(data stored in ACNUC7421 zone)

EMBL: CP001874

ID   CP001874; SV 1; circular; genomic DNA; STD; PRO; 4189976 BP.
XX
AC   CP001874;
XX
PR   Project:PRJNA20737;
XX
DT   26-MAY-2010 (Rel. 104, Created)
DT   26-MAY-2010 (Rel. 104, Last updated, Version 1)
XX
DE   Thermobispora bispora DSM 43833, complete genome.
XX
KW   .
XX
OS   Thermobispora bispora DSM 43833
OC   Bacteria; Actinobacteria; Actinobacteria incertae sedis; Thermobispora.
XX
RN   [1]
RP   1-4189976
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Jando M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Thermobispora bispora DSM 43833";
RL   Unpublished.
XX
RN   [2]
RP   1-4189976
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Mikhailova N., Chertkov O., Brettin T., Detter J.C., Han C., Larimer F.,
RA   Land M., Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T.,
RA   Wu D., Jando M., Schneider S., Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (15-JAN-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fa59acd5d22eeb0e115ba34a7b8bdabd.
DR   CABRI; DSM 43833.
DR   EnsemblGenomes-Gn; EBG00001031734.
DR   EnsemblGenomes-Gn; EBG00001031735.
DR   EnsemblGenomes-Gn; EBG00001031736.
DR   EnsemblGenomes-Gn; EBG00001031737.
DR   EnsemblGenomes-Gn; EBG00001031738.
DR   EnsemblGenomes-Gn; EBG00001031739.
DR   EnsemblGenomes-Gn; EBG00001031740.
DR   EnsemblGenomes-Gn; EBG00001031741.
DR   EnsemblGenomes-Gn; EBG00001031742.
DR   EnsemblGenomes-Gn; EBG00001031743.
DR   EnsemblGenomes-Gn; EBG00001031744.
DR   EnsemblGenomes-Gn; EBG00001031745.
DR   EnsemblGenomes-Gn; EBG00001031746.
DR   EnsemblGenomes-Gn; EBG00001031747.
DR   EnsemblGenomes-Gn; EBG00001031749.
DR   EnsemblGenomes-Gn; EBG00001031751.
DR   EnsemblGenomes-Gn; EBG00001031752.
DR   EnsemblGenomes-Gn; EBG00001031753.
DR   EnsemblGenomes-Gn; EBG00001031754.
DR   EnsemblGenomes-Gn; EBG00001031755.
DR   EnsemblGenomes-Gn; EBG00001031756.
DR   EnsemblGenomes-Gn; EBG00001031757.
DR   EnsemblGenomes-Gn; EBG00001031758.
DR   EnsemblGenomes-Gn; EBG00001031760.
DR   EnsemblGenomes-Gn; EBG00001031761.
DR   EnsemblGenomes-Gn; EBG00001031763.
DR   EnsemblGenomes-Gn; EBG00001031765.
DR   EnsemblGenomes-Gn; EBG00001031767.
DR   EnsemblGenomes-Gn; EBG00001031768.
DR   EnsemblGenomes-Gn; EBG00001031770.
DR   EnsemblGenomes-Gn; EBG00001031771.
DR   EnsemblGenomes-Gn; EBG00001031772.
DR   EnsemblGenomes-Gn; EBG00001031774.
DR   EnsemblGenomes-Gn; EBG00001031776.
DR   EnsemblGenomes-Gn; EBG00001031778.
DR   EnsemblGenomes-Gn; EBG00001031779.
DR   EnsemblGenomes-Gn; EBG00001031782.
DR   EnsemblGenomes-Gn; EBG00001031785.
DR   EnsemblGenomes-Gn; EBG00001031788.
DR   EnsemblGenomes-Gn; EBG00001031791.
DR   EnsemblGenomes-Gn; EBG00001031794.
DR   EnsemblGenomes-Gn; EBG00001031799.
DR   EnsemblGenomes-Gn; EBG00001031801.
DR   EnsemblGenomes-Gn; EBG00001031803.
DR   EnsemblGenomes-Gn; EBG00001031805.
DR   EnsemblGenomes-Gn; EBG00001031807.
DR   EnsemblGenomes-Gn; EBG00001031809.
DR   EnsemblGenomes-Gn; EBG00001031811.
DR   EnsemblGenomes-Gn; EBG00001031813.
DR   EnsemblGenomes-Gn; EBG00001031815.
DR   EnsemblGenomes-Gn; EBG00001031817.
DR   EnsemblGenomes-Gn; EBG00001031820.
DR   EnsemblGenomes-Gn; EBG00001031822.
DR   EnsemblGenomes-Gn; EBG00001031824.
DR   EnsemblGenomes-Gn; EBG00001031826.
DR   EnsemblGenomes-Gn; EBG00001031829.
DR   EnsemblGenomes-Gn; EBG00001031831.
DR   EnsemblGenomes-Gn; EBG00001031833.
DR   EnsemblGenomes-Gn; EBG00001031836.
DR   EnsemblGenomes-Gn; EBG00001031839.
DR   EnsemblGenomes-Gn; EBG00001031841.
DR   EnsemblGenomes-Gn; EBG00001031844.
DR   EnsemblGenomes-Gn; EBG00001031845.
DR   EnsemblGenomes-Gn; EBG00001031846.
DR   EnsemblGenomes-Gn; EBG00001031848.
DR   EnsemblGenomes-Gn; EBG00001031849.
DR   EnsemblGenomes-Gn; EBG00001031851.
DR   EnsemblGenomes-Gn; EBG00001031853.
DR   EnsemblGenomes-Gn; EBG00001031856.
DR   EnsemblGenomes-Gn; EBG00001031857.
DR   EnsemblGenomes-Gn; EBG00001031858.
DR   EnsemblGenomes-Gn; EBG00001031859.
DR   EnsemblGenomes-Gn; EBG00001031860.
DR   EnsemblGenomes-Gn; EBG00001031862.
DR   EnsemblGenomes-Gn; EBG00001031863.
DR   EnsemblGenomes-Gn; EBG00001031864.
DR   EnsemblGenomes-Gn; EBG00001031866.
DR   EnsemblGenomes-Gn; EBG00001031868.
DR   EnsemblGenomes-Gn; Tbis_R0001.
DR   EnsemblGenomes-Gn; Tbis_R0002.
DR   EnsemblGenomes-Gn; Tbis_R0003.
DR   EnsemblGenomes-Gn; Tbis_R0004.
DR   EnsemblGenomes-Gn; Tbis_R0005.
DR   EnsemblGenomes-Gn; Tbis_R0006.
DR   EnsemblGenomes-Gn; Tbis_R0007.
DR   EnsemblGenomes-Gn; Tbis_R0008.
DR   EnsemblGenomes-Gn; Tbis_R0009.
DR   EnsemblGenomes-Gn; Tbis_R0010.
DR   EnsemblGenomes-Gn; Tbis_R0011.
DR   EnsemblGenomes-Gn; Tbis_R0012.
DR   EnsemblGenomes-Gn; Tbis_R0013.
DR   EnsemblGenomes-Gn; Tbis_R0014.
DR   EnsemblGenomes-Gn; Tbis_R0015.
DR   EnsemblGenomes-Gn; Tbis_R0016.
DR   EnsemblGenomes-Gn; Tbis_R0017.
DR   EnsemblGenomes-Gn; Tbis_R0018.
DR   EnsemblGenomes-Gn; Tbis_R0019.
DR   EnsemblGenomes-Gn; Tbis_R0020.
DR   EnsemblGenomes-Gn; Tbis_R0021.
DR   EnsemblGenomes-Gn; Tbis_R0022.
DR   EnsemblGenomes-Gn; Tbis_R0023.
DR   EnsemblGenomes-Gn; Tbis_R0024.
DR   EnsemblGenomes-Gn; Tbis_R0025.
DR   EnsemblGenomes-Gn; Tbis_R0026.
DR   EnsemblGenomes-Gn; Tbis_R0027.
DR   EnsemblGenomes-Gn; Tbis_R0028.
DR   EnsemblGenomes-Gn; Tbis_R0029.
DR   EnsemblGenomes-Gn; Tbis_R0030.
DR   EnsemblGenomes-Gn; Tbis_R0031.
DR   EnsemblGenomes-Gn; Tbis_R0032.
DR   EnsemblGenomes-Gn; Tbis_R0033.
DR   EnsemblGenomes-Gn; Tbis_R0034.
DR   EnsemblGenomes-Gn; Tbis_R0035.
DR   EnsemblGenomes-Gn; Tbis_R0036.
DR   EnsemblGenomes-Gn; Tbis_R0037.
DR   EnsemblGenomes-Gn; Tbis_R0038.
DR   EnsemblGenomes-Gn; Tbis_R0039.
DR   EnsemblGenomes-Gn; Tbis_R0040.
DR   EnsemblGenomes-Gn; Tbis_R0041.
DR   EnsemblGenomes-Gn; Tbis_R0042.
DR   EnsemblGenomes-Gn; Tbis_R0043.
DR   EnsemblGenomes-Gn; Tbis_R0044.
DR   EnsemblGenomes-Gn; Tbis_R0045.
DR   EnsemblGenomes-Gn; Tbis_R0046.
DR   EnsemblGenomes-Gn; Tbis_R0047.
DR   EnsemblGenomes-Gn; Tbis_R0048.
DR   EnsemblGenomes-Gn; Tbis_R0049.
DR   EnsemblGenomes-Gn; Tbis_R0050.
DR   EnsemblGenomes-Gn; Tbis_R0051.
DR   EnsemblGenomes-Gn; Tbis_R0052.
DR   EnsemblGenomes-Gn; Tbis_R0053.
DR   EnsemblGenomes-Gn; Tbis_R0054.
DR   EnsemblGenomes-Gn; Tbis_R0055.
DR   EnsemblGenomes-Gn; Tbis_R0056.
DR   EnsemblGenomes-Gn; Tbis_R0057.
DR   EnsemblGenomes-Gn; Tbis_R0058.
DR   EnsemblGenomes-Gn; Tbis_R0059.
DR   EnsemblGenomes-Gn; Tbis_R0060.
DR   EnsemblGenomes-Gn; Tbis_R0061.
DR   EnsemblGenomes-Gn; Tbis_R0062.
DR   EnsemblGenomes-Gn; Tbis_R0063.
DR   EnsemblGenomes-Gn; Tbis_R0064.
DR   EnsemblGenomes-Gn; Tbis_R0065.
DR   EnsemblGenomes-Gn; Tbis_R0066.
DR   EnsemblGenomes-Tr; EBT00001635121.
DR   EnsemblGenomes-Tr; EBT00001635122.
DR   EnsemblGenomes-Tr; EBT00001635123.
DR   EnsemblGenomes-Tr; EBT00001635124.
DR   EnsemblGenomes-Tr; EBT00001635125.
DR   EnsemblGenomes-Tr; EBT00001635126.
DR   EnsemblGenomes-Tr; EBT00001635127.
DR   EnsemblGenomes-Tr; EBT00001635128.
DR   EnsemblGenomes-Tr; EBT00001635129.
DR   EnsemblGenomes-Tr; EBT00001635130.
DR   EnsemblGenomes-Tr; EBT00001635131.
DR   EnsemblGenomes-Tr; EBT00001635132.
DR   EnsemblGenomes-Tr; EBT00001635133.
DR   EnsemblGenomes-Tr; EBT00001635134.
DR   EnsemblGenomes-Tr; EBT00001635135.
DR   EnsemblGenomes-Tr; EBT00001635136.
DR   EnsemblGenomes-Tr; EBT00001635137.
DR   EnsemblGenomes-Tr; EBT00001635138.
DR   EnsemblGenomes-Tr; EBT00001635139.
DR   EnsemblGenomes-Tr; EBT00001635140.
DR   EnsemblGenomes-Tr; EBT00001635141.
DR   EnsemblGenomes-Tr; EBT00001635142.
DR   EnsemblGenomes-Tr; EBT00001635143.
DR   EnsemblGenomes-Tr; EBT00001635144.
DR   EnsemblGenomes-Tr; EBT00001635145.
DR   EnsemblGenomes-Tr; EBT00001635146.
DR   EnsemblGenomes-Tr; EBT00001635147.
DR   EnsemblGenomes-Tr; EBT00001635148.
DR   EnsemblGenomes-Tr; EBT00001635149.
DR   EnsemblGenomes-Tr; EBT00001635150.
DR   EnsemblGenomes-Tr; EBT00001635151.
DR   EnsemblGenomes-Tr; EBT00001635152.
DR   EnsemblGenomes-Tr; EBT00001635153.
DR   EnsemblGenomes-Tr; EBT00001635154.
DR   EnsemblGenomes-Tr; EBT00001635155.
DR   EnsemblGenomes-Tr; EBT00001635156.
DR   EnsemblGenomes-Tr; EBT00001635157.
DR   EnsemblGenomes-Tr; EBT00001635158.
DR   EnsemblGenomes-Tr; EBT00001635159.
DR   EnsemblGenomes-Tr; EBT00001635160.
DR   EnsemblGenomes-Tr; EBT00001635161.
DR   EnsemblGenomes-Tr; EBT00001635162.
DR   EnsemblGenomes-Tr; EBT00001635163.
DR   EnsemblGenomes-Tr; EBT00001635164.
DR   EnsemblGenomes-Tr; EBT00001635165.
DR   EnsemblGenomes-Tr; EBT00001635166.
DR   EnsemblGenomes-Tr; EBT00001635167.
DR   EnsemblGenomes-Tr; EBT00001635168.
DR   EnsemblGenomes-Tr; EBT00001635169.
DR   EnsemblGenomes-Tr; EBT00001635170.
DR   EnsemblGenomes-Tr; EBT00001635171.
DR   EnsemblGenomes-Tr; EBT00001635172.
DR   EnsemblGenomes-Tr; EBT00001635173.
DR   EnsemblGenomes-Tr; EBT00001635174.
DR   EnsemblGenomes-Tr; EBT00001635175.
DR   EnsemblGenomes-Tr; EBT00001635176.
DR   EnsemblGenomes-Tr; EBT00001635177.
DR   EnsemblGenomes-Tr; EBT00001635178.
DR   EnsemblGenomes-Tr; EBT00001635179.
DR   EnsemblGenomes-Tr; EBT00001635180.
DR   EnsemblGenomes-Tr; EBT00001635181.
DR   EnsemblGenomes-Tr; EBT00001635182.
DR   EnsemblGenomes-Tr; EBT00001635183.
DR   EnsemblGenomes-Tr; EBT00001635184.
DR   EnsemblGenomes-Tr; EBT00001635185.
DR   EnsemblGenomes-Tr; EBT00001635186.
DR   EnsemblGenomes-Tr; EBT00001635187.
DR   EnsemblGenomes-Tr; EBT00001635188.
DR   EnsemblGenomes-Tr; EBT00001635189.
DR   EnsemblGenomes-Tr; EBT00001635190.
DR   EnsemblGenomes-Tr; EBT00001635191.
DR   EnsemblGenomes-Tr; EBT00001635192.
DR   EnsemblGenomes-Tr; EBT00001635193.
DR   EnsemblGenomes-Tr; EBT00001635194.
DR   EnsemblGenomes-Tr; EBT00001635195.
DR   EnsemblGenomes-Tr; EBT00001635196.
DR   EnsemblGenomes-Tr; EBT00001635197.
DR   EnsemblGenomes-Tr; EBT00001635198.
DR   EnsemblGenomes-Tr; Tbis_R0001-1.
DR   EnsemblGenomes-Tr; Tbis_R0002-1.
DR   EnsemblGenomes-Tr; Tbis_R0003-1.
DR   EnsemblGenomes-Tr; Tbis_R0004-1.
DR   EnsemblGenomes-Tr; Tbis_R0005-1.
DR   EnsemblGenomes-Tr; Tbis_R0006-1.
DR   EnsemblGenomes-Tr; Tbis_R0007-1.
DR   EnsemblGenomes-Tr; Tbis_R0008-1.
DR   EnsemblGenomes-Tr; Tbis_R0009-1.
DR   EnsemblGenomes-Tr; Tbis_R0010-1.
DR   EnsemblGenomes-Tr; Tbis_R0011-1.
DR   EnsemblGenomes-Tr; Tbis_R0012-1.
DR   EnsemblGenomes-Tr; Tbis_R0013-1.
DR   EnsemblGenomes-Tr; Tbis_R0014-1.
DR   EnsemblGenomes-Tr; Tbis_R0015-1.
DR   EnsemblGenomes-Tr; Tbis_R0016-1.
DR   EnsemblGenomes-Tr; Tbis_R0017-1.
DR   EnsemblGenomes-Tr; Tbis_R0018-1.
DR   EnsemblGenomes-Tr; Tbis_R0019-1.
DR   EnsemblGenomes-Tr; Tbis_R0020-1.
DR   EnsemblGenomes-Tr; Tbis_R0021-1.
DR   EnsemblGenomes-Tr; Tbis_R0022-1.
DR   EnsemblGenomes-Tr; Tbis_R0023-1.
DR   EnsemblGenomes-Tr; Tbis_R0024-1.
DR   EnsemblGenomes-Tr; Tbis_R0025-1.
DR   EnsemblGenomes-Tr; Tbis_R0026-1.
DR   EnsemblGenomes-Tr; Tbis_R0027-1.
DR   EnsemblGenomes-Tr; Tbis_R0028-1.
DR   EnsemblGenomes-Tr; Tbis_R0029-1.
DR   EnsemblGenomes-Tr; Tbis_R0030-1.
DR   EnsemblGenomes-Tr; Tbis_R0031-1.
DR   EnsemblGenomes-Tr; Tbis_R0032-1.
DR   EnsemblGenomes-Tr; Tbis_R0033-1.
DR   EnsemblGenomes-Tr; Tbis_R0034-1.
DR   EnsemblGenomes-Tr; Tbis_R0035-1.
DR   EnsemblGenomes-Tr; Tbis_R0036-1.
DR   EnsemblGenomes-Tr; Tbis_R0037-1.
DR   EnsemblGenomes-Tr; Tbis_R0038-1.
DR   EnsemblGenomes-Tr; Tbis_R0039-1.
DR   EnsemblGenomes-Tr; Tbis_R0040-1.
DR   EnsemblGenomes-Tr; Tbis_R0041-1.
DR   EnsemblGenomes-Tr; Tbis_R0042-1.
DR   EnsemblGenomes-Tr; Tbis_R0043-1.
DR   EnsemblGenomes-Tr; Tbis_R0044-1.
DR   EnsemblGenomes-Tr; Tbis_R0045-1.
DR   EnsemblGenomes-Tr; Tbis_R0046-1.
DR   EnsemblGenomes-Tr; Tbis_R0047-1.
DR   EnsemblGenomes-Tr; Tbis_R0048-1.
DR   EnsemblGenomes-Tr; Tbis_R0049-1.
DR   EnsemblGenomes-Tr; Tbis_R0050-1.
DR   EnsemblGenomes-Tr; Tbis_R0051-1.
DR   EnsemblGenomes-Tr; Tbis_R0052-1.
DR   EnsemblGenomes-Tr; Tbis_R0053-1.
DR   EnsemblGenomes-Tr; Tbis_R0054-1.
DR   EnsemblGenomes-Tr; Tbis_R0055-1.
DR   EnsemblGenomes-Tr; Tbis_R0056-1.
DR   EnsemblGenomes-Tr; Tbis_R0057-1.
DR   EnsemblGenomes-Tr; Tbis_R0058-1.
DR   EnsemblGenomes-Tr; Tbis_R0059-1.
DR   EnsemblGenomes-Tr; Tbis_R0060-1.
DR   EnsemblGenomes-Tr; Tbis_R0061-1.
DR   EnsemblGenomes-Tr; Tbis_R0062-1.
DR   EnsemblGenomes-Tr; Tbis_R0063-1.
DR   EnsemblGenomes-Tr; Tbis_R0064-1.
DR   EnsemblGenomes-Tr; Tbis_R0065-1.
DR   EnsemblGenomes-Tr; Tbis_R0066-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01325; CRISPR-DR12.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001874.
DR   SILVA-SSU; CP001874.
DR   StrainInfo; 168803; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082801
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name Thermobispora bispora R51, DSM 43833
CC   Culture Collection ID DSM 43833, ATCC 19993, CBS 139.67, IFO 14880,
CC                         NBRC 14880
CC   GOLD Stamp ID         Gi02237
CC   Funding Program       DOE-GEBA 2007
CC   Gene Calling Method   Prodigal
CC   Isolation Site        Decaying manure
CC   Oxygen Requirement    Aerobe
CC   Cell Shape            Filament-shaped
CC   Sporulation           Sporulating
CC   Temperature Range     Thermophile
CC   Temperature Optimum   55 - 65C
CC   Gram Staining         gram+
CC   Biotic Relationship   Free living
CC   Diseases              None
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4189976
FT                   /organism="Thermobispora bispora DSM 43833"
FT                   /strain="DSM 43833"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="decaying manure"
FT                   /note="type strain of Thermobispora bispora"
FT                   /db_xref="taxon:469371"
FT   gene            270..1853
FT                   /locus_tag="Tbis_0001"
FT   CDS_pept        270..1853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bsu:BSU00010 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86738"
FT                   /db_xref="GOA:D6Y203"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y203"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADG86738.1"
FT                   /translation="MEGVDLDAVWARALRTLLDEGVSGQQRAFLQMTQPSGLINDTILL
FT                   AAPNDFAKEVIEVRLRPLIAHALAQELGRPVRIAVMVDPSAVPDAGVDRPDRQPMTQPG
FT                   QTGYPQHRPQTQPGFSTGLTTGSPGLATGGESAARHEAGPYSSSVPRPGGLAGEPRPEP
FT                   RPEPAHQRWDSRPSRSSSEPARLNAKYTFETFVIGASNRFAHAAAVAVAEAPAKAYNPL
FT                   FIYGDSGLGKTHLLHAIGHYAQSLYDGARVRYVSSEEFTNEFINSIRDHKADEFRARYR
FT                   AVDILLVDDIQFLEGKEQTQEEFFHTFNTLHNASKQIVISSDRAPKQLVTLEDRLRNRF
FT                   EWGLITDVQPPELETRIAILRKKAVQEGLAAPPEVLEYIASRISTNIRELEGALIRVTA
FT                   FASLNRQPVDIELAEMVLKDLISEESSPEITISLIMSTTAEYFGVSIDDLCGSSRSRAL
FT                   VTARQIAMYLARELTDLSLPKIGQQFGGRDHTTVMHAERKIRSLMAERRSMYNQVNELT
FT                   TRIKQRARNG"
FT   gene            2390..3526
FT                   /locus_tag="Tbis_0002"
FT   CDS_pept        2390..3526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bsu:BSU00020 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86739"
FT                   /db_xref="GOA:D6Y204"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y204"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADG86739.1"
FT                   /translation="MLFRIDRDQLAEAVAWTARSLPTRPSMPVLAGMRLEVTDDHRLKL
FT                   SGFDYEVSAEVTLDLETGEPGVVLVSGRLLAEITRALPAQPVNFTLDGAKAVVTCGSTR
FT                   FTLLTMPVEDYPSLPVMPPAAGRVGSDVFASAVAQVAVAVGKDDTLPMLTGVRMEIEGD
FT                   LITLAATDRYRLAVRELKWEPAQPGLQAVAMIPGRTLADIAKALGGTGAEVEIALSSGG
FT                   TGEGMIGFSSAGRRTTTRLLDPEFPKYRSLLPTEFSARADVATSAFVEAVKRVALVAER
FT                   NTPVRLTFRGGEVVLEAGSGDEAQAVEVLPVDFEGDEITIAFNHQYLLDGLAVLDSDVA
FT                   RMQFTTPTKPAIITAGKPAGEEAASDYRYLIMPIRLSS"
FT   gene            3637..4581
FT                   /locus_tag="Tbis_0003"
FT   CDS_pept        3637..4581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /note="KEGG: dde:Dde_3470 6-phosphogluconate dehydrogenase-
FT                   like protein; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86740"
FT                   /db_xref="GOA:D6Y205"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y205"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ADG86740.1"
FT                   /translation="MQIGMVGLGKMGGNMAERLRRGGHEVVGYDRNPAISDVGSLRELV
FT                   DRLQAPRTVWVMVPAGDPTRTTIERLGELLSAGDLVVDGGNSHYRDDQVHADRLGARGI
FT                   GFVDVGVSGGVWGLREGYALMAGGAPEHIERLMPIFTTLKPPGEDGFVHAGKVGAGHFV
FT                   KMVHNGIEYGMMQSLAEGWELLEASDLVTDVLATFRSWRSGTVIRSWLLELLVRALEED
FT                   PHLSELKGYAEDSGEGRWTVQAAVEHAVPLPAITAALYARFTSRQADSPAMKMIAALRN
FT                   QFGGHPVASAEGQTGKGADSPGADVIPPAEAER"
FT   gene            4719..5924
FT                   /locus_tag="Tbis_0004"
FT   CDS_pept        4719..5924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: afw:Anae109_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86741"
FT                   /db_xref="GOA:D6Y206"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y206"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADG86741.1"
FT                   /translation="MYVASLSLTDFRSYAGVELELEPGVSAFIGANGQGKTNLVEALGY
FT                   VATHTSHRVATDAPLVRHGAQRAIVRAAVVRDGRRALIELEINPGRANRARVNRALMPR
FT                   PRDALGLLRTVLFAPEDIALVKGDPAERRRYLDELLIARAPRFAGVRADYERVLRQRNA
FT                   LLRSAAAARSGRRGARRAEDEAAFAAIGAGDVLATLDVWDAHLVRHGAELTAARMELVD
FT                   ALRSLTAKAYAALAPSSGAVDLEYRSAAVDAAAAAPSTGGPGGGDRREAVAEWLRAALA
FT                   QARQAELERGVTLVGPHRDDLLLTLKGMPARGYASHGEAWSFALALRLAAYELLRADGG
FT                   DPVLILDDVFAELDHDRRRRLAEIVAPAEQVLITAAVPDDVPDELSGARFDVTGGCVTR
FT                   VR"
FT   gene            5914..6465
FT                   /locus_tag="Tbis_0005"
FT   CDS_pept        5914..6465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   gsu:GSU0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86742"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y207"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADG86742.1"
FT                   /translation="MSDETPEVPRSIGEGRQSPAAAAARGAALARAKLAEAKADAARRG
FT                   RLPRTEPRRDGGARPQPRGSGDPQPFARAIRELLAARGWERQAAIGGVFGRWAEIVGPE
FT                   LAAHTRPVSFADGELVVATDSTAWATQVRLLAGTLVRRLNEELGDGTVARVKVHGPGTG
FT                   PRPAGPLRVRGGRGPRDTYG"
FT   gene            6961..8904
FT                   /locus_tag="Tbis_0006"
FT   CDS_pept        6961..8904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bsu:BSU00060 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86743"
FT                   /db_xref="GOA:D6Y208"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y208"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADG86743.1"
FT                   /translation="MSYDASSITVLEGLEAVRKRPGMYIGSTGERGLHHLVYEIVDNAV
FT                   DEALAGHNDRIDVTLLADGGVRVADRGRGIPVGIVPSEGRPAVEVVFTVLHAGGKFDRK
FT                   SYAVSGGLHGVGASVVNALSKRLEVEVRTDGHVWRQSYVQAKPTGPLQKGEPTDDHGTT
FT                   VTFWPDETIFETTTWNFETLSRRFQEMAFLNKGLTITLTDERPEYINGEPKVVTYHYEG
FT                   GLADFVTYLNSKKEPIHGSVIYFEEHGDGISVEVAMQWNASYTESVYTFANTINTAEGG
FT                   THEEGFRAALTSVVNRYAREQRYLKEGKDDNLTGDDVREGLAAIISVKLANPQFEGQTK
FT                   TKLGNTEAKSFVQKACNDHLRDWFERNPGEAKEIINKAIQASRARIAARQARDLTRRKS
FT                   LLESGSGLPGKLADCQWSDPEKCELFIVEGDSAGGSAKGGRDPRFQAILPIRGKILNVE
FT                   KARIDKVLRNNEIQALITALGTGVHDDFDISKLRYHKLILMADADVDGQHITTLLLTLL
FT                   FRFMRPLIEAGHVYLAQPPLYKIKWDRKGEDASYAYSDRERDAIIEAGIAQGKRDPRLH
FT                   DGVQRFKGLGEMNASQLWETTMNPETRILRQVTLDDAAQADELFSVLMGEDVEARRQFI
FT                   IRNARDVRFLDV"
FT   gene            8933..11437
FT                   /locus_tag="Tbis_0007"
FT   CDS_pept        8933..11437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bsu:BSU00070 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86744"
FT                   /db_xref="GOA:D6Y209"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y209"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADG86744.1"
FT                   /translation="MTEVNTPPGPPADRIEVIDLQAEMQRSYMDYAMSVIVSRALPDVR
FT                   DGLKPVHRRVLYAMFEGGYRPDRGYFKSSRIVGDVMGSYHPHGDASIYDTVVRLAQPWS
FT                   LRYPLVDGQGNFGSPGNDPAAAMRYTESRMAPIAMEMLRDIDKDTVDFQPNYDGRSREP
FT                   VVLPSRFPNLLVNGSSGIAVGMATNIPPHNLRETGEAVQWALEHPELSDEELLEGLIER
FT                   IKGPDFPTGALIVGRRGIEEAYRTGRGSIIMRAVVELEEDAKGRQCLVVTELPYMVNPD
FT                   NLALTIAELVREGKISGIADVRDESSSRTGQRLVIVLKRDAVPKVVLNNLYKHTQLQTT
FT                   FGANMIALVDGVPRTLRLDQFVRHYIRHQIDVVVRRTRFLLRKAEERAHILRGLLKALE
FT                   RIDEVIELIRRSPSATEAQTGLMALLEIDEVQAQAILDMQLRKLAALERQQIQDEYDGL
FT                   MAQIADYNDILGSEMRQRRLVSEELGEIIAKYGDERRTKITAYEGDMSEEDLIAEEDVV
FT                   VTITRGGYAKRTSIDAYRAQRRGGKGVRGAQLRQDDIVEHFFVTSTHHWLLAFTNKGRV
FT                   YRFKAYELPEAARDARGQHLANLLAMQPDEHVMEILSLRNYDEAPYLVLATRSGMVKKT
FT                   RLAEYDSPRSGGLIAINLRDDDEVIAARLVSEEDDLLLVSKNAQAIRFKATDEVLRPMG
FT                   RATAGVIGMRFAEGDELLAMEVIRDGDEEVLVATEGGYAKRTPADQYPVQGRGGKGVLT
FT                   AKIVQSRGKLIGAIMVRPEDEVFAITSNGGVIRTRAAEIKRSGRQTMGVRLMHLSEGDS
FT                   LVALARNAESLNNEENGAGDGV"
FT   gene            11529..12353
FT                   /locus_tag="Tbis_0008"
FT   CDS_pept        11529..12353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG32656"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86745"
FT                   /db_xref="GOA:D6Y210"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y210"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86745.1"
FT                   /translation="MSETGKPRTPGAPVEGAARPASSSKQDAVSEAKGVTGATSASAKA
FT                   APADKATETVRVRPPAADRKWQGEPARNGGEPADGASGTESTAVYPRPSFDRPVASGGS
FT                   PTPGAPPAGPAPARSGADGAAQQGQRPAAFGAAESQAAGQKSNRTPRRAHLVVRRIEPW
FT                   SAMKFSFIISLVAFVVLFVAVAVLYGVLSSLGVFSTIIDTVTQLTGSGENGQQPVFDIA
FT                   SWFDPVRILGYTALVGAVNVVLITALSTIGAVIYNLSAELVGGIEVTLTESE"
FT   gene            12504..12577
FT                   /locus_tag="Tbis_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            12504..12577
FT                   /locus_tag="Tbis_R0001"
FT                   /product="tRNA-Ile"
FT   gene            complement(12943..13275)
FT                   /locus_tag="Tbis_0009"
FT   CDS_pept        complement(12943..13275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0009"
FT                   /product="protein of unknown function UPF0060"
FT                   /note="PFAM: protein of unknown function UPF0060; KEGG:
FT                   bsu:BSU08120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86746"
FT                   /db_xref="GOA:D6Y211"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y211"
FT                   /inference="protein motif:PFAM:PF02694"
FT                   /protein_id="ADG86746.1"
FT                   /translation="MTIARSILLFVLAALAEIGGAWLVWQGVREQRGLWWAGAGFLVLG
FT                   LYGLVATFQPDPHFGRILAAYGGVFVAGSLIWGMVVDGFRPDRWDLIGAAICLLGVGVI
FT                   MYAPRG"
FT   sig_peptide     complement(13204..13275)
FT                   /locus_tag="Tbis_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.568 at
FT                   residue 24"
FT   gene            complement(13508..14350)
FT                   /locus_tag="Tbis_0010"
FT   CDS_pept        complement(13508..14350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0010"
FT                   /product="putative periplasmic substrate-binding protein"
FT                   /note="KEGG: scl:sce7051 putative periplasmic substrate-
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86747"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y212"
FT                   /inference="similar to AA sequence:KEGG:sce7051"
FT                   /protein_id="ADG86747.1"
FT                   /translation="MSTRPAGGRPGLPCSGYGDRVEYDDLGLPVPVPDTVRRVVSLVPS
FT                   LTEAVAATDESLLAGATNWCTHPPGLDVPRVRGTKNPDLELIRSLRPDIVLANFEENRE
FT                   PDLAALRESGIPVWTTVIRTVDEALRSLDRMLTVACRLPRPAWLDRAAEAWRAPAPAFA
FT                   PARRAAIVVWRRPWMVVGRDTFTGDVLARLGVTNVFSGHPERYPKMPLDRIRETEPDLV
FT                   VLPDEPYRFTEDDGPECFPGIPAALVSGRHLSWYGPSLIEAPGLLTGQLRDAKARSAG"
FT   gene            14699..15592
FT                   /locus_tag="Tbis_0011"
FT   CDS_pept        14699..15592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86748"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y213"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86748.1"
FT                   /translation="MGALDAGRSSNFSMTVSVSGPVTEGGRLPLAELARIASGLQMTLE
FT                   RLALASTGTSIKPGRRPRDVVDAVRLDFTGFHEGSAVLEVSRPQEEAMNDLLRESLRML
FT                   GEGIEFLRQGHPLPAYLTPPVLNGLRELAGGISPHGVSRIQFQHPGGGFVIDSVFREAL
FT                   RRTPAQATEREVTVVGRLHMGDFSPATLRCRIDTYAGSILADFGSDLRDVILDAMDQLV
FT                   MASGRAELQPDGVTVRVMHLETVKRLTGAPITPLDRLAQEQGVRPIGNVDELRGDPIDD
FT                   LEEFLEVITAARRGEE"
FT   gene            15589..15990
FT                   /locus_tag="Tbis_0012"
FT   CDS_pept        15589..15990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0012"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   gur:Gura_1138 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86749"
FT                   /db_xref="GOA:D6Y214"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y214"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADG86749.1"
FT                   /translation="MRYVFVDTDVFSYLWQGVNVERYRRHLEGVIPALSFASVGELYYG
FT                   AAKKGWGAKKLQSLEEAIRRYLIAPYHEDIARLWGTLRARAAAQGHALGAPQQANDLWV
FT                   CATAIYYDAPLLTGNHRHFANFPGLSLLV"
FT   gene            complement(16061..18298)
FT                   /locus_tag="Tbis_0013"
FT   CDS_pept        complement(16061..18298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0013"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: bcb:BCB4264_A3829
FT                   copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86750"
FT                   /db_xref="GOA:D6Y215"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y215"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADG86750.1"
FT                   /translation="MASLTHRDPRATGATVELSITGMTCASCANRIERKLNKLDGVIAT
FT                   VNYATEKATVTIPEGFDPELLVAEVEKAGYGARLSSAERPSDEDADGLAALRARLITSV
FT                   VLAVPVIAMAMVPALQFPYWQWVSLALTLPVVLYGGWPFHKAALANLRHRATTMDTLIS
FT                   IGTIAALGWSLWALFFGTAGEPGMTHGFEFTVSRDGGTGDIYLEVAAGVTAFVLAGRYF
FT                   ELRSRRRTGAALRALLDLGAKDVAVLRNGREVRLPVAHLKVGDRFVVRPGEKIATDGVV
FT                   EEGASAVDVSMLTGESVPVEVRPGDPVTGATVNTSGRLVVRATRVGADTQLAQMAKLVE
FT                   EAQSRKAEVQRLADRISGVFVPIVIVLALGTLGFWLATGAGATAAFTAAVAVLIIACPC
FT                   ALGLATPTALLVGTGRGAQLGILIRGPEVLESTRRIDTIVLDKTGTVTEGRMRLTGLTT
FT                   AEGTTEEEALRLAGALEHASEHPIAQAIARAAAERLGELPTPEAFSNVEGLGVHGVVDG
FT                   RAVTVGRAAFLTERGHHLPGGLAEALRAAEAAGRTAVLAGWDGEVRAVFTVADTVKPTS
FT                   AEAVARLRELGLTPVLLTGDGEAVAKAVAAEIGVDEVIAEVLPADKVDVIKRLQAEGRT
FT                   VAMVGDGVNDAPALAQADLGLAMGSGTDVAIEAADLILVRGDLRAAADAIRLSRRTLRT
FT                   IKGNLFWAFAYNVAALPLAAAGMLNPMIAGAAMAFSSFFVVSNSLRLRRFR"
FT   gene            complement(18495..18722)
FT                   /locus_tag="Tbis_0014"
FT   CDS_pept        complement(18495..18722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0014"
FT                   /product="copper ion binding protein"
FT                   /note="TIGRFAM: copper ion binding protein; PFAM: Heavy
FT                   metal transport/detoxification protein; KEGG:
FT                   bpy:Bphyt_6893 heavy metal translocating P- type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86751"
FT                   /db_xref="GOA:D6Y216"
FT                   /db_xref="InterPro:IPR000428"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y216"
FT                   /inference="protein motif:TFAM:TIGR00003"
FT                   /protein_id="ADG86751.1"
FT                   /translation="MTATYTIKGMTCGHCVSSVKEEVGAIPGVTRVDVDLETGRMRVES
FT                   DAPIDPAAIVAAVEEAGYQVVTEPASGTGE"
FT   gene            complement(19035..20330)
FT                   /locus_tag="Tbis_0015"
FT   CDS_pept        complement(19035..20330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0015"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; Arsenical pump membrane
FT                   protein; KEGG: bcy:Bcer98_2196 citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86752"
FT                   /db_xref="GOA:D6Y217"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y217"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADG86752.1"
FT                   /translation="MTITAWLATFVFLAVYVLIATEKIHRVKAALLGAGILLLIHGTDA
FT                   ESAFFSERSGVDWNVIFLLLGMMVIVGVLRRTGVFEYLAIWAAKRAQGRPFRLMVLLTV
FT                   ITASASALLDNVTTVLLVAPVTFLVCERLALPVAPYLIAEALASNIGGTATLVGDPPNI
FT                   IIASRAGLTFNDFLVHLAPLVVLLMVAFLGLCRLLFRKAFTYDPERAAEIMQLDEKAAI
FT                   RDHVLLKQSLGVLSVVMAAFVLHPVLHYEPSVVALLGAGLLMLITKVKVEDVVRDVEWP
FT                   TLVFFIGLFVMVGALVNTGVIGTVSEAAASAGAGRPFLTSMVLLWGSAGLSAIVDNIPY
FT                   VAAMSPIVEHLVQQMPEGGTNGHVLWWALALGADLGGNATAIGASANVVILGLAERNKS
FT                   PISFWQFTRYGAVVAFATIAISMPYLWLRYLV"
FT   gene            complement(20327..20770)
FT                   /locus_tag="Tbis_0016"
FT   CDS_pept        complement(20327..20770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0016"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mno:Mnod_6174 CBS domain containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86753"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y218"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADG86753.1"
FT                   /translation="MRARDLMVPSPAVSLDSPVIDAANLMIESKLPGLIVLDERGTPYS
FT                   ILSGTQVLRLAIPQYCQEDPALARVIDEAHADRFAEALSRRTVRQVLPDRPSELPIADP
FT                   DATLLELAALMARTRCPLVAIVEKGRLLGAVALHPLMNRLFSA"
FT   gene            21240..21773
FT                   /locus_tag="Tbis_0017"
FT   CDS_pept        21240..21773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0017"
FT                   /product="protein of unknown function DUF1130"
FT                   /note="PFAM: protein of unknown function DUF1130; KEGG:
FT                   scl:sce8498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86754"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="InterPro:IPR014519"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y219"
FT                   /inference="protein motif:PFAM:PF06571"
FT                   /protein_id="ADG86754.1"
FT                   /translation="MFTVGHGARRIDEFLAVLREAGVTTLADVRRFPGSRRHPHFGREA
FT                   LAAALAEAGIRYEWHGKALGGRRSRRPRSRHTALRHAAFAGYADHMDTPEFRTAVQELA
FT                   ERARDERIAVMCAETVWWHCHRMLIADALAMRGVSVVHLLAVGRREPYRPHPAVRRGDD
FT                   GWPVYDVPDTLPGL"
FT   gene            complement(21805..22563)
FT                   /locus_tag="Tbis_0018"
FT   CDS_pept        complement(21805..22563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0018"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pde:Pden_0297 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86755"
FT                   /db_xref="GOA:D6Y220"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y220"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG86755.1"
FT                   /translation="MIEITNVTKRYGEHVVVDRVSLTIPRGGVTSIIGANGAGKSTLLS
FT                   IISRLIPADEGTVTVDGMDVATTPTERLARRLAILRQDNHMPVRLTVRELVAFGRFPHT
FT                   QGRLTAEDHRLVDEAMRYFELTDLADRHLDQLSGGQRQRAFVAMVLCQDTDYVLLDEPL
FT                   NNLDMRHSVHMMRRLRRMADDYGKTVVIVVHDINFASCHSDTIVAMKNGKVIAQGPTAE
FT                   MMTPEILAEVYDLGIDVHELSGHRIGVYFA"
FT   gene            complement(22560..23594)
FT                   /locus_tag="Tbis_0019"
FT   CDS_pept        complement(22560..23594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0019"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   atc:AGR_C_4491 ferrichrome ABC transporter (permease)
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86756"
FT                   /db_xref="GOA:D6Y221"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y221"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADG86756.1"
FT                   /translation="MTTTAESTVAPTRTGAAARSTGEAFAAARRRERRTIAVLALLALG
FT                   AVAAFAFAGIAGNWEFALAIRSRKIATMAVVGVAIAWSSVLFQTVTGNRILTPSIMGFD
FT                   QLFVLIQTVLVFLFGALALASADPRLLFSGQVVAMVGFAVLLYRWLFGRRGRDLYVMVL
FT                   AGVIFGTLFGSLSSLAARLINPNDFVVLQDSLFASVNQVDPGLLGFSALLIGAMAIWAI
FT                   RLCRRLDVVALGRDHAVSLGVDHAAVVNRALVIVAVLVSVATALVGPITFLGLLVANLA
FT                   RQLTGTFRHGALLPAAALIAVITLVGGQLILERVFTMDTALTVIVNFIGGIYFIVLLIR
FT                   ESRR"
FT   sig_peptide     complement(23433..23594)
FT                   /locus_tag="Tbis_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.609 at
FT                   residue 54"
FT   gene            complement(23591..24586)
FT                   /locus_tag="Tbis_0020"
FT   CDS_pept        complement(23591..24586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0020"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bmc:BAbS19_II05310 FecCD transport family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86757"
FT                   /db_xref="GOA:D6Y222"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y222"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADG86757.1"
FT                   /translation="MRKPSSAGRLRAWHLAAGVVLLAALAAASLFIGVGDMTPAGLLHA
FT                   REEDVRLLVESRLPRLLAVLLAGTAMSVAGLVMMHITGNRFVSPSTAGTTESATLGVLV
FT                   ATLFAGGEAVIVKMALAVACALAGTFVFMTLLRRLTFRDMILVPLAGIMFGGVIGAATT
FT                   FVAYRYDLLQTLGAWTSGDFSAVLRGRYELLWIAGTVTLLGYLYADRFTVAGMGRSFAI
FT                   NLGVRYDRVVNTGLVLASVITAVVVVTVGEIPFVSLIVPNLVTLALGDNLRYALPATAL
FT                   TGALFVLLCDVAGRVIRFPYEIPVSTVLGVIGSAIFLVLLLRGGRRLGVR"
FT   sig_peptide     complement(24449..24586)
FT                   /locus_tag="Tbis_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.511 at
FT                   residue 46"
FT   gene            complement(24586..25551)
FT                   /locus_tag="Tbis_0021"
FT   CDS_pept        complement(24586..25551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0021"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   oan:Oant_3797 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86758"
FT                   /db_xref="GOA:D6Y223"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR033870"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y223"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADG86758.1"
FT                   /translation="MRSQPLVRRLFALMLVPALLVLAACGGERSGSRDTAATPQQSAEQ
FT                   VTVAHAQGSTSVPKNPQKVIVFDVGVLATLDELGVKVAGVPSVENLPDNLAKYAGDEYP
FT                   KVGSLFEPDYEKVNSLSPDLIIVAARSAAAYGELTKIARTVDLSIDFSDFLGSFRQRME
FT                   AIGAIFGKEAEVKQRLDAIDAAVQETKAKAGDRTGLIVLTTGGKMSAFGPGSRFGLIHD
FT                   VIGVKPADPNLKVDTHGEAITAEFIAKTDPDLLYVIDRDAAIGEEGQPAQKVLDNALVN
FT                   GTKAAKNNKIIYLDPFTWYIAPNALSSVENMVKAVGDSLS"
FT   sig_peptide     complement(25471..25551)
FT                   /locus_tag="Tbis_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.753 at
FT                   residue 27"
FT   gene            26118..26618
FT                   /locus_tag="Tbis_0022"
FT   CDS_pept        26118..26618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86759"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y224"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86759.1"
FT                   /translation="METEASSGRDTSFLKNFLRVLTGRELRELREERRRFLDDKNALLA
FT                   ELRSVVDEANRVTTALRETADEAVNEIKKAVEEIQQETDSAPSMGERLSHELLQHWKQE
FT                   RNWNTSAIMSLEALAVNGKTDLAQWAAAELRNGGTISLGRDAKKRLILLSEGKVTPGAG
FT                   ARR"
FT   gene            complement(27246..28928)
FT                   /locus_tag="Tbis_0023"
FT   CDS_pept        complement(27246..28928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0023"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: mxa:MXAN_4017 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86760"
FT                   /db_xref="GOA:D6Y225"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y225"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG86760.1"
FT                   /translation="MGVGPYSAVQDADDLPRRVGPFRITHRLGAGGMGVVYAGIDARGR
FT                   RAAVKLVHPELAHDSEFRARFAREVVVLRRVAGTCTVRLLDADVDAKRPWLATEYVPGP
FT                   TLEQHVTAAGPLTGDQLLALAAGLAEAIKATHAAGVVHRDLKPSNVILSPSGPRLVDMG
FT                   IARLVDETSLTRTGVLVGSPGWISPEEYRGAEVGPPADVYGWGLLVLYAATGRTAFGRG
FT                   RPEVIAMRVLTDAPDLEGVPEPLKDLVAKALAKDPGERPDAAHLLESVSRIWRPDAEAS
FT                   GSAEEEVTRLLDQTWVMPAPEETDWIVPGRRRPWRSLGLAVAVTVACAALIGAVTVFGA
