Gobs_0612"
FT   CDS_pept        653297..654760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0612"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine carboxypeptidase/D-
FT                   alanyl-D-alanine-endopeptidase; PFAM: peptidase S13
FT                   D-Ala-D-Ala carboxypeptidase C; KEGG: saq:Sare_4750
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73392"
FT                   /db_xref="GOA:D2S792"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D2S792"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADB73392.1"
FT                   /translation="MADRIPEDRRRSFQGVGTIASSGSTTVTPKYSRFRRRLVLGLLAL
FT                   LLVVGAGVWFGVAPRGDDAAAEVAAAEARLPDVEPAAPVLAALASEAPAPDAAVLADEL
FT                   APLLASPALGPGVEARVVDVAAGEVLLDQDSDVPSTPASTAKLLTAVAALTTLGPDTTL
FT                   ETTVVAGSAPGEVVLVGGGDPTLSRTVPSLTYPGAPTVADLAAQVRGSLPAGTRVTRVV
FT                   IDNSLFQGPLTASGWGPGDAPSTYAAPVTATAVDGARVRSGDLPRSGAPGTDAGTALAV
FT                   ALGVPDATVVLGNAPQGAQTLGSVRSAPVARLVEQALSQSDNLLTESLARHVALARDLP
FT                   ATFEGAAEAVTGALTDAGLDVTGVSLSDGSGLSTTDRVPVELLTELFTGAADGTLPGTS
FT                   AVLSGLPVAGYDGTLFDRGDADPATAPGSVRAKTGTLLGVHGLAGTVVTAEGRLLVFGV
FT                   VADGAPANGEAAEDALDAVASALAACGCR"
FT   gene            654944..656011
FT                   /locus_tag="Gobs_0613"
FT   CDS_pept        654944..656011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   Protein of unknown function DUF2342; KEGG: fal:FRAAL6586
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73393"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:D2S793"
FT                   /inference="protein motif:TFAM:TIGR03624"
FT                   /protein_id="ADB73393.1"
FT                   /translation="MVDWDLAGRTARRLVGPGPQTTREEAAAVVRELHEAAATAVAHVE
FT                   GLTGLSPVPGGPVPEVAVVDRPGWVDANTQGMSALLDPLVDALAARQDSRPGPLATAIG
FT                   SRATGVQAGGVLAFLSSRVLGQYEVFGTGGRLLLVAPNIVDAERRLGVDPSDFRLWVCL
FT                   HEVTHQLQFSAVPWLKDHLEAQMAEFVEATDLDPDVLRDRLGDVLRSVLDAARGADGGD
FT                   DAGLMALVQDPAQRAVLDRVTAVMSLVEGHAEYVMDGVGPDVVPSVRTLRKRFAQRRKG
FT                   RGPIDRVLRRLLGLEQKMKQYAEGRVFVGGVVDLVGMEGFNRVWEGPENLPRIEELTDP
FT                   ARWVERVHGRPAIPA"
FT   gene            656017..657042
FT                   /locus_tag="Gobs_0614"
FT   CDS_pept        656017..657042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0614"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: sco:SCO3406 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73394"
FT                   /db_xref="GOA:D2S794"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D2S794"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ADB73394.1"
FT                   /translation="MAGPPRAVAVLRTAVRPGLRASDRPVLAACSGGADSVALAAALAF
FT                   EARHAGVRAGGITVDHGLQPGSAERAERTAQLLRGLGLDPVLVRRVAVAAGGGPEGAAR
FT                   TARYEALAAAAAQLGARVALGHTLDDQAETVLLGLGRGSGPRSVAGMVPERTADGTTWW
FT                   RPLLGVRRATTREACADQGLPVWDDPWNADPAYTRARLRGEVLPLLEDVLGGGVAPALA
FT                   RTADLLREDLDALDELAAAELARLAGADELAARELGALPAALRRRVLRGWLRAAGVPDV
FT                   QAVHLRAVEALVTGWRGQGRVDLPGGAGALRTSGRLVVSPPETRGPRPEDAPPTREESR
FT                   P"
FT   gene            657039..657626
FT                   /locus_tag="Gobs_0615"
FT   CDS_pept        657039..657626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0615"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: sen:SACE_0395 hypoxanthine-guanine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73395"
FT                   /db_xref="GOA:D2S795"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2S795"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ADB73395.1"
FT                   /translation="MSEPASAPAELGNDHGYGPDIDHVLLSEEQIQAKIAELAEQVERD
FT                   YAGREVLLVGVLKGAVLFMSDFARALRLPTQMEFMAVSSYGSATSSSGVVRILKDLDRD
FT                   ISDRHVLVIEDIIDSGLTLSWLLKNLGGRRPASLEVCALLRKPDAVKVDVPVRYIGFDI
FT                   PNEFVVGYGLDYAERYRDLPYIATLRPEVYSS"
FT   gene            658000..659988
FT                   /locus_tag="Gobs_0616"
FT   CDS_pept        658000..659988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0616"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: stp:Strop_4308 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; peptidase M41 FtsH extracellular; AAA ATPase