FT                   GRDTDQQAAARRQPPASPVAGAVQSPAAAGQPTAIPAEASITAPASPVTASPTPSARAG
FT                   RRVTMVQGYSFVLPDDWMYFPNNTHDINAFCLRPKDKEDDEYWFCHQYGMAIWPWQDDA
FT                   GEFRLEDISDPDEITGTRNPYGPCGESDPLARPGRMLKSGLYRIGDRKAYYRKAKSYCK
FT                   SGTTVETEILVLPVTRLTILIDELPAERRAQVDDILRSFRFPK"
FT   gene            complement(28888..30606)
FT                   /locus_tag="Tbis_0024"
FT   CDS_pept        complement(28888..30606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0024"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; aminoglycoside phosphotransferase;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: azo:azo3774 putative serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86761"
FT                   /db_xref="GOA:D6Y226"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y226"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG86761.1"
FT                   /translation="MADQEPTPLREDDPRVIGPYRLVHRLGVGGMGTVFAAVDDQGRRV
FT                   AVKRVHPELARDREFRERFRREIALLGRVQGEFVARMLAADPDAAEPWLATEYVPGPTL
FT                   TQRIAKQGPLGEQEVIGFAAALAEAIGSLHDVNVVHRDLKPSNLILSPIGPRLIDLGIA
FT                   RALDQTSLTRTGMVVGSPGWISPEEYRGDEVGPAADVYGWALLVLYAATGRPPFGTGRP
FT                   EVLATRVLTEVPEVSGVPAPLDELVRSALAKEPERRPDLAAIREGCRRAWRAVEAEAED
FT                   VTRFLERTWVMPATDEPEWRVPAPARRRLVVPALAAMLGMAVLGAGALAVTGLPGGPVA
FT                   TEAGPRAQPQVRGTALSAPPAVSTSPVSTPSSTVTASASGTTPASDATRYAVRARSADG
FT                   WLFLHPPGWTVTKEAGASGGETCVRPPDSPDCAARGVIIAYGVGVGREINLDIPEHTFP
FT                   LGFSLGGTYCADMHGISVDQRELRFNNVGHAYEFRKYQVICKNDRTFTAYSAYIRALDS
FT                   LIIGHRVAESDMNLIVGSFGRKYEYQGRLTNPVAPSNRSYVSHGRRSLLRSARRG"
FT   gene            complement(31386..32066)
FT                   /locus_tag="Tbis_0025"
FT   CDS_pept        complement(31386..32066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0025"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: AHDC1; AT hook, DNA binding motif, containing
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86762"
FT                   /db_xref="GOA:D6Y227"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y227"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86762.1"
FT                   /translation="MTADRTAHVSNPELTPDGHKRWLTTLKQVFSGKTPWPWTSHGQRG
FT                   DVRVAVCELGTDILAPRTARRFVVDVLRRWDMPDVRDDVELVVCELVANAINHGLRNTA
FT                   HLTPIRLLMFGVSRSLLCMVLDPSSEPPRPRSLDRTAETGRGLQVVAGISERWGWSPLP
FT                   TGKAVWASFTAPPPPESAVPPAVVRTQPVSAPAYGAPARPASMPPGGVRRTVSPARPGF
FT                   TCAT"
FT   gene            32651..32770
FT                   /locus_tag="Tbis_0026"
FT   CDS_pept        32651..32770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86763"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y228"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86763.1"
FT                   /translation="MKKLLVLALVALGGLLIWRKVQADRAELDLWTEATGSEN"
FT   sig_peptide     32651..32722
FT                   /locus_tag="Tbis_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            32810..33526
FT                   /locus_tag="Tbis_0027"
FT   CDS_pept        32810..33526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0027"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86764"
FT                   /db_xref="GOA:D6Y229"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y229"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ADG86764.1"
FT                   /translation="MAPVTLACLDLAGTTIGDIDMVERAFAEAIATQGIVPGTSAYARA
FT                   MVHVHRSRGCPKIEVFRGIFPGNEAQAQAANLAFERSFESALERTGLVSLPGTVEALEK
FT                   LRDNGIKIALISGFSRNTLSRVLSNLSWADMLDLALCPEDAGRGRPYPDMVLTAVLRLG
FT                   IDDVRQVAVVGDSESDMLCGRRAGASLVVGVLTGVHSRERLISGGATHILDSFADFPAL
FT                   VLDSEPDTPETVTSAR"
FT   gene            33646..33721
FT                   /locus_tag="Tbis_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            33646..33721
FT                   /locus_tag="Tbis_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(33957..34805)
FT                   /locus_tag="Tbis_0028"
FT   CDS_pept        complement(33957..34805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86765"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y230"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86765.1"
FT                   /translation="MVKYRWVHNGRVVGKGTVKVIRDKRISYTFKPNESHKGWVALEIV
FT                   SPRYGRSAHNAYQVTCEEPEPPAPPVETAASATAPEDYTGACPITRVFTGTVSVNRIEP
FT                   GGTTVQYRWMGPDFQGPTETLTFAEGDPLTKNVSHSVEVTASGPVQRWIEISSPNPAVS
FT                   ATAQTQVECQPLQITILNIQRSIDLSACGTPGYGPAITFSSPVQVNGPVRVEYRWDFNE
FT                   GELTVPGSFETTGPSTVTVSHRLESSPLTARDLMRVRLMITSHNVSGRVLDFTPPPCPA
FT                   S"
FT   gene            complement(34833..35450)
FT                   /locus_tag="Tbis_0029"
FT   CDS_pept        complement(34833..35450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK10816 gene product from transcript GK10816-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86766"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y231"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86766.1"
FT                   /translation="MISTGLARLAAAGVTALTALASGLLATPAAAGTAPVASTALAAGT
FT                   APVAGTALAAGTAPAKPAVSVKTPTVSPQRYVGRCPATLTFSAKVRLKVRGKTTVAYRW
FT                   VLSNGAKSAVKTTTVKGNGIKTVTFVKKVTFKKSAMGWMALQLLSPRKVTTGKTYFAVS
FT                   CQLPVRLKPGKPGHGKKPDFVKAYVHVPDYTGVCPPSRGVTA"
FT   sig_peptide     complement(35355..35450)
FT                   /locus_tag="Tbis_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.874 at
FT                   residue 32"
FT   gene            complement(36117..36611)
FT                   /locus_tag="Tbis_0030"
FT   CDS_pept        complement(36117..36611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86767"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y232"
FT                   /inference="similar to AA sequence:KEGG:Dole_1383"
FT                   /protein_id="ADG86767.1"
FT                   /translation="MSVGGEAGGRFRDPRIHVWQLTHTVLVRCPACGGCALVLRDLDAA
FT                   DRVPELSSALSGRRRLRCRACGFGKDEFFSEFLFGGPVDPFFRLPLWLQAGCRGHVLWA
FT                   YNVQHLDLLESWVAARLRERRAVPGSLSMLARLPAWVTSAKNRDDVLRAIHRMRASLPR
FT                   S"
FT   gene            complement(36798..38630)
FT                   /locus_tag="Tbis_0031"
FT   CDS_pept        complement(36798..38630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86768"
FT                   /db_xref="GOA:D6Y233"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y233"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86768.1"
FT                   /translation="MQLADRLFVPDERWGFEFREPEPIRANPYLDQEPVWQEPPLPEEL
FT                   VDLLQAQQEAEAKRKDRIRYMITMLACATLPPLMFILLPVAAWFGFQWFIRPNLNKQRI
FT                   DQLQHEYRKVRDAAFAQYQVAVQNWKQAVAAYDEAERRRWETAVSWYPIRLVSAPSRVD
FT                   VFGGTPEGWASLLATAGGSLLGARQDLVLLDFTEHDVGGGLAALTAVRGIPVNRIALPN
FT                   ELHRIDLLATASTDECAELLAEAVHGLRQSTNHADARALHADLLNAVLQRLSGPLSFTR
FT                   IAAGLAVLQGAYEPSGGGPLHSAEVERLSAYAGTLGQSEFTLKELRFLSNTLHLLAVDG
FT                   GARRMASDGTEPGTGYDSPWNLRGLTIVATFDNNRRRKEFTDHVLAQELVRALSNREPQ
FT                   GVVVVAGADHLGLQTLEAITKYARRADVRLVLLIEHLRGELQQLMGGTDSATFLMCLRN
FT                   HQEATTAADYIGRGFRFTLSQITEQVGRTLVTGGAESWGVQHQEGESWGSSWSTSRGPD
FT                   GTTKSGGGHHSTSESWSRSWQETRKWATADSETVGRTMSRVYEYMVEPTTLQSLPTTAF
FT                   ILVETGPAGRRIIAGDCNPGIALLDNVSDRPWPS"
FT   gene            39113..41599
FT                   /locus_tag="Tbis_0032"
FT   CDS_pept        39113..41599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0032"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10507 gene product from transcript GH10507-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86769"
FT                   /db_xref="GOA:D6Y234"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y234"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86769.1"
FT                   /translation="MSGEPWPAPGARWPSRRHPVDRRVPAAAPLIAVLLSLIAVVFGAV
FT                   SPASATAVPASPSAVAPVPGRAPAAAAATPATAPHASPPASPAREPAAAVSPPASAAGE
FT                   PAVASVSVSTAGEPAVASAPPAAAAAAPQPREARSGTVSPADQAQRVAVIGVPGLRWGD
FT                   LDPERTPNLWQLATEGAVASLSTRTIPPEGTSVNCPVAGWLTVSAGQRAAAPGPGCPPA
FT                   PEPVRAADGSATVPGWSELAALQRSSAYQASIGLLGQAITAAGGRVAAVGPGAALAAAD
FT                   QNGRVATYARTPGELPDLTPYAAVFAEAGEIARAWWRAGQGRAVELDDAARATAVRAAD
FT                   RTVGELLRHLPPETLVLVAGLSDAGSLAHLHVAIALGPGRGEPYWRSTLTAASTRQDAL
FT                   VTITDVTATVTHVLGLPTPEGAVGRPWRPAGPAPEDPVAELAAADLAGQVLREIRPSFY
FT                   TALVIVQLAFYGIAAAVVRRFRRMLTAVQVVAVVSGAVPVATFLAQLVPWWSAGRPMLA
FT                   LNAVILGFAVLIAGLAFAGPWRRHVLGPLTVVAGVSSLTLLIDVMTGSHLQVNAVTGYE
FT                   PVTGGRFYGFGNIAFAVFATGTILFLAGLWRLRCGLLRPVVLGYALFAIVVDGWPGWGA
FT                   DFGGVPSFVLGVAVFALLAFGLRISPGRLGLIALGGAVLIAALSVADWLRPADRRTHLG
FT                   AFVDQVLAGEGWPIVTRKLSAMLNTLGNVWLTLLALVAVAFLFLVLHKPSRWGASALSQ
FT                   AYGRAPELRAGLFGALATAICGFVLNDSGIAIPAMALTVAVPLTLAAAVRALRLGPPTT
FT                   ADRSSAESARTAPPTP"
FT   sig_peptide     39113..39265
FT                   /locus_tag="Tbis_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.614) with cleavage site probability 0.308 at
FT                   residue 51"
FT   gene            complement(41499..43154)
FT                   /locus_tag="Tbis_0033"
FT   CDS_pept        complement(41499..43154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_0338 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86770"
FT                   /db_xref="GOA:D6Y235"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y235"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86770.1"
FT                   /translation="MAAETARPAWPFGRSGVRPLNGTAAARFAVAASWLSILCTITIGL
FT                   LGPSAMVPALPGPAWHPPYSLGLAPDGHLVIALAAAAIVLGAAGLATGLLAAERLPGAR
FT                   TLVAAGCAAAAVLAFLPPSGSADHLNYAAYGRIAVLGHDPYVTVPADLPGDPVTGAVEE
FT                   WRNTPSVYGPVATALQTLAGHIGGESVRLTVFVLALANAAAFIATGLFLHHATRGDRGR
FT                   QRRAALLWIANPLLIYQLAAGMHLDTLAIAFAVAGLVACAGVPLGLGVAVKVTAGLVAP
FT                   GLAWELRRRPARLALVVVTATATVLVAYRLAGPHALDQVLNASRSISLATPWKLVQRAL
FT                   QALFGPGAYRPWIQAGSLALLASLAGLLLRRLLARDRAARASGPAGAVGPSGAAEAAGP
FT                   LGAAGAAEPSRPVDRSSGAEGPGDPAGSALPPATAVAGTPAAVPYREGAAVALALTAAW
FT                   LFAAPYVLPWYAGLAFALLALVPASALEAFLVAHLTALSLGYLPARQHGQPADLGWLVS
FT                   VVREWAVPCALIPLTIGLLWWAARAGARAPRPRA"
FT   gene            complement(43212..43952)
FT                   /locus_tag="Tbis_0034"
FT   CDS_pept        complement(43212..43952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0034"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bha:BH2769 dolichyl-phosphate mannose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86771"
FT                   /db_xref="GOA:D6Y236"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y236"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG86771.1"
FT                   /translation="MNERITPDTAVVIPAKDEAERIGATVTAAAKLPGVDLVVVVDDGS
FT                   ADETARVAAEAGARVVRHSRNRGKAAAMETGAEAVRLLDGEQPRHLLFLDADLGDTAAA
FT                   AHALITPVRSGAADMTIANFTTRVKLGGHGMVVRLARDGIKRLTGWEARQPLNGQRCLT
FT                   RAAFEAALPLAFGFGVETGMTIDLLRAGFRVLEVEVDMAHRATGTDWRSQLHRAKQFRD
FT                   VALALAAREPVIAQGVRTIRALRR"
FT   gene            complement(43959..44309)
FT                   /locus_tag="Tbis_0035"
FT   CDS_pept        complement(43959..44309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0035"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   sat:SYN_02356 anti-sigma F factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86772"
FT                   /db_xref="GOA:D6Y237"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y237"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADG86772.1"
FT                   /translation="MELKVATRSSGGTAIVAVSGEIDLYTAPQLQAEFARLISTSPQRV
FT                   VIDMSEVEFCDSTGVNVLLSALKRLRERGGDLEVAAPRSAVRKILQVTGLDSVFTVHDA
FT                   VPDDLLTTEHKG"
FT   gene            44517..45068
FT                   /locus_tag="Tbis_0036"
FT   CDS_pept        44517..45068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86773"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y238"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86773.1"
FT                   /translation="MGPEKMSSGIPEDPSRQRVREHLEIIQSRGAKASIWRETIEPLRQ
FT                   LINREGHVPVTTRLTPEDLDFLAEARDDVLTLTELVLRLLELHQPRDAGGITTDPSRPI
FT                   LRCRSCMWRWPCPTFRAMSEAFAPRERPERINRYPIGTAWQAQRGLHRAGEGAAGPRVP
FT                   GIPEPAGGGEAAGHDVPGEP"
FT   gene            45108..45281
FT                   /locus_tag="Tbis_0037"
FT   CDS_pept        45108..45281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86774"
FT                   /db_xref="GOA:D6Y239"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y239"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86774.1"
FT                   /translation="MARIALTVLGIFLALWLVFGFVLPTLFAIFKFLLFAAVLAFLGFV
FT                   AVTLVGKVSGRS"
FT   sig_peptide     45108..45170
FT                   /locus_tag="Tbis_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.313 at
FT                   residue 21"
FT   gene            complement(45442..45897)
FT                   /locus_tag="Tbis_0038"
FT   CDS_pept        complement(45442..45897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0038"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: cak:Caul_4555 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86775"
FT                   /db_xref="GOA:D6Y240"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y240"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG86775.1"
FT                   /translation="MLPYAPSSVAIARQRLSAELQAAGLVSSAVDDVVLVLSELLSNAL
FT                   RHAHPLPSGKLRVAWSCSESHVEVQVSDGGAATEPRAGCLTLSSLGGRGLSIVDYVAER
FT                   WGVRHEDRQTTVWARITASWESKNGTGPHTAEHPPGAAGRTETRGNR"
FT   gene            complement(46026..47942)
FT                   /locus_tag="Tbis_0039"
FT   CDS_pept        complement(46026..47942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0039"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: gur:Gura_1221 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; GAF domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86776"
FT                   /db_xref="GOA:D6Y241"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y241"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADG86776.1"
FT                   /translation="MGDVDGSWVTDGDADGVAGAVVASAPDAIVAFDRDLAVVSWNAAA
FT                   ERLFGWQAEELVGKRAPIVPRELMAEHNAVLERVRTGGRVSLRSRRYHRDGRLLDVRVD
FT                   TSALRSPTGALLGYVSVYHSVEDDDAAQGGAARRARLVRRLTDVVADINADLDLPIVLD
FT                   RIAASLTELTGADAGAFASIEGDRLRLVGLHRLPEEARGSTAELATSLVGKLLRTGRPV
FT                   LLETGVGDGCEEPLRAYVPGVHTIAVGLAAVGGRPYGALYALFARHRASHVELELLELL
FT                   AGHVGIAVGNAMAYQEAVRQRAHERAVFDACADGIAVLDGESRVVRWNAAAAELTGLTA
FT                   AEVIGKPPPFPLPAPGEKLTFRLPSGRWLDVLCNEIPETGEAVVDFRDVTRAKELEEAK
FT                   DLFLAVTGHELRTPITIVRGFASTLDRRWDALSDAERRSAVRTIAERANALGRLMDHLL
FT                   LGAWAGTGALTITTEPFDLGERIRAATLGLPALSDRHRIEVDVQPGLPLVHGDALATEI
FT                   LLGQLLENAFKYSPDGGLIRVAAWAEGDRVVVVVEDEGVGIAPADRERIFERFVQADSG
FT                   NRRRFGGVGLGLYIVRSLARAQGGEVTAHPRPGGGTRMRVVLPCAVPDSGQGKQKAPMT
FT                   TDQ"
FT   gene            48039..48602
FT                   /locus_tag="Tbis_0040"
FT   CDS_pept        48039..48602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0040"
FT                   /product="methylated-DNA/protein-cysteinemethyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S- methyltransferase DNA binding; KEGG: pol:Bpro_1637
FT                   methylated-DNA--protein- cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86777"
FT                   /db_xref="GOA:D6Y242"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y242"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADG86777.1"
FT                   /translation="MSSGDLEALLRVTAPGYKGEPAPDIALGTTDGPVGRLVLAVTARG
FT                   VVACSYEDEDTVYARIHKSLGGSIGSDPRRIDPVRRELDAYFEGRLRAFSTPADLQLAA
FT                   PFVRTVLQMMLSVPYGTTTTYRDIAARIGRPQAVRAVSSALSANPVCLFVPCHRAVESA
FT                   ESLGGYAGGAEAKGYLLRLEGALA"
FT   gene            complement(48668..50041)
FT                   /locus_tag="Tbis_0041"
FT   CDS_pept        complement(48668..50041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0041"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: bxe:Bxe_A3437 nucleobase/cation symporter,
FT                   (NCS1) family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86778"
FT                   /db_xref="GOA:D6Y243"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y243"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADG86778.1"
FT                   /translation="MTSGRVGSDRSEAPLTLDEEPPKTLGLLDQGAFWANLGVSLLGFS
FT                   GALFLLDPLGGEPLTFPAALLAAVIGSLIGTAMVGVSAIPGTQTGRPAMVLLRGLFGTR
FT                   LSYVPTVLNIVQMLGWGAFELWVIARGAQAIFGPGTPYALWVVLAGVVTIALTIRPLGS
FT                   LRLLRRYVTAGVIVSMVWLSVVLFARVPSLGEGSWHAFAPAVDYVIALSVSWVPLAADF
FT                   TRHSRSSAAAFTGVVGGYTIAQVACLALGIAALAIVGNDPDRVWDPFVAAPLGGLFFGI
FT                   LVLREVDQSFANVYSTTMSIQNLRPRLDRRVISVAVGVVTILIALVADVTAYGAFLSVI
FT                   GAVFVPMFAVLAVDYFVLGGASRWNTAEDAPARWLMLVPWLLGFAAYWLVTATPTVGWW
FT                   DAIWAAARSAIGFTSPPWLNAALAAFVISAAGTLLAGPIVRRRRMAEAERRDPALTGR"
FT   misc_binding    complement(50031..50147)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 49.44"
FT   gene            complement(50326..50649)
FT                   /locus_tag="Tbis_0042"
FT   CDS_pept        complement(50326..50649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0042"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: bch:Bcen2424_5472 beta-lactamase
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86779"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y244"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADG86779.1"
FT                   /translation="MTVHEVDASEVPENAFLLDVRELDEWRAGHAPQAVHIPMGDLRSR
FT                   IGEVPDAQPIYVICRAGGRSAQAAAWLNHIGKQAINVGGGMQSWAAAGRPMVSETGMPP
FT                   YVA"
FT   gene            complement(50792..51670)
FT                   /locus_tag="Tbis_0043"
FT   CDS_pept        complement(50792..51670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0043"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycosylase catalytic
FT                   domain protein; DNA glycosylase/AP lyase, H2TH DNA-
FT                   binding; KEGG: afw:Anae109_0505 DNA-formamidopyrimidine
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86780"
FT                   /db_xref="GOA:D6Y245"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y245"
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /protein_id="ADG86780.1"
FT                   /translation="MPELPEVEALAAFLRARAGGRTVAGADVVAVQALKTVNPPPAALV
FT                   GRAITGVHRHGKFLDLECEGLHLVAHLGRSGRLRWRDDLTGARPARSGRGPLAARVRLS
FT                   PDPEGRAPGFELHEAGPRKRLALYVVHDPAEVPGIAGLGIDPLSDGFTVARLREIVRAG
FT                   CTQVKGLLRDQRLISGIGDAYSDEILHAARLSPFKLADSLTDDQVAALHSAIVTVLGEA
FT                   VAEARALAAERPEPHPRLRMRVHGRTGEACHACGDTIREVSFADSALQYCPTCQTGGRP
FT                   LADRRLSRLLR"
FT   gene            complement(51729..52346)
FT                   /locus_tag="Tbis_0044"
FT   CDS_pept        complement(51729..52346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0044"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG:
FT                   ret:RHE_CH00249 TenA family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86781"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y246"
FT                   /inference="protein motif:PFAM:PF03070"
FT                   /protein_id="ADG86781.1"
FT                   /translation="MRFMGISQELQAIGRPMLDAQLAHPTVRGIANGDLPEEVFRSWLE
FT                   QDYLYLHDYVRVFCRLAWQAPDKHLGDLVDLAYSTFHDELNLHRSLSAEFGADLEGAVK
FT                   GPACAAYTSFLLEAAANYAEGLAALYPCMWGYSTLGQILAKNPPAEPRYRRWVETYADP
FT                   NFAALADRIAVMLDEANPDPERAKALFIEGMNHELAFWDVPV"
FT   gene            52385..53041
FT                   /locus_tag="Tbis_0045"
FT   CDS_pept        52385..53041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86782"
FT                   /db_xref="GOA:D6Y247"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y247"
FT                   /inference="similar to AA sequence:KEGG:BH0832"
FT                   /protein_id="ADG86782.1"
FT                   /translation="MTLTIAEELLLLGYHDETGRPQAGSVELDAAVAGALLAELAVAGR
FT                   IDLRDDMVVVTDRSPVGDEELDAVLARVHGEPKPRKAQWWVERLRSGELRKRLLRRLAE
FT                   RGVLSEETTKLFGLIPLRRYPERDPSAEQEIRRRIENVLTGADPDPRTAVLISLLHAAR
FT                   LDRKAFPKTHRRRIKEIAEGEWAGAAVYRAIVAVQAAVTAAVAAAIAATSAAAGS"
FT   gene            complement(53193..54155)
FT                   /locus_tag="Tbis_0046"
FT   CDS_pept        complement(53193..54155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0046"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   bcr:BCAH187_A5364 transcription antiterminator, LytR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86783"
FT                   /db_xref="GOA:D6Y248"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y248"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADG86783.1"
FT                   /translation="MGGGRSLGKVIRTTLVCALVLLLVFVVGGYFWIGSRLTTTEAFSD
FT                   YPGRPEETPGTDWLLVGSDSREGLTAAERKRLATGSVGGRRTDTVMLLHIPRDGRPTLV
FT                   SLPRDSYVPIDGHGRNKLNAAYAFGGPELLVKTVEQVTGIRIDHYMEIGFGGFVDIVDA
FT                   IGGVEICVKQNIKDPKAGINLKKGCQVMDGGTALGYVRTRATGAIPDLERTQRQRQFLA
FT                   ALVSKAASPGTLLNPFSSVPLALSAADAVTVDPGTGPIDLLRLALAMRDKPISTAVPIG
FT                   ALPTINGMAVVKWDTEKALRLFNALKEDRPVPKDVLSNK"
FT   gene            54640..56202
FT                   /locus_tag="Tbis_0047"
FT   CDS_pept        54640..56202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0047"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   pde:Pden_3115 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86784"
FT                   /db_xref="GOA:D6Y249"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y249"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADG86784.1"
FT                   /translation="MSAAIGLLAVVIITFATGFFVAQEFAFVAANRTVLREQALRGDRS
FT                   AERALTVTSRLSFMLSGAQLGITVTTLLVGFIAEPAIAAGVRGPLLAIGVPEEMVPGVS
FT                   ITLGIAFATVLQMIFGELAPKNLGIARPEPVARFLARPTLVYLKVAGPVIRLFDSAANR
FT                   LIRLAGMEPVEELEHGVTARELARIVDESAAAGELPRRLADLLDRALEFGDRTTEDVMV
FT                   PRPRVVSLRADRPVGDLLEALRSHGHSRYPVLGEAPDDVVGVTGLTEYVRAGSPRTGVI
FT                   RDITRPAMLVPATLPLHALLERMTAAGETFACVIDEYGGLAGVVSIEDLAEELVGELVD
FT                   ENDPEPLGVVRVGDDGWNVPGTLRLDEVERATGVRLPESEDYETIAGLVLARLGRMAEV
FT                   GDEVAVAVLPDDDLFAEEEQRHAALGVLSVRRRVPEWVRLTLRMGPPPNPGDDSTAEPD
FT                   VRWAHGRRLPVSPPQGRGAGRPMGGPAAPPPVNGAAVPEGEPVSPRAASEAGSSEPLGW
FT                   RAR"
FT   sig_peptide     54640..54720
FT                   /locus_tag="Tbis_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.641 at
FT                   residue 27"
FT   gene            56199..57203
FT                   /locus_tag="Tbis_0048"
FT   CDS_pept        56199..57203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0048"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; KEGG: shl:Shal_2700 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86785"
FT                   /db_xref="GOA:D6Y250"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y250"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADG86785.1"
FT                   /translation="MTDLGAILLGVLLLIGNGLFVAAEFAVVSAQRHRMEELARAGGRP
FT                   ARIAARAAVRSSRELSLMLAGAQLGITLCSLGLGMVAEPAVEHLLGPVLVFLPEAIHTP
FT                   VAYLVALGLVTFLHMVVGEMAPKSLALTHPERAALGLALPFRGFVWIVRPLLALLNGLT
FT                   NATLRLVGVRPRDELAVAKTPRQLAMLVAESGRMGMLDRHKHDLLLRAFRAQTRRVEEL
FT                   MLPVDQAPAVPAGASADLIRATAARDGGHRMLVVSPDGVLGVLHVRDALINPDRPPETL
FT                   ATAAPRIPAGTTVPDAVTVLQEARAQLGLVTDERGAVIGVVDLTRLIGELLAA"
FT   sig_peptide     56199..56279
FT                   /locus_tag="Tbis_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.752) with cleavage site probability 0.322 at
FT                   residue 27"
FT   gene            complement(57614..57697)
FT                   /locus_tag="Tbis_R0003"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(57614..57697)
FT                   /locus_tag="Tbis_R0003"
FT                   /product="tRNA-Leu"
FT   gene            57850..58587
FT                   /locus_tag="Tbis_0049"
FT   CDS_pept        57850..58587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0049"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_1361 FHA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86786"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y251"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG86786.1"
FT                   /translation="MGVLQRFERRLEGLVEGAFARAFKSDLQPVEVASAIQREMDERAA
FT                   IVAQGRTLVPNDFVVELSITDGERLQVYADSLCQELANLAREYAKEQGYSFVGPVRVRF
FT                   ETADDLAVGLFRIRSGVIRGATVEQDEIRHPVTDMPVRKGVFRGRPRLLVSTQDDPTGQ
FT                   RSFELTTPVTLLGRGTDCDLRLVDPGVSRHHAELRIEGDKVVLVDLGSTNGTFVNGQPV
FT                   RRIEMQDGTRVTLGRTTLVFRRD"
FT   gene            58606..59076
FT                   /locus_tag="Tbis_0050"
FT   CDS_pept        58606..59076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0050"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: bbt:BBta_4519
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86787"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y252"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADG86787.1"
FT                   /translation="MSELTLLLIRIAFLALLWLFVIAAVGVIRTDLFGPRTAPAPGRSP
FT                   ARQGMALPKLKPKRGQPRQLVVTAGPLQGTVIDLTDSPITIGRASDATLVLNDDYASSR
FT                   HARLFPQDGQWIVEDLGSTNGTYLERSKVTRPTPVPVGVPIRIGKTVLELRK"
FT   sig_peptide     58606..58677
FT                   /locus_tag="Tbis_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.680 at
FT                   residue 24"
FT   gene            59073..60353
FT                   /locus_tag="Tbis_0051"
FT   CDS_pept        59073..60353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0051"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: nmu:Nmul_A1997 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86788"
FT                   /db_xref="GOA:D6Y253"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y253"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADG86788.1"
FT                   /translation="MTIALRYAARSDVGLLREGNEDSAYASGRLLAVADGMGGHAHGEV
FT                   ASSVAIAALSSLDRDTSGSDLVSDIEAAFRDANHQLQELVNRDPSLKGMGTTLTAMLWN
FT                   GLRFALAHVGDSRAYLLRNGELYQITHDHTLVQSLVDDGRITQEEAANHPQRSILLRAL
FT                   DGTAEVDPDLQDREAQVGDRYLLCSDGLSTVVSPETLHHTLTTIEDPEEVVRQLIDLAN
FT                   RGGGPDNITCVVADVIEIDDPEPPQTKAAIVGAAGSGRLEALSRDLGLGNGLGNRSAVT
FT                   APQPVITDEDLDDAPAGRAGRRARGRRTWLRVLGGITVTAAALGAGGYGAQQWINSQYY
FT                   VGAQGDRLVVYQGIDAELGPLSFKKVAYTENVRLSSLPAVQQSQIRSGIQVEDLQDGIE
FT                   TLKRFAASAQPSTETIDTLSSPSGSGQ"
FT   gene            60350..61732
FT                   /locus_tag="Tbis_0052"
FT   CDS_pept        60350..61732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0052"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: dps:DP2425 cell
FT                   division protein (FtsW)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86789"
FT                   /db_xref="GOA:D6Y254"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y254"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADG86789.1"
FT                   /translation="MSAIPSPQVPTTAKRRVVQLGMLTFAMLVVMAAYAGVGLGINGQV
FT                   PSGMLGYGLGLGGLVFAAYLVLARFAPWADPLLLPLVTLINGIGLVMIYRIEQAGQPGA
FT                   NATTQLMWTALGVVMFAVTLIVLRDHRILQRFTYTAGFAGLVLLAIPAILPSSLSEVQG
FT                   AKIWIRIGGFSIQPGEFAKLALVVFFAGYLVAKKDVLSLAGRRLLFIDLPRGRDMGPIL
FT                   ITWLLSLGVLVLEKDLGTSLLLFGAFIAMLYIATQRTSWVLIGLLLFVGGAYLAGQIFS
FT                   HVEARFEGWLHADDNEIYNRTFGGSYQLMQGLFGIGSGGILGTGLGRGHPELIPLSFSD
FT                   FIFPAVGEELGITGLMALLMVYMLIVERGLRTALGARDPFSKLLAGGLSFILAWQVFII
FT                   VGGVTRLIPLTGLVTPFMSAGGSALLANWMLIAMLVRMSDAARRPPPQAIQNEGETQVM
FT                   RR"
FT   sig_peptide     60350..60457
FT                   /locus_tag="Tbis_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.892 at
FT                   residue 36"
FT   gene            61729..63186
FT                   /locus_tag="Tbis_0053"
FT   CDS_pept        61729..63186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0053"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: sat:SYN_00551 cell elongation specific D,D-
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86790"
FT                   /db_xref="GOA:D6Y255"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y255"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADG86790.1"
FT                   /translation="MNSTVKRTAVACLFMFLLLMGNVTYIGAVQAEGLKNDPRNARAFF
FT                   ARYNIDRGWITANNGKVTLARTKDTGDATFRFKREYPGGKAFSHVVGYFAPESATGIEA
FT                   AAGRYLDGTHPDLVVRRAIDLVSGKPAKGANVDLTLDVQAQRVAYRLLNGTGKRGAVVA
FT                   LDPKTGAVLAMVSSPSYDANPLAQPNKAKVNAAWQKLNKDDNKPLINRAIEQTYPPGST
FT                   FKVVTSAMFLSEDTSRDENTVVDAPDALPLPGVVQPLRNYRGESCGGQATMLRALAISC
FT                   NTPFAKIGMDLGYDRLKEQAERFGVGKPLEIPLYVQPSDIGPQEDKAALAQTSIGQRSN
FT                   RMTPLQMAMVAAGIANNGTVMKPYLINKIVAPDGTELEVTEPEELTEAVSPEVAAELTR
FT                   MMVGVVQQGTGRAAQVPGITVAGKTGTAETGPGQPSHAWFICFAPAEDPKVAVAVIVES
FT                   GSAGSDATGGAVAAPIAREVIQAVLGR"
FT   sig_peptide     61729..61824
FT                   /locus_tag="Tbis_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.943 at
FT                   residue 32"
FT   gene            63183..64589
FT                   /locus_tag="Tbis_0054"
FT   CDS_pept        63183..64589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0054"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: azo:azo3774 putative
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86791"
FT                   /db_xref="GOA:D6Y256"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y256"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG86791.1"
FT                   /translation="MNPDTVLGGRYRLISRIAAGGMGEVWRALDESLGREVAVKVMHSH
FT                   VAADPSFRTRFRTEARITAALTDPGIAQVYDYGESDSVAYLVMELVHGEPLAAILSRNG
FT                   ALDPQVTLDIIEQAAKGLYAAHRNGVIHRDIKPGNLLVTEDGQVKITDFGIARALEAAR
FT                   LTRTGTVLGTAQYVSPEQASGSELTPASDIYSLGVVAYECLAGRPPFTADTPVALVLKH
FT                   INTPPPPLPETVPQAVRDLVSAMLAKDPAARPADGAELARRVRALRATLTGEPARRLGA
FT                   LTDPSGFPVARTAGLPPQEPRDLPTTKPELPETAAAGPGPGSGRRTGRRPVIIGGVVAG
FT                   CALAAVIGVLAPRFTESAVEPPRERPASPTPEVSPTPVQPSRSPAVRPTQRVVQVPSAT
FT                   PFPTPSATVITSAPATWTPTPSASPTPSLSQTPPSTPTHQPTDTAAPTASPTETSPPDD
FT                   EGTDEKGVDD"
FT   gene            64631..66478
FT                   /locus_tag="Tbis_0055"
FT   CDS_pept        64631..66478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0055"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: bsu:BSU15770
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86792"
FT                   /db_xref="GOA:D6Y257"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y257"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG86792.1"
FT                   /translation="MIQPRLLGGRYQLESVVGRGGMAEVYRARDIRLDRIVAIKTLRSD
FT                   LARDHTFQARFRREAQSAASLNHPSIIAVYDTGEDVVDGTPVPYIVMEYVEGRTLRDVL
FT                   RTERKVLPERALELTDGILRALDYSHRGGIVHRDIKPANVMLTNSGEVKVMDFGIARAM
FT                   ADSAATMTQTAQVIGTAQYLSPEQARGERVDARSDIYSTGCVLYELLTGQPPFTGDSPV
FT                   AIAYQHVREDPIPPSHIDPEIPKWADAIVLKAMAKDPFQRYQSAAEMRADIQRVLSGLP
FT                   VDPQTMALATSYQQYGGAADRTRTMTATDVPSVQATQAIPDYEYGPPERNGRYDRRRGG
FT                   GNTALKTALWIVIPLLIIGAFIGIGYAFLSPGSSGTTKVKVPQLVNQTKEAAEKALTDL
FT                   GLKVAYGPAEYHDEVPKNSVIRTEPAADTEVSLGDTVTVILSKGRELVSIPTDIIGKTP
FT                   EEAKAELEALGLNVSIVMKTAPGKPQGKVYDTNPKPGQRVAKDTLVRLYVPRELAQVPS
FT                   VVGIPEDEARATLEGAGFKVKVVTRNSDVPVGNVIDQSPAPGTKLQPGTTVTLIVSSGP
FT                   AVQQNPDDGLPTEPPMDDLPTDDGEDDGAGIDLNGDPFG"
FT   gene            complement(66847..67437)
FT                   /locus_tag="Tbis_0056"
FT   CDS_pept        complement(66847..67437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0056"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pde:Pden_2136 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86793"
FT                   /db_xref="GOA:D6Y258"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y258"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADG86793.1"
FT                   /translation="MTATRVLVVDNHDSFVHTIVQYLRRLGAHCDVRPRDRVGLTDTAG
FT                   FDGVLISPGPGSPEAAGISVPLVRHAAEHRLPLLGVCLGHQAIAVAYGATVARAPELMH
FT                   GRTSPILHDGRGVFRSLPSPVTMTRYHSLAVVPGTVPPELEVSAVTPDGVIMGVRHRTA
FT                   PIEGVQFHPESIASEHGHRLLKNWLEMCNTRPL"
FT   gene            67590..67835
FT                   /locus_tag="Tbis_0057"
FT   CDS_pept        67590..67835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0057"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86794"
FT                   /db_xref="GOA:D6Y259"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y259"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ADG86794.1"
FT                   /translation="MPKSKVRKKAVYTPPKRAQAVKTSPRWLAPLMVTCWIVGILWIAV
FT                   YYIAPQTPGIETLGNWNLLVGFGLIILGVILSTRWR"
FT   gene            complement(67943..68803)
FT                   /locus_tag="Tbis_0058"
FT   CDS_pept        complement(67943..68803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0058"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG:
FT                   aba:Acid345_1881 rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86795"
FT                   /db_xref="GOA:D6Y260"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y260"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADG86795.1"
FT                   /translation="MTSQPPPSPPHPPGAAVPTCYRHPDRETYVRCQRCDRSICPDCMR
FT                   EAAVGYQCLDCVQEGNRTVRRARTVFGGAPVTTARVSWTLLAINLLAYVAEVLDPERVI
FT                   SAYGMWSIGVYQGEWWRLITSAFLHAPPPSFWHILFNMWALYVIGPDLERLLGSARFAA
FT                   LYLLSALGGSVAIYLFGVAALGASGAIYGLFGALFVVARRLGTDVRGVLWLIGINVLIT
FT                   FVVPGISWQGHLGGLVTGTVVAAGLVYAPERHRTLVQSAVAVAVLAALICAVTLLPPYP
FT                   LALFR"
FT   gene            complement(68869..69399)
FT                   /locus_tag="Tbis_0059"
FT   CDS_pept        complement(68869..69399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0059"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: lpp:lpp1946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86796"
FT                   /db_xref="GOA:D6Y261"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y261"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADG86796.1"
FT                   /translation="MAETLIANLRTNHGTIRIKLFPDKAPNTVRNFVELAEGTREWRHP
FT                   ATGERMTTPLYNGTIFHRVIDGFMIQGGDPIGQGTGGPGYMFDDEIHDKNRFDRPYLVA
FT                   MANAGKWRGRGTNGSQFFITVAPQPHLDRNHTIFGEVIEGTEVVDSIARTPTDHRDRPL
FT                   QDAVIEEVTIERS"
FT   gene            69535..70017
FT                   /locus_tag="Tbis_0060"
FT   CDS_pept        69535..70017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86797"
FT                   /db_xref="GOA:D6Y262"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y262"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86797.1"
FT                   /translation="MRTSMGRGGRRESMLNPQDLMGRVRSAAKKAGVRMTPVAGTARDV
FT                   AAQRIEDARLWAAPKLDQAAHSVEEQIAPVVSAFLTELARRLESTAPKKTRRWPLAALC
FT                   TGAAIGAIGVAMYRGNAKRWAESVRDTVRGVEQPTTDWSQERTGSMQQGAEQTRRP"
FT   gene            complement(70076..71641)
FT                   /pseudo
FT                   /locus_tag="Tbis_0061"
FT   gene            72490..73785
FT                   /locus_tag="Tbis_0062"
FT   CDS_pept        72490..73785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0062"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   yen:YE2035 putative membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86798"
FT                   /db_xref="GOA:D6Y263"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y263"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG86798.1"
FT                   /translation="MRARNRRTSGLGQDLGILRDRRFTLMLAARMFSALGLAFAPVALA
FT                   FGVLELPGATAATLSLVLAAESTPMVLFMLVGGVIADRMPRDRVMMAGETFNAIGYFSL
FT                   GAMLLTGWAPVPALAAAAAFSGIASAIVVPAMTGIVPDVVPAARLQTANALLGLVTNVS
FT                   RIAGLVLSGAAVALLGGGWALVASGAMFAAAAVLIALLRLTPAERAENGSGSIIADLRL
FT                   GWREFASRQWLWVVVAQFSIVVMAVNAAHGVLGPLIAKEHLGGAPAWSVFLTGEAVGML
FT                   TGVLIAMRIRPQRPVLITALLAIPSALPYLLLGGGAPLWAVVAGAFVLGVSFDVLGVLW
FT                   NTTMQREIPPEALSRVSSYDALGSLMFGPIGLLVAGPAALMIGPRPALIGCAVIIVAVS
FT                   LVAVLFPGVRGLRAPAPAPAAAADGSVTAPAQ"
FT   sig_peptide     72490..72627
FT                   /locus_tag="Tbis_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.969 at
FT                   residue 46"
FT   gene            74110..75369
FT                   /locus_tag="Tbis_0063"
FT   CDS_pept        74110..75369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0063"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: lpn:lpg1638
FT                   drug:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86799"
FT                   /db_xref="GOA:D6Y264"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y264"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG86799.1"
FT                   /translation="MAGVQERLRRVALDTRPLSFAPYRRLLVGQGVSFIGFQLTAVAVS
FT                   GQVYAISGSSLWVGMLGPVSLVPLVVFGLWGGAFADAIERRRLLLIGSVISWSATVALL
FT                   LHAWSGLNSVPVVLAAVAVQSIGFAITSATRGAIIPRLLPTERVAAANTLNFMVSNFGT
FT                   VVGPLLAGAVLHFGGFALAYLLDAILFGAGFYAAVRLPRIEPLGEISRPGLRSVLDGLR
FT                   YIATQPIVLMSFVVDIIAMALAMPRALFPEMTAERFGGSSVAFGWLSASIAIGSVTAAL
FT                   FSGWVGRVRRQGVALTLVIALWGLAVAAAAFARPLWLVVTLLAIAGAADLASAVWRQTI
FT                   LQTYAPDELRGRMQGVFMVVVAGGPRLGDLRAGAMASAYGLVTAWALGGLLCTVLVLIV
FT                   GFAVSSFRRYDAFARRQETG"
FT   gene            76172..77542
FT                   /locus_tag="Tbis_0064"
FT   CDS_pept        76172..77542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0064"
FT                   /product="PAS sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; KEGG: bba:Bd1322
FT                   putative sensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86800"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y265"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADG86800.1"
FT                   /translation="MSLQRVAVPNGVEQKVGADELFFSTTDRQGRIRSGNSVFARISQF
FT                   SIEELVGSPHNIVRHPEMPAGVFRLIWDRLYADRPVGTYVKNLARDGSSYWVFATVTPL
FT                   GTDGYLSVRMAPRTPLFTTVQRIYEYVLEAEREAAERDGLNRREVARLGKERLEEMLRR
FT                   LGFHSHDEFLAEALSGEVAARGRMASGTYARPWAEGAIAEVLSSSGALEEILASLVQRL
FT                   DSYRTLSERLERASTNVLDIARRLERTVDTAQAASARVADTAPVLHNVARVMATPARTA
FT                   VAELEQLGPRLRELRGYLTELRFRIALASLHNDMVAAFAAEVADGAAPASSLSEVPHLC
FT                   DTMHDSVLEMSAKMQEVNRTLHDVVAEVNLASERLQDFYRFLGQWRILVVRRGAERTLA
FT                   DLVQPIDEEFAASWSGMDMLRDLVREFQAAIARFDVDAVEAQLTRIRSAAAASRALV"
FT   gene            complement(77768..79189)
FT                   /locus_tag="Tbis_0065"
FT   CDS_pept        complement(77768..79189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86801"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y266"
FT                   /inference="similar to AA sequence:KEGG:MXAN_0926"
FT                   /protein_id="ADG86801.1"
FT                   /translation="MAKLRGETDVPVIAIVGGGASGTLTAVHLLRLSRSHGVPMRVVVI
FT                   DRYGRHGVGQAYATDDPLHLLNACADKMSAFPDDPGHLLRWARTIGLEVAGSDFLPRQV
FT                   YGRYLCHVLDTAVAEAWPYGRLARVTGTASELHVPGPRGPVRVALSDGTGVDADAVVLA
FT                   TGNLPTADWPVAAAAGHRYIADPWEPGALGRIRGGRAVLVIGTGLTMIDVALTATRARS
FT                   DAVVHAISRHGLLPRPHRCPPPAPVPTDLPDGPLRLAELVRAVRRAVRDNGGEWQAVVD
FT                   GLRPHIPRLWARLGHDDQRRFLRSVARYWEVHRHRLPPAAAARIAELRSSGRLHVLRGT
FT                   LTGVTAEGELLTARVTGANGRTRDLVVDRIVNASGPSSPLSGNPLYRRLFAAGLARPDR
FT                   LHLGVDADEDGAVLDATGRPSDRIFTLGPPLRGLRYETTAIPEIRAQAAALAPRLLETV
FT                   AAASSPRLQPGGLPR"
FT   gene            complement(79520..80668)
FT                   /locus_tag="Tbis_0066"
FT   CDS_pept        complement(79520..80668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0066"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   mxa:MXAN_6347 putative chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86802"
FT                   /db_xref="GOA:D6Y267"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y267"
FT                   /inference="protein motif:TFAM:TIGR00937"
FT                   /protein_id="ADG86802.1"
FT                   /translation="MRRRNGTIKEVALVFLRLGTIAFGGPAAHIAMMRDEVVRRRGWVT
FT                   DQRFADLIGATNLIPGPNSTELAIHLGFDRGRWRGLITAGVCFILPAALIVTALAWAYV
FT                   RYGGTPAVAGVLYGVTPVVVAIIAHALAGLVRTVIKGVWLGVLAAGVLAGYLLGVNELV
FT                   LLFGGGAVAGLAHLIRHPPSPGGRHALVSAPLLLTARPGFPAADGADLAQLFLTMLKIG
FT                   AVLYGSGYVLLAFLDGDFVDRLGWITERQLLDAVAIGQVTPGPLFTTATFVGYLVAGPL
FT                   GAFLATVAIFLPSFVFVGLLTRLTDRLRSRAWTGALLDGVNAASLALMAGVSAELARQA
FT                   VVDPLTLAVAVAALGLLWRTRIHHAWLIAGGALIGVAHALLT"
FT   gene            complement(80978..81865)
FT                   /locus_tag="Tbis_0067"
FT   CDS_pept        complement(80978..81865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0067"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_0946
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86803"
FT                   /db_xref="GOA:D6Y268"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y268"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG86803.1"
FT                   /translation="MIATSKPAPRTASRPRSRRQGVGERPNWIGGAVAWLWLLVVIVPI
FT                   YWIVITSFKTQANYYATNPLLPPTEPVLDNYRLVIESDFPRYFRNSVIVAVGAVVPAVA
FT                   FSFMAAYAIVRAGAASRFLRLVNSLFLMGLAIPLQAAVIPIYLIIIKLRLYDSLTALIL
FT                   PSIAFAIPLSVLVLSNFIRDVPKELFESMRIDGAGEMKMLWRLALPLTRPAVVTVTIYN
FT                   ALTIWNGFLLPLILTQSPDKRTLPLALWTFQGQYSVNVPAVLASVVLTTLPILILYAVG
FT                   RRQLLSGLTAGIGK"
FT   gene            complement(81862..82788)
FT                   /locus_tag="Tbis_0068"
FT   CDS_pept        complement(81862..82788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0068"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_0945
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86804"
FT                   /db_xref="GOA:D6Y269"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y269"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG86804.1"
FT                   /translation="MSRIARSTLTPQAAAGRGSAGGGLGWLALPALAVFVAFGVVPLIG
FT                   VLALSFTSWDGLGEIRWTGLTSWREVLTDPGLPHALWVTFLVMAFSWLVQTPASILIGV
FT                   FLAGHQRYREVLAVLYFIPLLLSSAAIAITYKALLDPNFGLGAGLGVDLLVQDWLGEPV
FT                   LAFGVVIFTVSWQFIPFHALIYQGGVRQIPRSLYEAAEIDGAGRIRKFFSITLPQLKYT
FT                   IITSSTLMVVGSLTFFDLIFVLTEGGPGDATRVLALEMYKRGFQANLMGPASAIAVVLV
FT                   LLGLVLALLLRRIGGRDPGASQLEGAS"
FT   sig_peptide     complement(82687..82788)
FT                   /locus_tag="Tbis_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.480 at
FT                   residue 34"
FT   gene            complement(82785..84131)
FT                   /locus_tag="Tbis_0069"
FT   CDS_pept        complement(82785..84131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0069"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: vei:Veis_0944 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86805"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y270"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADG86805.1"
FT                   /translation="MESRTFTRRSFLGLSIGLPLGATLAACGTSGPTGTGSSPGGGGGG
FT                   AKATYWFLSGQPQEGVRMGAVERFNKANPGGQIEPTTFQNDAYKTKIKTAIGAGQAPTI
FT                   IWGWGGGTLRSYVQAGQVEDLTSWFEEHPEVKDRLFPSSFGAATIDGRIYAMPCETVQP
FT                   IVLFYNKRVFEKVGVEPPQSWGDIMALVPKFNAHGIAPFSLGGQSRWTSMMWLEFLFDR
FT                   IGGPEVFQAVFDGEKDAWSHPAALDALTKIQELIKAGGFVKGFSSITADSNADQALLYT
FT                   GKAAMMLHGSWSYGIQAAEGGDFVSSGALGFMNFPPVEGGKGDPSNTVGNPGQYLSISS
FT                   AATPEQKEIAKKFFATGVLDEEEQKGWVETGGVPIVKGVDKFFANSKDAEFLNFVYGIA
FT                   SNAKSFAQSWDQALSPTAAEVLLDNIAKLFQLSISPQQFVDNMNAVIGK"
FT   sig_peptide     complement(84045..84131)
FT                   /locus_tag="Tbis_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.365 at
FT                   residue 29"
FT   gene            84613..85980
FT                   /locus_tag="Tbis_0070"
FT   CDS_pept        84613..85980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH03421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86806"
FT                   /db_xref="GOA:D6Y271"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y271"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86806.1"
FT                   /translation="MTDGDKTRVRPPAWAWALALVVIAAATAPLIHHWLTNPEDQRLVD
FT                   LEVYRAGGAALLLGRPLYEVITPAPQLLPFTYPPIAAMLAMPFAMLPWAVAQWVWTLGI
FT                   VAVLAVTVAVCFRPLVAAATAAPAGPPWWRRLMRSGAAVPLLIALLTAACAYLMPIRDQ
FT                   FRFGQVGVFLMALCVLDCTVRRPWWPRGMLIGLATAIKLTPGVFLIYLAITGFPRRDGD
FT                   PEQRRALYMAVFTAALLTLLPFLLVFDDARDYWFRALLDSGRVGANNATTNQSLRGMLL
FT                   RLYWPAPLTTALWLAAVAVIGWYGFRRARRAYRAGDPMTGIALTGLMAVLLSPVAWIHH
FT                   LAWLVVALAALAGTGRDPRRLLAAAAVWLYFTVPIPWWGVSIKALEIPVLSPVVGKLVQ
FT                   NGFGLGAVALVWVLGSGVLDRPARRPAVRPKARTEAAGENGPVGTVEGGDRRKAGR"
FT   gene            86020..86994
FT                   /locus_tag="Tbis_0071"
FT   CDS_pept        86020..86994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0071"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ade:Adeh_1779 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86807"
FT                   /db_xref="GOA:D6Y272"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y272"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ADG86807.1"
FT                   /translation="MEWTDRTPSTHQLRYPFPMAKLAYLGPQGTFCEAALRRLQPDAER
FT                   MPCPNVGAALDAVRNGEADGAVVPMENSVEGAITETLDELAWGAPLLITGEYLLPVEFS
FT                   LLARPGTELGQIKRILTHPAAHTQCRGFIEKELPGAVVIAASSTAAAAQEVASPASPYD
FT                   AAISPAIAGEYYGLVELASNIGDRKDTVTRFVQVSPPGRLPEPTGADRTSLVAFLRDDH
FT                   PGALLEMLSEFAVRGVNLSRIESRPTGDGIGRYFFHFDCEGHIADARVGEAISGLYRLC
FT                   SGVRFLGSYPRADRVAPKIKPGTTDTDFETAAEWLARIRAGQV"
FT   gene            87439..88704
FT                   /locus_tag="Tbis_0072"
FT   CDS_pept        87439..88704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0072"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: bcz:BCZK0013 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86808"
FT                   /db_xref="GOA:D6Y273"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y273"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADG86808.1"
FT                   /translation="MIDLRTLREDPDRLRASQRARGEDETVVDRLLSLDERRRTALTRF
FT                   ESLRAEQKRLGKSVSRASGDERQALLDRAKELAAEVKAAEAEAEALGQELDELLMTVPN
FT                   IVEEGAPQGGEDDFVVLEHVGEPPTFDFTPRDHVELGELLGAIDIDRGAKVSGARFYYL
FT                   TGAGARLVHGLLTMAMHQAIEAGFTPVIPPVLVKPEAMAGTGFLGAHSAEVYRLEADDL
FT                   YLVGTSEVSLAAYHADEILDAAALPLRYAGWSSCFRREAGSYGKDTRGIIRVHQFDKVE
FT                   MFSFCRPEDAHEEHLRLLGWQKQMLDKIEVPYRVVDIATGDLGTSAARKYDCEAWLPSQ
FT                   GRYRELTSTSNCTDFQARRLRVRYRDEDGTTRHVATLNGTLATTRWIVAILENHQQRDG
FT                   SVVVPKALRPYVGLDVLEPVSR"
FT   gene            complement(89300..89503)
FT                   /locus_tag="Tbis_0073"
FT   CDS_pept        complement(89300..89503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0073"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ank:AnaeK_2588 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86809"
FT                   /db_xref="GOA:D6Y274"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y274"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADG86809.1"
FT                   /translation="MAQGTVKWFNPDKGFGFIAPDGGEPDVFVHFSAIIGSGYRNLEDG
FT                   QRVEFDIVSSPKGPQASNVRGI"
FT   gene            89734..90543
FT                   /locus_tag="Tbis_0074"
FT   CDS_pept        89734..90543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0074"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase type
FT                   3; sucrose-6F-phosphate phosphohydrolase; KEGG:
FT                   aha:AHA_3603 phosphatase YbhA"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86810"
FT                   /db_xref="GOA:D6Y275"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y275"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ADG86810.1"
FT                   /translation="MTLPRLVATDLDGTALRSDGTISARTAAAFARVEKAGATLVFVTG
FT                   RPPRWMHEVAGAVRHHGLAICANGAITYDLHNEEVVEAHLIEPGILEECVHRLRTHLPE
FT                   LRFSAEYENHFGYEPGFRIGVLDSRHNAGAQLKLSTLTSRPCAKLLAQHPYLPSDELYR
FT                   RTLDLVGDLVTPTYSSDSETRALIEMSAHGVTKATALAAFAAGHGIDAAEVVAFGDMPN
FT                   DVPMLTWAGRSYAVANAHPEVLAAVDHVTAANNEDGVALVLEELFPE"
FT   gene            complement(90561..91100)
FT                   /locus_tag="Tbis_0075"
FT   CDS_pept        complement(90561..91100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86811"
FT                   /db_xref="GOA:D6Y276"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y276"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86811.1"
FT                   /translation="MSADEGAPQIVVVGPQGMSVAGGDSRQSEREERSVADMVEQPAKV
FT                   MRIGSMIRQLLEEVRAAPLDEASRKRLKEIHESSIKELQEGLAPELVEELERLSLPFSD
FT                   DPDSPPTEAELRIAHAQLVGWLEGLFHGIQTTLFAQQMAARAQLEQMRRALPGGGTHQQ
FT                   QSHQEDHHRGGGGPYL"
FT   gene            complement(91179..92141)
FT                   /locus_tag="Tbis_0076"
FT   CDS_pept        complement(91179..92141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0076"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86812"
FT                   /db_xref="GOA:D6Y277"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y277"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADG86812.1"
FT                   /translation="MRAIVIPEHGGPEVLTWQEMPDPHPAPGEVVIEVAASAVNRADVL
FT                   QRQGLYPPPPGASEIPGLECSGVIAEIGENVEGFSVGDRVCALLAGGGYAERVAVPYQQ
FT                   VMPIPDGVSLTEAAAFPEVACTVWSNVFMTAGLREGETLLVHGGGSGIGTFAIQLAKAR
FT                   GARVLVTAGSAEKLQRCFELGADDGVNYRVEDFAERFAGQADVILDIIGAAYLPRNIAA
FT                   LATGGRLVVIGLQGGTRGELNLGTLLAKRASVHASGLRARPVAEKAVICREVVEHVWPL
FT                   IGAGRIRPVVHAEVPLQEAARAHRMLEASEHVGKILLVR"
FT   gene            92965..94884
FT                   /locus_tag="Tbis_0077"
FT   CDS_pept        92965..94884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0077"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86813"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y278"
FT                   /inference="protein motif:COG:COG0455"
FT                   /protein_id="ADG86813.1"
FT                   /translation="MDEGSPGGTAERGADALSGPLSGAAAGPGAGPLSDEAGGAGGTGT
FT                   GDTGIGTGGTDRTGTGGTEWTGGGTGVRGGAEQIGTGIGAGRDADQIGAGTGVGGGADP
FT                   IGAGGTDEPVSGARSLLDAALPLPPKPPERSFSWFSGPVQPAEEGGRREPGQERKDEPV
FT                   TGAAEGLAVPRDGGAPGAAPAPAGAAGVEQTAEPVSADEPTRAWFTSGTFAETMPVEPP
FT                   AEAASGSAGTPAEFPAAAPAMPPITGPGTPPATGTVGSSVGSDGPGVSQPSSSVPPGDP
FT                   AEPYAPGAQTGAAAEREPYQTGRRAASSGVPLSGSGRPSAESLDPDTLLKGRKKGPSRG
FT                   WRRAVYTMSGGLINPGEPPDVRRRHELIARARTPVAGGHHRVAVLSLKGGVGKTTTTVG
FT                   LGATLAQVRGDRVIAVDANPDRGTLSDKVELETSATVRDLLNERAQVKRYADIRAFTSQ
FT                   TPSRLEILASDRDPSVSEAFSGEDYQAVAEVLENFYSICITDCGTGLLHSAMSGVLRLA
FT                   DQIVLVSSPSVDGARAASATLDWLEAHGYGDLVRAATVVLCNVRPRSKSKVDLKKLQEH
FT                   FAARCRAVVRVPYDPHLEEGAEIDLERLQQATRDAYLELAACVGDGFAGPRSQRGLSPA
FT                   LQPS"
FT   gene            95029..95117
FT                   /locus_tag="Tbis_R0004"
FT                   /note="tRNA-Ser1"
FT   tRNA            95029..95117
FT                   /locus_tag="Tbis_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(95334..96704)
FT                   /locus_tag="Tbis_0078"
FT   CDS_pept        complement(95334..96704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0078"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: dac:Daci_1611
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86814"
FT                   /db_xref="GOA:D6Y279"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y279"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADG86814.1"
FT                   /translation="MNTSTDVKFWGIRRNKSSKTPSYEVRWTVAGRQRSRSRRTKALAE
FT                   HFLSELRQAAKRGEPFDVETGLPVSMVKVKQAVTWFSFVVAYVDMKWPHAAAKTRDSLT
FT                   DALATVTPALVDEDAPGKPDLALLRKALRQYVLPPVARHLPRPADVAAAVAWLERHSLP
FT                   LAELGKVRNVRLGLDALTLRLDGTPAAPTTIARKRAVFYNVLQYAVDLEELPSNPLDKV
FT                   KAWRPPKVREVVDRRVVVNPTQARELLTAVTYVGRPDRGRHLRAFFACLYFAGLRPAEA
FT                   LGLRLQDCHLPESGWGRLIISRSKPQANRRWTDTGEAHDDRGLKHRAQGEGRTVPIPPE
FT                   LVAILREHVDEFGVHDDGRLFRTSRGGVVSIATYCEAWQQARILALPPEQVASPLAARP
FT                   YDLRHAAVSLWLNAGVSAPEVAERAGHGVDVLLRVYAKCIDGGAEIASQRIEDALRM"
FT   gene            complement(96701..96892)
FT                   /locus_tag="Tbis_0079"
FT   CDS_pept        complement(96701..96892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0079"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86815"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y280"
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /protein_id="ADG86815.1"
FT                   /translation="MTRNDRLLTVPEVLAELGGVSRRTFYRWRELGCAPRCIKLPNGEL
FT                   RIWRSDLMAWLESLREVA"
FT   gene            complement(96889..98274)
FT                   /locus_tag="Tbis_0080"
FT   CDS_pept        complement(96889..98274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86816"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y281"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86816.1"
FT                   /translation="MPTAHALAGLITRLHDPQYARWAAQIRRTGGCRRPVHLRGTVEHY
FT                   DRATGRLLHRYSTSTEPDGVLRVPCKTRRASRCPSCAETYRADTYHLIRAGLIGGKGVP
FT                   ETVTSHPCLFVTLTAPSFGPVHTRRENNGTVLPCHPRRDAATCPHGRVMSCTARHGSDD
FT                   ARLGEPLCPDCYDYTGSVLFNALAPELWRRFTLALRRHLAKLGGLAPRAMRDQLMVSFA
FT                   KVAEYQRRGVVHFHAVIRLDGPDGPTSPPPAWATLDLLGEAVRHAASAVTATIPALDGQ
FT                   PERVLRWGDQLDIRPISMDGELTAQAVAGYIAKYATKYATKAAECVGTLDQRILPTADL
FT                   AALPVRDHARRLIAECLRLGALDELACLRLTQWAHMLGFRGHFATKSRRYSTTLGALRE
FT                   ARAAHKRDEQISVGRLPLFDEDTVLVIAHWQYAGQGLSAGDALLAAAITGVPMPSAVGG
FT                   DAR"
FT   gene            complement(98391..98507)
FT                   /locus_tag="Tbis_0081"
FT   CDS_pept        complement(98391..98507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86817"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y282"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86817.1"
FT                   /translation="MTELALIPPRRWQCCHCGGTGLDSYGDTCPHCQGLGLC"
FT   gene            complement(98504..98680)
FT                   /locus_tag="Tbis_0082"
FT   CDS_pept        complement(98504..98680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86818"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y283"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86818.1"
FT                   /translation="MRIHIEGTNAEIAYTLSKIRTILPVGRISPITPIRRRPHTWRVIV
FT                   DTAPQRAECRWAR"
FT   gene            complement(98695..99426)
FT                   /locus_tag="Tbis_0083"
FT   CDS_pept        complement(98695..99426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to C6orf97 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86819"
FT                   /db_xref="GOA:D6Y284"
FT                   /db_xref="InterPro:IPR021235"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y284"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86819.1"
FT                   /translation="MNSILSRLAVRLADTGPVVVLAAIAGAGSFTHIRDTAAESGQTGW
FT                   MSWAVAVCVDLTCVMAARERQRDKKTGRTQRGLVSWPTIVLVAGIALSLAANLHQAEPT
FT                   LWGRLTAGTPAGAFLIAVSMLERRASGPRLVPSAVPASSPVTDPGSATVPASSPTSEAS
FT                   SPTGGTSSPAPALVRAGQHGKDGTRGPSPALVDFARRVADEHRAKHGKPITRDQLRAHL
FT                   GVSNQLASDLLRTLRSTPDAP"
FT   gene            complement(99459..100841)
FT                   /locus_tag="Tbis_0084"
FT   CDS_pept        complement(99459..100841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0084"
FT                   /product="cell division FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: cvi:CV_2479
FT                   cell division FtsK transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86820"
FT                   /db_xref="GOA:D6Y285"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y285"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADG86820.1"
FT                   /translation="MPLPPVPRPVLLAVALVLVLVCWRQWAPVSYWYLFGFPCKAVWLR
FT                   WSWRHVASGCGLTKKRNRWWFTTVPGLVSSTGVVRVKRRLQRVAVDTKPWMGLPRPTRH
FT                   GFRVTFHLLDGQIPEDYAKVCDRLAHAWRIEAVRVVGSRPGRVTLQGINRDPLAHVIPA
FT                   VAPVEPPDGWRAEDLLRPVVGVLETGAPWRMDFRLIPHWMNAGATQSGKSNLINALIVG
FT                   LAPQPVALVGFDLKGGVELSPYTPRLTALATTRGECLDLLADLIGVMGARMLACRWLAV
FT                   RDIWQLPDASRPIPVVVMVDEIAELFLTADKAEKDQVTRTATALLRIAQLGRAFGIHLV
FT                   LSGQRIGSDLGPGVTALRAQIGGRVCHRVNDPETAVMTLGDLDPDALVAARSIPPELPG
FT                   VAVVTGSDGRWYRARSGYVSTAVAEQVATAYAHLTPSWAQVATSGLGHDLAPASENPQI
FT                   AA"
FT   gene            complement(100841..101176)
FT                   /locus_tag="Tbis_0085"
FT   CDS_pept        complement(100841..101176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86821"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y286"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86821.1"
FT                   /translation="MRTIPIPVDVSMLRISCAKAPRPRLVSKETGEIKRDRDGNPIYEV
FT                   TLLVEDEAGRMELVKVYVTPEPQIAPGDEVVPVGLAASIWEQAGRWGIAYRARSIIPAG
FT                   SAGAGVG"
FT   gene            101315..101695
FT                   /locus_tag="Tbis_0086"
FT   CDS_pept        101315..101695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0086"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: xau:Xaut_3372 GntR
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86822"
FT                   /db_xref="GOA:D6Y287"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y287"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADG86822.1"
FT                   /translation="MIEKTGRPAYMQIADELRRQIRSGSLPPGTALPSITQLCRRYDVS
FT                   ASVVKAAISVLRTEGLIVGQQGKGVFVRDPGSAAGREVAETSEIMEQLVEIRATLRDLR
FT                   ERVADLESAVFQEPKRSGERGK"
FT   gene            101961..102998
FT                   /locus_tag="Tbis_0087"
FT   CDS_pept        101961..102998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1993 P-loop ATPase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86823"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y288"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86823.1"
FT                   /translation="MKSTQRPGWIPSRLREHREAHGLTLEAAGDLLRETARRHGLAVPA
FT                   ANFQTLWGHENGSIYPGPHYRRAYCLMYRATEPQLGFRPPLPGETEKAEIMISDLPAPS
FT                   DPAADEAAAKVIEEAVAKASVGGIQPDNPQQVALRNRIVDAWRRRHGGGSPRPILTLVG
FT                   GYAGSGKTEFSRFLSDITGWAFLDKDSLTRSMTERLLVSLGGDPNDRHSELYLTEVRPL
FT                   EYRFLMEAAWDNLNAGTSAILSAPFIAELNDEAWFKRLENRCAAKGIDLAAIWVRCDAE
FT                   SMREYIEFRGAARDAWKLANWETYLAGLDLEESPPTVHITVDNRLGSAITLADQTRQTL
FT                   KRILS"
FT   gene            102995..103621
FT                   /locus_tag="Tbis_0088"
FT   CDS_pept        102995..103621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0088"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc2155 guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y289"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86824.1"
FT                   /translation="MSAPPVGVGLYGPPCSGKSTITTALHQLDPRFRLLRKLKVGTGRA
FT                   DEYDMVTAEQLDQLRRAGRLLVQTYRYGNIYAVDRRQIEDMSSAGHAPVVHMGNIADLR
FT                   RLVGRTPDAWLRVLLWVPREVTERRSKDRGDTDTAERLRAWDETLADLTANTDEAFFHL
FT                   RLCTDRLDAEAAAKEIITAFHALTKAAEPRTAGGRQEDAPARRKE"
FT   gene            complement(103779..104075)
FT                   /locus_tag="Tbis_0089"
FT   CDS_pept        complement(103779..104075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86825"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y290"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86825.1"
FT                   /translation="MDDLAELLESCPGLHPAAPQKGYTRVKWRESRPRADRIRVRGHTC
FT                   DCQPIVYELCQAGGLRFIRRFYRSDEVLVHESEWTRAAEAEQLWMKILLGQAR"
FT   gene            complement(104080..104328)
FT                   /locus_tag="Tbis_0090"
FT   CDS_pept        complement(104080..104328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86826"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y291"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86826.1"
FT                   /translation="MDLEQIAAKYPGWVIWRGASEAGPGAWYATRRGTSLSYEQLNAGL
FT                   EQTVCGDDASALVVELERQAKIAARLAAEQGAKGRPR"
FT   gene            104440..104859
FT                   /locus_tag="Tbis_0091"
FT   CDS_pept        104440..104859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0091"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bam:Bamb_4443 GntR
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86827"
FT                   /db_xref="GOA:D6Y292"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y292"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADG86827.1"
FT                   /translation="MTIDPSADRPVYKQLADLIRARIQSGEYRPGQRLPAENDFVAEYG
FT                   ISRDSVRRAMAVLRGEGLIVTELRGSRVREVGEAVTVSISPGTQVAARMPTEPERKQLG
FT                   IAEGVPILIITEPDGETRKLPADRTIIEASKEQQG"
FT   gene            106536..107603
FT                   /locus_tag="Tbis_0092"
FT   CDS_pept        106536..107603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_B0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86828"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y293"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86828.1"
FT                   /translation="MEDCEGWIDPQRGFAEFEIRQEGIGMFRRGNFEKLKFETRPCIHS
FT                   HENDPPSVYDEVRNIIYPVIRVTSSDGTTCIEISPNSPLCTPLLPLDDDGRPARVQTLK
FT                   IFLAGPTEKLELLRRSRELANSFLFELNVRHGSHYSLRSRVVGPSRPRRAVRTHDTVRF
FT                   PRTRVPNNVATLFSIPSEFGIRNNYTLAYLSYYQILEYYLPIVHRRDTIERVRRILRSL
FT                   DFDEEEDFSVLQIVTSVERSHGASEIDQLRTLIEKCVPESKLKEFFSLDHNGHFGKRGP
FT                   ISGVPAIYPTSGESLASQVAKRIYKLRNRIVHAKDDARYSESTVLLPFSHEAMQLYPDI
FT                   ELLRLLAIEVIVSNQ"
FT   gene            complement(108291..108851)
FT                   /locus_tag="Tbis_0093"
FT   CDS_pept        complement(108291..108851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86829"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y294"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86829.1"
FT                   /translation="MSLEFDLTLKRLRRKEKRDFHLALTGKAGPYGEVTVTVGRTTKRA
FT                   DLSSATLPQAWVTDPDMDREGLVPLGKRSCLVVGDEQAELTQNRRALGKEDRALHIKLG
FT                   DRRYSYLAIKRNVEELRGADQEPLVRVRVIRGGRKISVLTETDPIDLALGLILQGADLR
FT                   GLTITRTVLFNVLDFLDTGKGEA"
FT   gene            complement(109303..109680)
FT                   /locus_tag="Tbis_0094"
FT   CDS_pept        complement(109303..109680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86830"
FT                   /db_xref="GOA:D6Y295"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y295"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86830.1"
FT                   /translation="MLLAKHRHYRASRPWYARVFGYLLDGMVGYGYRPGRAALWMLTLL
FT                   AAGSVFFAHHRPEPIKPGEHPHYHPVLYAADVLLPIINLGQESAFKHQGLGQWVASVLI
FT                   LLGWVLATAVVAGVTRVLTRT"
FT   gene            complement(110124..110858)
FT                   /locus_tag="Tbis_0095"
FT   CDS_pept        complement(110124..110858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0095"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_0701
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86831"
FT                   /db_xref="GOA:D6Y296"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y296"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG86831.1"
FT                   /translation="MSEAAENAAGVTRRERLRQQLMRDVMAAAREIAAEGLEGFTLTAV
FT                   ARKVGVSPPALYRYYDGKKGLIQALYRDLTEELMREVREAVERQDEDDIAAQLYASTKA
FT                   VLDWSVANREGFNLVFGATYPMIAGSGERIPRLISEELGGMYGRLFGRLWRQGVLTYPA
FT                   DEEIAPELRDQLKTYRDAITPDLPVGVVYLMITCWRQIYGVLTMAVNKHLDFAIDDIEP
FT                   LFNDMFGGLIRLLGLEPPSQAR"
FT   gene            111370..111885
FT                   /locus_tag="Tbis_0096"
FT   CDS_pept        111370..111885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86832"
FT                   /db_xref="GOA:D6Y297"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y297"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86832.1"
FT                   /translation="MATGYWTVRVRIDDGWLWIGNEAFPLRHISHVGQRTLEVDRQAAW
FT                   RRFGKLAGISLLLFVPLIAIAGDVFTIVLLAVLTALLWWLLSRLHKPALYGLVIHVGGT
FT                   RRDALWTAVKSELDHLVREITRAIGRPDAVKTTFYVEHAVQGDYLRRYGAGGHGEQQHL
FT                   GLAGGTAG"
FT   gene            113180..115207
FT                   /locus_tag="Tbis_0097"
FT   CDS_pept        113180..115207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0097"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: mxa:MXAN_5176
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86833"
FT                   /db_xref="GOA:D6Y298"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y298"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADG86833.1"
FT                   /translation="MATGEASLGSQYVLLDEIGAGAMGAVWRARHRETGELVAVKLLRD
FT                   GLTGDQELVMRFVQERNVMRSLRHPNIVTVRDFVIEGDRLAMVMDLVEGGSLQALLRRH
FT                   GTLPPAEAARMMAEVADALAAAHAAGVVHRDVKPANILIEQATGRVRLTDFGVARIVYG
FT                   PGLTQSTAIIGTPMYLAPETAMGEKPTPAVDVYAIGLILYQLLAGRPPFIGDHPVALIK
FT                   QHSSAAPRRLPGMPDALWSLIARCAAKNPADRPTAAQVAAELRRAMPALAGLPPLPPVP
FT                   WDADPSITSEPLPASAAGPAPAVQRPGGAPGTGRPGGMPGAAGMPVPPGTADTAPGGTG
FT                   GTLPKGGKQAAGVPVPGFIGVPGAGGGTGAGSAGAPATGSGGAAGTGPAGVLATGSGGV
FT                   PQVGSTGVPGLPGAASRWSAKKRWLLAGTSTAAAGAVVLSVVFFAPWRSDGEAHTRALG
FT                   SASPGALATAMDSASAYPDDGDRDPVPTPAWEDQARRSPSPKATTARPSPSLTEVPRPV
FT                   VPPPTTQPRQTTAPRPQQSKTAQPRKTRVVQPEPKATTVKADEPPPSLNWQCRSWFDTG
FT                   QGVQMSPCMAMVGDTFYLLGRVQGSSAAKWDILVGLFDSDNDVFVSKTFTCLNGTAPYE
FT                   CGPFTVKVPRKGVKTDVRQRWRKSGTPSFGGGVESPWILW"
FT   gene            115606..116439
FT                   /locus_tag="Tbis_0098"
FT   CDS_pept        115606..116439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86834"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y299"
FT                   /inference="similar to AA sequence:KEGG:AN3511.2"
FT                   /protein_id="ADG86834.1"
FT                   /translation="MPESTDASVYFIGNATTIIRCNGFTLLTDPNFLHRGQQARLGWGI
FT                   RTRRRTEPAMSVADLPPVDLVVLSHLHGDHWDEIAERGLDPYVPIVTTPHAADVLRGRG
FT                   FGNAIGLETWQTYQVHRNSGVLSITAVPARHAPGPLDRLLPPVMGSVLDFCRGDDLDLR
FT                   LHISGDTVLDPCLAEIPRRFPEIDAAIVHLGGTRIFRVLVSMDGVQGAEWLQLIKPEVA
FT                   LPVHYDDYEAFTSPLSEFQHHVRRLGLTHAVHYLMRGETCRLPLRTRPRPVARPR"
FT   gene            complement(116605..117480)
FT                   /locus_tag="Tbis_0099"
FT   CDS_pept        complement(116605..117480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0099"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pla:Plav_1556 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86835"
FT                   /db_xref="GOA:D6Y2A0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A0"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG86835.1"
FT                   /translation="MAAKDGDGWALCARGHQHWGIHGATGLLAVHHTLDGMPYVLLQKR
FT                   SWWTHHGGTWALPGGALDSHEDAISGALREVREETVLSTDLFRVQGIYVDDHGGWSFQT
FT                   VIAEAAGMLDAAPANGESVDLRWVAADEVASKPLHPGFADSWPKLRPALSPLVLVLDVA
FT                   NIIGSRPEELWWKDRARAANRLLNEVQPLATEGLRETPDGLPELARWFPRIVVVLEGAA
FT                   AVAADPEAHGTNLSVVVANGSGDDAIVQAVRERKPWERVLVVTADRALRERVTALGALV
FT                   AGPRWLLNQL"
FT   gene            complement(117524..117775)
FT                   /locus_tag="Tbis_0100"
FT   CDS_pept        complement(117524..117775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86836"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86836.1"
FT                   /translation="MSGWLHLDPLPPVWPPDRFEVRSIRPGPEAPAADRYHFSALAQEA
FT                   ALRLRDIGLATQIQVIRLADGAILYDLAAGVHRPLAEW"
FT   gene            complement(118498..119562)
FT                   /locus_tag="Tbis_0101"
FT   CDS_pept        complement(118498..119562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0101"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; PFAM: NHL repeat containing protein; KEGG:
FT                   bca:BCE_2353 triple helix repeat-containing collagen"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86837"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A2"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86837.1"
FT                   /translation="MLARWIKATVANRRTGISGQPQVRVRRSRLRSAITAVALVTGLTA
FT                   TASLPAPASADQTRQARQVAYVTNLNDDTVSVIDVASNTTIATIPVGNAPLGVAASPGG
FT                   TRVYVTNNGSNTVSVIDTATNGVIAVIPVGALPYDVAVSPGGTRAYVTNQGAGTVSVID
FT                   TATNIVIATIPVGNEPQGVAITPGGTRAYVANTGSNTVSVIDTATNTVIATIPVGAQPF
FT                   GVAVTPGGTRVLVTNRANSTVSVIDTATNTVIATIPVGAQPFGVAVTPGGTRAYVANTG
FT                   ANNVSVIDVARNSVITTVPVGTQPLGVAVTLGGTRAYAVNLTTVSVINTATNTVEATLG
FT                   VGNNAIEVAIANVP"
FT   sig_peptide     complement(119395..119562)
FT                   /locus_tag="Tbis_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.980 at
FT                   residue 56"
FT   gene            complement(119913..120377)
FT                   /locus_tag="Tbis_0102"
FT   CDS_pept        complement(119913..120377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0102"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86838"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A3"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86838.1"
FT                   /translation="MIDTATNTVIATIPVGNAPRGVAFSPGGTRAYVTNRSDDNVSVID
FT                   TATNTVIATIPAGDGPSEVAVTPGGTRAYVTNQTSGDVTVIDTATNTVITTIPTGASPT
FT                   GVAVTLGGTRAYVANFNSGTVSVINTATDTVEATLGAGVNPDYVAIANVP"
FT   gene            complement(120391..120969)
FT                   /locus_tag="Tbis_0103"
FT   CDS_pept        complement(120391..120969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0103"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86839"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A4"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86839.1"
FT                   /translation="MLIRSLTRRRTGRSGQPQVRVRRSRLRSAITAALVTGLTVLVPLP
FT                   TPVSAGETRQARQVAYVTNLNGNTVSVIDVAGNTTIATIPVGLGPTGVAASPGGTRVFV
FT                   VNQGSRTVSVIDTATNGVIATIPVGVTPFNVAITPGGTRAYVTNLGSDNVSVIDTATNT
FT                   VIATIPVGNGPIGVKVSPGGHPRLRHQPA"
FT   sig_peptide     complement(120817..120969)
FT                   /locus_tag="Tbis_0103"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 51"
FT   gene            complement(121532..122593)
FT                   /locus_tag="Tbis_0104"
FT   CDS_pept        complement(121532..122593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0104"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86840"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A5"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86840.1"
FT                   /translation="MLTRWSTTARAHGRTRGRGRRMRWARFRSAVTAVALATGLAALAP
FT                   VPAPATAGEARQGRQVAYVANRLDNTVSAIDVATYATIATIPVGAAPNGLDASPGGTRV
FT                   YVANQNAGTVSVIDTATNTVIATIPVGTSPADVAISFDGRRAYVSNTFSNDVSVIDTVT
FT                   NTVIATVPIGIGSFDLVVSPCGTRVYASNAFTGNVSVIDTATNTVIATIPVGTTPSGIA
FT                   ISPRGTRVYVTNAASDDVSVIDTATNTVIDTIPVGDAPNAVVITPGGTRAYVGNSGSNT