FT                   central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73396"
FT                   /db_xref="GOA:D2S796"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D2S796"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADB73396.1"
FT                   /translation="MERKKIFRSVWFWVVLVVLLALAFSSLFRGTGGFQEVRTAVALEQ
FT                   IQNGNAERVTINDKEQTLDLDLANPVEGSDQITASYPLGAADDVFDLVSGLGNGEGVDF
FT                   TTNVTQDSVLVSLLISFLPFVILLLLLFWLFNSMQGGGRGVMAFGKSKAKQVTKDTPKT
FT                   TFADVAGADEAIEELHEIKDFLANPVKFQAVGAKIPKGVLLFGPPGTGKTLLARAVAGE
FT                   AGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKQNAPAIIFVDEIDAVGRHRGAGMGGG
FT                   HDEREQTLNQMLVEMDGFDVKGGVIMIAATNRPDILDPALLRPGRFDRQIAVDRPDLEG
FT                   RKRILEVHAKGKPLAPDVDLETVARRTPGFTGADLANVLNEGALLTARNNGTVITDDLL
FT                   EEAIDRVVAGPERKTRAMSEKEKKVTAYHEGGHALVAHALPNLDPVHKVTILPRGRSLG
FT                   HTLVLPTEDKYTQTRSEMIDTLAYALGGRAAEELVFHEPTTGAGNDIEKATAMARAMVT
FT                   QYGMSAKLGAVKYGSTDSEPFLGRDMGTRPDYSEAVAADIDAEIRALIEAAHDEAWEIL
FT                   VEYRGVLDQLVLELMEKETLSKEDMARICAPVTKRPSLAPYNGFGKRTPSDQPPVLTPA
FT                   EQAAQNGNGHLGHGSTAVGDVGAPAQR"
FT   gene            660062..660682
FT                   /locus_tag="Gobs_0617"
FT   CDS_pept        660062..660682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0617"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: mbt:JTY_3674 GTP cyclohydrolase I; TIGRFAM:
FT                   GTP cyclohydrolase I; PFAM: GTP cyclohydrolase I/Nitrile
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73397"
FT                   /db_xref="GOA:D2S797"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D2S797"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ADB73397.1"
FT                   /translation="MSEIPAEAEDLLLSLPRTGVDHVRAAAAVRELLLAVGEDPDRPGL
FT                   QGTPDRVARAYAETFAGLWQDPADVLATTFDEDHDEMVLVKDIPMYSTCEHHLVPFHGV
FT                   AHIGYIPGENGRVTGLSKLARLVEVYARRPQVQERMTSQIADALADVLKPRGVLVVIEA
FT                   EHLCMAMRGIRKPGATTLTSAVRGIFRDNAATRSEAMSLIHGR"
FT   gene            660679..661539
FT                   /locus_tag="Gobs_0618"
FT   CDS_pept        660679..661539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0618"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: saq:Sare_4732 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73398"
FT                   /db_xref="GOA:D2S798"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D2S798"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ADB73398.1"
FT                   /translation="MSRTELLRPGHCVVMGVLNVTPDSFSDGGCFADAGAAVAHGLAMH
FT                   AAGADYVDVGGESTRPGADRVDAAEECGRVVPVIRELAAAGVRPSVDTTRAEVAEAALA
FT                   AGAVLVNDVSGGLADKNMAELVAEAGVPWVLMHWRGHSREMYAAAQYGDVVTEVCAELT
FT                   ARVEDVVAAGVAPEQLVLDPGLGFAKRSEHNWRLLAGLDRIVGLGLPVLVGASRKSFLG
FT                   RLLAAPDDTLRPAEQRDAATLATTVLAAEAGAWGVRVHDAAASADAVRTVAAVRAARRE
FT                   GERRG"
FT   gene            661532..661918
FT                   /locus_tag="Gobs_0619"
FT   CDS_pept        661532..661918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0619"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: tfu:Tfu_2891
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73399"
FT                   /db_xref="GOA:D2S799"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D2S799"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADB73399.1"
FT                   /translation="MADVHPSTRLDRIAVHGLSAHAFHGVYEAERRLGQTFRVDAVLEL
FT                   DTAPAAADDDLERTVNYAELARALHSVLTGEPVDLLETLAQRLADVCLEDPLVDAVEIT
FT                   VHKPEADLGVPFDDVAVAIRRERP"
FT   gene            661992..662498
FT                   /locus_tag="Gobs_0620"
FT   CDS_pept        661992..662498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0620"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: sen:SACE_0400 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase;
FT                   TIGRFAM:2-amino-4-hydroxy-6-hydroxymethyldihydropter
FT                   idinepyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73400"