FT                   VSVIDTATNTVIATIPVGLGPVGMAVTPGGTRVFVADQSSDTVSVIDTATNTVIATLTA
FT                   GNVPSDVAIATVP"
FT   sig_peptide     complement(122435..122593)
FT                   /locus_tag="Tbis_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 53"
FT   gene            complement(122958..123380)
FT                   /locus_tag="Tbis_0105"
FT   CDS_pept        complement(122958..123380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0105"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: gur:Gura_3003 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86841"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A6"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86841.1"
FT                   /translation="MLTRRSMTTAAHRRTGTSGQARVRWSRFRSVITALATGLAVLASL
FT                   PAPASAGDARQGRQVAYLTNQGNDTVSVVDITTNTVIATVPVGTQPFGVAVTAGGTRAY
FT                   VCNVDSMSVIDTATNTVIATLSLPDGPFEIAIAEVP"
FT   sig_peptide     complement(123225..123380)
FT                   /locus_tag="Tbis_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 52"
FT   gene            complement(123923..124922)
FT                   /pseudo
FT                   /locus_tag="Tbis_0106"
FT   gene            complement(125305..126123)
FT                   /locus_tag="Tbis_0107"
FT   CDS_pept        complement(125305..126123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0107"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bcy:Bcer98_1704 YVTN beta-propeller
FT                   repeat- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86842"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A7"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86842.1"
FT                   /translation="MLTRWFTTAAENRRSGISGEARPAVRRSRLGSAITAMALATGLTA
FT                   LASLPAPATAGDARQGRQVAYITNQDDNTVSAIDVATNTTIATIPVGNGPRGVAASPGG
FT                   TRVYVTNLGSDTVSAINTATNGVIAVIPVGADPFDVAVSPGGTRVLVTNSIDNTVSVID
FT                   TITNTVIATIPVGTAPNQLAVTPGGTRAYVANQGSNTVSVINTATNAVITTVPVGTGPI
FT                   GVAVTLGGTRAYVTDSGSDTVSVINTATNAVEATLTVGNTPTEVAIANVP"
FT   sig_peptide     complement(125956..126123)
FT                   /locus_tag="Tbis_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.936 at
FT                   residue 56"
FT   gene            complement(126435..127499)
FT                   /locus_tag="Tbis_0108"
FT   CDS_pept        complement(126435..127499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0108"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: bca:BCE_2353 triple helix
FT                   repeat-containing collagen"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86843"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A8"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86843.1"
FT                   /translation="MRWIRAAAENRRTDISGQTQVGVRWSRLRAVITAAALATGLTALA
FT                   ALPTTAAADETRQARQVAYVSNLTEGTVSAIDVATNTTIATIPVGNGPRGVAASPGGTR
FT                   VYVPNSTSGTVSVINTATNGVIAVIPVGTAPFDVAVTPGGTRAYVTNNGSNTVSVINTA
FT                   TNTVIATIPVGAQPFGVAVTPGGTRAYVTNNGSNTVSVIDTATNTVIATIPVGNTPLGV
FT                   AVTPGGTRVLVANRSDNTVSVINTATNTVIATIPVGSLPSEVAVTPGGTRAYVTNEGSG
FT                   NVSVINVAGNSVITTIPVGTQPFGVAVTLGGTRAYVANFASNTVSVIDTATNTVEASLG
FT                   AGSGPVEVAIANVP"
FT   sig_peptide     complement(127338..127499)
FT                   /locus_tag="Tbis_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.658 at
FT                   residue 54"
FT   gene            complement(127830..128894)
FT                   /locus_tag="Tbis_0109"
FT   CDS_pept        complement(127830..128894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0109"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; SMART: WD-40 repeat protein; KEGG:
FT                   gur:Gura_3003 YVTN beta-propeller repeat- containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86844"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2A9"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ADG86844.1"
FT                   /translation="MLTRWFTTAAENRREISHVQVGVRRSRLRSVIMAAALATGLTGLA
FT                   SLPTTATAEEIRQPRQVAYVTNNADNTVSAIDVASNTTIATIPVGAAPDGVAASPGGTR
FT                   VFVANNADNTVSVINTATNGVIAIIPVGAGPTGVAVTPGGTRAYVANSGAGTVSVIDTA
FT                   TNGVIATIPVGTAPTDVAVTPDGTRAYVTNNGSNTVSVINTATNTVIATIPVGVAPTGV
FT                   GVSPGGTRVLVTNETDGTVSVINTATNTVIATIPVGTTPSDVAFSPNGARAYVTNSGDG
FT                   TVSVINTAGASLITTVTVGTTPIGVAVSLGGTRAYVANSGDGTVSVIDTATNTVEATLT
FT                   VGATPTEVAIANVP"
FT   sig_peptide     complement(128733..128894)
FT                   /locus_tag="Tbis_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.885 at
FT                   residue 54"
FT   gene            complement(129232..129431)
FT                   /pseudo
FT                   /locus_tag="Tbis_0110"
FT   gene            129516..130340
FT                   /locus_tag="Tbis_0111"
FT   CDS_pept        129516..130340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0111"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: xac:XAC0253 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86845"
FT                   /db_xref="GOA:D6Y2N4"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2N4"
FT                   /inference="protein motif:SMART:SM00342"
FT                   /protein_id="ADG86845.1"
FT                   /translation="MAWYVAAPVAPDLSRDLVTAWTVRTEGRHRLVPDGCVDVLWIDNG
FT                   TVWVCGPETSAWSFRLPPGTQAVGVRFRPGRASAVFKIAAHELRDRRVALEDVLGSRAH
FT                   RLLAEQVGYAADEAARLRVMEDHVRRWVAEAPVADAVPAAVVRMLTRDIGTSITALADA
FT                   VGLGERQLHRRCLTAFGYGAATLRRILRLQGFLELARTAGDVTGLATLAAAAGYTDQPH
FT                   LSRDCRAIAGISPRALVAEARAGRLTGGPYDQVSRRISSARSAGRPLALVSG"
FT   gene            complement(130847..131074)
FT                   /pseudo
FT                   /locus_tag="Tbis_0112"
FT   gene            complement(131110..131868)
FT                   /locus_tag="Tbis_0113"
FT   CDS_pept        complement(131110..131868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86846"
FT                   /db_xref="GOA:D6Y2N5"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2N5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86846.1"
FT                   /translation="MGERRKRRSAAVLGVAIAGLAACGGGGGTAGPAGSPAAGAASATP
FT                   VASPTATATAERQATPAPEPTFSATITKVTRADLPYSWRPGCPVRPGELRKITMTHWGF
FT                   DGKVHTGELVVHESVAEDVVSVFRTLFGYRFPIRRMEPIDVYKGSDYDSIEADNTSAFN
FT                   CRPATGSTRWSEHAYGRAIDLNPRENPYVYADGSNAHRNADAYVKRPLHKPGVINAGDR
FT                   VVRAFESIGWGWGGYWSGAKDYQHFSKSGR"
FT   sig_peptide     complement(131746..131868)
FT                   /locus_tag="Tbis_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.787 at
FT                   residue 41"
FT   gene            complement(132058..132510)
FT                   /locus_tag="Tbis_0114"
FT   CDS_pept        complement(132058..132510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86847"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86847.1"
FT                   /translation="MSFASDPLAMAPQSIPADGLPAPADRLTTKQPGLVIGGGLRRTVR
FT                   ALLTWARHLWARYRWPPLVEGPRRRRTESRWRYARELDGRLQSWEIVITPGLLAREIWT
FT                   AGQVVLAHTTLRLTPASVAPWLAERHAQLHAAGWRIDSISGGPDGR"
FT   gene            132874..134049
FT                   /locus_tag="Tbis_0115"
FT   CDS_pept        132874..134049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0115"
FT                   /product="ATPase"
FT                   /note="KEGG: ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86848"
FT                   /db_xref="GOA:D6Y2N7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2N7"
FT                   /inference="similar to AA sequence:KEGG:Geob_1221"
FT                   /protein_id="ADG86848.1"
FT                   /translation="MDPVRNPYAPGAGQRPPELAGRDRELRQFEIVLERVARGRPERSM
FT                   VLTGLRGVGKTVLLNTFKSMAMQRLWGTGKIEARPDQSIRRPVAAALHMAIRELAPRHR
FT                   APERIEHVLSVLKAFALRDPGKGAANWTPAIDVPAARGRADSGDLVIDLTELFVDAASV
FT                   AADLGVGIALFIDEMQDVRPPDISALCAACHELSQSGGPLIVVGAGLPHLPTVLSASKS
FT                   YSERLFRYTRIDRLDREAADQALIAPAAREGVEFTPGALDALYEAADGYPYFVQAYGKV
FT                   VWDYAPKSPITADDVAVAAPEAEEELAVGFFGSRYERATPAERDYMRAMARLGDDPVPT
FT                   AAVAEVLGRKPSSLSPARDSLIKKGLIYSAERGLVGFTVPHFGRFLRAQPV"
FT   gene            complement(134301..134933)
FT                   /locus_tag="Tbis_0116"
FT   CDS_pept        complement(134301..134933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86849"
FT                   /db_xref="GOA:D6Y2N8"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86849.1"
FT                   /translation="MTGMSKAGSILKTAVLRLLALAVVAAIGYGGYLFFGPVPRASDEP
FT                   PDSTHDLETLCWYQRRYYPTVDAYQGPAPHPIQIFEESDSQVSDPGWSPARVRQSLPKH
FT                   WNRKHDDPTSVQLVACVEIADEGPRIGECRFRGRPIPMYQGRYRATLYEVRTGEKVAEV
FT                   DDILGRKDFEESMCPAMHVWREDKEPRLLSTPDAAEYQRVFGRYVDG"
FT   sig_peptide     complement(134856..134933)
FT                   /locus_tag="Tbis_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.319 at
FT                   residue 26"
FT   gene            complement(135376..136188)
FT                   /locus_tag="Tbis_0117"
FT   CDS_pept        complement(135376..136188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_3810 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86850"
FT                   /db_xref="GOA:D6Y2N9"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2N9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86850.1"
FT                   /translation="MLQFAAAAALPIVVAMLVLGGVAKLAAGDSAPGALARLGPAVLVP
FT                   ERFARPAMICCAAGEFALAAALVFADHPAARWLPVVFFSIATYVLWDLRKRRPDAGCGC
FT                   FGDVSVAPVGLRSIARSAVLTAMAVLVALERVTGADLPALWSGTVAAWIAGYAALLLLL
FT                   SPEVEELIDRVRYRAPCEQRRIPPGRALSRLKASAAWRAHRPMLAAEEPSDMWRELCWR
FT                   FFTFPAKDGSEVVFAVYLSGRRPAVKAAVVPPDGAPAIADDSRVPISR"
FT   sig_peptide     complement(136105..136188)
FT                   /locus_tag="Tbis_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.440 at
FT                   residue 28"
FT   gene            complement(136192..137295)
FT                   /locus_tag="Tbis_0118"
FT   CDS_pept        complement(136192..137295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86851"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86851.1"
FT                   /translation="MVFIPALWPTGINYRKVGEKPFILEEDFCPRTAHRHGNHTAPPLT
FT                   ACEAGNVGNATPYRAVDRRRMLAAAALGREVAPLEPAPGDVAPYGTVRGSIIDVSPHLI
FT                   VVEDDAGEEHRLVIAPWATAWRGAPIAPAELPLRANVIIRALHGGTVADRVWADITRIT
FT                   GTIRSVSGNRDLTIELDCGPHRRPRSVVVPYRATGRIRVRHPQLEPGYLFDAIGMIDEG
FT                   TTLALLPATSQPPYRANAVPPPPPAYRGVQPTISGTAVWGDFEEYGVAYPMLEPGDAGC
FT                   EDAGVSCTGLPYLSLGSVLHVLNECDRRGNRLPIVACGCVAGRFCDRCLECGTSERGRI
FT                   VELSTTAYVELGGELTKGCFNVRVGLG"
FT   gene            137418..137918
FT                   /locus_tag="Tbis_0119"
FT   CDS_pept        137418..137918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0119"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor, sigma-E
FT                   family; RNA polymerase sigma factor, sigma-70 family; PFAM:
FT                   Sigma-70 region 4 type 2; sigma-70 region 2 domain protein;
FT                   regulatory protein LuxR; sigma-70 region 4 domain protein;
FT                   KEGG: bac:BamMC406_4381 ECF subfamily RNA polymerase
FT                   sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86852"
FT                   /db_xref="GOA:D6Y2P1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P1"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADG86852.1"
FT                   /translation="MVVNHEEFRAYVQSRGAALLRVANQITGNPSDAEDLLQAALAKTY
FT                   LAWEKIKDRASLDGYVRRAMVNINISWWRRRKLEEFPAERLPDVPIQPEARNRYDELEQ
FT                   ALDRLPARQRTAIVLRYYEDMSEMEIARALGISVGTVKSSVSRGMAKLRDDLLVSADRK
FT                   SLN"
FT   gene            complement(138250..139116)
FT                   /locus_tag="Tbis_0120"
FT   CDS_pept        complement(138250..139116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0120"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); Excalibur
FT                   domain protein; SMART: nuclease (SNase domain protein);
FT                   KEGG: sea:SeAg_A0011 protein ParB"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86853"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P2"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADG86853.1"
FT                   /translation="MERPVSPLSRALTMVAAAAALAVPAVWASPAAAASRPKNVPKNSI
FT                   EVTVKKVVDANAIDVVTAKGRTVRIGLLEAESPVRGQCWNEEALKRLKELLPDGKRAYL
FT                   RTVKPLPFDDGRYLVYVWSRSGDFVNRDLVAKGYAQASPFGRKYAYTESILRAQSKAQD
FT                   TRLGIWSEACGEAAQRPLVVDLHVPQDSASVRQGGGTLVMPEIRGTDRPRSPERYIRGA
FT                   NPFEPAQPQPGAPAASATQPSGSGVDPRFRTCAEAIRYGYGDYRRGIDPEYDWYRDADG
FT                   DGVACER"
FT   sig_peptide     complement(139015..139116)
FT                   /locus_tag="Tbis_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.707 at
FT                   residue 34"
FT   gene            complement(139749..140258)
FT                   /locus_tag="Tbis_0121"
FT   CDS_pept        complement(139749..140258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0121"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: ade:Adeh_4108 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86854"
FT                   /db_xref="GOA:D6Y2P3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P3"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG86854.1"
FT                   /translation="MSNICAYTESMDLFDDPRLTAMGLFAEVYAGLSAKTTRTFAEAGL
FT                   SEVDFETLIRLARSPERRLRMSDLAAQTSMSTSGITRVVDRLEREGLVERRACPNDRRS
FT                   LYAVLTDAGRKRLEQVLPQHLADIETWFTGLLTPEQLTQFLEALRTIRDVVRPNATAGV
FT                   APRHGR"
FT   gene            140326..140889
FT                   /locus_tag="Tbis_0122"
FT   CDS_pept        140326..140889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0122"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: afw:Anae109_3192
FT                   YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86855"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P4"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ADG86855.1"
FT                   /translation="MSVREWEGLQIPTAGDFVLDQAHTRVGFVVRHMMVSKVRGHFGEF
FT                   EGKIVIAENPLESSVEAVIKAASIDTGVADRDAHLRSDDFLSADKFPEITFRSKRIAEH
FT                   SGNEFKVVGDLTIRDVTKEVTLDVEFGGAATNPWGKHIFGFSAKTEIDREDFGLTWNQA
FT                   LETGGVLVGKKVTIEIEGEAVRAE"
FT   gene            141155..141245
FT                   /locus_tag="Tbis_R0005"
FT                   /note="tRNA-Ser2"
FT   tRNA            141155..141245
FT                   /locus_tag="Tbis_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(141375..141923)
FT                   /locus_tag="Tbis_0123"
FT   CDS_pept        complement(141375..141923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86856"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86856.1"
FT                   /translation="MPDWDNAHAKAAALAGQAGGTAPVRVAVDEGTGCIAGVVSGYDHT
FT                   PEPLWPEEAERNEPSLFLATAFTHPCYYGQRIGRLMAWWALDHTHRLGRLWVRRGTGPY
FT                   PRLVDYYTREPGWALVKKDRAPGDDGLRVPAPGRAAAAPAGARMRLGVHSRPMPHTDRT
FT                   WPPGGDRPPDGESNVAAGR"
FT   gene            complement(142153..142362)
FT                   /locus_tag="Tbis_0124"
FT   CDS_pept        complement(142153..142362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86857"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86857.1"
FT                   /translation="MTHDEAAAVAPGWRIWRSDAGRWWATRIRPFTAAAEAAGAARTVD
FT                   GDDLAELCRAIAEQERLAALAQRP"
FT   gene            142512..143750
FT                   /locus_tag="Tbis_0125"
FT   CDS_pept        142512..143750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0125"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: Tetratricopeptide TPR_4; SMART:
FT                   helix-turn-helix domain protein; KEGG: scl:sce3347 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86858"
FT                   /db_xref="GOA:D6Y2P7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P7"
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /protein_id="ADG86858.1"
FT                   /translation="MEDLPAWADRIRRERRNRGWSQKELAKRLAEVAARLGVPMPERAS
FT                   LIRSIRNWEAGRCRPRDPYPMLLARVLGLGEEELFAGSWQPYRPAPGEVLDGLLPEGDP
FT                   VGVLQAGRRIGPGIVAHLAARVHGLRRSDDVLGGGDLIGPVFRELGGIVRLYREGSHDA
FT                   RTGRALLTVIGECAQIAGWVASDAGRHDTAARTYRLGISAARQAGDRTLESHLLGSLGY
FT                   QEVNRGRLREGTELTRSAVRVLDRRSPARARALAWDRLAWAHARTGNAQAAMRALGEAG
FT                   DALAGDDGGETPAYLYWVNPAELQIMEARVYTELRRPLRAVPLLTEVLDRYDSTHAREL
FT                   GLYLSWLAVALVDANEPEEAARTARRMLEVSAGVASARTAERARVVLRRLQPYRDLPEV
FT                   RDVLSVAGDALQG"
FT   gene            143948..144406
FT                   /locus_tag="Tbis_0126"
FT   CDS_pept        143948..144406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0126"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   reh:H16_B0667 acyl dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86859"
FT                   /db_xref="GOA:D6Y2P8"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P8"
FT                   /inference="protein motif:PRIAM:4.2.1.17"
FT                   /protein_id="ADG86859.1"
FT                   /translation="MRIFKSLDEMKAAKGEHLGYSDWRQITQEQVNLFADATDDHQWIH
FT                   VDVERAKEGPFGGTIAHGYLSLSLLPSLVKEIYRVEGLRMGINYGLNRVRFPRPVPVGS
FT                   RVRAGAEILDVKDTQNGTLTALKVTLFVEGDEKPACVAETLSLLVPQT"
FT   gene            144666..144738
FT                   /locus_tag="Tbis_R0006"
FT                   /note="tRNA-Arg1"
FT   tRNA            144666..144738
FT                   /locus_tag="Tbis_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(145297..146175)
FT                   /locus_tag="Tbis_0127"
FT   CDS_pept        complement(145297..146175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86860"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86860.1"
FT                   /translation="MPTRRWAALAVTVLITSMITVNPATAQADAPRPVRAVKRLLRAKH
FT                   GVRVVETTRYFLDEWSKTFGNGVRIRGVLQLGPSGPVAVRFTWWDLPRKADSTAAKPDA
FT                   HRVIRLGKDVYVGRDQYPGPVPAGKKWIRFPKNHLGAMNRDMAQDAGLQPINVYDPSML
FT                   TAVLKRSTSTRVSGGFLYRGTMSYRELSKISKNAIVSWTTGRPIGKKSKGTIAWRLWTD
FT                   RTGLPTRLITTDTAGEGKKALVKRSDTRYTGWGFHLVVTAPPADEVIDEADLLAYVRRQ
FT                   NEPIPPDDKNT"
FT   sig_peptide     complement(146095..146175)
FT                   /locus_tag="Tbis_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.636 at
FT                   residue 27"
FT   gene            complement(146860..148044)
FT                   /locus_tag="Tbis_0128"
FT   CDS_pept        complement(146860..148044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0128"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bra:BRADO1326 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86861"
FT                   /db_xref="GOA:D6Y2Q0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG86861.1"
FT                   /translation="MTAVGTRSAAGGAASLLRVLPLAGASFAAGTGDMVIAGILPALAA
FT                   GLRVSEAAAGQLVTAYAVAYGCGTVLVAALTGGMPRRRVLTWGLAAFTVVNAAAAVVSS
FT                   FGVLLVLRVLAGLAAAACTPAAVAIAAEVAPEERRGRYLALVTGGLTVALVAGVPAGTW
FT                   LGGEYGWRSTMVFVALLGAVSLAGAAGVPFVPAPPSLGLRRRLAPLAVPAVARLLAATV
FT                   VSGIGGMMMLTYLFPVLREAGGVGHQQMTALFTLYGVAGTAAAWLGGRGADRWGPYRTL
FT                   VAALAGYGVTLWAAAALTMAGGVPSAVLGVVVVLLALAAWAINPPLQSMMYGFARGAAA
FT                   EAMALATAALFTGASLGGAMGGILLDGWGPAAIPLAGGVLLLAAVPLIPRRASS"
FT   sig_peptide     complement(147958..148044)
FT                   /locus_tag="Tbis_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            complement(148041..148424)
FT                   /locus_tag="Tbis_0129"
FT   CDS_pept        complement(148041..148424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0129"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: gur:Gura_3524 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86862"
FT                   /db_xref="GOA:D6Y2Q1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q1"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG86862.1"
FT                   /translation="MQIGELARRAGVSTRALRYYEQVGLLAPARAANGYREYDELDLIH
FT                   ARNIRDLLAIGLTTEDIRGYLEKGCLDRPLEETPRCAAELTTVEARLRSLDERISRLQR
FT                   LRDRLARHGEEIRRAIENGEAVR"
FT   gene            complement(148610..149203)
FT                   /locus_tag="Tbis_0130"
FT   CDS_pept        complement(148610..149203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0130"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bsu:BSU17080
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86863"
FT                   /db_xref="GOA:D6Y2Q2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG86863.1"
FT                   /translation="MPRVVDHRARRAEIVSAVLDLIAREGAEAVTVRKAAAAAGVSVGA
FT                   LAHYFADKDELLTAAFTEVVARSAFRLRELPPYPDTAELLFQALLASLPLNDARHTEAR
FT                   VWLAFLDRALAREDSTALLRAVYDEWRKAIAEIITKGQKEGRFRADLDPLATAGSLIAH
FT                   VDGLTLQAVFDPAAFDHDTLRRLVHAQVRSLLAD"
FT   gene            149256..150092
FT                   /locus_tag="Tbis_0131"
FT   CDS_pept        149256..150092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0131"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: bat:BAS3057
FT                   CAAX amino terminal protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86864"
FT                   /db_xref="GOA:D6Y2Q3"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q3"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADG86864.1"
FT                   /translation="MTTAAHRADLRGLIWFYVLATAVTWVCYIPLVLDAHGRLSIDLDL
FT                   QSLLGLTAIMAPTLTACLLAAVRGGRGELRRLLGMAVRVRFAARWYLVVLLVPFAVPLA
FT                   AVAVESLTSGTAPAAWLVAPTTWTLATFWMAAVGEDLGWRGYALTRALGQWGPVKASVV
FT                   HGSLWALWHLPMFFMPGTAQNDQVFPMFLLQLIGATMIFVRIFIGTGGSVAAMMLMHAT
FT                   ANLAFNTVPVFATEGGNPTRAALVSVIYLLAGVVALATLPRRTSPTAGVTTVTEAA"
FT   gene            complement(150344..151981)
FT                   /locus_tag="Tbis_0132"
FT   CDS_pept        complement(150344..151981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0132"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   afw:Anae109_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86865"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q4"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ADG86865.1"
FT                   /translation="MSSVLLALLPALAGAAIAYLVARSRTAAERADLRVAQERYRQARA
FT                   EADGLRSERDKAHERVSGLEREHSKAQTELKTLTGQVTRLQAALEAGQERLQRAEAEAE
FT                   RLKASLETERQRLDERDRLLQEAEKKIAALAAREDKAREEVQELREQLSELTAQKQGLQ
FT                   EQAARLEAARKELDRIRERNNKLLEETLRATAADMLQKSRTELVAEAEERLAAVSKPVK
FT                   EQLALLDRQLQEFSTSRAAAEAKLDQQLATLAEEGARTREETRKLVEALKKPQVRGRWG
FT                   EMQLKRAVELAGLVEHCDFDSQVHLADDDNAQRPDLVIHLSNGRHVVVDAKVPMTAFIA
FT                   AIEASDDAEADKHWADHARQLRQHVDDLASKEYHRRVGASPEFVVLFVPSDAFLVPALE
FT                   HDPALQEYAATKRVMIVTPTILIAMLRTIAYAWTQAALEENLKQVYDIGRELYERLSKL
FT                   GEHFERLGKALNQSVKAYNDTVGSLERRVLVTARKFHSLKLTETQLKRLDPIEQAPRPL
FT                   GAPELTGPAADEASGVTPAPAGGPETIG"
FT   sig_peptide     complement(151925..151981)
FT                   /locus_tag="Tbis_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.519 at
FT                   residue 19"
FT   gene            complement(152496..153191)
FT                   /locus_tag="Tbis_0133"
FT   CDS_pept        complement(152496..153191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0133"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); Excalibur
FT                   domain protein; SMART: nuclease (SNase domain protein);
FT                   KEGG: bsu:BSU21610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86866"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q5"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ADG86866.1"
FT                   /translation="MRQLPHALLALTTVALTVATATPAEAASRPKGVPKAAITAQVKKV
FT                   VDGDTIHVISRGRTLKVRLLEIDTPDWGQCWYNAATAKTKALLPVGKPVYLLRDRDPKD
FT                   RYGRYLFYVWSHNGTFVNRYLVRYGYARAMLIKPNDKYIKLMRSEEAKAKRQKLRIWSG
FT                   RCDKGGTAKPKTKGGTAEPKTTARTGTDPRFRTCAEANRNGYGPYYRGRDPEYAWYQDR
FT                   DGDGVVCER"
FT   sig_peptide     complement(153111..153191)
FT                   /locus_tag="Tbis_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            complement(153498..154877)
FT                   /locus_tag="Tbis_0134"
FT   CDS_pept        complement(153498..154877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0134"
FT                   /product="amino acid carrier protein"
FT                   /note="TIGRFAM: amino acid carrier protein; PFAM:
FT                   sodium:alanine symporter; KEGG: pde:Pden_0666 amino acid
FT                   carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86867"
FT                   /db_xref="GOA:D6Y2Q6"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q6"
FT                   /inference="protein motif:TFAM:TIGR00835"
FT                   /protein_id="ADG86867.1"
FT                   /translation="MEDILSGISDFVWGPFLLIPLLLLTGLYLTIVLRGLQFHKLLYAL
FT                   WLAFIRRKEPEGTGDISHYQALSTALAATVGVGNIAGVATAIHFGGPGAVFWMWVTGLV
FT                   GMATKYCEAFLGVRFRRTDAKGEQSGGPMFYLTYGIGGKFGATLGILFAIFGAIAAFGI
FT                   GNMVQSNSVADAINSQWGVPMWVTGLIITVIAAVVILGGIKSIGAFTSAFVPVMIIFYI
FT                   LGALWVIIANIGSLPSAIATIVTDAFTGTAATGGFAGATVLLAIRYGVARGIFSNESGL
FT                   GTGGIAAAAAKTNEPVRQALVSMTQTFIDTIVVVGMTGLVIVVTGAWQSGENGAPLTSL
FT                   AFSQGLPGEWGGIIVTLGLVFFAFSTLLGWAYYGERCMDRLFGRGAVVPYRLVFIVLIF
FT                   VGTVLELQTVWTFSDIMNGLMALPNLIGLVLLSGLVVRETKAYFSRPDWQTEYRPVSTK
FT                   R"
FT   gene            155819..156145
FT                   /locus_tag="Tbis_0135"
FT   CDS_pept        155819..156145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86868"
FT                   /db_xref="GOA:D6Y2Q7"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86868.1"
FT                   /translation="MALVGGGGLDAFAVGAFAGAVYPQVGAPKRDGSLTHFMDIAQYGT
FT                   AEEVVRRLSHPRAANVTELAGELLRISVLVRRKYRFVRWGCWSLLTGVVLSLGSIITGW
FT                   LLTV"
FT   gene            complement(156549..157187)
FT                   /locus_tag="Tbis_0136"
FT   CDS_pept        complement(156549..157187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86869"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86869.1"
FT                   /translation="MKKILRALTAFAAVFAFIGLSGPAHATTADTDPGLAAEWQYAWDT
FT                   YKFYDRTPPAPDSGRSQRTATISIVIDAPFRHVFDAYSNFSNHIGRNPFLTRVVTHKDW
FT                   RKGSLRHINLTAVEEVPYEGTIVTLNTHAQQRLHRSKRYYEVDSWSAPGVVTHQKIVFK
FT                   PLSKRQTKVTEYLTFEADNSLIDFTATNGVAAHQQIQAALKQAIENGEL"
FT   sig_peptide     complement(157107..157187)
FT                   /locus_tag="Tbis_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(157227..158174)
FT                   /locus_tag="Tbis_0137"
FT   CDS_pept        complement(157227..158174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0137"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bsu:BSU05170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86870"
FT                   /db_xref="GOA:D6Y2Q9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Q9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ADG86870.1"
FT                   /translation="MLERLNRAVDYIERHLDQRIDGAELARITLMSEYHFRRLFSALAG
FT                   IPLSEYIRRRRLTLAGAEVLAGKETLLDIAVRYGYGSGEAFARAFRALHGVGPAEARRT
FT                   GAALFSQPRISFRLVVEGSSGMRYRIVEKEGFRIVGKKARLPLVHEGMNPAIVAFVQSI
FT                   DPETRRRIEELSDQEPRGILNVSHDLAEGRAEGTEFDFYTAWSPALPRPRTWTCCPCRR
FT                   GRGRSSRSRATSPWRSSTCGGTSSPSGSRRTPIRAGRARRCSAPGSHRTGRGRTRSCGS
FT                   PWSGPRTDHGRPGAGSRDRSECWGECFQFERSVR"
FT   gene            158883..159275
FT                   /locus_tag="Tbis_0138"
FT   CDS_pept        158883..159275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86871"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86871.1"
FT                   /translation="MPAFKKILAGLALGTALTGGALTLGATAASATAPTGNFGPCFDNN
FT                   VFFNDCNNFWNNSNFWTSNCWNDSYDDSSAFVVSNGTATISFFDETHRDSYWSNSGWFN
FT                   NNGWFNNTPFFNDCGFGGFGGCGFGF"
FT   sig_peptide     158883..158969
FT                   /locus_tag="Tbis_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.520 at
FT                   residue 29"
FT   gene            159576..161072
FT                   /locus_tag="Tbis_0139"
FT   CDS_pept        159576..161072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0139"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: cti:RALTA_B1435
FT                   putative acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86872"
FT                   /db_xref="GOA:D6Y2R1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ADG86872.1"
FT                   /translation="MRAALTRVRELAERTPPTRDRFIDLLRAISIIAVVLGHWLVSVVG
FT                   YDEQGELSGRSALPDLPWAFPITWAVQVMPIFFFVGGYANAASLTAERRRGGNAVEWLI
FT                   SRSGRLVRPTTTLVLVIAAGALAARLWDTDPSRVRLVAWFATIPLWFLVAYLTVVALTP
FT                   PMYALHRRYGLLVPLVLAGLVALGDVARLTGRPLWGYGNYLFGWLAIHQMGFAWYDGRL
FT                   PARPRVALPLLLGGFAALLLLTLAGPYPVSMINVPGERLHNMSPPSLALIAVATAQLGA
FT                   ALLLRERGERWLRRRTPWLVVVAVNTVIMVIFIWHISAAILLAGALHFAGVLPTPEVGS
FT                   PAWFAWRIPWLIMLSAVLALLIMVFGRFEPGGARVTGRVRVALPEAPARVVARPATRLI
FT                   LVIAGFVSVIYALLSNSSFPDAAPAVYGLPEDALITYLGGAAILRLLRSVPRREQARSR
FT                   AAAPDGIGPSRPVDRPGAGPETGRPEDSGGRAAGHPGGDR"
FT   gene            complement(161303..162376)
FT                   /locus_tag="Tbis_0140"
FT   CDS_pept        complement(161303..162376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0140"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   ferredoxin; KEGG: bam:Bamb_4089 oxidoreductase FAD/NAD(P)-
FT                   binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86873"
FT                   /db_xref="GOA:D6Y2R2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R2"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADG86873.1"
FT                   /translation="MTSTAESAPAAGTAEARPVSMVTADGERLEFPCAPGQSVLEAAAA
FT                   AGAALPASCRQGTCGSCHASVTGGAFDHGPCSPMALPPERREQGEVLLCRTYPQGPLSV
FT                   ALPYESSRILYGGIPRREAVITALETVARETVRLELQLEPDEEAGSGCQFEPGQFMELE
FT                   VPGTDAKRAYSLANTGNWEGRLEFFIRLRPGGLFSTYLQERARPGERLTAHGPQGAFGL
FT                   RETGLRPRWFVAGGTGLAPLLSMVRHMAEWQEPQPARLLFGVNEEADVFGLAELDAVAA
FT                   ELPGFRYEVCVWRPGPSWQGQAGTPADRVAELLAATAEKPDIYVCGPPPMVDAVAQAAL
FT                   TAGVPEERVIRERYLPT"
FT   gene            complement(162373..164034)
FT                   /locus_tag="Tbis_0141"
FT   CDS_pept        complement(162373..164034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0141"
FT                   /product="hybrid cluster protein"
FT                   /note="TIGRFAM: hybrid cluster protein; PFAM: Prismane;
FT                   KEGG: bvi:Bcep1808_5223 hydroxylamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86874"
FT                   /db_xref="GOA:D6Y2R3"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010048"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016100"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R3"
FT                   /inference="protein motif:TFAM:TIGR01703"
FT                   /protein_id="ADG86874.1"
FT                   /translation="MLCFQCEQTDRTGLTPGCAGPLGNCGKDPITSDLQDLLIHAVKDI
FT                   ARYAAKARELGAPDDEAAAFIVYAMFTTLTNVNFNPTRFDALIREAASVRDRVRARYEE
FT                   AARANGLQPEPPPASAQWEPAADLDGLLAQAAEARIDAGIDTVGPDIVGLRAFNLYVLK
FT                   GICAYAHHAHVLGHDSAEVFAGIESGLAYLASEPTDAEGLLERALELGRLNFRVIELLD
FT                   KANTGTYGAPQPTAVRVTPVAGKAILVSGHDLRDLAAVLELTKDTGINVYTHGELLPAH
FT                   AYPRLKAYPHLVGNYGGAWQDQQREFAAFPGPILMTSNCIIEPHLSYRRRIFTTGPVGW
FT                   PGVRHLADGDFTPLIQAAKALPGFAEDGPEEFITVGFGRETVLTHADRIIEGVRQGAIR
FT                   HFFLIGGCDGPTPGRDYYRELALSTPDDTVVLTLGCAKYRFNRHDFGEIGGLPRLLDMG
FT                   QCNDSYSAIRVAMALADAFGCGINDLPLTLALAWTEQKAAAVLATLLALGVRGIHLGPT
FT                   LPAYLTPALVDTLVDRFGLRLIGDPKADLAAALGRA"
FT   gene            complement(164105..164713)
FT                   /pseudo
FT                   /locus_tag="Tbis_0142"
FT   gene            complement(165383..166279)
FT                   /locus_tag="Tbis_0143"
FT   CDS_pept        complement(165383..166279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0143"
FT                   /product="tryptophan 23-dioxygenase"
FT                   /note="PFAM: tryptophan 23-dioxygenase; KEGG: cak:Caul_5244
FT                   tryptophan 23-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86875"
FT                   /db_xref="GOA:D6Y2R4"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R4"
FT                   /inference="protein motif:PFAM:PF03301"
FT                   /protein_id="ADG86875.1"
FT                   /translation="MSISPPPPAPAAAELGPTTAEQRAAKAAANRGEPTLDFTGISPYD
FT                   AYVRASTLHTLQRPLSSEPGEMSFLMVSQIMELYFGLICFELCEARRALREDDLPAALA
FT                   PLNRAVLHLTGLNATWHGLSWMTPADFNRFRDLLGEASGFQSAMYRRLEFVLGYRSTSL
FT                   IRPFRRQPEVYQALVDEMRSRSIWDETIALLARRGFDIPHDLLERDFTEEHRPHEAVEA
FT                   AWVTVYREDTPDLRRLGDALAQIAEGFSDWRYEHLKAVKRTMGEKPGSGGSSGVAWLQR
FT                   SLARVVFPELWSARTII"
FT   gene            166449..166895
FT                   /locus_tag="Tbis_0144"
FT   CDS_pept        166449..166895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0144"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: bcj:BCAM1597 AsnC
FT                   family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86876"
FT                   /db_xref="GOA:D6Y2R5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R5"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADG86876.1"
FT                   /translation="MDDRDWELLRHLQADARLSFSELSRRVHLSPPAVAERVRRLEETG
FT                   VIRGYHAHVDLARAGWTVVALIRMSCYGPRCVLRDPEVREWPEVFEIHRITGDACCVLK
FT                   VAATSMEGFERLIDRLAPYGRPSSTMVLSTPVAWRPVVPPPSGP"
FT   gene            167163..167606
FT                   /locus_tag="Tbis_0145"
FT   CDS_pept        167163..167606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0145"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psa:PST_3778 lipoprotein, RlpA family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86877"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86877.1"
FT                   /translation="MITQLAAAGVTAALLAAGASTPSPTPTPTRTVVVGKDGVPEEIVV
FT                   VPIPIDSSGRAEAVSIPMPDFGPTSIQLAADPRSRRRTSGNPAFDDRFWDRHWQVRQPA
FT                   KHKRPKKAKAVRNTASSARKHGAPAAQKPKKAKQARKNARARS"
FT   sig_peptide     167163..167222
FT                   /locus_tag="Tbis_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.793 at
FT                   residue 20"
FT   gene            complement(167681..172066)
FT                   /locus_tag="Tbis_0146"
FT   CDS_pept        complement(167681..172066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0146"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: hch:HCH_00429 cation transport ATPase;
FT                   TIGRFAM: ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase-associated domain protein;
FT                   cation transporting ATPase domain protein; Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86878"
FT                   /db_xref="GOA:D6Y2R7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R7"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADG86878.1"
FT                   /translation="MFLTQLFASYAPVLRDVLPEPLRGLVVTPRRVIACPGGLRIDLRG
FT                   IGGPGTERSAALLEERLSALPGVERAEVNGRLGCVFVGCDPEAVDREELLEIARELDEQ
FT                   ERHAHETPVRVVEEHIRSIIRLATGVAGVGTIFTGIALRAPRLSPAVPALVNLLNATPV
FT                   LREELDKRIGRGPANALFHTANLVTQTLTLRPLGLVAHSMAALSRYVETRAAQRSWVAL
FT                   ERRLAEVPGSYRHVRARFRRRPTHLPHGPIERYADLASTAAALTYGFMRFAARQDERAL
FT                   AVLTAITPKIAEYTREAFAGAVRRALGERDTVVFDAEALRRMDRVDTVVLDSDALTTGS
FT                   WAIDRVEPLVDELDLNELYARLYRLLDFTDPGATRIDEEWSAAPLTDPARFPGTHATEW
FT                   RGRGMRLVEVRRADTPVALVGLSREIDPLAVPIVAAAKAAGTVLLAGDEDGTAHRLAID
FT                   QVLPGGADLAHRVFEMQAEGHCVLVVSRRAREALAQADIGFGVMDPGTATVPWDADVAG
FT                   GLPGLHLLLIGLRRAETASRDGVRIGVAGGLIGALFSFAGPASGAVGRAQLVSSLGALV
FT                   AVAWGELAGRALARTPVPLRADPTPWHAMSVPEVLARLGSSPRGISEEEAERRRAAARP
FT                   VEIAAPRSLARTVLGELANPLTPALASGAAIAALIGSAVDSVMISGVMVINAFIGGVQQ
FT                   SQADRELTRLTETTSVRVRVRRPEGTVEIRKEDLVPGDVVELRAGDAIPADGRVIKSVG
FT                   LEVDESTLTGESQLIAKRTEPTIAAAIADRASMVYEGTTVAAGTGLAVVVATGEMTEAR
FT                   RAAQLGTAPPRVSGVELRMRELSRRVLPLSVGSGLFLLVTELLRGRSLAAALVPAVSLT
FT                   VAAVPEGLPFVATAAELAAARRLSRRAALVRNPKTIEALGRVNVLCFDKTGTLTEGRIS
FT                   LQYVSDGRAGRPVEELTHHLRRVIAAAVRASPKTGGGRVLAHPTDRAIHEAAERLSITP
FT                   REGLQVWERVDEMPFEPGRGYHAVLGRTEHGHLLSVKGAPEIVIDHCTTALRGTEVVPC
FT                   DDAVRHELTREVARLARQGYRVLAVAQRPASDRSDLDESRIDELCFLGFLGLADPVRAT
FT                   AAESVDRLMRAGVRIVMITGDHPSTAEAIAVELNTLNGGRIMTGPELDELDDETLTKLL
FT                   PEVSVFARVTPAHKVRIVSCLRRAGEVVAVTGDGANDAPAIRIANVGIALGSRATPAAR
FT                   SAADLVVTDDRIETVVDAIVEGRAMWSSVRDALSILVGGNLGEIIYTIASSLIGATALN
FT                   ARQLLLVNLLTDLAPAIAVALRPPTSTEPERLLTEGPEASLGASLMREIYVRAGVTALA
FT                   AAMGWLAGRATGTRGRAATIGLVALVTAQLLQTLSGGGTNRTVVLAVLASFALLCVIVT
FT                   APGVSGFFGCRPLGPVGWTVGLGSAGLAALIGEVVQRWLLRPVASAAPRPALTPAPAAA
FT                   "
FT   gene            complement(172896..173405)
FT                   /locus_tag="Tbis_0147"
FT   CDS_pept        complement(172896..173405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0147"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: cvi:CV_3594 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86879"
FT                   /db_xref="GOA:D6Y2R8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG86879.1"
FT                   /translation="MPVQRLNHAVLYVRDLARSVAFYQEALGFRVIGDIALRGAAFLQA
FT                   PGSTNDHDLALFEIGPHAGPSTAGRHTVGLYHLAWEVDTLAELERIARKLQEMGALVGA
FT                   SDHSTTKALYAQDPDGLEFEVCWVVPADRLTDEIIAGRSTIRPLDLAKEIERYGAHTQG
FT                   GIGVSR"
FT   gene            173520..173732
FT                   /locus_tag="Tbis_0148"
FT   CDS_pept        173520..173732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86880"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2R9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86880.1"
FT                   /translation="MIGDDATRQYEANQALFRAVHEVAVRHAGAPFDQVVSALTGSLPP
FT                   TPRLQADEIRRIAEEISLGRDPSGL"
FT   gene            complement(174106..175527)
FT                   /locus_tag="Tbis_0149"
FT   CDS_pept        complement(174106..175527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0149"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: cvi:CV_2895
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86881"
FT                   /db_xref="GOA:D6Y2S0"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADG86881.1"
FT                   /translation="MKRAIRHDAMRARNLALVLGELSARGSLTRAALAEITGLTKTTVS
FT                   KLVSDLIEAGLVTEAGPVRDGERGRPGVEVQVSGDRVAALGLEVNVDYLALRVVDLAHT
FT                   VRLRRTQAVDNRGADPVEVIGSLRTMALSAVDEAVDMGLRVVGGGLAVPGPVDATGTVY
FT                   NAPNLGWREVPVAGLLDLPFPVRVENEANLAALGELWFGTGLPDFVYVSGEIGIGAGVV
FT                   VQGRLFRGTHGFAGELGHVVVRPEGPPCRCGGRGCLERYAGQEALLAAAGITGPGDAHR
FT                   PGSAHGPSTAQGSSIGRGSNTAHGSGSAQGSNTAHGPGIGQGSSTAQGPGTAEGPGTTE
FT                   GPGSAHGPDTAQGLDVTAEAPAAGVRDLLARLEAGDEAALAACEQAGAALGVALCSAVN
FT                   LLDPDAIVLGGIYAPLFPWLAEPVTEALTTRLGRMRPTVPPVVVSRLGTEAAALGAAGQ
FT                   VIEQVIADPAALLSG"
FT   gene            175636..176781
FT                   /locus_tag="Tbis_0150"
FT   CDS_pept        175636..176781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0150"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="KEGG: aba:Acid345_0903 xylose isomerase; TIGRFAM:
FT                   xylose isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86882"
FT                   /db_xref="GOA:D6Y2S1"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013453"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S1"
FT                   /inference="protein motif:TFAM:TIGR02631"
FT                   /protein_id="ADG86882.1"
FT                   /translation="MYTPTPEDRFSFGLWTVGWQARDPFGDATRAPLDPVETVHRLAEL
FT                   GAYGVTFHDDDLLAVEPDRTKAIERFKKALSETGLKVPMATTNLFTHPIFKDGAFTSND
FT                   RDVRRYALRKVMRNLDLAAELGAKTYVCWGGREGAESDAAKDVRAALDRYKEALDILCQ
FT                   YVIDKGYDIRFAIEPKPNEPRGDILLPTIGHALAFINELEHPERVGLNPEVGHEQMAGL
FT                   NFVHGIAQALWHGKLFHIDLNGQHGPRYDQDLIFGHGDLISAFFLVDLLEHGGYDGPRH
FT                   FDYKPMRTEDKEDVWESAAANMRMYLILKEKSKAFRADPEVQEALAAARVPDLSQPTLA
FT                   EGETIDDLLNEEFDPDAAAERGYHYTRLNQLAMEHLLGVRG"
FT   gene            176793..178184
FT                   /locus_tag="Tbis_0151"
FT   CDS_pept        176793..178184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0151"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: pfl:PFL_3075 xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86883"
FT                   /db_xref="GOA:D6Y2S2"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S2"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ADG86883.1"
FT                   /translation="MTLVAGVDSSTQSCKVVIRDAETGALVREGRAPHPDGTEVHPDHW
FT                   WTALQAAIEEAGGLDDVAAIGVAAQQHGMVCLDENGEVVRPALLWNDVRSAKAASDLVA
FT                   ELGGPERWAEAVGSVPVASFTVTKLRWLAEHEPENARRTRSVCLPHDWLTWRLAGRPEV
FT                   ITTDRGDASGTGYWSPITGSYRMDLLELAMGATPEVPRVLGPTERAGTAGDAVLAPGTG
FT                   DNMAAALGVGMGPGDVVISIGTSGTAFAVSDTPSRDPSGTVAGFADATGRFLPLVCTLN
FT                   AARVLEAAARILGVSHDRFSELALQAPPGAGGLVLVPYLEGERTPNLPDATGSLHGLRL
FT                   ATSTPAHLARAAVEGMLCGLADALDALKIEPRRILLIGGGARSEAVRRIAPAVFGRPVL
FT                   VPEPAEYVANGAARQAAWVLSGKPEPPEWRLGEMARYEADPTPGLRERYREATALVAGG
FT                   AVAGA"
FT   gene            178389..179075
FT                   /locus_tag="Tbis_0152"
FT   CDS_pept        178389..179075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86884"
FT                   /db_xref="GOA:D6Y2S3"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S3"
FT                   /inference="similar to AA sequence:KEGG:MXAN_2746"
FT                   /protein_id="ADG86884.1"
FT                   /translation="MIRPLSPVIACAGLGTAMIALLAGLVGTGAPADPVSMTISDHVAR
FT                   GGGVLRPALAVLGAASLVLVAGLRAAGAPVRGRPAAWLAGWGVALITAAVLPVRAATGG
FT                   AEAPWEAHLHHGVMIAAFVSVPVAALQLVGRFERDERWRVAARPVEWLTLPAGLGLTAL
FT                   TYVMLPGQGVMIGVVEGALLAVDTAILGVLAVRLLRLTWGPVPRRGRRPAGGGAVARPR
FT                   ISAAPR"
FT   sig_peptide     178389..178460
FT                   /locus_tag="Tbis_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.356 at
FT                   residue 24"
FT   gene            complement(179056..179631)
FT                   /locus_tag="Tbis_0153"
FT   CDS_pept        complement(179056..179631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0153"
FT                   /product="protein of unknown function ATP binding protein"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   dac:Daci_0776 protein of unknown function ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86885"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S4"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ADG86885.1"
FT                   /translation="MAFAPSDEPVALKILVAGGFGVGKTTLVGSISEIRPLRTEEVLTD
FT                   RGVGVDDLYGVEGKTTTTVAMDFGRITIREGLVVYLFGTPGQERFWFMWDELAYGALGA
FT                   VVLADTRRLTDCFPSIDYFEQRGTPFIVAVNCFDGAERHDPEDVRIALDLDPDVPVLLC
FT                   DVRRRASVKVVLITLVEHALKMLTAAQR"
FT   gene            complement(179612..179977)
FT                   /locus_tag="Tbis_0154"
FT   CDS_pept        complement(179612..179977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0154"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86886"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S5"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ADG86886.1"
FT                   /translation="MTDPWWIDEEAGPLVRPYALTGGRTRSSGDHLDLIAMVTTTGEPP
FT                   GDANIGPEQRRILEIARHGASVADIAADVDLPVGVVRVLLGDLRDLGLIRVRPPAHVAP
FT                   LPSTSLLKEVINGLRAL"
FT   gene            complement(179991..180398)
FT                   /locus_tag="Tbis_0155"
FT   CDS_pept        complement(179991..180398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0155"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   lch:Lcho_0658 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86887"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S6"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ADG86887.1"
FT                   /translation="MTGKATTTGELNWLLDDLISRVAAVRQAVILSNDGLVVGASQGLS
FT                   REDAEHLSAVAAGFQSLARGAGRHFGGGEVRQTIVEMENAFLFVTAAGQGTCLAVLAEA
FT                   DADVGHIAYEMAMLVKRVGQHMSTNPRQVTP"
FT   gene            complement(180395..183112)
FT                   /locus_tag="Tbis_0156"
FT   CDS_pept        complement(180395..183112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0156"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Nitrate and nitrite sensing domain protein;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   rpb:RPB_0321 OmpA/MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86888"
FT                   /db_xref="GOA:D6Y2S7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S7"
FT                   /inference="protein motif:PFAM:PF08376"
FT                   /protein_id="ADG86888.1"
FT                   /translation="MSSRNRSIRFKIFLLLLLPLLVLSAMWGFVLKVTIGDVVSLFRAN
FT                   ALYEAIGVTSADLGLELQAERAITVRLLSSGQTGSNELAAQQTKTTAAMEKFTSAARDP
FT                   STRDAMSGELLTSVDSLLAQLDRLPSIRESVTLGRFDRLQTLDAYNGLLDQLFALYERL
FT                   VALPDLDIYRQAAAMQGMGNAYEMIAREDTLIRGALVSGVLTDAERSRLSDWVATRRFL
FT                   VEKNRPILAGAMREPYEEVLSSSVFTRFTELETQILTRVRAGGELPDAAQNWAGTVDSL
FT                   LSRLDQARTRASEALTKEATSVATGIVTRLAIAGGLGLVAIVATILFSARFGRRLTGEL
FT                   TDLRNAALDLAEVRLPRLVERLRRGEEIDACAEAPPIKVNGPAEIEDLAHAFSTVQRTA
FT                   VESAVGEAHLRRGINQVFLNIARRKQSLLQRQLKLLDAMQRRTEDPQLLEDLFQLDHLT
FT                   TRMRRHEENLIVLSGAPPGRTWRKPVPFIDVVRGALAEVEDYRRITLGPIPEAALRGES
FT                   VADLVHLLAELLENATVYSPPSTRVDVRGEIVANGLVVEIEDRGLGLSAEEYAEINRRL
FT                   ADPPEFDPAGSDRLGLFVVGRLAARHGVQVVLRGSPYGGTSAIVLIPRTLVAHEDATGT
FT                   VPDDAGRGRAHGRPERIENRLGQEEPPAQEDRAARPEPAEQGASLFAPPARPQTPAPDQ
FT                   PPAQADGSGGAAALDGAARPGGPSPLPRRVRTTPAAPDRGTPPPAQPASATPPDQRIPA
FT                   PAQAAPEGETGAPQAGRPGAAPEPAGEPAGTAPAPARAEGGSGETAGQDSPAPQRGVLR
FT                   SGVERARVSITNGTYNGLPRRVRQASLAPQLRNRPLSAPTPAGGIAERPPEQVRALFSA
FT                   IQRGAQRGRAESQDPSGSASADHVPDTYREKGDE"
FT   sig_peptide     complement(183014..183112)
FT                   /locus_tag="Tbis_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.716 at
FT                   residue 33"
FT   gene            183231..184040
FT                   /locus_tag="Tbis_0157"
FT   CDS_pept        183231..184040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0157"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: RDH12; retinol dehydrogenase 12
FT                   (all-trans/9- cis/11-cis) ; K11153 retinol dehydrogenase
FT                   12"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86889"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG86889.1"
FT                   /translation="MIAVITGAGSGIGAAAALELAKRGYRLVLVGRTPEKLAGVADRIA
FT                   SVTETRPDTITADFASLDQVRYLADQLLRRYDDIHVLINNAGVMTSQRRITADGHELIM
FT                   QVNHLAPFLLTNLLFDRLKFASARVISTSSIAAYSGTIDPSDLSRERRWWNSWLQYFDS
FT                   KQANALFTVSLAERGLNATCFHPGVVRTPFAGDTLTMKLMLMIPGLAKPPATAAARLVH
FT                   LVTHDDGINHPGRFFMGNGPAWVPRRMKDPELAEALWEASCAATGLR"
FT   gene            complement(184142..185083)
FT                   /locus_tag="Tbis_0158"
FT   CDS_pept        complement(184142..185083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bat:BAS2719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86890"
FT                   /db_xref="GOA:D6Y2S9"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2S9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86890.1"
FT                   /translation="MGTTVFAAVYVRNQGARRHPGGPAVDRMSTHDAAHTVRRRMSHLV
FT                   RLAKFLVPVIIAVEAVLVLSGVTSIGDATMVVIATEVLLFWLIVIEIVEIRRAYRRFAR
FT                   EEPDRFTAAMRAVESVLPEPVGRLIAHELMLQRALVLLVLRKRGVPPGGQGIPHHRPVM
FT                   GFLGAVLGLTAVEMLGVELAVPWPTVRWILLAVSLIGCWWLAGFAAGLVVQPVTVGPDT
FT                   LRIRYSCFADLSVPLAAIDRVVPLPRSRGRRRTAMAHGDEPVVEVGKQQHGAPPGEPVP
FT                   IRLRGGAPREVRRVHLWVDDPQALAAAVAEYR"
FT   gene            complement(186042..188126)
FT                   /locus_tag="Tbis_0159"
FT   CDS_pept        complement(186042..188126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0159"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bcz:BCZK4970 bifunctional hypothetical
FT                   protein/glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86891"
FT                   /db_xref="GOA:D6Y2T0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG86891.1"
FT                   /translation="MAETDETRLPDETPDAPRFTRLGPVNWLPEERKIVERYEERIRDL
FT                   EKRLAIAEARAEYATWKLKATQAQRPYRVAQALTGATKPGKFVRLPRDLSKAIKVRKAP
FT                   KPPLPVTEAAKLAEAKGPEVTIPTLQWPDGPVVRPDLRVAVILDDFSRLAFRYEWDQIE
FT                   FGLHDWREIFAEKRPDLLFCESAWHGNQGRWRYQMTGTNAPKKELRELVAWFKEQGIPT
FT                   VFWNKEDPPNFDHFIETAKLFDYVYTCDGDMIPKYREILGHDRVGVLQFAAQPRIHNPI
FT                   QTRLGRPYDIVFAGMYFRDKHPERREQMETVLAPLRELGLHIFARNATVADKYAWPEEY
FT                   RPHIVGELPYEQMLAAYKMYKIFLNVNSVIDSPTMCARRVFELSACSTTVLSGWSRAIE
FT                   ETFGDLIPVAHTQEEAYNLALYFLNSPELRARQGHLAMREVLSKHTFSHRVDQILRDLG
FT                   WPVRPRSRSVSVVLPTNRPGQIEHAISQVARQRHRNLELVLVLHNMSEDPSVVRDKALA
FT                   AGIPEVKVLTADPDWTLGEVLNHGIAHAEGELIAKMDDDNIYGEHYLSDLIRAFDYTDA
FT                   EMVGKGAHYTYFPDQDITVLRLPGLEHRYAHLIQGATILAKADLLRAMPFEPVNAGEDT
FT                   RLVRRCKEEGIRIYSADRFNFIYIRGADAKAHTWQAADHKLTRNAQFCFAGNPERHVLI
FT                   "
FT   gene            complement(188553..189680)
FT                   /locus_tag="Tbis_0160"
FT   CDS_pept        complement(188553..189680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0160"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: ade:Adeh_4279 UDP-N-acetylglucosamine 2-
FT                   epimerase; TIGRFAM: UDP-N-acetylglucosamine 2-epimerase;
FT                   PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86892"
FT                   /db_xref="GOA:D6Y2T1"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T1"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADG86892.1"
FT                   /translation="MRDNPLVLHVLGARPNFVKAAPVVHALAELGVRQAIVHTGQHYDA
FT                   LMSDVFFADLNLPEPIANLGVGSGTHARQTAALLVGLEDVLQEHAPALVVVYGDVNSTL
FT                   AAALVCAKLHIPFAHVEAGLRSFDREMPEEVNRVVTDALADLLFCTSPDALSHLANEGV
FT                   DPAKVHFVGNPMIDSLFAALPKLDPEPIKRRLGVDGRYAVATLHRPANVDDPEAARELV
FT                   SAVLGVAEHVRVIVPLHPRGRTRLAEAGLVDRENLKIIEPLGYVDFLSLVRGAALVVTD
FT                   SGGVQEETTMLGIPCLTVRPNTERPITVTHGTNRLVTPASLPAAAAKALADGAATPAGE
FT                   LPPLWDGKAGPRIARVIAAWLRGDNLSPAGRGTVG"
FT   gene            189794..191467
FT                   /locus_tag="Tbis_0161"
FT   CDS_pept        189794..191467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0161"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   dar:Daro_2409 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86893"
FT                   /db_xref="GOA:D6Y2T2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG86893.1"
FT                   /translation="MPTGSRSTSTSKIDAKKARADLGRFLRGFVKNPVVVSRIFVSKVR
FT                   SDPMRVAQAAAEAMPAPLRPLVGRVAWPVARYVKVTTRKVVRRMADGPLEKAKDLFDQG
FT                   RMSEAIKVLRPHQRWPFIRRRIAYYEGEMAALGPNPIPPQPKVTVADRVPGRVLHLVTN
FT                   ALPYTQAGYTVRTHRIVTAQRAAGLDPHVVTSWGWPMLQGHTDAAPYEDIDGIPYHRLL
FT                   PKGEVPSESRGRMILGAAEVTELVKTLRPQVLHAATDHRNGSVALAVRERTNTPFVYEV
FT                   RGFLEETWVSRDPRRVGSERHRMQREREAQIMREADAVVTLAETMAAEIVERGVPRERI
FT                   YLAPNAVDDSLLTAEFDGAALRRRYGIGDDEIVVGSVSSIVAYEGFATLLDAAALLREA
FT                   GTPVRVLLVGDGAERPALLEQVERLGLKDLAILPGRVAPDEALQAQAALDIFVCPREDL
FT                   RVCRLVTPLKPVEAMALGKPVVLSDLPALAELVGSGEAGVLVPPGDASALARAIAELRD
FT                   DPARRREMGEAGKAEVAAKRTWSSLAKTYQNIYRTVTDGR"
FT   gene            191578..192840
FT                   /locus_tag="Tbis_0162"
FT   CDS_pept        191578..192840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0162"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase; UDP-
FT                   glucose/GDP-mannose dehydrogenase dimerisation; UDP-
FT                   glucose/GDP-mannose dehydrogenase ; 6-phosphogluconate
FT                   dehydrogenase NAD-binding; KEGG: sus:Acid_4597 UDP-glucose
FT                   6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86894"
FT                   /db_xref="GOA:D6Y2T3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T3"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ADG86894.1"
FT                   /translation="MTGFDLTIIGLGYVGMPLAKEATAAGLRVAGLDVDPHKIEELKAG
FT                   RSYIDDLTDGDLDAMLSAGFTPTVDPSVLAGSSTIVICVPTPLDEDRRPDLSAVVNASR
FT                   TVAGQLRPGTLVVLESTTWPGTTDEVVRPILEESGLRAGVDFHLAFSPERIDPGNPKYG
FT                   VRNTPKVVGGYTEACRERACAFYSRFIERVVPVSGTREAEMAKLLENTYRHVNIALVNE
FT                   MAIFCDELGVNLWEAIEAAATKPFGFQKFLPGPGVGGHCIPVDPSYLSYTVRKLGYPFR
FT                   FVELAQEINERMPSYVVTRVQRLLNRARKPVNGSHVVLLGVTYKPDISDTRETPAVPVA
FT                   EALLELGADLSYCDPFVKEWSVKGRVIPRRESLEEAVEEADVAVLLQQHSAFDLDTVER
FT                   KARLVLDTRGVLTESDRVERL"
FT   gene            192854..193942
FT                   /locus_tag="Tbis_0163"
FT   CDS_pept        192854..193942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0163"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: bha:BH3662
FT                   glycosyltransferase (biosynthesis of lipopolisaccharide O
FT                   antigen)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86895"
FT                   /db_xref="GOA:D6Y2T4"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADG86895.1"
FT                   /translation="MHVLVMTVVHHPEDARILHRQIRALVDAGHEVTYAAPFTARGVTP
FT                   RPWVTGVDLPRAAERRRIAAIWAARRLFKRMRGKVDLVLIHDVELLLAVVGVRNRPPVV
FT                   WDVHEDTPATLSLKPWLPAFLRPPVRFLARLLEGTAERHLHLLLAESAYAQRFKRQHLV
FT                   VPNETWVPDHVVPPGDDRVVYLGWLSEARGVHEAVEVARLLRPHRVSVELIGYADPQSR
FT                   PLLTAAVNEGLLEWRDFMPNDEALKRLDGALAGLSLLHDEPNYRHSMPTKIVEYMAHGI
FT                   PVITTPSPRAVELVERYRCGTVVPWRDPAAVVQAILHYRDNQEERVHTGGRGYAAARAY
FT                   HHWPNSARRFVAQLEAWAAGRE"
FT   gene            193990..195819
FT                   /locus_tag="Tbis_0164"
FT   CDS_pept        193990..195819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86896"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86896.1"
FT                   /translation="MRWLTIFLGLVILAGVAATVIVLREGSPDPGATAARSAPPQATAK
FT                   PSPTESSFTDPCGTFETVQRTPYPVSGYWLVPTSDPCTWRRQLEAIHRLGGDTVIRLGF
FT                   GLAPRPVNDQGQVLEAPDFSGDKKPKPDKRYLACVEDGLPCVKAAERDLKAAHPDNRIS
FT                   WTYVYRTDERFGSGIFRCPTMERQIEVGGAVYYRLIAPEDGSDDPSCDFSSKGRAYHLI
FT                   LIRGETKDSLTELLDLGDRFGIQVFPALPSAPRDPVASTTANPRHIGTLTTLTRRILQD
FT                   YGDRFKDRASLGGVYQPFELQLREWPDPSKVQTLQVYEEQHRIVEQELPGKPILVSPYI
FT                   DSRRERDFTATPAQVAEGFKAVARTGVEIIAPQDGRGTGKVGLYWPNLKNKPVDERLEP
FT                   VVGKSTYAQAYYGSTRDYYRAMARAREELAAEGVDVELWANVEAFEPAATPATKCAAQT
FT                   RGRTDKARLDTQVALATPYVSKLISYMWSDFFTCGSPSLSEEIAQDWNRPIAVEARRVR
FT                   RDIQDGLEIRGFHLQGAKVTLTWAGISTPRVVDSTAVGWHDPTPIEGLPAGVERVWIPV
FT                   DWGSVPGDVWVRVTVTAPDGRKAAESVYYHNAA"
FT   sig_peptide     193990..194049
FT                   /locus_tag="Tbis_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.438 at
FT                   residue 20"
FT   gene            195852..196511
FT                   /locus_tag="Tbis_0165"
FT   CDS_pept        195852..196511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0165"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aeh:Mlg_0745 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86897"
FT                   /db_xref="GOA:D6Y2T6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG86897.1"
FT                   /translation="MIPRIAVSVDLVVLTVRNQQLSALVWRRDRPPYEGKWALSGGFIK
FT                   LDEDLPAAAARVLAERAGLKDAPVHLEQLQTYGYPARDPRRRVLSVAYLGLAPDLPAST
FT                   EAHMSWQPVSELTDMAFDHRRIMLDGVERARAKLEYTSLGAAFCPPEFTVAELRRVYEI
FT                   VWGRRLDPRNFHRKVTKAKGFLVSTGRTTTRDGGRPAMLYRRGPAVLLHPPMLRSS"
FT   gene            196692..197750
FT                   /locus_tag="Tbis_0166"
FT   CDS_pept        196692..197750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0166"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: maq:Maqu_1024
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86898"
FT                   /db_xref="GOA:D6Y2T7"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T7"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADG86898.1"
FT                   /translation="MPRFRSILETMPTYKPGKTVVSPEGKSYKLSSNESPYGPLPSVVE
FT                   AIAKAATEINRYPDPGATRLTEAIAERLDVPPGHVALGAGSVAVAAQILEAVAEPGVEV
FT                   LYAWRSFEAYPLLADLAGATSVTVPLRDETHDLEAMADAVTPRTRLIFVCNPNNPTGTV
FT                   CRKAEIERFLDRVPEDVLVVFDEAYREYVRDADVPDALVYYRERPNVAVLRTFSKAYGL
FT                   AGLRVGYLIGQEPVAAAVRKTPPPFSINHLAQAAAVASLQAEDELMARVESVIKERSRV
FT                   REALIADGWTVPPTEANFVWLRLGERTTAFAEHCAGYGVAVRPFAGEGVRVSIGDPEAN
FT                   DAFLAAARSFPR"
FT   gene            complement(198212..199558)
FT                   /locus_tag="Tbis_0167"
FT   CDS_pept        complement(198212..199558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86899"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86899.1"
FT                   /translation="MGRTLVERTEEGPRGSRLGTVTPELTIGVVGSHDLVERVMLMGSI
FT                   SAPLPCRLIAVAYRDEREAADKVLRLGPSVDACLFASPVPYEIAQRAGALTMPATHVQF
FT                   GGPSLTAAIARAALDERVDPRRVSVDGLSRAEIEEAYADLDLPSTEVTTREEPGPVSTI
FT                   TAFHERLLRQGVTTAALTCVRAVAERLTAAGFPAVPIRPTTAAIRNALQTAALLGARHR
FT                   LEESQLAVVLVEVPTLREPVRRSAPRYWREELRLSLHRLLVQEANRISAGVWPIDGHSY
FT                   LVVATMGSIAAVTDGFRVMPFAARIREELGLIAEIGVGLGRTIHEAEAHAKGALTRSQG
FT                   GKQPHGFAIDREGRALVPPPRSASAQNGMTKRKGMEILSRLAAKLDSRDWVVDAETTGK
FT                   LLGVTPRTARRLLRTLVDEGLAWPLPPNRSPQPGRPRQLYRLIVEKLSR"
FT   gene            complement(199712..200989)
FT                   /locus_tag="Tbis_0168"
FT   CDS_pept        complement(199712..200989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0168"
FT                   /product="UDP-N-acetylglucosamine1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1- carboxyvinyltransferase); KEGG:
FT                   bsu:BSU36760 UDP-N-acetylglucosamine 1-
FT                   carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86900"
FT                   /db_xref="GOA:D6Y2T9"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2T9"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADG86900.1"
FT                   /translation="MVRYRVRGGNVLRGTAFIQGAKNAVLPMIGAALLATEGRTVLRNV
FT                   PVIEDVRRAVELAQAVGATVEFHESERTLVIDASRLTSPVLPAAIANRFRGTVLFVPAL
FT                   LHRLGEAVIEGIGGCNLGSRNLDFHYNGYKRLGAVVNEQESVIHIKAGKLVGAPLYLDT
FT                   PSHTGTENLVMAATLAKGTTVIENAALEPEVLDVIAMLTRMGAKIRGGGTGFITVEGVE
FT                   NLKAVEHTVMPDRLDAGVFAMAAAITGGEVTLVGAELQHLGVVRWKLEQMGVEFETNGA
FT                   VLHVRREKPLRPINVITDTYPGFATDLQSPIMAVACLADGTSYIHERIFDGRFALAGEL
FT                   NKMGAKIEVQGSRAVVHGPTPLRGTQVTAHDLRSGIALVLAGLVAEGETVIESGYLIDR
FT                   GHSAVAERMRALGANVEREISTPADR"
FT   gene            complement(201157..202008)
FT                   /locus_tag="Tbis_0169"
FT   CDS_pept        complement(201157..202008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0169"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamides
FT                   ynthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: psa:PST_2788 phosphoribosylaminoimidazole-
FT                   succinocarboxamide synthase; TIGRFAM:
FT                   phosphoribosylaminoimidazole- succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86901"
FT                   /db_xref="GOA:D6Y2U0"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U0"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADG86901.1"
FT                   /translation="MVKHLHSGKVRDLYETEDGLLLMVASDRISAFDHVLQPEIPDKGK
FT                   ILTQLSLWWFDQLADIVPNHVVSTDVPPEYAGRAVLCRKLRMVPVECVARGYLAGSGLT
FT                   DYRKDGAISGVPLPPGLTEGSRLPEPIFTPSTKAPKGEHDRPMTFDEVVAEVGQEVAEE
FT                   LRRITLAVYERGARIAAERGIILADTKIELGWDENGVLTLGDEVLTPDSSRFWPLGEWK
FT                   PGRPQPSFDKQFVRDWLLSPESGWDRASGAAPPPLPDEVVARTRERYIQAYELLTGRRF
FT                   EP"
FT   gene            complement(202165..203427)
FT                   /locus_tag="Tbis_0170"
FT   CDS_pept        complement(202165..203427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0170"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: cak:Caul_4544 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86902"
FT                   /db_xref="GOA:D6Y2U1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U1"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADG86902.1"
FT                   /translation="MNRDNEWVRVLVIGSGGREHALCRALRRDPAVSEVHCAPGNAGIA
FT                   DDAVLHSVRPTDGEAVANLAKRIGADLVVIGPEAPLVAGVADAVRQAGVPCFGPSERAA
FT                   MIEGSKAFAKEVMAAAGVPTARSFVCTTEQEAAAALDAFGPPYVVKDDGLAAGKGVVVT
FT                   EDRDRALAHARACERVVIEEFLDGPELSLFALCDGSTAVPLQPAQDFKRAYDGNKGPNT
FT                   GGMGAYTPLPWIPGDLTERVMSEIVTPTITELAERGTPYTGVLYAGLALTSAGPKVVEF
FT                   NARFGDPETQVVLDRLATPLGGLLYACATGDLAAHGPLRWHGGAAVTVVLAAENYPADP
FT                   VKGDPILGLPSDVEGAYVLHAGTARDESGRLVSAGGRVLNVVGTGADLAEARSRAYEAI
FT                   GRITLRGSHYRSDIALNAAAS"
FT   gene            204186..205283
FT                   /locus_tag="Tbis_0171"
FT   CDS_pept        204186..205283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0171"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: bbt:BBta_0881 putative metal ion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86903"
FT                   /db_xref="GOA:D6Y2U2"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U2"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ADG86903.1"
FT                   /translation="MRSSLLFPRIRPRVLPARLTTPAPEPSPEPATGHSVVEFGAYIGG
FT                   EKITVRSVPEAVRLVREHNAEGARDDAFVWVGLHEPAAPEVEWLGEVFGLHPLAVEDAI
FT                   KAHQRPKVERYGDSLFVVLKTVSFREHDRASGDIIDTGEIMIFVGHDFVVTVRHGDNCP
FT                   LGGVRQRLEGDPKWLRRGPTGVLHAIADHVVDKYLQVVDLMQAELEEVEAAVFAEVSSR
FT                   DINRIYQLKREMLELKRAVQPLQAPFDSLPQRRIIPSEMREYFRDIGDHLSRVCEQVQA
FT                   SNELSDSILQAALARSNALANEDMRKISSWVAIISVPTMIAGIYGMNFTHMPELDTKFG
FT                   YPVVLGVMVIACTLLHRAFRRNGWL"
FT   gene            complement(205480..206106)
FT                   /locus_tag="Tbis_0172"
FT   CDS_pept        complement(205480..206106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0172"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rlt:Rleg2_0103
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86904"
FT                   /db_xref="GOA:D6Y2U3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG86904.1"
FT                   /translation="MSEPLGLRERKKLRTRRALVEAALRLFGEQGYQETTIAEITAAAD
FT                   VSARTFFSYFGSKEDVLFFDHQERTDEALKLLADRRPDEPIRDVLLRLVEHGLRASLLP
FT                   ADMASELSSVRYRLVSSVPALRARGLRLLFETERRLAAALHETYPGELDRTEAAAVIGA
FT                   LSGAANLAVQVSMDRGEPPERAWEAGRRAAEIAMGGLAVLGRGTV"
FT   gene            206222..207409
FT                   /locus_tag="Tbis_0173"
FT   CDS_pept        206222..207409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0173"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: bxe:Bxe_C0945 putative
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86905"
FT                   /db_xref="GOA:D6Y2U4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U4"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADG86905.1"
FT                   /translation="MTESLNHVACYPIHREHIFDPPEALTRWAEQAPIHPLTFPDGHEG
FT                   WLVTGYAAVREILADRRFSARPELVHSPFFDRIERDPQRQEGFFIRMDPPEHTRYRRLL
FT                   AGEFTVRRMMRLEPRIKEIVTEHLDRMELAGPPVDLVQAFALPIPSLVICELLGVPYAD
FT                   REKFQRDSATMLDLESTPEQVQAAVDDLLAYLGDLVTRKREHPEDDLLSVIAPKLTLEE
FT                   AAGVGLLLLVAGHETTANMLGLGTLALLSNPDQLAVLRGDAELIGNAVEELLRYLTIVQ
FT                   IGLARAALEDVEIAGTRIRAGQTVLLMLPTANRDPERFPGGDALDLTRPAHGHLAFGHG
FT                   IHQCLGQQLARLEMRIAYPALFERFPGLRLAVPVAEIPLRTSMVVYGVHRLPVTW"
FT   gene            207430..207651
FT                   /locus_tag="Tbis_0174"
FT   CDS_pept        207430..207651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0174"
FT                   /product="protein of unknown function DUF1271"
FT                   /note="PFAM: protein of unknown function DUF1271; KEGG:
FT                   rec:RHECIAT_PB0000290 cytochrome P450 monooxygenase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86906"
FT                   /db_xref="GOA:D6Y2U5"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U5"
FT                   /inference="protein motif:PFAM:PF06902"
FT                   /protein_id="ADG86906.1"
FT                   /translation="MKIKADTGRCIGAGMCVMTLPEVFDQSEEDGTVVVLAPDPPGELH
FT                   ALVRRAVTLCPSGALSLEETPVSSNSTG"
FT   gene            complement(207629..208540)
FT                   /locus_tag="Tbis_0175"
FT   CDS_pept        complement(207629..208540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0175"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: bja:blr6584 putative glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86907"
FT                   /db_xref="GOA:D6Y2U6"
FT                   /db_xref="InterPro:IPR004129"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U6"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ADG86907.1"
FT                   /translation="MYGYVELHGHRGARGLRPENTLPALMHALELGVDVLEFDLVMSAD
FT                   GELVLCHDLIVSDVTSADTAPAAEGAPYVGKPVISLTLPQLHTLEVGRRRPRCPEDPFA
FT                   ATQVPVPGLRMPTLGAALDLIEALGAGHVRLNLDLKTDPTRPDLSADPRRLTDLVVAEL
FT                   DRRGLLRRSSILAFDWRILEIVRPLGIPRYALVEKPTMSPEWMNGIHLDDFGGSLVEAA
FT                   RAAGATALSPEWVLIDHEVMEHARRHGMPVIAWTVNDVAEAGRLIDLGVSGIVTDYPDR
FT                   MRPLWRSRGFPLPAPLSRCCCC"
FT   gene            complement(208975..210258)
FT                   /locus_tag="Tbis_0176"
FT   CDS_pept        complement(208975..210258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0176"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: adenylosuccinate synthase; K01939
FT                   adenylosuccinate synthase; TIGRFAM: adenylosuccinate
FT                   synthetase; PFAM: adenylosuccinate synthetase; SMART:
FT                   adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86908"
FT                   /db_xref="GOA:D6Y2U7"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U7"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADG86908.1"
FT                   /translation="MPAVVLVGAQWGDEGKGKATDLLGADVDYVVRYQGGNNAGHTVVI
FT                   KDQKYALHLLPTGVLSPHVVPVIGNGVVIDPGVLLSEIDALTERGISCDRLLISANAHL
FT                   IMPHHKAIDKVTERYLGKARIGTTGRGIGPAYSDKIARVGIRVQDLLDPGILRQKIEVA
FT                   LNEKNQVLTKIYNRRGLEPARVLEEYLGYAERLRPYITDTSLVLSKALDEGKVVLLEGG
FT                   QGTLLDIDHGTYPFVTSSSPTAGGACTGAGIPPNRLTKIIGILKAYTTRVGSGPFPTEL
FT                   LDEQGEWLRQTGGEYGTTTGRNRRCGWFDAVIARYAVRINGITDFFLTKLDVLSGLERI
FT                   PVCVAYDIDGVRHDEFPMTQTEFHHAKPIYEELPGWQEDISDAKSFEDLPPNAQAYVRT
FT                   LEELTGAPISAIGVGPGRDQTLVLRPLL"
FT   gene            complement(210769..211209)
FT                   /locus_tag="Tbis_0177"
FT   CDS_pept        complement(210769..211209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86909"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86909.1"
FT                   /translation="METHENLLAGPPPTLLPDNPEARQMLESGARAADVAARFPAYSAA
FT                   WARLADEYFAAGHAVTSYAFARTGYHRGLDQLRRAGWKGHGPIPWEHEPNRGFLRCLYA
FT                   LQRAAQAIGEMDEAVRCAQFLRDSSPTAAEILNGKASEKAEG"
FT   gene            complement(211349..212371)
FT                   /locus_tag="Tbis_0178"
FT   CDS_pept        complement(211349..212371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0178"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; KEGG: sfu:Sfum_1469
FT                   fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86910"
FT                   /db_xref="GOA:D6Y2U9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2U9"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ADG86910.1"
FT                   /translation="MPIATPEVYAEMLDRAKAGGFAYPAINVTSSQTLNAALRGFAEAE
FT                   SDGIIQVSTGGAEYFSGTAVKDMVTGAVALAEFARVVAEKYPVNIALHTDHCPKEKLDG
FT                   FMRPLIEISRERVKRGQDPLFQSHMWDGSAVPLEENLRIAAELLEKCAEARVIMEMEIG
FT                   VVGGEEDGIVGEFNEKLYTTPADALATAEAVGLGERGRYLLAATFGNVHGVYKPGKVKL
FT                   RPSVLKEIQEAVGAKYGKEKPFDLVFHGGSGSALEEIHEAISYGVVKMNIDTDTQYAFT
FT                   RPIADHMFKNYDGVLKVDGEVGNKKVYDPRSYGKLAEAGMAKRVVEACEQLKSAGKRIK
FT                   "
FT   gene            212563..213252
FT                   /locus_tag="Tbis_0179"
FT   CDS_pept        212563..213252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0179"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   afw:Anae109_1317 SNARE associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86911"
FT                   /db_xref="GOA:D6Y2V0"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V0"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADG86911.1"
FT                   /translation="MDVLLNLLDPKWWLSMLGAFATIGVIAMIFAETGLLVGFFLPGDS
FT                   LLVCAGIFCTASAAQAFGIPPLNLTALLIGTPLAAICGAQLGHYLGAKVGRKLFERPDS
FT                   RFFKQEHVRKAEYYFNKFGPAKAVIIARFMPIVRTFMNPVAGVLEMDARKFFVWNVAGG
FT                   ILWVESMVLLGYFLGSKVENIDRFVLPGAIVIIILSVLPIVREVLKERRAARMAAPRGR
FT                   HARQRIQ"
FT   gene            213308..213739
FT                   /locus_tag="Tbis_0180"
FT   CDS_pept        213308..213739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86912"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86912.1"
FT                   /translation="MGRHRSDRAGAAKPLTIGAAVVLVLAVLVVAVRTLMPDGGSDASA
FT                   AATPAAEAAASENPAERVPTVRLVCQAERCPVFVRIPGGDVLIDRDLSKGEEASYYEPE
FT                   LEIVLDDAGSVRVFENGTPREGGQPGEREAFKVKRDPDR"
FT   gene            complement(213717..214253)
FT                   /locus_tag="Tbis_0181"
FT   CDS_pept        complement(213717..214253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0181"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: scl:sce0446 putative orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86913"
FT                   /db_xref="GOA:D6Y2V2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V2"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADG86913.1"
FT                   /translation="MSDREQLLDLIKSKGIVHGRVVLSSGQEADWYIDLRRITLDGEAA
FT                   PLVGRVMLDLTADLDYEAVGGLTLGADPVATAMLHAAAARGRRLDAFVVRKSGKAHGLQ
FT                   RRIEGPDVAGRRVLAVEDTITTGGSVLTAVEALREAGAEVVGIASIVHRGGEERLRATG
FT                   LPYRSAYSLTDLGLA"
FT   gene            214373..216850
FT                   /locus_tag="Tbis_0182"
FT   CDS_pept        214373..216850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0182"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   ade:Adeh_0794 sigma-24 (FecI-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86914"
FT                   /db_xref="GOA:D6Y2V3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG86914.1"
FT                   /translation="MRRKNRQSDEELLDAVRRGDTSAYGMLYQRHVLPARALARRLVRG
FT                   DEEVEDVLVETFAGVLEIIRRGGGPGSAFRPFLLASLRRYAAAGEVDLTDPDACYVDPE
FT                   LAGLEQAPLARAYRSLPERWRAVLWHIEVEGATPAETAPLLGMSARRTARFAREARGAL
FT                   REAYLALHESDAHDEACRPVLALLLRHVEGLLPKREARTVDQHIAGCIECRSVFLELTD
FT                   VTQGLRMIVGPLYAGPAAEDYLSDLRRVRQEARRGPVRGVLLPLARLLPGLWRRLPPAQ