FT                   /db_xref="GOA:D2S7A0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D2S7A0"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ADB73400.1"
FT                   /translation="MTRAVLSLGANLGDRAAALRTAVTTLKDDGVLVARSTLYEAPPWG
FT                   PVEQPPYLNAVVVVRGDRDAAGWLARAHELEQAAGRSRDVRWGPRTLDVDVVTATGDDG
FT                   QPVLSDDPALTLPHPRAHERAFVLVPWASLDPTAVLPGRGRVSDLLAALPPEDVAAVVR
FT                   WEHLR"
FT   gene            662572..663078
FT                   /locus_tag="Gobs_0621"
FT   CDS_pept        662572..663078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rer:RER_06300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73401"
FT                   /db_xref="GOA:D2S7A1"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:D2S7A1"
FT                   /inference="similar to AA sequence:KEGG:RER_06300"
FT                   /protein_id="ADB73401.1"
FT                   /translation="MRPVNRRDLLVLGAGLAVAAWLVVRASYGSLPALRWWLPVPLGVL
FT                   AVAEFLGTRTLRARLAAQRDRRPPAERGTAPVRPVEPMLVARLAVLAQASAYVGAAFVG
FT                   IWVGLLLYVGPSVSRLQAAANDTVTGVVGVVCSAALVAAALWLESVCRIPPSPDDETPQ
FT                   AGARA"
FT   gene            complement(663118..664302)
FT                   /locus_tag="Gobs_0622"
FT   CDS_pept        complement(663118..664302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0622"
FT                   /product="glycine betaine/L-proline ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: sgr:SGR_4097 putative ABC transporter ATP-
FT                   binding protein; TIGRFAM: glycine betaine/L-proline ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   CBS domain containing protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73402"
FT                   /db_xref="GOA:D2S7A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2S7A2"
FT                   /inference="protein motif:TFAM:TIGR01186"
FT                   /protein_id="ADB73402.1"
FT                   /translation="MDATAAPSSLRTASPGAGSAGGAPGIRLEGVSKVYPDGTVGVAEL
FT                   DLTFAAGELSVLVGPSGCGKTTTMKMVNRIIEPTTGRILLGGEDVTRVDADRLRRRIGY
FT                   VIQSVGLFPHQTVRTNIATVPRLLGWDRREIRDRVEELLTLVGLDPAVHGDRYPAQLSG
FT                   GQRQRAGVARALAADPGVLLMDEPFSAVDPVVRERLQSEFLRLQETVRKTIVFVTHDIE
FT                   EAVRLGDRIAVMSTGGHVEQFAPPAELLGRPANETVADFVGADRGLKRLAVTPIDPADL
FT                   EHPPVVGVGDGLAEAGAALDRAGAGRAVVLDVGGRPAGWLPADRASGSGTVASAVVRDD
FT                   AAVPLQASLRTALATILQSDAGWVPVLDGDRHLGVLTPAALHAALRRSVHEGAR"
FT   gene            664305..665027
FT                   /locus_tag="Gobs_0623"
FT   CDS_pept        664305..665027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0623"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: saq:Sare_4725
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73403"
FT                   /db_xref="GOA:D2S7A3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2S7A3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB73403.1"
FT                   /translation="MASLGALSAASGPGTPVLAADEAPNPWFDPSYVTDNWDTIVGHLG
FT                   QHVRLTVGAVLLGALVALPLALLARRTRLLAGPVLGFSSVVYTIPSLALFAFLAPFTGA
FT                   LSPVTVLIGLTVYTLVILVRNFLAGLQGVPDDVREAARGMGYGPARLFLRVDLPLALPA
FT                   FMAGLRIATVSTVALVTVGVITGNGGLGQLIIGGLNANFYRAEIVTGAVGCVLLAVVAD
FT                   VLLAGLERLLTPWTRAAR"
FT   gene            665024..665755
FT                   /locus_tag="Gobs_0624"
FT   CDS_pept        665024..665755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Gobs_0624"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: stp:Strop_4289
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Gobs_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADB73404"
FT                   /db_xref="GOA:D2S7A4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D2S7A4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB73404.1"
FT                   /translation="MNAFGDAFVYLNDPFNWTRPGGILDLLVQHLRISTLAVLLAAVLA
FT                   VPAGVLLGRSGRGAGAVVVLSNVSRAVPTLALLTVLAVTPLGFSETGTVLALAAFAVPP
FT                   MLTNTYVGFREVDRDVREAARAMGMSRGQMLTRVEFPLASPLVATGVRTAAVQVVATAT
FT                   LAALVGGGGLGRIINLGFGQQDHGEILAGAVLVAALALLTELLLVLVSTAVTPGLRRWP
FT                   LRPVRAARTGRSEPTSSGVPL"
FT   gene            666164..666920
FT