FT                   RAAAAGAALLLSAVTVILSAEPVGERRAVGGLALPTLPSPDSAVTGQAGDGPGRPERGE
FT                   RARPRDGHRAGGPGGAPDGLPAGEAGSGPRRGTGAPAGSRASDASARPQPGAGGLPVRR
FT                   PLAARDPGPAPSAAGVPDPAPAGADHPVRLTRRPDLGITVQPLGALVRGRSGIVALGAR
FT                   NTGTARTERVVATVLLPPGVRFRGLVAPERPGAGRPWSCRDAARAVRCTRPGLAAGASA
FT                   TAFLRVKVAEGAPLGRPVRAWARSGERIAFATSSSGVRAMGVPARFAAEGRLLTQVIGG
FT                   VLFGPPGDAPTGVPATVPGGPEANAESGARLTLPARGRVLWAGLYWSAAGHGRLQAGEV
FT                   LVRAPGARGPVTVRPASVIRRDLPGLSGYQAFAEVTGLVRAHGSGQWAVAGASAALRPG
FT                   GPGVLRWARWTLVVVAADPRQPFGRVMVLDTAEVVDDRGRLNVPLTGLAPAASPVRIDL
FT                   AVWTGERDGSAALRDRSRRGASARGDGQGSDVSLATARPLRGLLGQRPVLTLTGVRDTL
FT                   LFGVAAVSAHHWS"
FT   gene            217040..218446
FT                   /locus_tag="Tbis_0183"
FT   CDS_pept        217040..218446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0183"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG: Prp2;
FT                   proline rich protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86915"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V4"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ADG86915.1"
FT                   /translation="MDRCALFVDAGYLLADGARAVHGTRQREAVSWDLPGLVRFLGKLS
FT                   RDRTGLPLLRCYWYEATVEGRRTPEHDVLADIPGIKLRLSRIRPGRREGMDAQVHRDLM
FT                   TLARNNAICDAVVVSGDEDLVQVICDAQDLGIRVTVVQIAGESGWSSARALRQECDDLI
FT                   EVGGGQLRPYVTLVTATGSPPSPAQGNGRAPGPAGNGQAYDSGPGQYQPKHGAPNGRSP
FT                   GLPSGPQPTPPPPAGAHARQPDQPALPAPLDGPSSPRYSPEPTSAPQLAQQQPAAQPQA
FT                   GQGQPPQGQQNRPAAQPQPQARPPQPAPGPASPLNAPIPPQAPPSAQPASAPAAPSTPP
FT                   PVPAPVSARQPAPQTGYDPGNGYVPTPLGPYTGPQPAPVQTQSATGTMTLAEAVKSAHK
FT                   EGHEFGQSVARDAPPLWLEAVLARKPRMPSDLEARLLQGSSLPIDFLLHEEVRQALRRG
FT                   FWDALERARG"
FT   gene            complement(218642..219274)
FT                   /locus_tag="Tbis_0184"
FT   CDS_pept        complement(218642..219274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0184"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: mxa:MXAN_6734 response
FT                   regulator/sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86916"
FT                   /db_xref="GOA:D6Y2V5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG86916.1"
FT                   /translation="MPDRAKILLVDDREENLIALEASLSSLDVDPYPVRSGEEALKALL
FT                   THDFALILLDVRMPGMDGFETAAHIKRRERTRNIPIIFLTGLDSAPDLTFRGYAAGAVD
FT                   YLTKPFDPWMLRAKVSVFVELYNVNRRLAEQAQMLRERLSAELAGREQRELGSVLGELS
FT                   DRLTAVEAELGKVRELAGTRADRSLTEALEALDGSVARLRAGLDALR"
FT   gene            complement(219267..222911)
FT                   /locus_tag="Tbis_0185"
FT   CDS_pept        complement(219267..222911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0185"
FT                   /product="GAF sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; GAF domain protein; histidine
FT                   kinase A domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; histidine kinase A
FT                   domain protein; GAF domain protein; histidine kinase HAMP
FT                   region domain protein; KEGG: scl:sce7807 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86917"
FT                   /db_xref="GOA:D6Y2V6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG86917.1"
FT                   /translation="MSPTEATPMEAERVYAESDLRPFLEALKAWRNGDLRHRLTDAPPG
FT                   VLSEIGFLLNDFAEQRERTVTELMRVHREIVTERRFDERLTPGPASGIWSGPIDAINEI
FT                   IESLVTQVGNAADVIDAVAKGDLSCRMPHDPKARGEIRRLNKAINGMVDQLAQITSEVT
FT                   RVTKDLGVEGRLGGRARLEGMSGSWRDLAEAVNTMSSRVSAQVRDIAEVTTAVAQGDLS
FT                   RKVTVDAVGEMLQLKNTVNTMVDRLSAFAEEVTRVAREVGTEGRLGGQAQVRGVSGVWK
FT                   DLTDSVNVMANNLTVQVRQIAAVSTAVAQGNLTKKITVDARGEIFELKETLNTMVDQLS
FT                   AFADEVTRVAREVGTEGRLGGRAEVKGVSGVWKDLTDNVNSMANNLTYQVRNIAEVTTA
FT                   VANGDLTRKIDVDAQGEILELKSTINTMVDQLSSFASEVTRVAREVGSEGRLGGQARVD
FT                   GVAGTWKRLTESVNELAGNLTTQVRAIAEVTSAVARGDLTRSITVDAPGELAQLKDNIN
FT                   TMVAALRETTQANQEQDWLKSNLARISRLMQGHRDLKELARLIMSEVPPLVSAHYGACY
FT                   LMEEGELHLVAGYGVQPELSPRSRFALGEGLVGQAALEAKQITIDNVPPGSITVETGLS
FT                   RSTPAQIVVLPIQFEDQVLGVLELASFTSFSEVHMAFLTQFVEATGPTINTIKANSRTE
FT                   ALLKESQRLATELQKRSDELQRQQEELRRSNAELEEKAALLAKQNRAIEIQNFQIEQAR
FT                   RALEERAEQLAISSRYKSEFLANMSHELRTPLNSLLVLAKLLADNAEGNLTPRQVEFAK
FT                   TIHEAGTALLQLINDILDLSKVEAGRMDIHPQQISLPRLVEYMEATFAPLAEDKELAFT
FT                   VRLDPSAPQEIYTDEQRLQQVLRNLLSNAIKFTHEGEVRLEVGRAPADVQYADEALKNT
FT                   PDMLAFRVIDTGIGIAPNKLDVIFEAFRQADGTTSRKYGGTGLGLSICRQIARLLGGEI
FT                   HVASTPGEGSTFTLYLPAVYTGPLSSWDSGAAPAGTAAGSGPEPEQRAESVPPEAAPSS
FT                   ALTGLDSPRPSDADRWQGEDPLNGAKILIIDDDIRNVFALTSVLERHGATVVYAENGRE
FT                   GIEQLERNEDVALVLMDIMMPEMDGWATTSAIRKMPQFADLPIIALTAKVMHGDREKSI
FT                   ASGASDYVPKPVDVDLLLDRLRGWLAQSRSERGPAGRPEPREGGAPDA"
FT   gene            223088..224626
FT                   /locus_tag="Tbis_0186"
FT   CDS_pept        223088..224626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0186"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: gme:Gmet_2818
FT                   putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86918"
FT                   /db_xref="GOA:D6Y2V7"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V7"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADG86918.1"
FT                   /translation="MVTIPQAVLAAPIAPGETALPEAKRFTREVLTAWAVMSVSARAER
FT                   LVEELLADRTGEPVELAWIHCGQSIRLEVREKPKERTPASPAGASEWGEAYGPGVRARW
FT                   ATIDLPEEERAPEAGEERAAEARHGAGWLGFLADASDLLAGTLDPDMVPAIIAQVVVPR
FT                   LATWCAVHTAEHAGGPLRLAYVWHADETQLDRLRRRLSDLPEAGADGPELQQIGEWQTL
FT                   AFPLTARGRRLGVMRLGRRDTFPEEIVQIAEDLSRRAALSMDNARLYARQAAAKLALQR
FT                   SLLPPELPVIPGLDFHVIYEPAGEDNEVGGDFYDLFPVGDGAWRFAIGDVCGTGPEAAA
FT                   VTGLARHTLRLLAREGYGVAAVVGRLNQAILEEGERARFLTLLHGEIASGENGVDLTLL
FT                   SAGHPEPLRLRPDGTVEPVATPQTLLGIFPEADYAAERVHLDPGDVLLAVTDGVTERRS
FT                   GSRLLDDDGGLARLLADCAGLSARAVAERIRRAVQEFAAEPSTDDVAILALRVP"
FT   gene            complement(224854..225684)
FT                   /locus_tag="Tbis_0187"
FT   CDS_pept        complement(224854..225684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0187"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   acp:A2cp1_1787 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86919"
FT                   /db_xref="GOA:D6Y2V8"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V8"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADG86919.1"
FT                   /translation="MLADVIGYLICPVCGSAVALTGGAVRCERGHSFDVARQGYVNMLT
FT                   GSKPPGTADTPAMVAARAAFLGAGHYAPLAGRLAELCRGAAVVADAGAGTGHYLARALD
FT                   DRAVGIALDVSKHALKRAARAHPRIGAVVADVWRRLPVRDRCVDVLLNVFAPRNAAEFA
FT                   RVLRPGGTLIVVTPTDGHLRPLVERLGLLSVDEEKERRLEAALGGRFTRTGHEIIELDL
FT                   ALGHDAVEAVVAMGPSAWHTDPETLAGRIRGLPGTVRVAASFRVTTWRVTELTP"
FT   gene            complement(226002..228233)
FT                   /locus_tag="Tbis_0188"
FT   CDS_pept        complement(226002..228233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0188"
FT                   /product="drug exporter of the RND superfamily-like
FT                   protein"
FT                   /note="KEGG: bca:BCE_1403 transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86920"
FT                   /db_xref="GOA:D6Y2V9"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2V9"
FT                   /inference="protein motif:COG:COG2409"
FT                   /protein_id="ADG86920.1"
FT                   /translation="MRQRNFAAAIGGWSARHRWWALLIWVVFVAVATVAGNAVGTAEME
FT                   RWEALNGDSREALRILDEAGFPRVAGEFVLVQARQGSLTADDPRFRQAVLDVKSAVEAT
FT                   GEVQNVRTPYDPEPSPVTQDRRTALIRFEMKGDAATAKDRVRPVLDAVAGVQRAHPELR
FT                   IEQAGDASSDLLINEAIDRDFMRAEQLSIPITVGILLAAFGALLAALVPVALAMTAIFA
FT                   ATGLLAFTSQLLHVHSLTANLMLCIGLAVGVDYSLFYIMRQREERAKGRDPRRAIEIAA
FT                   ATSGRAVLISGITVMVAMAGMFLTGSGIFMGFAEGTILVVFTAVLGSLTVLPALLSLIG
FT                   DKIDSRLIHGTVRAATGGRITWRRVLGVRGGESRLWSAILKPVLRRPGLSVVVAGGLLA
FT                   ALAVPALGLKTGPESIDDLQGDYSIAETFKRINSAFPSGTDPAVVVVKAADVTAPEFTA
FT                   RIEEFKRRALATGQTNEPINVVVNPDKTVAMITIGIKGTGTDAVSEQAIRTLREQVIPE
FT                   TLPGAHVTGMTANGMDFGEQLRRSLPLVFGFVLLFAFLLLLVSFRSVVIAITSIALNLL
FT                   SVGAAYGVLVLVFQKGYGESLLGFRSTGEITDWVPLFLFVILFGLSMDYHVFILSRIRE
FT                   AYDSGMRTEDAVVTGITSTAAVVTSAAIIMVAVFATFATLSLLQFKELGFGLAVAVLID
FT                   ATIVRAVLLPAAMRLLGDRNWYLPRWLGWLPTLSHGDEQEKERTPALVG"
FT   gene            228488..228973
FT                   /locus_tag="Tbis_0189"
FT   CDS_pept        228488..228973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0189"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bba:Bd2755 putative
FT                   ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86921"
FT                   /db_xref="GOA:D6Y2W0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W0"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG86921.1"
FT                   /translation="MIPPEAFYAGLNKVLAAAAGFITDAAGRVLLVKPNYRDHWGLPGG
FT                   HIDEDEHPEIACARELQEELGLTLPVGRLLVVQWVPPFDGRPYPLIHFLFDCGTVPDGA
FT                   EVVLQEEELEEYGYFTAEEIKDRELVPGFLLARITAGARARATGGTFYLGPSAGAPA"
FT   gene            complement(229040..230314)
FT                   /locus_tag="Tbis_0190"
FT   CDS_pept        complement(229040..230314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0190"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to MGC139263 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86922"
FT                   /db_xref="GOA:D6Y2W1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86922.1"
FT                   /translation="MARSGRRDQPIDRRLGPIAEFVDDLRRLRGDRSLEAIGSRMGYHP
FT                   STISRRLNPKELPPWDFVERYVKACGADPGPWRARWRDIQEADTARPAPAERRDAAGEP
FT                   PAEQARHVAGAAEQATGSQASTGTAPGQDHRSTGESTEHDQRGPGEAVGRTTGDDQKAA
FT                   GHATGDRPVSGEAAQRPAEGRPDAAGAAEPATRPYAAGNAPNSPERPPYAAVPAEHAAG
FT                   QAPSGPDGAAGSPTPPGSGRRRIGFPVTIAAVAVVSIGLALYFTFTPDDEEPPRTLTAS
FT                   PTSAPSEPPAGHGFTMRIERMAFRLFSREWTMTAPGDIELWSNNQCPQGTAHYWVALRP
FT                   NGEPVQFACNSWQYHKWIGVPAGTYHLETWKDHDGNAIHGSGVLRSSVPIVVHPKVTPA
FT                   QTASASPDADAPAAPGAEDERSPAP"
FT   gene            230884..233211
FT                   /locus_tag="Tbis_0191"
FT   CDS_pept        230884..233211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0191"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: scl:sce5225 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86923"
FT                   /db_xref="GOA:D6Y2W2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W2"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADG86923.1"
FT                   /translation="MAVVPLRAGAEHRLPAEVTSFIGRRRETTEARRLLSVARLVTITG
FT                   VGGVGKSRLALRVALDVRRAFPGGVCFVELADVDEPALIGQALADTHSIRIPPSQSPVD
FT                   VLIEHLADRRMLIVLDNCEHLLEDCAVLADGLLRALPDLRILATSRQPLGIASEQTLEL
FT                   APLPVSGAGPLTCSAESDAVRLFAERVAAVRPDFAVTEANLPVVLEICRRLDGLPLAIE
FT                   LAAVRLRALSVEQLLQRLDDRFRLLTTGSRAAPPRQRTLRALIDWSHDLCTAKERLLWQ
FT                   RACVFSDGFTLETAEEVCSGDGIGKAEVIDLITGLVEKSVLIREEGYHEARYRLLDTIR
FT                   QYGRERLAESGEEAIWRRRHRDHYRDLARKAWERHFGPAQLDWHVRLHAEDGNLHKALE
FT                   WSFAEPGEAETGLAMATHLLHHWIRYHPREGRGWLAQGLALCTAPTVLRARALWGCAWM
FT                   SLMQGDEAPAAAMLAECREIAARTGSDYDLAYADLCSGMLAMSRGEAATAAVLYRKAAD
FT                   RCRRLGDHVGVALALIRLCLARSVQGRGEEAQALGEEAVAVCEAHGDVRYRAYALMVLG
FT                   IEAWRRGELQRAAALQKQSLESNRVMDDYTGCGMNLEVLTWIAGSEERYARVARLLGIL
FT                   KSPPWSDDVSMVEFRWLRRHSRVCEAEAVKALGTKAFSAEVTRGARLAPDEAAGFVLEL
FT                   EAPEEPVPAASNGQVPPLTRRETEIARLVSRGLSNKEIASTLVISPRTAEGHVEHILDK
FT                   LGFSSRTQIATWLNEQTRNGKA"
FT   gene            complement(233215..233748)
FT                   /locus_tag="Tbis_0192"
FT   CDS_pept        complement(233215..233748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0192"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: pfo:Pfl01_3355 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86924"
FT                   /db_xref="GOA:D6Y2W3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG86924.1"
FT                   /translation="MSHIATTPRLEMAEHFTTAGEPRSAWLGMTELYRRFSRFVLRIMG
FT                   GSRVQTESWRLSADLHAAARARRLTRDQLIAWGLGHLSDTAMLLVSELVTNALRYTPGP
FT                   ISLTITRMDGVVRCEVADSGGEIPRCDTSENLTLEEEGGRGLMLIDILSSRWGGRTTAA
FT                   GKVMWFELRADRLR"
FT   gene            complement(234298..234374)
FT                   /locus_tag="Tbis_R0007"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(234298..234374)
FT                   /locus_tag="Tbis_R0007"
FT                   /product="tRNA-Pro"
FT   gene            complement(234405..235361)
FT                   /locus_tag="Tbis_0193"
FT   CDS_pept        complement(234405..235361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0193"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: msl:Msil_1866
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86925"
FT                   /db_xref="GOA:D6Y2W4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W4"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADG86925.1"
FT                   /translation="MSGMMCSVRRAAAASLSLLGLGAAGLGYAAVFERNWFRLRRFDVP
FT                   VLEPGQRPIRILHISDLHLTPRRTRLIKWVRSLDLLNPDLIVNTGDTIAHPDAVEAYLR
FT                   AVEPLLERPGVFVYGSNDLYAPHFKNPARYLWRTSKGDVRRNTPDLPWEELGAAMTAAG
FT                   WLDLNNKTARLKVGDLDVHVGGIHDSHIDRDRYDEIAGQAPADADLRIGVMHSPEPRNL
FT                   TRFADDGYDLLLAGHTHGGQICIPFYGALVTNCGLDTARVKGLSRHGRAWLHVSAGLGT
FT                   SPYAPVRFACPPEASLLTLVPRRPVGRARGTSTAKVR"
FT   sig_peptide     complement(235272..235361)
FT                   /locus_tag="Tbis_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 30"
FT   gene            235423..235878
FT                   /locus_tag="Tbis_0194"
FT   CDS_pept        235423..235878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0194"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="KEGG: vfm:VFMJ11_2362 GatB/YqeY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86926"
FT                   /db_xref="GOA:D6Y2W5"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W5"
FT                   /inference="similar to AA sequence:KEGG:VFMJ11_2362"
FT                   /protein_id="ADG86926.1"
FT                   /translation="MSALKDRLQADLTAAMKARDEVRMRTIRMALAAINVAEVAGEKAR
FT                   ELSDDEVIKVLTKEAKKRREAATAFSDAGRADRAQAELDELAVLEEYLPAQLSDEELNK
FT                   LIDEAIAETGAQGPKAMGQVMKVLTPRIAGRAEGARVAQAVRARLSG"
FT   gene            complement(235969..238188)
FT                   /locus_tag="Tbis_0195"
FT   CDS_pept        complement(235969..238188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0195"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; penicillin-
FT                   binding protein transpeptidase; KEGG: gur:Gura_2430 1A
FT                   family penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86927"
FT                   /db_xref="GOA:D6Y2W6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W6"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ADG86927.1"
FT                   /translation="MQTNGKPKASVRGGVLRLLGAAGVAGVLTAGIALPAVGTVGMTAK
FT                   SATEALHLAPEELDEPPLPEKTVLLDADGKPFAQFYYQNRESVTLDKIAPIMRKAIVAI
FT                   EDYRFYEHGPLDLEGTARALIKNIVSGGVTQGGSSITQQYVKQVLYNKAETEEEKAAAV
FT                   APTLSRKLTEIRYAMAIEQKYTKDEILERYLNIAYFGAGAYGIEAAAKRFFGKHASQLN
FT                   LAEAATLAGAVQNPNATDPNRGKRFRDRLLARRNVVLDRMAELKIITPEEAEKAKAQKL
FT                   GYKDVPIPGGCEQSEFPYFCLYVRNEILNNPQFGKTQKARSDFLARGGLTIKTTLDRKM
FT                   QRAAEKAIRKYVHPTDNPVAAEALVEPGTGAIKAMAASRKFGTNRKKKEMSINVVADAE
FT                   HGGGTGFQAGSTFKMFTLVTALKKGYKFNDGFNVGPTYVARSPHDFKDCQGNSVGDTRT
FT                   PLHNSEGGRGGFLTLQTGTWKSVNTFFLTLEQKVGLCDVVKTAKDFGIKRADGQKLQEF
FT                   EPFTLGFNEMDPVTVAAAYATLGARGKYCKPMAITEIIDRYGRSTKFKPQCKQVVEPEV
FT                   ADATTYILQGVFTKGTMAGVGGIGRDAAGKTGTGDVSRTAWFAGYTPDLAGAVSLGDPR
FT                   GPVRYPLSGQVMGGRRYGSVYGATIPGPIWKETFLEALKGVPPSSFVPPDMSRFGGCSK
FT                   QCAPPPKKRDKDGRGDERGGRGGDRERGRGPGDRLDLFGGDNPFE"
FT   sig_peptide     complement(238072..238188)
FT                   /locus_tag="Tbis_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.309 at
FT                   residue 39"
FT   gene            238446..238754
FT                   /locus_tag="Tbis_0196"
FT   CDS_pept        238446..238754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0196"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86928"
FT                   /db_xref="GOA:D6Y2W7"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W7"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADG86928.1"
FT                   /translation="MWITDWTSRAACRNADPDALFVQGAAQNRAKLICRGCPVRTECLA
FT                   DALDNRIEFGVWGGMTERERRALLRRRPDVTSWRDLLAAAKEEYERNLERSKELIAG"
FT   gene            complement(238937..240064)
FT                   /locus_tag="Tbis_0197"
FT   CDS_pept        complement(238937..240064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0197"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: mxa:MXAN_5818
FT                   anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86929"
FT                   /db_xref="GOA:D6Y2W8"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W8"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ADG86929.1"
FT                   /translation="MKTAPTLDIDAILDDRGTRIIVCCGAGGVGKTTTAAALGLRAAER
FT                   GRSVVVLTVDPAKRLAQAMGLTELDNTPRLVLGNTAKGGELYAMMLDMKRTFDEIIEAH
FT                   ADPERAHQILTNPFYQSLSSSFSGTQEYMAMEKLGQLSRTGDWDLIVVDTPPSRSALDF
FT                   LDAPERLGRFLDGRLIRILTAPAKAGGRSAFKLFNLGLNVMTGILTKVIGAQVLRDIQL
FT                   FVSALDAVFGGFRQRAEQTYRLLQAPGTAFLVVAAPERDAMREASYFVERLAEDRMPLA
FT                   GLVVNRVHASPAAALSAERSIAAAEELEARGEHELTAAVLRLHAERMQLAAREQREQEH
FT                   FTAAHPTVPVARVPAMPEDVHDLDGLRQIGQLLAM"
FT   gene            complement(240116..241141)
FT                   /locus_tag="Tbis_0198"
FT   CDS_pept        complement(240116..241141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0198"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: ade:Adeh_0929
FT                   chromosome partitioning-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86930"
FT                   /db_xref="GOA:D6Y2W9"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2W9"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ADG86930.1"
FT                   /translation="MNDPTAAGSARDTDWEGVRLHVITGKGGTGKTTVAAAFALALAAG
FT                   GRKVLLVEVEGRQGIAQVFDLPQLPYAERKIAVAPGGGEVYALAIDPEEALLEYLEMFY
FT                   GLKRMGKALDRIGMIDFATTIAPGLRDVLVTGKTSEAVRRRDRSGKRAYDAVVMDAPPT
FT                   GRIVRFLNVTHEVAGLARVGPIKNHAEMVRGVIASPETAVHFVALLEEMPVQETLDGIA
FT                   ELRAAGLPVGGIVINMVRPVFLSEPVLAAARENRFDSGELALGLKAAGIVDESGDASLI
FT                   AEALTQEVIEHAKRVELERREREMLASAGVPCYELPLLADGVDRAGLYELAEALRAQGA
FT                   A"
FT   gene            241320..241475
FT                   /locus_tag="Tbis_0199"
FT   CDS_pept        241320..241475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86931"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86931.1"
FT                   /translation="MTKWEYVTVPLLTHATKQILDNWGDEGWELVAVVPGPNPEQLVAY
FT                   MKRPKQ"
FT   gene            241472..241933
FT                   /locus_tag="Tbis_0200"
FT   CDS_pept        241472..241933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0200"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bov:BOV_1122
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86932"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X1"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ADG86932.1"
FT                   /translation="MSAPEQRLAELGLALPEVAAPLAAYVPAVRSDAYVYTSGQLPLVE
FT                   GKLPVTGKVGAEVPVEEAQRLARICALNALAAVKSVVGDLSSVVRIVKVVGFVASAPGF
FT                   TGQPQVVNGASELLVDVFGEAGKHARSAVGVAVLPLDAPVEVELIAEVR"
FT   gene            242050..242223
FT                   /locus_tag="Tbis_0201"
FT   CDS_pept        242050..242223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86933"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86933.1"
FT                   /translation="MARWEYAVVGFDLGTYRGAQQVLDDWGSAGWELVTVIHLYNTEYN
FT                   SSFVAFLKRRTG"
FT   gene            242414..243301
FT                   /locus_tag="Tbis_0202"
FT   CDS_pept        242414..243301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0202"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pna:Pnap_2699 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86934"
FT                   /db_xref="GOA:D6Y2X3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X3"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG86934.1"
FT                   /translation="MRLPLRGAAGERARDVLAGRAPVVPARDAATVVLLRDDPLETFLL
FT                   RRKQTLAFAAGAYVFPGGAVDPRDADHAIAWAGPSPAEWAEVLRTDERTARGLVCAAVR
FT                   ETFEESGVLLAGPDTGSVVADTSGDDWEADRRALVDRTLSFAEFLERRRLVLRSDLLKA
FT                   WAHWITPEVEPRRYDTRFFVAALPAGQRTRDVGGESDGVVWMEPKTALARAAAGEMHLM
FT                   PPTLRTLTEIAAFETISEVLAHEREIVTIMPPAVEIDGEVVLLIPGPEPGSETGPEAGG
FT                   EPGPAEGRPAAERP"
FT   gene            243377..244168
FT                   /locus_tag="Tbis_0203"
FT   CDS_pept        243377..244168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0203"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   eli:ELI_00475 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86935"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X4"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADG86935.1"
FT                   /translation="MSGLRIPLDGPDGAGTEHVTNLLAPNPSPWTLDGTNTWVIGGGET
FT                   VLVVDPGPDDEQHLKRVVEHLGDRRVAAILLTHGHRDHSAGAPALAEMVRAPVRALDPK
FT                   HRLGEEGLQDGDVLTVDGLEVRVVGTPGHSFDSLCFWVPEDRAMLTGDTILGRGTTVIA
FT                   SDGHLGDYLRSLDRLRALAETVEASALLPGHGPVLPDPIAALDGYIAHRRKRLDQIREA
FT                   IRRGAKDVAEIVDIVYADVDPSLRRAAEWSVRAQLDYLEGR"
FT   gene            complement(244256..244936)
FT                   /locus_tag="Tbis_0204"
FT   CDS_pept        complement(244256..244936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0204"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bja:bll6060 putative catabolite gene activator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86936"
FT                   /db_xref="GOA:D6Y2X5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X5"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADG86936.1"
FT                   /translation="MSTDEILMKAPLFSALDPESAAALRASITEIELSKGQTVFSEGEE
FT                   GDRLYVVLEGKIKLARTSSDGRENLLSVLGPGEMFGELSLFDPRPRTASAIALTHVRLA
FT                   GLGHDDLRPWLTGRPEVAVHLLRALAQRLRRTNDVIADLVFSDVPGRVAKQLLDLADRF
FT                   GTKTEDGVRVHHDLTQEELAQLVGASRETVNKALADFAQRGWLRIEAKAVVILDRDRLH
FT                   HRSR"
FT   gene            245018..245737
FT                   /locus_tag="Tbis_0205"
FT   CDS_pept        245018..245737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0205"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: pca:Pcar_0009 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein;
FT                   iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86937"
FT                   /db_xref="GOA:D6Y2X6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X6"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADG86937.1"
FT                   /translation="MSRNRSAAGESRLALVRRARRIDRILAETYPDAHCELDYSSPLEL
FT                   LVATILSAQCTDKRVNTVTPVLFAKYRTAADYAAADQAELEEIIRPTGFYRAKASNIIA
FT                   MAQALCERHHGEVPDRLEDLVRLPGVGRKTANVVLGNAFGIPGITVDTHFQRLARRFGW
FT                   TKETDPVKIEHEVGELFPKSSWTMLSHRLIWHGRRICHARRPACGACPIATLCPSYGTG
FT                   PTDPEEARKLVKAGPFS"
FT   gene            245841..246488
FT                   /locus_tag="Tbis_0206"
FT   CDS_pept        245841..246488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0206"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ade:Adeh_4112 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86938"
FT                   /db_xref="GOA:D6Y2X7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG86938.1"
FT                   /translation="MAPGWLTDLAIKARRQPVPPALRPPADGAGRSAAVLLLFGESPVG
FT                   PDILLIQRSTKDRVHGGQPAFPGGGVDPQDDGPVAAALREAAEETGVDPSGVEVVGTMP
FT                   EVYVWRSRYRVTPVLAWWHTPSAVHPASPDEVDAVERVPIAELTDPANRFLLRYPGGLP
FT                   PSVAFRVRGLLVWGFTARVLDSVLSIGGFERPWDRTRIEDMPPDVLMQVTRA"
FT   gene            246679..247863
FT                   /locus_tag="Tbis_0207"
FT   CDS_pept        246679..247863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0207"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: eli:ELI_11340 trypsin-like
FT                   serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86939"
FT                   /db_xref="GOA:D6Y2X8"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X8"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ADG86939.1"
FT                   /translation="MRGDLLDLILIGLVVAFAVSGYRQGFIIGAFSFIGFVGGALLGMF
FT                   IAPPLAGAIVNGDMERALLAIVIVFLTATLGQFICSTIGAVVRSHVTWEPARVVDAFGG
FT                   SVASGLSVLLIAWLFGSLIVSMSSPVLKEQVVGSIVWQAVDEAIPDSVRALQKPFKDFV
FT                   ETSEWPQVITSIGGQNVPPPDEGVLQGSPALARARKAIVKIEGTAPSCRKHIEGTGFVY
FT                   ARHRVMTNAHVVAGVTEDLKVIDSTGKRHAATVVHYNPDKDVAVLFVPELQVPALRFDF
FT                   TAERGEDAIIAGYPKGRGFTPLAARIRTKLRAESDDIYNRRKVERDVYVIRGKVQPGNS
FT                   GGPLLSTEGRVYGMIFAAATDQEETGYALTAREILPDAKKASAAVARVGTQECD"
FT   gene            complement(247982..248515)
FT                   /locus_tag="Tbis_0208"
FT   CDS_pept        complement(247982..248515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0208"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   dvm:DvMF_2231 protein of unknown function DUF309"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86940"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2X9"
FT                   /inference="protein motif:PFAM:PF03745"
FT                   /protein_id="ADG86940.1"
FT                   /translation="MRDRDEAGRPRNLRPRDEYGRPLPHGAEGVPRIPDDYAPGPLQAI
FT                   EDAKRLLEAGRPFHAHEVFEARWKTGPAEERELWQGLAQICVGLTHVQRGNLPGAATLL
FT                   TRGSARLSAYGSRRPYGLDLRALAIASDRLTGEIDSGQVDAATAIGVILEHLRQAGEPE
FT                   RATTAEASADGSNG"
FT   gene            complement(248845..249750)
FT                   /locus_tag="Tbis_0209"
FT   CDS_pept        complement(248845..249750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0209"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ank:AnaeK_0555 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86941"
FT                   /db_xref="GOA:D6Y2Y0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y0"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG86941.1"
FT                   /translation="MSTEKAVIEIEGPWHHRTVHAGGTRFHVVEAGTGPLVLLLHGFPQ
FT                   FWWTWRHQLVALAEAGYRAVAVDLRGYGASDKPPRGYDLPTLAVDAAGLIRALGEAGAV
FT                   VVGHDWGGLIAWTMSVMDPKVVRRLVVVSAPHPLRLRAALWTTLGQLKAVRHALAFQLP
FT                   ILPERRLTADGGALVARLLKSWSGPGWPPADVADVYRKALLIPSAANCALEYYRWFARS
FT                   QVRPDGFHYAKQMRARIEAPTLQVHGALDPCLLPRTAMGSSRYVAAPYRWRLIEGAGHF
FT                   PHEERPEPFNAELISWLTDL"
FT   gene            complement(249755..250225)
FT                   /locus_tag="Tbis_0210"
FT   CDS_pept        complement(249755..250225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0210"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   jan:Jann_2210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86942"
FT                   /db_xref="GOA:D6Y2Y1"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y1"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ADG86942.1"
FT                   /translation="MREDESLGALIAQASHHLSTLVRSEIELAKAELTFDAKRVGMAAG
FT                   FFGAAAFIGHLCLILSSFAIAYVLVAIGVATWLAFVIVTAFYLVVAVILVFVGYRRLKG
FT                   LSGMKRTTRTLRGLRGSGRETSPLEPAAGTASASQRGQERSEPSASVLSDNP"
FT   gene            complement(250801..252780)
FT                   /locus_tag="Tbis_0211"
FT   CDS_pept        complement(250801..252780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0211"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: aba:Acid345_3520
FT                   acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86943"
FT                   /db_xref="GOA:D6Y2Y2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y2"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADG86943.1"
FT                   /translation="MATETPGRETQETLSNLLTETRRFAPPAELAAAANVTAEAYEEAE
FT                   RDRLAFWERAAERLTWAERWHTTLEWNAPFAKWFVGGKLNVAYNCVDRHVEAGLGDRVA
FT                   YYWEGEPEGHSRTITYAELQREVAKAANALQELGVRKGDRVAIYMPMIPELPIAMLACA
FT                   RIGAIHSVVFGGFSVSALKNRIEDANAKLVITADGGYRRGKPNPLKPTVDEAVAECPGV
FT                   ERVVVVRRTGQEVNWTDKDIWWHDIVDRQPAEHEAVPHDAEDPLFILYTSGTTGKPKGI
FT                   LHTTGGYLTQTSWTHWAVFDLKPETDIYWCTADIGWVTGHSYIVYGPLANAATSVIYEG
FT                   TPDTPHRGRFWEIVQKYKVTILYTAPTAIRTFMKWGADIPAKFDLSSLRILGSVGEPIN
FT                   PEAYVWYREHIGGNRCPVVDTWWQTETGAIMITPLPGITHAKPGAAMRALPGIVADVVD
FT                   DKGESVPNGGGGYLVIREPWPSMLRTIWGDDKRYVDTYWSRFEGLYFPGDGAKRDEDGD
FT                   IWLLGRVDDVMLVSGHNISTTEVESALVSHPKVAEAAVVGASDPVTGQAIVAFVILRGE
FT                   AEESEDIAAELRAHVASTLGPIAKPRQILVVPELPKTRSGKIMRRLLRDVAENRELGDV
FT                   TTLTDSSVMKLIAEKLPAAKSSED"
FT   gene            253067..253843
FT                   /locus_tag="Tbis_0212"
FT   CDS_pept        253067..253843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0212"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="KEGG: acp:A2cp1_0593 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86944"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y3"
FT                   /inference="similar to AA sequence:KEGG:A2cp1_0593"
FT                   /protein_id="ADG86944.1"
FT                   /translation="MNDPLAVIAELPGVPEAVQEAREAVDRLYRHPVLRRRSPEVSAES
FT                   ALRGARASAAIEGVDVPLEELRRGEVTDPVVQGALRASTEIGRLTSLWRSAPPQVLARL
FT                   HAVAAVGLTDDPGRPRSTPTDADPLGLGPAPGPEETAARLSMLTRLLTGDTKAPALVLA
FT                   AIVHAELVTLRPFGVADGLVARAAARFTLVERGLDPKSLCAVEVGHAELGDAYPEALRS
FT                   YQTGTPAGLAGWIRHCADAVVLGVRETTAICEALSR"
FT   gene            255271..256311
FT                   /locus_tag="Tbis_0213"
FT   CDS_pept        255271..256311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0213"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: pzu:PHZ_c2999 pilus assembly protein CpaE"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86945"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y4"
FT                   /inference="protein motif:COG:COG0455"
FT                   /protein_id="ADG86945.1"
FT                   /translation="MQQPLAITHDQELLDDLLRMAVAAGVELDVARSAAQARPYWNHAP
FT                   LVIVGGDIAGDLAAAGLPHRDRVLIVTRETADVDTWRTCVALGAQAVWELPEAERILVE
FT                   ELGEAADPPTRAGDVVCVVGGKGGAGATVLAAALAVTASRAGLRTLLIDADPLGGGIDV
FT                   VLGQEEATGARWPDFVGREGRVGFAALQDALPTFGELTVLSWHRGEPAEIPRQAMRAVL
FT                   DAGRRGCDLVVVDLPRHLGEGGEEALPRAARTLLVVPAEVRGALAAAQTLAVLRRHTSE
FT                   LYAVLRQGSLDPDVVGASLDIPCAGVLPELSGLTETLDRGDPLPLGRAPLGGFCTTLLR
FT                   TLMEAR"
FT   gene            256308..257555
FT                   /locus_tag="Tbis_0214"
FT   CDS_pept        256308..257555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0214"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   pzu:PHZ_c3030 Flp pilus assembly protein ATPase CpaF"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86946"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y5"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADG86946.1"
FT                   /translation="MTSRARGGAEVMAGEGGMMTRPAGDRTAAQAAVPPELVEAVRVRL
FT                   SRAGAPPTAAQVAAALRAERAVLGDAEVLAIGRILRADLVGAGPLEGLLALPGVTDVLV
FT                   NGPREVWIDDGSGLRKTDVTFSGEEEVRRLAQRLAATAGRRLDDACPYVDARLAGGIRL
FT                   HAVLPPIARDGTCLSLRLPPRRTFTVEELVPGAGAELLRAIVAARMAFLVTGGTGTGKT
FT                   TLLASMLSCADPGERLLLVEDSAELNPRHPHVVRLEARPPNLEGAGGITLRDLVRQALR
FT                   MRPDRLVVGEVRGAEVVDLLSALNTGHEGGCGTLHANNPADVPARLEALACAAGLSREA
FT                   VHSQIAAALDVVVHLVRAPGGGPRRVAEVCLLERDPSGFVTARPSVIFTPEGRAVPGPA
FT                   FGALRDRCPVPLPCLT"
FT   gene            258015..258806
FT                   /locus_tag="Tbis_0215"
FT   CDS_pept        258015..258806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0215"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   reh:H16_B0188 flp pilus assembly protein TadB"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86947"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y6"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADG86947.1"
FT                   /translation="MLILIALAIALAVWVATGPDAGTVRLAALRRPSARRPSGRVRGRP
FT                   GPGHASARSGVPARRVGARFTLRPRRARTAAAWRALSIELCHGIHAELVAGRMPGEALV
FT                   NAIAAVEPPDPAALTPVVAAVRDGGDVAAALLSAAPEEGGEGLVRLAACWRVSTSVGGG
FT                   LAALVDRLAASLREAEAHRQEVAAQLAGPRATARMLAALPLLGLLMATALGVSPLPFLL
FT                   GSPAGHACLLIGLALDAAGVWWTRRLADRAIAAPVTGGGSR"
FT   sig_peptide     258015..258080
FT                   /locus_tag="Tbis_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.753 at
FT                   residue 22"
FT   gene            258826..259608
FT                   /locus_tag="Tbis_0216"
FT   CDS_pept        258826..259608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0216"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   bte:BTH_I2454 type II secretion system protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86948"
FT                   /db_xref="GOA:D6Y2Y7"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y7"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADG86948.1"
FT                   /translation="MTLLIAMSVAAAVLLWPVPRSPAGRLRALVTGGRGERAPGTAEGR
FT                   SGGGVMPALKGMPAFTARWDRLVLAAVPGLAGFAVISGVPGLFFGALLAGAALVAAGRR
FT                   EPVEARRRRARIAADLPFAIDLLVACLRAGQPVDRAVEVTADAIGGPLAERMSWVAVQL
FT                   RLGADPGTAWAGLADEPPAAPFARTMIRAAKGGAPVADVLVRLADDARQAARAASSAAA
FT                   RKVGVQVVAPLGLCFLPAFVLLGIIPMIAGLIARIPLP"
FT   gene            260324..260551
FT                   /locus_tag="Tbis_0217"
FT   CDS_pept        260324..260551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86949"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86949.1"
FT                   /translation="MRRLVSAARERVRRIGLRWVLLARERPDAGMSTAEYAVGTLAACG
FT                   FAALLWKVVTSAEVKSMLIALIQRALKVAG"
FT   gene            260601..260933
FT                   /locus_tag="Tbis_0218"
FT   CDS_pept        260601..260933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86950"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Y9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86950.1"
FT                   /translation="MTAEAAVLLPVLLIVLGAALWAVAIVGVQLQCVDAARAGARAAAR
FT                   GEVIDEVRRTVLRAVPAGARVEVIPGTETTRVEVVAVVEPFPGAVLPPVRVTAAAVSAT
FT                   EPGVVP"
FT   sig_peptide     260601..260669
FT                   /locus_tag="Tbis_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.930 at
FT                   residue 23"
FT   gene            261172..261609
FT                   /locus_tag="Tbis_0219"
FT   CDS_pept        261172..261609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86951"
FT                   /db_xref="GOA:D6Y2Z0"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86951.1"
FT                   /translation="MAPMGEHPWTGAGPFGDAPGIRADRGRRLSGERGSATVWMITVIT
FT                   VIWAVATAVVAAGMARVARHRAQSAADLSALAGAAWAFSRPALACTHAKEIADANGVVL
FT                   ESCAISEGIAEVAVSLRFTLPIAGARSVRATARAGPVTVQR"
FT   gene            complement(261732..264440)
FT                   /locus_tag="Tbis_0220"
FT   CDS_pept        complement(261732..264440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0220"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: dvl:Dvul_2723 DEAD/DEAH box
FT                   helicase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86952"
FT                   /db_xref="GOA:D6Y2Z1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z1"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADG86952.1"
FT                   /translation="MPNWKPVTAISSRQGGAGELLGRLLAVPARRGLVTHVEHVPAREG
FT                   GDARWPDWVPEPLVGRLRHLGISGLWEHQLATAEHVRRGENVIIATGTASGKSLAYLVP
FT                   AITEIFAGGTVLYLTPTKALAADQLATIRKLRLTEVRAATYDGDTPPEERSWVRRHANY
FT                   VLTNPDMLHRSILPRHGSWASFWRRLRLVVVDECHGYRGVFGSHVAQILRRLRRVCAKY
FT                   GSRPVFLLASATASDPGAAGKRLTGLDMAEVTADASPRGAMTFALWEPPLTELRGERGA
FT                   PIRRTATAEAADLLTDLVVEGVRTLVFVRSRRGAETVALTAKRHLTELEAVLEAGPYGT
FT                   ALSAGATGTAGPVGSAGAAGSPGPAGSGAASGSGGTTAVGEVGEDPAGAATTPAGSPAV
FT                   GDHKEAASGDRRGTSARGDGATTADGHGGTTTGRPGDTTTGGPGDTTTGDHGAGPAGGR
FT                   LADRVAAYRGGYLAEDRRLLEKALRTGELTALATTNALELGVDISGLDAVIIAGWPGTR
FT                   ASLWQQAGRAGRTGQDALVVLIARDDPLDTYIVHHPEAVFGQPVEAIVLDPDNPYVLAP
FT                   HLCAAAAEIPLTEDDLEIFGPAARDVVDDLVRRGMLRQRPSGWYWTHRERAADLADIRG
FT                   SGGNPIHVVESGTGRLLGTVDEPSAHTTVHPGAVYLHQGETYEVESLDLEAGVALVSPA
FT                   DPDYATYPRDVTDIRMIESLRSRPFGPGELHFGTVEVTRQVVSYLKRRTQTGEVLGEEP
FT                   LDLPPRTLCTRAVWWTLPDTALAPLRSAEHGGPVDLGGAAHAAEHASIGLLPLFATCDR
FT                   WDIGGVSTELHPDTGMLTVFVYDGHDGGAGFAERGFARAADWLTATREAIASCECERGC
FT                   PSCIQSPKCGNGNEPLDKTGAIRLLDVLLGS"
FT   gene            264587..264937
FT                   /locus_tag="Tbis_0221"
FT   CDS_pept        264587..264937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0221"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   bcz:BCZK0894 anti-sigma B factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86953"
FT                   /db_xref="GOA:D6Y2Z2"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z2"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADG86953.1"
FT                   /translation="MDLKLDHRTEGNLTIVDVEGEIDVYTAPRLRELLIDLVNKGNFHL
FT                   LVNMEKVDFLDSTGLGVLVGGLKRVRAHDGSLELVCTQERILKIFRITGLTKVFGIYAS
FT                   VDEAKEAHARDK"
FT   gene            264955..265383
FT                   /locus_tag="Tbis_0222"
FT   CDS_pept        264955..265383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0222"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: bcr:BCAH187_A1158 anti-sigma B factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86954"
FT                   /db_xref="GOA:D6Y2Z3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z3"
FT                   /inference="similar to AA sequence:KEGG:BCAH187_A1158"
FT                   /protein_id="ADG86954.1"
FT                   /translation="MATVELTFSALPAHVRTARLVAAAVARRTGVPEAILDEVRLAVGE
FT                   ACLRAVEAHRLRCPAEPVVMRLRDDDGRFEVTVIDAASRNGVSPPAAEANGSPLPEMGD
FT                   LGLAVIAGLADDVEVVPRPEGMSIRMSWPVSPGEPTAA"
FT   gene            265754..268090
FT                   /locus_tag="Tbis_0223"
FT   CDS_pept        265754..268090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0223"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: mms:mma_2575 membrane-bound proton-
FT                   translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86955"
FT                   /db_xref="GOA:D6Y2Z4"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z4"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADG86955.1"
FT                   /translation="MSAFLAAADGAAVALSGFHFTLVIVVAVVALLALAVAGGLVREVL
FT                   SAGQGTERMQNIARAVQEGAAAYLARQFRTLVVFVVVIPLLLLLLPAPSTSVQIGRSVF
FT                   FVVGALFSALTGFMGMWLAVRGNLRVAAAAKDQGEKAALRIAFRTGGVAGMFTVGLGLL
FT                   GAAIVVLVYKGDAPNVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQGIPED
FT                   DPRNAATIADNVGDNVGDCAGMAADLFESYAVTLVASLILGKAAFGTEGLVFPLLVPMI
FT                   GVLTAIIGIFAVRTRSGDRSGMAAINRGFFISAVISAILVAVAAFAYLPSSFAELSGVS
FT                   EEIRALTADPRLIALGAVLIGLVLASLIQLLTGYFTETNRRPVREIGESALTGPATVIL
FT                   SGVAVGLESAVYSALLIGAAVYGAFLLGFGNVTVALFAVALAGTGLLTTVGVIVSMDTF
FT                   GPVSDNAQGIAEMSGDVDGEGAQVLTSLDAVGNTTKAITKGIAIATAVLAATALFGSFR
FT                   TAVETELAAATQGVKDVLGSFASFSLSVDAPNVLVGLVIGASVVFLFSGLAINAVGRAA
FT                   GRVVIEVRDQFRNKPGIMDGTEKPDYGRVVDICTRDSLRELATPGLLAVLTPIAVGFAL
FT                   GYAPLGAYLAGAIAAGTLMAVFLANSGGAWDNAKKLVEDGHHGGKGSEAHAATVIGDTV
FT                   GDPFKDTAGPAINPLIKVMNLVALLIAPAVVAYADNFVIRTVVTAIAVVIVVAAIVVSK
FT                   RRSSGIIPDSGDAGEVKRASETVAR"
FT   gene            268546..269010
FT                   /locus_tag="Tbis_0224"
FT   CDS_pept        268546..269010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0224"
FT                   /product="putative phosphohistidine phosphatase, SixA"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: gox:GOX2000
FT                   phosphohistidine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86956"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z5"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADG86956.1"
FT                   /translation="MTRLIVIRHAEAAGVLGLPDRERPLTAAGESAARAAGAQIRPLKP
FT                   ELVLCSPAVRARRTAELLGLDAPIEIEPVIYHGDSDDLIDLLCRTDQGIGTLALVGHNP
FT                   AVSRLVWELTGRECDAFPPGGYAVIDLNGSWAEAGPGRGTLVSFHRPHQG"
FT   gene            complement(269280..270500)
FT                   /locus_tag="Tbis_0225"
FT   CDS_pept        complement(269280..270500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0225"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: scl:sce0663 hypothetical protein; TIGRFAM:
FT                   phosphoserine phosphatase SerB; HAD- superfamily hydrolase,
FT                   subfamily IB (PSPase-like); PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; amino acid-binding ACT domain
FT                   protein; Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86957"
FT                   /db_xref="GOA:D6Y2Z6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z6"
FT                   /inference="protein motif:TFAM:TIGR00338"
FT                   /protein_id="ADG86957.1"
FT                   /translation="MNQRSLLITLTGHDRPGVTSRLFAALARFPVTVVDVEQVVIRGRL
FT                   ILGVLVTYPGGGSEEVDSTIGGLWAAVEQVAADLDMELDIATGTLAKEKRRRGRLHVTV
FT                   LGAPLKPAAMAAIAGRIAASGANIDRIERLASYPVTCIEMAVSGADPQALRASLTAEAA
FT                   AQKVDVAVQRSGLHRRAKRLVVMDVDSTLIQNEVIDLLAKHAGCLDEVTKITESAMRGE
FT                   IDFAESLTKRVSLLEGLPEDVFDTVSKEVVLTPGARTLVRTLKRLGYRFAIVSGGFTQI
FT                   TDRLVAELGIDYSAANTLEVVDGRLTGRLVGEILDRPGKARALERFAAEAGVPLSQTVA
FT                   IGDGANDLDMLAVAGLGVAFNAKPAVRKAADAAVNVPYLDSILYLLGISREEVEAADAE
FT                   DGLQPAK"
FT   gene            complement(270622..271182)
FT                   /locus_tag="Tbis_0226"
FT   CDS_pept        complement(270622..271182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AFL138Wp; K00667 fatty acid synthase subunit
FT                   alpha, fungi type"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86958"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86958.1"
FT                   /translation="MLFAVTVGATSLVSASPAAAATPPAALAPTSAQAASAASAASSAS
FT                   SAAAAPGWISVRYPIRARAGRVVTYKITLTNRQSRTSQKIFFAAKFPKNVYKVRIYVPK
FT                   GSRYREGCTRERTRSLCLFPGLKKGKSYTLWAKAWVNGSARGTLYGYFGGSFIPNHVKD
FT                   PRYVMRKAGDEIRWIKTRTRLVR"
FT   sig_peptide     complement(271120..271182)
FT                   /locus_tag="Tbis_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.926 at
FT                   residue 21"
FT   gene            271615..272880
FT                   /locus_tag="Tbis_0227"
FT   CDS_pept        271615..272880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0227"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: scl:sce2236 putative two-component system
FT                   sensor kinase; PFAM: GAF domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; ATP-binding region
FT                   ATPase domain protein; SMART: GAF domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86959"
FT                   /db_xref="GOA:D6Y2Z8"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z8"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ADG86959.1"
FT                   /translation="MSPIRLPTGEPMGAPRRRTAGRDRPIRPPPRPGGRAAAYPEGVPD
FT                   ATPPVSERDEVLHAVSSAVLAVTSHLSVQEVLRVIVRSARRLLDAQYAALGVPDSQGAF
FT                   AEFIAEGVTPEQWAVLGTTPRQHGMLDAMLRMDGPVRLADIRKDPRFVGWPRGHPILKD
FT                   FLGVPIRNGGEVLGIVFLSNKRTPGGFTEADEELLTLFAAHAAIAITNARLYERSRELT
FT                   VIEERTRMARELHDAVTQKLFSLRLTARAAATLARTDPARAAQEIEQVERLAGEALAEL
FT                   RAVIVELRPAELDRHGLVETLRKQVALLDRVHPVSFAFHFDGDPPHGLPPAVEVAVLRV
FT                   AQEALHNAVRHANATRIEVRLSHRRPVLTLQVCDDGRGFDPGRVPGLGLASIRDRAEAV
FT                   GGTLTVTTSPGRGTVVHLEVPT"
FT   gene            272877..273497
FT                   /locus_tag="Tbis_0228"
FT   CDS_pept        272877..273497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0228"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: bcr:BCAH187_A5591 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86960"
FT                   /db_xref="GOA:D6Y2Z9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y2Z9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG86960.1"
FT                   /translation="MIRVLIADDHPVVRQGLRTFLEVHDDITVVGEAADGLETIELARS
FT                   LTPDVLLLDLKMPVRDGLDVLAELHGLGVRVIVLTSVTGRGEVLPAMRAGAAGFLYKDV
FT                   DPEALVQAIRAVHEGQVLLAPEAAEAVLGGPAAPPGEPEIALTAREREVLRLIAAGRSN
FT                   REIARELSVAEKTVKTHVSNVLMKLGVQDRTQAALYAVRRGLV"
FT   gene            274102..274890
FT                   /locus_tag="Tbis_0229"
FT   CDS_pept        274102..274890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0229"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_3281 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86961"
FT                   /db_xref="GOA:D6Y300"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y300"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG86961.1"
FT                   /translation="MGGQVLLLQDVTVRRDGAALLRGIDWSVLEGERWVVIGPNGAGKT
FT                   TLLQVAGALLFPSEGTVEILGEVLGRTNVFELRPRIGLASAALAERIPPDEKVIDVVLT
FT                   ASYAIFGRWKEEYDSSDVSRAVGLIDQLGCAHLIRRRFATLSEGERKRVQIARALMPDP
FT                   ELLLLDEPAAGLDIAAREDLVRRLGVLAQDPKAPTTVLVTHHVEEIPVGFTHVLLLRQG
FT                   SVVAQGPLEAVLTPQNLSETFGMPLTLERSREGRWFARPL"
FT   gene            275001..275747
FT                   /locus_tag="Tbis_0230"
FT   CDS_pept        275001..275747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0230"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sfu:Sfum_1521 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86962"
FT                   /db_xref="GOA:D6Y301"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y301"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADG86962.1"
FT                   /translation="MSPLEAFFVFLAGVGAGGINTVVGSGSLITFPTLLAVGLPPVVAN
FT                   VSNNIGLVPGGVTGVVGYRPELKGQRERLLRLGSASVLGSLAGGLLLLWLPESAFRFIV
FT                   PVLIGLACVLVIVQPRLNQWLLRLRVHPHGGPWLWLGVLAAGVYGGYFGAAQGVVLIGL
FT                   LGSFLDDDLQRINAAKNVLALLANTTAALLFVLIAPVDWMAVLMVALGTSVGGYLGARI
FT                   GRRLPTPILRAFIVIVGIAAIVKLIA"
FT   gene            275754..276005
FT                   /locus_tag="Tbis_0231"
FT   CDS_pept        275754..276005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86963"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y302"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86963.1"
FT                   /translation="MSLLMKGDRVEIVIDAGGTPRTYEVVARKAGRRIEITTGRGVVEV
FT                   TEVTRTGAPVRSARFMASRILALVEHPAGDRERRGDRS"
FT   gene            complement(276230..277141)
FT                   /locus_tag="Tbis_0232"
FT   CDS_pept        complement(276230..277141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0232"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   scl:sce7049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86964"
FT                   /db_xref="GOA:D6Y303"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y303"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ADG86964.1"
FT                   /translation="MDEKTRPPRTHRLTRMVPSPEFLRGLERTTTLDAPIRAISKTLRT
FT                   RLGPGRLRDMLHGVPFGHPLHPALAMVSLGCWVSTAVLDVTKADPRASRALIATGLGTA
FT                   LPTAAAGITDWSTLHLEQQRVGVFHALSNLAAAALYTGSLLMRLGGRERTGRVLAFAGL
FT                   GAVSIGGFLGGHLAYRQAAGANHAESVGHLTLLGWHDLCLLKDLPDGRPVRRQLGYIDL
FT                   VVLRLGDTVHVLADGCSHLAGPLHQGRVTVEEGEPCIVCPWHGSTFRVSDGSVVHGPAT
FT                   SPQPAFETRLRHDGVVQVRPAM"
FT   gene            complement(277284..277502)
FT                   /locus_tag="Tbis_0233"
FT   CDS_pept        complement(277284..277502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86965"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y304"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86965.1"
FT                   /translation="MVGKLPARVNELLTLIKGGLDHADRVLCVDQDWWALRLNWTVERI
FT                   GFGARRYRDPRFDLIREVEEAGRLFTA"
FT   gene            277703..278560
FT                   /locus_tag="Tbis_0234"
FT   CDS_pept        277703..278560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0234"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86966"
FT                   /db_xref="GOA:D6Y305"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y305"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ADG86966.1"
FT                   /translation="MPDRSSPTVRRRRLGQELRRLREQAELTGDQVAARLGWSAAKLSR
FT                   IETARTVPRRSDVEALLMIYMVDSEQRHELLALHRDASRKGWWEKYRDTLPEEYTTFLG
FT                   LEAEATVARHWEPQIVPGLFQTEAYVHALMESSQRSTLQAPGDLRDRIQVRMARQEAIL
FT                   SAERPQTLSVVVEESVLLRRFGDSAVMREQLQRLIEVSELPNVDLRVLPLDADHCINTG
FT                   AFIHLTLPEYHDVVYLEALLGGRLLEDEQIVYRYEVAFDYLKGRALDADASRKLIAKTI
FT                   GRWK"
FT   gene            278594..278827
FT                   /locus_tag="Tbis_0235"
FT   CDS_pept        278594..278827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0235"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86967"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y306"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ADG86967.1"
FT                   /translation="MISGGSDIDMHESDLSQLSWRKSSRSAMNGACVEVAVLPDGRVGV
FT                   RDSKNRSGPVLVFTPAEWRAFIGGVKDGEFDL"
FT   gene            complement(278968..280416)
FT                   /locus_tag="Tbis_0236"
FT   CDS_pept        complement(278968..280416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0236"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: abo:ABO_1845
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86968"
FT                   /db_xref="GOA:D6Y307"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y307"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ADG86968.1"
FT                   /translation="MTDRPTTTTDAGIPAPSDEFSLSVGPNGPLLLQDHYLIQKMAHFN
FT                   RERVPERVVHAKGGGAYGILQITEDVSQFTKAKLFQKGKETELFVRFSTVAGELGSADT
FT                   VRDPRGFALKFYTEDGNYDIVGNNTPIFFIRDPQKFSDFIHSQKRRADNHLRDHNMQWD
FT                   FWTLSPESAHQVTFLFTDRGTPRTWRNMHGYGSHTFLWYNAAGEKYWVKYHFKTEQGIE
FT                   NFTDAEAKAMVSEDPDFHIRDLYNAIKRGDHPSWKVNVQIMPFEEAADYRFNPFDLTKV
FT                   WPHSDYPEITIGRIILTRNPENYFAEVEQAAFEPSNMVPGVGPSPDKMLQARLFSYPDT
FT                   HRYRIGPNYNQLPVNQPKVPVHSYNFDGPMRYKNPTDPVYAPNSYGGPVADPSLYEGES
FT                   YHISGEIIRSAYTKHREDDDFVQPRALWENVLSETDREHLVSNIVTHASAPEVTGEMKK
FT                   RIVEYWTNVHKDLGQAVAKGLGVS"
FT   gene            complement(280427..280912)
FT                   /locus_tag="Tbis_0237"
FT   CDS_pept        complement(280427..280912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0237"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: sfu:Sfum_2668
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86969"
FT                   /db_xref="GOA:D6Y3E0"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E0"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADG86969.1"
FT                   /translation="MATVHDVQRLRQAGLRVTAARLAILQTVREGNHLDVESIHRGVCQ
FT                   RVGQVSLQAVYDSLNALHQAGLLRRIEPAGSPARYETRVGDNHHHLVCRECGEVTDVDC
FT                   AVGKAPCLDPVRDAGYLIDEADVIYWGWCPKCRPKVEGTVRARVPSAHDHEHPTTQG"
FT   gene            280990..282123
FT                   /locus_tag="Tbis_0238"
FT   CDS_pept        280990..282123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86970"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E1"
FT                   /inference="similar to AA sequence:KEGG:BCE_1940"
FT                   /protein_id="ADG86970.1"
FT                   /translation="MMASSSVVIRKPLALAALYALLLTGCSAAEGERVPGASAEPAATG
FT                   AAEPTPSPSPKPVRRPYTISFAGDVHFEGVLRARLDRNPRTALGPIAAVLRKADITALN
FT                   LETAITTGGTPAPKQFTFRAPPTAFTALKAAGVDVVTMANNHGMDYMESGLRDTLAAIR
FT                   KSRFPVIGIGRNEAEAYRPFRKTVNGNRVAIIGATQVLDTNLIEAWTAKGAKGGLASAK
FT                   EEARLIRAVREARRNSDTVIVFLHWGAELVECPTPVQRQLAVKLVRAGADVIVGGHAHI
FT                   LLGGGYLGRAYVHYGLGNFAFYNWGPKTGMTGVLTLTINGRRILKDEWTPARIEGGVPI
FT                   PLTGAAKQQALRSYHALRGCTGLSAKPRATATGSSQS"
FT   sig_peptide     280990..281076
FT                   /locus_tag="Tbis_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.513 at
FT                   residue 29"
FT   gene            282156..282845
FT                   /locus_tag="Tbis_0239"
FT   CDS_pept        282156..282845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0239"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce5559
FT                   HTH-type transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86971"
FT                   /db_xref="GOA:D6Y3E2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG86971.1"
FT                   /translation="MDSVSRQQSPRTPGDPLRRRPAQRRSARRVERMLDACAELLDEGG
FT                   YDALTTTRVAERAGVAIGSVYQFFPDKRALSQALTKRNVERFAARVGRRFMTEEFAGWW
FT                   DAVDAIIDEYVEMHRTVPGFRSLHFREVFDLNLLESVADTNMVIAGRLRELLLAEFGIA
FT                   DSEELDRAMLVAVEAGDAVLKLAFRHDPDGDPEFVAEAKRLIRGYLSGQLQAARRTAGR
FT                   TDATAGA"
FT   gene            complement(282882..283283)
FT                   /locus_tag="Tbis_0240"
FT   CDS_pept        complement(282882..283283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86972"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86972.1"
FT                   /translation="MSRRMICALASATVLSAVVPGVAGYISAQVEALHEARQELARLQA
FT                   KLRMMELSTVRPVAATGCAYGRSTRDRAAASGELPLRPPRDTRPWQDTGRTFAPAIWNT
FT                   FVMPTAAPTEVPTRLTSPGDRHRATSPGR"
FT   sig_peptide     complement(283197..283283)
FT                   /locus_tag="Tbis_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.608 at
FT                   residue 29"
FT   gene            283448..283978
FT                   /locus_tag="Tbis_0241"
FT   CDS_pept        283448..283978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86973"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86973.1"
FT                   /translation="MTSEQLNRLLDQALLQGDHDALAGRLDALAREYESGEMSRAAVLV
FT                   LAAEQWRLAGRPEIALERYQQAAEDGGDVVIDPRAGIADTLFELGRADEARRALAELWD
FT                   EGGWTPDTALAVAETLVAYGDLPAAHEWATAGVRACQGPTATRDALLRLRYRIRVDLGM
FT                   PEDQLDAMLDGAG"
FT   gene            complement(284375..285643)
FT                   /locus_tag="Tbis_0242"
FT   CDS_pept        complement(284375..285643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86974"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86974.1"
FT                   /translation="MSKASQRIRGRCLAIAAVTAGVSWLSTGPALARDVTATTGCDAPA
FT                   RTHMARQVSLAPPVGLLSIADTAGAAAARGIPSLPGRSGSAALDQLLGPQGKARALPGT
FT                   KDLLPPLPGGKGGPPVLPDARSLLPDAKPLGALTPITQQAPARLPLSAQADPSASGTVP
FT                   QPPMVPSVPLLDIAPIKAAAPEPRCAPAAQRRGTDAGAVAPQPGSADENRPAAQQAPAA
FT                   DGRRPAQAVPRPATGEGTVAKPRAGVKTGKAAPGTNTGKAVPGKKAGPVKDAAKAHPSG
FT                   KMGHPGHHAKPATASTAERPSRLQAHPAAPAPHKKQGHLPVHKKDLVPGHKKHGLVPGK
FT                   KQGHVKAEAKKVKGKALNGVPHRKAERAGTPALQGKPQQSRVQHQTQPLPRIVDMPGDI
FT                   TAPALATTGAVTRLANTGKGLLP"
FT   sig_peptide     complement(285545..285643)
FT                   /locus_tag="Tbis_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(285741..288326)
FT                   /locus_tag="Tbis_0243"
FT   CDS_pept        complement(285741..288326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0243"
FT                   /product="ATP-dependent chaperone ClpB"
FT                   /note="KEGG: ade:Adeh_0385 AAA ATPase, ClpA/B; TIGRFAM:
FT                   ATP-dependent chaperone ClpB; PFAM: ATPase AAA-2 domain
FT                   protein; AAA ATPase central domain protein; Torsin; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86975"
FT                   /db_xref="GOA:D6Y3E6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E6"
FT                   /inference="protein motif:TFAM:TIGR03346"
FT                   /protein_id="ADG86975.1"
FT                   /translation="MEYKLTQKSQEALSAAVRRATADGNPEVMPAHLLAALLAQTGGIA
FT                   VPLLEAVGADWRRLRARNEELLGRLPKARGATVSAPSTSRQLISVLNTAAERAKRLEDE
FT                   YVSTEHLMVGLASDGGQVAELLRQEGATADALLEAFEKVRGHARVTSETPEDTYQALEK
FT                   YGVDLTERARAGKLDPVIGRDAEIRRVIQVLSRRTKNNPVLIGEPGVGKTAVVEGLAQR
FT                   IVAGDVPETLKNKRLVALDLGAMVAGAKYRGEFEERLKAVLNEIKASDGQIITFIDELH
FT                   TVVGAGAAEGAMDAGNMLKPMLARGELRMIGATTLDEYRERIEKDPALERRFQQIYVGE
FT                   PSVEDTIAILRGLKGRYEAHHQVQISDSALVAAATLSDRYITARFLPDKAIDLVDEAMS
FT                   RLRMEIDSRPVEIDQLQRSVDRLKMEELALAKETDAASRERLEKLREELANKQEELNAL
FT                   ISRWEREKAGLNKVGELKKQLDEARSAAERAQRDGDFETASRLMYGEIPRLEKELSEAS
FT                   KIAEAAETAPMVKEEVGPDEIAEVVSAWTGIPAGRLLEGESAKLLRMEDELGKRLIGQH
FT                   RAVQAVSDAVRRARAGISDPDRPTGSFMFLGPTGVGKTELAKALAEFLFDDERAMTRID
FT                   MSEYSEKHTVARLVGAPPGYVGYEEGGQLTEAVRRRPYTVVLLDEIEKAHPEVFDILLQ
FT                   VLDDGRLTDGQGRTVDFRNTILILTSNLGSQYLVDPQLDQAAKHEAVMNAVRAAFKPEF
FT                   LNRLDDIIIFDPLGTEELTKIVDLQVARLARRLSERRLTLTVTPAAREWLALTGYDPMY
FT                   GARPLRRLIQTAIGDQLAKELLAGNIRDGDEVIVDLDSARDALTIRPAR"
FT   gene            complement(288354..288701)
FT                   /locus_tag="Tbis_0244"
FT   CDS_pept        complement(288354..288701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0244"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: nis:NIS_0956 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86976"
FT                   /db_xref="GOA:D6Y3E7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E7"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG86976.1"
FT                   /translation="MDANPFELTDDTPVYVISVAAQLAGLHPQTLRQYDRLGLVSPGRS
FT                   AGRGRLYSARDILLLREVQRLSQEHGINLAGIKRILELETENMRLREEINRLRGEVAML
FT                   RALVRYELPPA"
FT   gene            complement(288706..289857)
FT                   /locus_tag="Tbis_0245"
FT   CDS_pept        complement(288706..289857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0245"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: gsu:GSU0034 chaperone protein DnaJ; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; DnaJ central domain protein; heat shock protein
FT                   DnaJ domain protein; SMART: heat shock protein DnaJ domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86977"
FT                   /db_xref="GOA:D6Y3E8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E8"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADG86977.1"
FT                   /translation="MSTKDYLEKDYYAVLGVPESASAEEIKKAYRKLARKYHPDANKGN
FT                   KEAEERFKEISEAYDVLSDPKRRKEYDEARSLFGSGLGGFAGAGGQRGGFTFDFGDLFS
FT                   GTVAGDRIGDLFGGLFGRSTRTTTRPRRGQDIETEVTLSFSEAVEGTTIPLRLTSSSAC
FT                   SACSGTGAKSGTTPRVCPMCEGTGTASRNLGSFAFSEPCRHCRGRGLIVDDPCVVCQGS
FT                   GRGRSTRTIHARIPAGVADGQRIRIKGKGAPGEHGGPAGDLYVLVHVKQHPVFGRSGEN
FT                   LTVTVPVTFAEAALGAEIKVPTLKGMPVTLRIPECTPNGRTFRVRGRGVPRKDGTRGDL
FT                   LVTIQVVVPQRLNDKARAALEEFRIATEGPDPREELIKQARSE"
FT   gene            complement(289936..290658)
FT                   /locus_tag="Tbis_0246"
FT   CDS_pept        complement(289936..290658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0246"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: gme:Gmet_3533 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86978"
FT                   /db_xref="GOA:D6Y3E9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3E9"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADG86978.1"
FT                   /translation="MTSSENGSEQGPVIRDKRKIDPETGQARKTAAEQGQEKKDEQPGG
FT                   GAQAASAPADAQIADLLAERTADLQRVQAEFSNYRKRVERDKALVREQAVGGVLYELLP
FT                   VLDDIGRAREHGELVGGFAKVAELLESTLTKLGLSAYGKKGEPFDPTVHEALAHSYSPD
FT                   VTEPTCVEILQLGYRYGERILRPARVAVAEPPPEPAPEAPSGAPEGGEAGRPDAAEPGD
FT                   AAASPADTEPGAPSGEQN"
FT   gene            complement(290655..292520)
FT                   /locus_tag="Tbis_0247"
FT   CDS_pept        complement(290655..292520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0247"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: bha:BH1346 class I heat-shock protein
FT                   (chaperonin)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86979"
FT                   /db_xref="GOA:D6Y3F0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F0"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADG86979.1"
FT                   /translation="MGRAVGIDLGTTNSVVAVLEGGEPTVIANAQGSRTTPSVVAFAKN
FT                   GEILVGEVAKRQAVTNVERTIRSVKRHMGTDWKIDIDGKKFTPQQISAFILQKLKQDAE
FT                   AYLGEKITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIINEPTSAALAYGLDKEKDQ
FT                   TILVFDLGGGTFDVSLLDVGQEDGHGFVEVKATSGDNHLGGDDWDQRIVDELVRRFKNA
FT                   HGIDLSKDKMALQRLREAAEKAKIELSGQTETTINLPYITASAEGPLHLEEKLTRAEFQ
FT                   RLTADLLERCKGPFFQVIKDAGIKVSDIDHVVLVGGSTRMPAVSDLVRELTGKEPNKGV
FT                   NPDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGIFTKIIERNTTIPTKRSE
FT                   IFTTAEDNQPSVQIQVYQGEREIAAYNKKLATFELTGIPPAPRGIPQIEVTFDIDANGI
FT                   VNVSAKDLGTGKEQSMTITGGSALPKEEIERMMREAEQYAEEDRKRREEAETRNNADAL
FT                   AYQTEKFLRENEDKVPADVKNEVNAALSDLKKALEGSDVTAIRNAAEKLATVSQKMGSA
FT                   IYANAQSAGEQTAAASGGQTSGSQNKDEDVVEAEIVDEDREGGSK"
FT   gene            complement(292921..293373)
FT                   /locus_tag="Tbis_0248"
FT   CDS_pept        complement(292921..293373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_1609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86980"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86980.1"
FT                   /translation="MIPLLSLAAACGQGSPDPSARSSAASPAPPDSVVVHTLSPLASPP
FT                   PEPSPSPVTPAGNTVAPRKVPWTEVTASPDGRTLTVVWWSGVEPCHVLDRVEVAESRDK
FT                   VTITLYEGADRRSPDAACIMLAVRKSTEVRLRAPLGGRQVADGARE"
FT   sig_peptide     complement(293299..293373)
FT                   /locus_tag="Tbis_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.600) with cleavage site probability 0.379 at
FT                   residue 25"
FT   gene            293828..294622
FT                   /locus_tag="Tbis_0249"
FT   CDS_pept        293828..294622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0249"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: afw:Anae109_1387 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; 6-phosphogluconate dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86981"
FT                   /db_xref="GOA:D6Y3F2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F2"
FT                   /inference="protein motif:TFAM:TIGR00112"
FT                   /protein_id="ADG86981.1"
FT                   /translation="MIAILGTGKMGEALLSGLLRAGRSPDEIVATARRPERAEALRKRY
FT                   GVRMLGNAEAAREAETIILAVKPQDMDRLLSEIASCDLADKLVISVAAGITTAFIQARL
FT                   GEVPVVRVMSNTPVLVDEAMSVISPGAHATEEHLKRTEELLSPVGKVVRIPESLQDAAT
FT                   ALSGSGPAYFFYLVEAMVDAGILLGMPRAAALEMVTQAMVGAAIMLRDSGEHPVSLREA
FT                   VTSPGGTTIAAIAELERHRVRAAFLDAIEAACNRSRELASGR"
FT   gene            294997..296160
FT                   /locus_tag="Tbis_0250"
FT   CDS_pept        294997..296160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0250"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   bsu:BSU29710 acetoin dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86982"
FT                   /db_xref="GOA:D6Y3F3"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F3"
FT                   /inference="protein motif:PFAM:PF00850"
FT                   /protein_id="ADG86982.1"
FT                   /translation="MSKAVRIVWDDALTSYDFGPGHPMAPVRVALTMGLARELGLLSGV
FT                   DVAGCRPATDEELLMVHSRDYVAAVKEASATGRPALAHGIGTEDNPAFLGVHEASALIA
FT                   GASLAAARAVWSGEAEHAINVAGGLHHAMPGMASGFCIYNDVALAIQWLLDQGASRVAY
FT                   VDVDVHHGDGVQAMFYDDPRVLTISLHESPRTLFPGTGYPHETGADGTAVNVALPIGCG
FT                   DTGWLRAFHAIVPPLLREFRPDVLVSQHGCDTHALDPLAHLMLSLDGQRRTYAALHELA
FT                   HETAGGRWIATGGGGYEVVRVVPRAWTHLIAEVAGASLDPLTPTPDTWRVMVKELTGEV
FT                   PPLNMTDGRHPVWRDFADGYDPADPVDRAIMATRKAVFPYYALDPMP"
FT   gene            296634..296837
FT                   /locus_tag="Tbis_0251"
FT   CDS_pept        296634..296837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0251"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: bsu:BSU33370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86983"
FT                   /db_xref="GOA:D6Y3F4"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F4"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADG86983.1"
FT                   /translation="MGAGERPLSEVKFLTVAEVAAVMRVSKMTVYRLVHSGELPAIRVG
FT                   RSFRVPEQAVHDYLRDAFIEAG"
FT   gene            297170..298183
FT                   /locus_tag="Tbis_0252"
FT   CDS_pept        297170..298183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0252"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   dal:Dalk_1448 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86984"
FT                   /db_xref="GOA:D6Y3F5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F5"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADG86984.1"
FT                   /translation="MGRTVLVTGVSRHIGARVASALAADPDVHRVIGVDTAPPVSSTAP
FT                   PLGRVEFVRLDLRGLDLAQLIADSDIDTVVHLGLLSDPAGSRPAMREYNIIGTMQVLAA
FT                   CQRSRTVRRVVVRSTTAVYGSSPASPAVCTETTEPADSPHHGYERDAIEVEGYARGFAR
FT                   RRPDVATTILRFAPMLGPRVETPLTRYFSLPVLPTVLGFDPRLQFVHEDDVVDVLCRMA
FT                   REELRGVFNVAGDGVLLLSQCARRAGKPVLPLPSAAFHLLGTAVRSTGLIDFSPEQIAL
FT                   LSHGRVADTTALAAATGWRPKYGTAAAFDDFIRARGLGSDLPARVFDLAADLIRGR"
FT   gene            298189..299118
FT                   /locus_tag="Tbis_0253"
FT   CDS_pept        298189..299118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0253"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: dal:Dalk_1813
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86985"
FT                   /db_xref="GOA:D6Y3F6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F6"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADG86985.1"
FT                   /translation="MGSAEPSGPPGTGGAGPWPPGEERLAELLGFLRRRLTGEYEVDEF
FT                   GFDPEFSDSVLLPLLRPLYRHWFRVEVLGAEHVPADSGALVVANHAGGMLPLDALMLQV
FT                   ALHDEAGRHVRLLGADLVYRLPLLNHLARKGGHTLACPEDAARLLAKGELVGVFPEGYK
FT                   GIGKPFSERYRLQRFGRGGFIVTAIRAQVPIIPCAIVGAEEIYPKLGEIPVLDRLLGLP
FT                   YVPVTPFFPWFGLLGLVPLPSKWAIEFGEPIRTDEYDVADAEDQFLVLDLTDRVRETIQ
FT                   HRLEALRAHRGPAFRFGPFAVEFGRFGC"
FT   gene            299220..300266
FT                   /locus_tag="Tbis_0254"
FT   CDS_pept        299220..300266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0254"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ade:Adeh_1736
FT                   alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86986"
FT                   /db_xref="GOA:D6Y3F7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADG86986.1"
FT                   /translation="MGKGRRAVLMGLTVGAAAGTLRRRAAARRARERERFFRTTGRKVT
FT                   VTTDDGARIAAEVDDHPAPRAAVVFTHGWLMSRHCWRYQRDALAGRALLVSYDHRGHGE
FT                   SSAAPLDAYTIDRLGDDLAAVIEATVPSDLPVILAGHSMGGMTIMALAQRHPGLIASRV
FT                   AGVALLSTSAGWRSGGLTYGLPGPVGRFAARATPRIFDALLARAEEIDRRPRLKELAML
FT                   PVTRLTAFGKKPHRADVRFVNAMATATATEPMVAFFHQIQVHDRLSALQALQDVETLII
FT                   VGERDRLTPPSDSRRIAKALPGARLIITPDAGHMIGIERPGLVNQELLGLLQRATERGA
FT                   AGRLGIAS"
FT   sig_peptide     299220..299297
FT                   /locus_tag="Tbis_0254"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.656 at
FT                   residue 26"
FT   gene            complement(300282..301142)
FT                   /locus_tag="Tbis_0255"
FT   CDS_pept        complement(300282..301142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0255"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sal:Sala_0193 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86987"
FT                   /db_xref="GOA:D6Y3F8"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F8"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADG86987.1"
FT                   /translation="MRRLLLRRNSPEVAGEVAAETTEAVATPDPTSAAFFDVDNTMMRG
FT                   ASIYHFARGLAARGLFTTRDLAKFAIGHAWFRIRGSENADHIAKAKEMALAFVAGLKVE
FT                   DVVRLGEEIYDEEMADRIWPQSLALARMHLAAGRRVWLVTATPVELARVIAQRLGLTGA
FT                   LGTVAETENGVYTGRLVGDLLHGPAKADAIRELARREGLDLSRCWAYSDSANDLPMLSL
FT                   VGHPHAINPDSELREHAAEHGWEISDFRTGRKITLIGLPIAATAGAIAGGIAAGIALRR
FT                   HYRAA"
FT   gene            complement(301197..301919)
FT                   /locus_tag="Tbis_0256"
FT   CDS_pept        complement(301197..301919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86988"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3F9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86988.1"
FT                   /translation="MGGRFMGWWRFSRRRRGRWASRRSGQITARIAELGPWFGEGPRPE
FT                   FRAALRDELMRRFAEQAAARASRPAAPAPAGAPPVRRRPVLVRMLPSLVFSALLVLMFS
FT                   TGVRTYHSVPGEPLYPLKRMAECTVLSFAHDDDERAQREMTVARRRAAETASLVRRTPA
FT                   RDSQRLIGETLDDMEVTTRAALTHVARKGSAASTEVRRFAREQRNVVEPLLPKLDRENQ
FT                   ARARKYLIYIETFTSSGP"
FT   gene            complement(302069..302758)
FT                   /pseudo
FT                   /locus_tag="Tbis_0257"
FT   gene            302895..304352
FT                   /locus_tag="Tbis_0258"
FT   CDS_pept        302895..304352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_3587 DNA polymerase III, subunits
FT                   gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86989"
FT                   /db_xref="GOA:D6Y3G0"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG86989.1"
FT                   /translation="MDILVALLAFAGALLAGITTGVLVGRLRDEPNGWLIAWSVATGAL
FT                   ALSLAAIAVGHLTGFGALTFRAYQITGSLLAPLWLAAGTIQLLAERAATRFGVWLVGTA
FT                   ITVVGVVITMVDPISESFSKRLPVGSVHWDIWPEWLLRGVHGLVILTMLIALIVAVLRW
FT                   RDGDDYDADNMNASAVVAPAGMAIAGAMELALPGIVVVALMAGTAGGVWYVVARPLAPY
FT                   EDEEDEDYLDDEWEDPREGGRAAPAPEPARHPAAAAPPRRSGLGDLVAEYRAGEQGEAA
FT                   HHAGPGRPEPAGDDFSGPATGQIMIGDQMSRYAGMQPPPPAPVEEDESMPATGVVLSGG
FT                   ELPISEELAAALGVGFSGASREAGRAEQRQSGSVKPSPGIYGLLTVFTLMDGSGEAFDK
FT                   LAEETVEAVRQHEPDTLLFVCHSVKSAPLQRIIYELYRDEVGYAEHQRQPHIERFVTER
FT                   QPLVLAANTIELKVNAAKVVPLPTRFR"
FT   sig_peptide     302895..302945
FT                   /locus_tag="Tbis_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.673 at
FT                   residue 17"
FT   gene            complement(304805..305089)
FT                   /locus_tag="Tbis_0259"
FT   CDS_pept        complement(304805..305089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0259"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin 2; KEGG: bxe:Bxe_A1082
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86990"
FT                   /db_xref="GOA:D6Y3G1"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G1"
FT                   /inference="protein motif:PFAM:PF05768"
FT                   /protein_id="ADG86990.1"
FT                   /translation="MAPSDHRITLLGKPGCHLCDDARAVVAKVAAEFGVPWEERDITLS
FT                   PEEQAEYWEMIPVVFLDGVQHGYWRIDEARLRAALTELLAADGSAGSGA"
FT   gene            305265..305993
FT                   /locus_tag="Tbis_0260"
FT   CDS_pept        305265..305993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0260"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: sfu:Sfum_1603 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86991"
FT                   /db_xref="GOA:D6Y3G2"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G2"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADG86991.1"
FT                   /translation="MIRRTHHARDRGIPDATVARLPLYLRALNALAERGTLTVSSEELA
FT                   AAAGVNSAKVRKDLSHLGSYGTRGVGYDVQYLIYQISRELGLTQDWAVAIVGVGNLGRA
FT                   LANYGGFVSRGFRIAALFDADPAVVGERIAGLVVEHVDALESVIKDRGISIVVIATPAS
FT                   AAQDVCDRVIAAGVTSILNFAPVVLAVPPEVNVRKVDLSIELQILAFHEQRKANGGPIM
FT                   ADQWPDEVGHVRERSMGAGS"
FT   gene            305990..307297
FT                   /locus_tag="Tbis_0261"
FT   CDS_pept        305990..307297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0261"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: gsu:GSU3284 glutamyl-tRNA reductase; TIGRFAM:
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86992"
FT                   /db_xref="GOA:D6Y3G3"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G3"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ADG86992.1"
FT                   /translation="MSILVVGLSHRTTPVSLLERATVSGDALVKLLHDVHRDEDVAEVL
FT                   VVSTCNRVEVYAHVARFHGGVTAITDVLGRHSGLPHEVLARHLYVHYQERAVQHLFTVA
FT                   CGLDSMVIGEQQILGQIRSALRLAQEEGTAGTALNELTQHALRVGKRARTETAIDRAGA
FT                   SLVGVGLSLAEQAIGQLPGKQALVVGAGSMSSLATATLARAGVTGIVVANRTLERAVRL
FT                   AESVGGRAVPLTGVAGEIGRADLVVSCVGAGTYSITEEMVEAAMRDRRSPLFVLDLAMP
FT                   RDVDPAIRRLPGVTLVDLESMQQDGLGSEIDGGRAKAIWEVKQIIAEEVDAYLDSQRAS
FT                   VVTPTVVALRSKAAEVVEAELARLWSRIPDADTRTRDEITNTVRRVVDKLLHAPTVRVK
FT                   QLATSPGGAQYAHALRELFDLDPQCPDAVTGLEVER"
FT   gene            307294..308205
FT                   /locus_tag="Tbis_0262"
FT   CDS_pept        307294..308205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0262"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: sat:SYN_02273 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86993"
FT                   /db_xref="GOA:D6Y3G4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G4"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADG86993.1"
FT                   /translation="MSAPLRLGTRKSLMATSQSRRVAERLAQATGRRSELVGITTFGDV
FT                   SRAHLTQLGGTGVFVSELRNALIAGEVDFAVHSLKDLPTKGDDRIVIAAIPPRDDPRDA
FT                   FVGRVPFSELPPGARVGTGSPRRIAQLRMLRPDLEYVPIRGNADTRLGKVTSGELDGIV
FT                   LAAAGLGRIGREEAIAQVFEVEQVLPAPGQGALAVECRADRADLIELLSAIDDRATRDA
FT                   VTAERSVLAALEAGCAAPVGAHASGDGNVLSLTAAVVSVDGRRSVRKSVSGPASAAMEL
FT                   GRDLAAAMLAEGAGTLMREQVQ"
FT   gene            308202..309782
FT                   /locus_tag="Tbis_0263"
FT   CDS_pept        308202..309782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0263"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4; KEGG: sfu:Sfum_3201 uroporphyrin-III C-
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86994"
FT                   /db_xref="GOA:D6Y3G5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G5"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADG86994.1"
FT                   /translation="MSSANHSLEAQSGFVAFVGAGPGDENLLTLRGADLLRRADVVIAD
FT                   RTLHGAMLRHCRDGAKIVDVGEDGSPAVDAIEEAKAGRTVVRLCPGDPSFFSSVADEIS
FT                   ACADAEVEFEIVPGVPPATAVPTYAGIPPASGVAEFRVVDATKVEDWTPHASCEGTLVI
FT                   YHGLAEAPAIAKALISGGKPDSTPVAVVREGTVTAQHTVVSTLGRLGPDLKRADVSEPA
FT                   MIVVGDAVGMRDRMSWFETKPLFGWRVLVPRTKEQAKELTEQLRAYGAVPEEVPTISVE
FT                   PPRTPQQMDRAIKGLINGRYEWVVFTSVNAVKALREKFEEYGLDARAFAGLKIAAVGDA
FT                   TARSLMDFGIRPDLVPTGEQSSEGLLAEWPPYDSLLDPINRVLLPRADIATDTLIAGLT
FT                   ELGWECDDVTAYRTVRAAPPPAPIREAIKSGGFDAVLFTSSSTVRNLIGIAGKPHNVTV
FT                   IAVIGPQTAKTAQEFGLRVDVMAEKPSVSLLAAALAEYGAKMRQAQLAAGETPRRPSQM
FT                   RRGARRRAK"
FT   gene            309895..310881
FT                   /locus_tag="Tbis_0264"
FT   CDS_pept        309895..310881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0264"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   sfu:Sfum_3057 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86995"
FT                   /db_xref="GOA:D6Y3G6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G6"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ADG86995.1"
FT                   /translation="MSAQFPVARPRRLRRTPALRRLVAGTRLHPADLILPLFVKEGIAE
FT                   PQPVGSMPGVVQHTRDSLRKAVTEAAEAGVGGVILFGIPAHKDARGSAADDPEGIVQVA
FT                   VRDVVAEVGDALVVMTDTCLDEYTDHGHCGILTETGEVDNDATLERYASAAVSQAAAGS
FT                   QVIAPSGMMDGQVKAIREALDANGFAHVPILAYSAKYASGFYGPFREAAECAPRFGDRS
FT                   AYQQDPAGPIDEALREVRLDLAEGADAVMVKPALPYLDVIRRVRDAVDVPVAAYQVSGE
FT                   YAMIEAAAANGWLDRERIIMESLISIRRAGADLILTYWAAEVARLLS"
FT   gene            311031..311675
FT                   /locus_tag="Tbis_0265"
FT   CDS_pept        311031..311675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0265"
FT                   /product="Bifunctional DNA primase/polymerase"
FT                   /note="PFAM: Bifunctional DNA primase/polymerase; KEGG:
FT                   dol:Dole_2704 bifunctional DNA primase/polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86996"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G7"
FT                   /inference="protein motif:PFAM:PF09250"
FT                   /protein_id="ADG86996.1"
FT                   /translation="MVGVPLARRVKRRGHRRPQKITAVLEYAQLGWAACPGAHPRGEGG
FT                   RACSCDRIGCPDPGAHPLSPAWRLQATTDPALLTRWWQQNPDANIILPTGRVFDVFDVP
FT                   ASMGLPALAAMDAAHVHGPVAENGDRVLFFVATRGAPEDEDEWWSCHLDADPETIESTP
FT                   GLRWHCRDSYVLAPPSTRVDGDQVRWIRPPDGRPLPDPLRVLDLLADFCDS"
FT   gene            311767..313065
FT                   /locus_tag="Tbis_0266"
FT   CDS_pept        311767..313065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0266"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; aminotransferase class I
FT                   and II; KEGG: aeh:Mlg_0806 glutamate-1-semialdehyde 2,1-
FT                   aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86997"
FT                   /db_xref="GOA:D6Y3G8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G8"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADG86997.1"
FT                   /translation="MTRTQTSEALFDRAKKIVPGGVNSPVRAFGAVGGTPRFMASGEGP
FT                   YLVDVDGNRYVDLVCSWGPLILGHRHAAVVQAVEEALSRGLSYGTATEGEVLLAEEIVS
FT                   RMPPVEKIRLVSSGTEATMSAVRLARGFTGRSKVIKFAGCYHGHVDALLASAGSGVATF
FT                   GLPDSPGVTGAAAADTIVLPYNSVEAVEEAFRKFEIACVITEACPANMGVVPPAEGFNR
FT                   RLRELCSEHGALLIIDEVLTGFRVTAQGWYGVDPVDADLMTFGKVMGGGLPAAAFGGRA
FT                   DVMAHLAPEGPVYQAGTLSGNPLAVAAGLATLRACDQAVYDRLDRVAETIGRAASEALS
FT                   AAGVPHRLQRAGNLFSIFFTDRPVVDYESARAQDTAAYRAFFHSMLDQGVYLPPSAFEA
FT                   WFVSAAHDDEAVNRVLEALPAAARAAAQAARQG"
FT   gene            313409..314311
FT                   /locus_tag="Tbis_0267"
FT   CDS_pept        313409..314311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0267"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pol:Bpro_4368 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86998"
FT                   /db_xref="GOA:D6Y3G9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3G9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADG86998.1"
FT                   /translation="MLDLNRLRALHAVAVHGSVGAAAEALMVTPSAISQQLAKLERETG
FT                   TVLLERDGRGVRLTDAAGLLVEHAERILAMVEAAEAEFAALRGKVVGTLTLAAFPTAAR
FT                   GILPRALSILKRNHPGLGVLIYEREPERQLREVARGEIDVAVVQDWLTRPMPLPHGLSR
FT                   AVLLDDVADLVVPSGHPLAGRRAVSLHDLPEGDWISSGPGTVCHDFLLFLLRSVEREPR
FT                   IVCMAGEYPTQLALVAAGHGCALIPRLGRVALPEGVRVVPVEPPPTRRVYAVWRTRGGR
FT                   RPAIRAAVEALRGACAEDG"
FT   gene            314289..314981
FT                   /locus_tag="Tbis_0268"
FT   CDS_pept        314289..314981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0268"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mex:Mext_0502
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADG86999"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ADG86999.1"
FT                   /translation="MPVPRTGRLSGTMSELTIVHLLRHGEVHNPTGVLYGRLPGFHLSE
FT                   LGRRMAEVVAETLATRDIVEIRSSPMERAVETATPTAERLGLKIQIDDRLTEAFNVFEG
FT                   VRVGNGTALLRDIRRYRYFLNPFRPSWGEPYVEVVARMKAAIDEARERARGHEALLVSH
FT                   QLPIWVTRLAAEGRRLWHDPRRRQCALASLTSFTFEGNRLISVGYSEPAGALLKESAAG
FT                   EAGPSAGA"
FT   gene            315276..315842
FT                   /locus_tag="Tbis_0269"
FT   CDS_pept        315276..315842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0269"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Thioredoxin domain; KEGG: bmj:BMULJ_00460 thiol-disulfide
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87000"
FT                   /db_xref="GOA:D6Y3H1"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H1"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ADG87000.1"
FT                   /translation="MSVKRLTAIVALAAAALAGCAGSEAAQPGIGETRFVPGDGRVQVF
FT                   DPGERPKAPQISGRTLDGETVTLTPGTVYVLNFWASWCAPCRAEAPVLKDVAAITKSKG
FT                   VRFIGVNFKDQEASAKAYDRAVEPGYPSIFDNEGKLLLAFQGTVPPAAIPSTLIIDAQG
FT                   RIAARALGAVKYQDLLDAVTKVSDE"
FT   sig_peptide     315276..315353
FT                   /locus_tag="Tbis_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.790 at
FT                   residue 26"
FT   gene            315835..316566
FT                   /locus_tag="Tbis_0270"
FT   CDS_pept        315835..316566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0270"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: rde:RD1_2269 cytochrome c-type biogenesis
FT                   protein CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87001"
FT                   /db_xref="GOA:D6Y3H2"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H2"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADG87001.1"
FT                   /translation="MSDLGTTVATGSLLLAVPIAVLAGVVSFISPCVLPLVPGYLSYVT
FT                   GMSGDPRRGRMVLGSALFVLGFAAVFVTGGAFFGGVGALLLEHSAVITRVLGGVTVLLG
FT                   LAFLGAIPGLQRDLRIHRLPSAGLAGAPLLGVVFGLGWTPCIGPTLAVVLTLSVDQGSA
FT                   GRGALLAFAYALGLGLPFVLAGLAYRRALYAIKALRRHTVLITRIGGAMLVTVGLLLVT
FT                   GWWGGLVAQLQGWVAGFEPVI"
FT   sig_peptide     315835..315906
FT                   /locus_tag="Tbis_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.953 at
FT                   residue 24"
FT   gene            316566..318182
FT                   /locus_tag="Tbis_0271"
FT   CDS_pept        316566..318182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0271"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: gur:Gura_3842 ResB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87002"
FT                   /db_xref="GOA:D6Y3H3"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H3"
FT                   /inference="protein motif:PFAM:PF05140"
FT                   /protein_id="ADG87002.1"
FT                   /translation="MTEPQETGTATAVESEPEAPHRPAGLGLIGWLRWGWRVLTSMRTA
FT                   LILLFLLALAAVPGSIYPQRGIDPDQVAQYFSSRPQEAEWLDRLWLFDVYSSPWFAAIY
FT                   LLLFISLLGCIVPRLARHAGELRRRPPAAPRNLLRLPYGEEFEGDLTVAEAAALLRKRR
FT                   FRVTTGPDWVAAEKGYLRETGNILFHFSLVVLLFAFAGGALYGYRGNVVVVEGESFANT
FT                   VAAYDRFMPGSRVTAESLHPFSFTLKDFQVTFIAAGERTGQALDYQAALTVRDAPDAPA
FT                   REAVLKVNQPLEVGGTQTYLISHGYAPTFKVTDGKGQVAWEGPVPCLISDRATYASECV
FT                   IKVPDARPEQLGFLIRFLPTGVQAGDAWVSAFPGTVNPVAQVFPFAGDLGLDSGVPQSV
FT                   FQLDTTKMRPLGKMTAQPKPLSVGETLELADGAGTIQFTGVKEWISLQVSRDPGRLPAL
FT                   LAATAAVLGLVLSLTVRRRRIWVRVNDRRITVGGLERTDGGAAAFAKEFTEIVTALRAD
FT                   RVGPTPPSPTAPPPAEHEEER"
FT   gene            318179..319150
FT                   /locus_tag="Tbis_0272"
FT   CDS_pept        318179..319150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0272"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG: pca:Pcar_2228
FT                   ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87003"
FT                   /db_xref="GOA:D6Y3H4"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H4"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ADG87003.1"
FT                   /translation="MTPLVNEELATLSDQLTLVAVLLYLVAMICFALDLAFGRIHPASA
FT                   VKAREPVAVGAGGGGPSSGEPGEAAAAGGAATAEGAPWAAKAGLAGIALTWIGWAAHLA
FT                   AIVTRGLAVDRWPWGNMYEFVVGLCLAAVTAFLVLLFRHRIRFLGAFVTLAAALGLGFA
FT                   VLFLHVQAGPLMPALQSYWLAIHVSAAIVASGLFTVAGVSAILYLVRKDRPSVLPTREA
FT                   LDTVVHRAIVIGFPIWTFAVIAGALWADRAWGRYWGWDPKEVWSFITWVVYAAYLHARA
FT                   TAGWKGKAAIIISLVAFACLLFNLIGVNIFFPGLHSYSDIPR"
FT   gene            complement(319737..320063)
FT                   /locus_tag="Tbis_0273"
FT   CDS_pept        complement(319737..320063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87004"
FT                   /db_xref="GOA:D6Y3H5"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87004.1"
FT                   /translation="MAYLVGMPSVISGLVLLAFWLFCLFHVITTPWHEVRNLPKAAWVI
FT                   IVALLPGLGGLLWLLFGRPQAPAWHDPAAGAGWREQPQPGRPIGPDDDPEFLRSLDRRL
FT                   RGEE"
FT   gene            320396..321124
FT                   /locus_tag="Tbis_0274"
FT   CDS_pept        320396..321124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87005"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87005.1"
FT                   /translation="MERVHAATAPVVHDRPSYTWRDFELDDRPMRAEPHPPDAPDLRDG
FT                   RRHCGPLERILHRQWDAAEGPPSIDAVHAVDSLARLPDLIKVKLADGLAGIYIGAGGVP
FT                   DLDDMGYLRGAPLPSGQGTWDICAGAYGDRKIVVGDRPSPTPDVMLHEVGHALDDVDAT
FT                   PPWEWVSDSPEFAALYAECVPLLASSFHRQPGGLGRKEFFADAFAAIASRQRPALVDML
FT                   SGHTRAALNVMLFFNRRYGI"
FT   gene            321134..321370
FT                   /locus_tag="Tbis_0275"
FT   CDS_pept        321134..321370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87006"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87006.1"
FT                   /translation="MFVIRLGDGRLRVPRSLTSADGRLIGNAYVEIAPGEPDYERYLSE
FT                   AITEEEAAERRRRWREDNDELERVFQAFKAEQE"
FT   gene            complement(321598..321819)
FT                   /locus_tag="Tbis_0276"
FT   CDS_pept        complement(321598..321819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0276"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; PFAM: regulatory protein MerR; KEGG: cps:CPS_4926
FT                   MerR family DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87007"
FT                   /db_xref="GOA:D6Y3H8"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H8"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ADG87007.1"
FT                   /translation="MESSSERLLTPGEVAALFRVDPKTVTRWAAAGRISSIRTPGGHRR
FT                   FRESEVHALLRGEDVMSAERQNGDSPRV"
FT   gene            322079..322285
FT                   /locus_tag="Tbis_0277"
FT   CDS_pept        322079..322285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87008"
FT                   /db_xref="GOA:D6Y3H9"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3H9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87008.1"
FT                   /translation="MHPLVVYTLSRFGLFLVTLGVLYLVGMRGFWLLILAFLVSGLASY
FT                   VLLSRQRDAVSERIVRKRERRDG"
FT   gene            322684..323439
FT                   /locus_tag="Tbis_0278"
FT   CDS_pept        322684..323439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0278"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methionine biosynthesis MetW
FT                   protein; Methyltransferase type 12; KEGG: mmw:Mmwyl1_0746
FT                   ubiquinone/menaquinone biosynthesis methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87009"
FT                   /db_xref="GOA:D6Y3I0"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I0"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADG87009.1"
FT                   /translation="MTRASLDKQPREVAAMFDRTAKRYDLVNTVLSLGQDRTWRRATAA
FT                   AIDAGPGELVLDLAAGTGTSTDAFTMYGARAIACDFSLGMLRTGVARRGGSGLYGGGVR
FT                   GVTFIAGDALRLPFKSETFDAVTISFGLRNVADPAQALREMLRVTKPGGRLVICEFSRP
FT                   PARWFDLVYSQYLMRLLPLVARLLSSNPDSYEYLAESIRAWPDQAALAKLIHEAGWEKV
FT                   AWRNLTFGIVALHRAFKPGPGAARPGDAV"
FT   gene            323555..324829
FT                   /locus_tag="Tbis_0279"
FT   CDS_pept        323555..324829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0279"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; tryptophan halogenase; FAD
FT                   dependent oxidoreductase; Lycopene beta and epsilon
FT                   cyclase; KEGG: pna:Pnap_1343 geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87010"
FT                   /db_xref="GOA:D6Y3I1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I1"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADG87010.1"
FT                   /translation="MSEQTRAERSTADADVIVVGAGPAGSTAAFYLAKAGLDVLLLEKT
FT                   RFPREKVCGDGLTPRSVKELVAMGVDIDAPGWIRNRGLRVYGAGLRFELDWPQLTSYPD
FT                   FGLVRTRADFDEILARHAERAGARLLEETNVTGPVLDERSGRITGVTAKGADGAPQTFR
FT                   APLVIAADGNSSRLSIAMGLHKRADRPMGVAVRTYFRSPRHDDDYLETWLELWDGDRLL
FT                   PGYGWIFGVGDGTCNVGVGLLNTSAAFKNVDYRDLLRRWVKGMPAEWGFTEENMTAPIR
FT                   GAALPMAFNRQPAYRRGLLLVGDAAGAVNPFNGEGIAYAMATGRIAAETIVQALARPTP
FT                   AQRERVLLSYPRILKEEYGGYFTLGRLFLEAIGRPGVMKFATRHGLPRPTLMRFALKLL
FT                   ANLTDRRGDVSDRIINALSKVAPSA"
FT   gene            324826..324927
FT                   /locus_tag="Tbis_0280"
FT   CDS_pept        324826..324927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87011"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87011.1"
FT                   /translation="MTEANCNPYATVKAAAEPGAIVNVRFHRVCEDM"
FT   gene            324930..325292
FT                   /locus_tag="Tbis_0281"
FT   CDS_pept        324930..325292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0281"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: glo:Glov_3138 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87012"
FT                   /db_xref="GOA:D6Y3I3"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I3"
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /protein_id="ADG87012.1"
FT                   /translation="MELYVPILALAILAAGFALLSVSVIAPLTGPKRWNRAKLDSYECG
FT                   IDPTPQPVGGGRFPLKFMVTAMLFIVFDIEIIFLYPWAVAFDKLGVFGLVEMVLFIVTV
FT                   LAAYTYVWRRRGLDWD"
FT   sig_peptide     324930..325001
FT                   /locus_tag="Tbis_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.701 at
FT                   residue 24"
FT   gene            325296..325847
FT                   /locus_tag="Tbis_0282"
FT   CDS_pept        325296..325847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0282"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: aba:Acid345_2252 NADH-quinone oxidoreductase,
FT                   B subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87013"
FT                   /db_xref="GOA:D6Y3I4"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I4"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ADG87013.1"
FT                   /translation="MGLEEKLPSGFLLTTVEKAVGWARKNSVWPATFGLACCAIELMAT
FT                   GGPKHDLARFGMERASATPRQADLMIVAGRVSQKMAPVVRRIYDQMAEPKWVIAMGVCA
FT                   SSGGMFNNYAVVQGVDHIVPVDVYLPGCPPRPEMLIDAIVKLHDKIQNMKFGAHRAAQL
FT                   EELERRALRTLPLIEQGAGK"
FT   gene            325844..326533
FT                   /locus_tag="Tbis_0283"
FT   CDS_pept        325844..326533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0283"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 30 kDa subunit; KEGG:
FT                   mno:Mnod_4128 NADH (or F420H2) dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87014"
FT                   /db_xref="GOA:D6Y3I5"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I5"
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /protein_id="ADG87014.1"
FT                   /translation="MSSKNLPEVPDGANADMANWPVVRTGMFGVKGSGDTSGYGRLVVR
FT                   RPPKSSTPRPYGSYFDEVADALEALCGDAIERVVVDRGEITFHVRRERLVEVMRHLRDD
FT                   PRLRFELSLGVSGVHYPDDAGAELHAVYHLCSITHNRRIRVEVSCPDSDPHIPSTVSVY
FT                   PTHNWHERETYDFFGIIFDGHPALTRIEMPDDWEGHPQRKDYPLGGIPVEYRGATTPPP
FT                   DQRRSYS"
FT   gene            326530..327846
FT                   /locus_tag="Tbis_0284"
FT   CDS_pept        326530..327846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0284"
FT                   /product="NADH dehydrogenase I, D subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: aba:Acid345_1313 NADH dehydrogenase I, D
FT                   subunit; TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87015"
FT                   /db_xref="GOA:D6Y3I6"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I6"
FT                   /inference="protein motif:TFAM:TIGR01962"
FT                   /protein_id="ADG87015.1"
FT                   /translation="MSTMEAEGRVVDVAGQDWDEVVRTVGESGEERLVVNMGPQHPSTH
FT                   GVLRLVLTLDGETVTEVRPVIGYLHTGIEKNMEYRTWTQGVTFVTRMDYLSPIFNETAY
FT                   CMAVEKLLGITDRIPERAKTLRVLMMELNRISSHLVAVATYGMELGATSIMIYGFRERE
FT                   MVLDLFEYITGLRMNMAYVRPGGVSVDLPAGAVDKIGEFLKVMPGRIKDMRKLLDENPV
FT                   YTRRTKDVAYLDLTGCMALGVTGPVLRAAGLPWDLRKTQPYLGYETYEFDVPTANTCDV
FT                   YGRYLVRMAEMEESLKIIEQALDRLTGPLKGEPVMIEDKKIGWPSRLALGPDGLGNSPD
FT                   HIAHIMGTSMEALIHHFKLVTEGFRVPAGQAYAAVESPRGELGAHVVSDGGTRPYRVHF
FT                   RDPSFTNLQALPAMCEGGMVADVISAIASIDPVMGGVDR"
FT   gene            327843..328538
FT                   /locus_tag="Tbis_0285"
FT   CDS_pept        327843..328538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0285"
FT                   /product="NADH-quinone oxidoreductase, E subunit"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, E subunit;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 24 kDa subunit; KEGG:
FT                   aba:Acid345_1312 NADH-quinone oxidoreductase, E subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87016"
FT                   /db_xref="GOA:D6Y3I7"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I7"
FT                   /inference="protein motif:TFAM:TIGR01958"
FT                   /protein_id="ADG87016.1"
FT                   /translation="MTYAPEVRERLEREAKEIIARYPKPRSALLPLLHLVQSEDGYISD
FT                   DGAEFCAEQLGLTKAEVLGVATFYTMYKREPAGEYNVGVCINTLCAVMGGDQIWETLTE
FT                   HLGIGHNETTPDGKITLERLECNAACDYAPVVVVNWEFFDNQTPESAKRLVDDLRAGKG
FT                   ATPTRGPKRLCTFKEASRILAGFPDGRAGEGPSAGEASLRGLRLAKANGWEAPRPGAEA
FT                   NEQKRGSEE"
FT   gene            328535..329821
FT                   /locus_tag="Tbis_0286"
FT   CDS_pept        328535..329821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0286"
FT                   /product="NADH-quinone oxidoreductase, F subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: sme:SMa1525 NuoF2 NADH I chain F; TIGRFAM:
FT                   NADH-quinone oxidoreductase, F subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase domain 51 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87017"
FT                   /db_xref="GOA:D6Y3I8"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I8"
FT                   /inference="protein motif:TFAM:TIGR01959"
FT                   /protein_id="ADG87017.1"
FT                   /translation="MTQLTPVLTRNWDRPDSFTLAGYGDYSAARKALSMDPDTIIQMVK
FT                   DSGLRGRGGAGFPTGMKWGFIPQNDGKPHYLVVNADESEPGTCKDIPLMMANPHALIEG
FT                   AIITSYAIRANHAFIYVRGEVLHVIRRLQAAVREAYEAGYLGRNIFGSGYDLELVVHCG
FT                   AGAYICGEETALLDSLEGRRGQPRLKPPFPAVAGLYACPTVINNVESVATVPSIVANGP
FT                   EWFASMGTEKSKGFGIFSLSGHVARPGQYEAPLGITLRELLEMAGGIRAGHRLKFWTPG
FT                   GSSTPIFTEEHLDVPLDFESVAANGSMLGTRAIQIFDETTCVVRAVLRWTEFYAHESCG
FT                   KCTPCREGTYWLKQVLYRLEKGQGTEEDLATITDIADNILGRSFCALGDGATSSIHSSV
FT                   KLFRDEYLKHFEIGGCPFDPAASTVWGVK"
FT   gene            329818..332223
FT                   /locus_tag="Tbis_0287"
FT   CDS_pept        329818..332223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0287"
FT                   /product="NADH-quinone oxidoreductase, chain G"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   molybdopterin oxidoreductase; ferredoxin; molybdopterin
FT                   oxidoreductase Fe4S4 region; KEGG: smd:Smed_3617
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87018"
FT                   /db_xref="GOA:D6Y3I9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3I9"
FT                   /inference="protein motif:TFAM:TIGR01973"
FT                   /protein_id="ADG87018.1"
FT                   /translation="MTIETTSAGQIERPVDMVTLTIDGFRVSVPKGTLIIRAAELLGIE
FT                   IPRFCDHPLLDPAANCRQCLVEITDAGNGRGFPKPQPSCAIEVAEGMVVKTALTSPVAE
FT                   KAQRGVMEMLLLNHPLDCPVCDKGGECPLQNQAMSHGQGESRFQEKKRTFPKPVALSTQ
FT                   VLLDRERCIQCARCLRFSEQIAGDPLITFFERGAKEQVAAADGEPFHSYFSGNTIQICP
FT                   VGALTGAAYRFRARPFDLVSTPSACEHCASGCALRTDHRRGKVLRRLAADDPQVNEEWN
FT                   CDKGRWAFTYATQPDRLTTPLVRDEDGKLVPASWPEALAAAAEGLARARGRAGVLVGGR
FT                   LTLEDAYAYSKFARVALGTNDIDFRARPHSEEEARFLAYAVAGKGIEVSYADLERAPVV
FT                   LLVGFEPEEESPIVFLRLRKAVRKKGLKVYSIAPFTTPGLAKLNATLIRTVPGAEAEAL
FT                   GELIGGDLIPAEGIILVGERLATVPGAFSALVRLVQATGARVAWVPRRAGERGALEAGA
FT                   LPNLLPIGRPVDDETARSEVARVWNVGSLPSLPGRDTTGIIDAALNEEIDALLVAGVDP
FT                   YDLPDPSRALAALENTPFVVSLEIRASAVTDRADVVLPVAVVAEKSGSFVNWEGRGRQF
FT                   EAALQVPGVLSDLRVINAIADHMDVHLGLPDPAAARRELAAIGTWKGSRATPPTLTGRP
FT                   GKEPQAGEAVLATWHLLLDDGRLQDGEPYLAGTARPATALISAATAAEIGVSEGDKISI
FT                   GDGGVVMPVRIADLPDRVVWVPSNSNGISVTRDLGAVAGDVVKIGSVS"
FT   gene            332220..333578
FT                   /locus_tag="Tbis_0288"
FT   CDS_pept        332220..333578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0288"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: aba:Acid345_1308 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87019"
FT                   /db_xref="GOA:D6Y3J0"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J0"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADG87019.1"
FT                   /translation="MNNAGPTLSDFGNDPLWLSFLKAVCIFVLLLLGVLFGVWGERKII
FT                   ARMQHRYGPNRAGKFGILQSLADGIKLALKEDLVPRKVDKVVYILAPALIAIPAFLAFS
FT                   VIPFGPTVSIFGVETPLQLTDLPVGVLLVLAMASIGVYGIVLAGWSSRSPYAILGGLRS
FT                   SAQVVSYEIAMALSFVAVFLQAGTLSTSEIVAAQAHAGSVTLFGVEIPTPSWYVVSLFP
FT                   SFAIYVITMFGETNRLPFDLPEGEGELVGGFHTEYSSSLKWGMFMIGEYVNMFTVSAIA
FT                   VTLFFGGWHAPWPISIWDAANTGWWPMLWFLGKVALAFWFFVWVRASLPRVRYDQLMAF
FT                   GWKVLIPVNLAWILIAATMKAMRISEGDRTVIYVLGAVIIIGAFAIWLRFDTVNQRRAE
FT                   AKAAQIEEEFKQLREEPAAGGFPVPPLDLPHYRGVVPAARHSTDAKEVTSGSN"
FT   gene            333565..334080
FT                   /locus_tag="Tbis_0289"
FT   CDS_pept        333565..334080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0289"
FT                   /product="NADH-quinone oxidoreductase, chain I"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   sus:Acid_3879 NADH-quinone oxidoreductase, chain I"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87020"
FT                   /db_xref="GOA:D6Y3J1"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J1"
FT                   /inference="protein motif:TFAM:TIGR01971"
FT                   /protein_id="ADG87020.1"
FT                   /translation="MGATDWLNPVKGFGVTFHHMFKKPVTVQYPEEKRPTAPRFHGRHQ
FT                   LNRWPDGLEKCVGCELCAWACPADAIYVEGADNTETERYSPGERYGRVYQINYLRCIMC
FT                   GLCIEACPTRALTMTNEYELADTSREAMIYTKDMLLAPLGPGMEAPPHPMRLGETEEDY
FT                   YRLGRGNG"
FT   gene            334073..334963
FT                   /locus_tag="Tbis_0290"
FT   CDS_pept        334073..334963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0290"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: afw:Anae109_4347 NADH-
FT                   ubiquinone/plastoquinone oxidoreductase chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87021"
FT                   /db_xref="GOA:D6Y3J2"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J2"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADG87021.1"
FT                   /translation="MGESITFWVLAVVSVLAAFGLVLSRKAVYSALMLGVVMLSLAVLY
FT                   AVQDAPFLAAVQIIVYTGAVMMLFLFVLMLIGVDTSDSLVETIKGQRFWAIVAGLGFVA
FT                   LLGLAVGNVAVSAATGLGEEGKASNVLSLAELIFTRHVFAFEVTSALLITAALGAMVLA
FT                   HRERRTPKPTQKDLSRRRFLEYGRTGKDPAPLPGPGTYARHNAVDLPALLPDGTVSPLS
FT                   VNRYIARYEANEGDLDPELARLREQGRLLEGRAAAVDGEEPRDERAEGGEPAEDVLSAQ
FT                   AAGRGDGPRSEEEGK"
FT   gene            334960..335256
FT                   /locus_tag="Tbis_0291"
FT   CDS_pept        334960..335256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0291"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   glo:Glov_3128 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87022"
FT                   /db_xref="GOA:D6Y3J3"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J3"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADG87022.1"
FT                   /translation="MTTHYLVLSALLFTIGAVGVLLRRNAIVVFMCIELMLNACNLAFV
FT                   TFARQHGNLDGQLIAFFVMVVAAAEVVVGLAIIVTIFRTRRSASVDDANLMKH"
FT   gene            335266..337194
FT                   /locus_tag="Tbis_0292"
FT   CDS_pept        335266..337194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0292"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: pla:Plav_3215 proton-translocating NADH-
FT                   quinone oxidoreductase, chain L; TIGRFAM:
FT                   proton-translocating NADH-quinone oxidoreductase, chain L;
FT                   PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87023"
FT                   /db_xref="GOA:D6Y3J4"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J4"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADG87023.1"
FT                   /translation="MEPAVFQRDLTEIASIIQHDGGAIGASWLMIALPLVGAALLLVGG
FT                   RRTDKFGHLLGTVMALASFAVSVLAFIELLGFAPQERRRAVPLFEFIPGIADVGLLIDP
FT                   LSISFCLLITGVGSLIHIYSIGYMAHDPDRRRFFAYLNLFVAAMLLLVLADNYLLLFVG
FT                   WEGVGLASYLLIGFWQYKPSAATAAKKAFIINRVGDFGLLIGLFTIFATFHSLAFGEVF
FT                   SAASRASEVTLTAIGLLLLVGACGKSAQLPLQAWLLDAMEGPTPVSALIHAATMVTAGV
FT                   YLIVRSGPIYEGAPTAQLLVTIVGVATLLAGAIIGTAKDDIKKALAGSTMSQIGYMVLA
FT                   AGIGPAGYAFAIAHLITHGFFKADLFLGAGSIMHAMNDEVDMRKYGALRKVMPITFATF
FT                   LIGYLAIIGFPLLSGYFTKDGIIETAMEHSAVLGWLAVLGAGITGFYMSRVVFMTFFGT
FT                   KRWDANAHPHESPKVMTLPLIVLSIGSIGLGAYLILGNRFMLFLAPAVGAPEELPGFHP
FT                   FSVPGLATLGLVALGAAYAWLKYGAAEVPTVAPRGSFLVRFARRDLYGDALNEALFMRP
FT                   GQWLTRIAVFFDNRGVDGLVNGLAALIGGTSGRLRRVQTGFARSYALSMFIGATVLVGA
FT                   WFVVGNL"
FT   gene            337194..338702
FT                   /locus_tag="Tbis_0293"
FT   CDS_pept        337194..338702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0293"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; K00342 NADH dehydrogenase I
FT                   subunit M; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87024"
FT                   /db_xref="GOA:D6Y3J5"
FT                   /db_xref="InterPro:IPR000260"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J5"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADG87024.1"
FT                   /translation="MHWLSTLMGVSVLGALGVPLFRNDKLAKQFTLVISLVVLALALAM
FT                   AREFDPNGDRFQFTETYAWIPSFGIHFSVGVDGIALVLILLSAVLVPVVVLASWNEAEG
FT                   GKRSVRTYFSLILLLEAMMIGVFAATDVFLFYVFFEAMLIPMYFMIGSYGGAQRSYAAV
FT                   KFLLYSLFGGLLMLVAVIALYVIAGKNTFLFGDLVGTVQDATTQKWLFLGFFIAFAIKA
FT                   PLWPFHTWLPDAAAQAPAGSAVLLVGVLDKVGTFGMLRYCLELFPDASKYFTPLVITLC
FT                   VIGVVYGAIVAIGQTDMKRLIAYTSVSHFGFIALGVFAMTSNASAGATLYMVNHGFSTG
FT                   ALFLIAGFLISRRGSQFIADYGGVQKVAPVLAGTFLIAGLSSLSLPGLSPFVSEFMVLL
FT                   GSYERFLWPTVIATTGVILAAIYILWMYQRMMNGPTAEPVKRMPDLNAREKWAIAPLIL
FT                   LLVVFGFYPKPLLDVINPAVKSTLASVSVTDPAPAVPVAAEEGQ"
FT   gene            338699..340249
FT                   /locus_tag="Tbis_0294"
FT   CDS_pept        338699..340249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0294"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain N"
FT                   /note="TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I); KEGG:
FT                   gbm:Gbem_3913 proton-translocating NADH- quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87025"
FT                   /db_xref="GOA:D6Y3J6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J6"
FT                   /inference="protein motif:TFAM:TIGR01770"
FT                   /protein_id="ADG87025.1"
FT                   /translation="MIFQAPNIEYGLLAPILIVFGAAVAGVLVEAFAPRYLRSAIHLPL
FT                   ALVSLLGAFALTIWQVAANGIPTKAAAEGALAVDGPALFIWGTILVLAIVSVLLINDEG
FT                   HFVASAVAVPGTAEEEQSLQDGAAHTEVFPLALFAVGGMMLFPVANDLLVAFVALEVMS
FT                   LPLYLLCGLARRRRLLSQEAAVKYFLLGAFSSAFFLYGVALVYGFAGSVDLAAISRALG
FT                   EVDGRDPLLFLGMALLGVGLLFKIGAAPFQAWKPDVYQGSPTPITALMASGTLVAAFGA
FT                   LLRVFWVGLGGMDWSWRPVMWAVAILTMLVGAVLAVTQTDIKRMLAYSSIAHAGFLLIG
FT                   VVATGGTQAENAAVVSAILFYLVAYGFSTVGAFAVVTMVRDPGGEAWHLSRWAGLGKRS
FT                   PLLAGVFAFFLLAFAGIPLTSGFLGKYAVFSAAVANDAVPLVIVGVIASAIAAFFYVRV
FT                   IVLMFFSDPAADAPAVVLPSVGTAAVVATAALATVVLGVYPEPVLDLAHSAAKSLFVR"
FT   sig_peptide     338699..338776
FT                   /locus_tag="Tbis_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.668) with cleavage site probability 0.646 at
FT                   residue 26"
FT   gene            340262..341257
FT                   /locus_tag="Tbis_0295"
FT   CDS_pept        340262..341257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0295"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: xca:xccb100_1425
FT                   octaprenyl-diphosphate synthase, probable"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87026"
FT                   /db_xref="GOA:D6Y3J7"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J7"
FT                   /inference="protein motif:PRIAM:2.5.1.30"
FT                   /protein_id="ADG87026.1"
FT                   /translation="MAAPPLVEIPRVDERLAEDLATGLAEVERMLRASVESEDAFITEA
FT                   ARHVMEAGGKRFRAMLVLLAAQFGDPKAPAVVPGAVVIELTHLATLYHDDVMDQAPMRR
FT                   GLPSANARFGDTVAILTGDYLFAQASEILADLGAEAIRVQARTFSRLVRGQIRETIGPP
FT                   EGMDPITHYLQVLADKTGSLIATSGRFGAMLSGAPREVEDRLAGACEAIGVAWQLGDDI
FT                   IDVVSDGSVSGKTPGTDLREGVRTLPVLYALASTDPADERLRMLLSGPVAEQDIEEALT
FT                   LLRAHPAMDMARKELVKWADQAKGALSGLPDIPARTALIRLCDWVVERTA"
FT   gene            341412..343097
FT                   /locus_tag="Tbis_0296"
FT   CDS_pept        341412..343097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0296"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: hypothetical protein
FT                   mgc108497"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87027"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023294"
FT                   /db_xref="InterPro:IPR036813"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J8"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ADG87027.1"
FT                   /translation="MLGAAVLTVASATPAQAAVALTCPATVPVYAIDGDGRLKWYGHRD
FT                   AGGGSWSWASGSGAQIGHGWHGFKRVFSGGNGVIYAVDGSGYLKWYRHTGASTGANTWA
FT                   SGSGKVIGHGWGGFVDVVADGTGVIYALDADGNLRWYRHLSPTTGGTGWASGSGTVIRT
FT                   GWKAITKLIPGRDGVIFGINTKGLVRWYKHLNPSGGGSTFGTGTGLVTGEEWDRYRTPS
FT                   GAGAGVFYAVDSGGRLWWERHADPQAGAPVWYERRQIGSGWGSFTSVFADVASCAPASS
FT                   TGYATGSGGRTLYYVNGRVAAVLTPGARTAVLYGTTVRKFSESTTTATVSTRAWVRLLP
FT                   GPWSTSASWASSWLSANVGSTSEDILEIASQYITGAPDRYKNGLRYAGDAHYGPVGEEG
FT                   RIEGSDFNDYLGIPWKYGDRVDEPEPDQKDSLDCSGFVRMVYGYRSGYPMEIGTPTGTA
FT                   LPRRAVQMHASAPGVMVVDGGTAKPTSYAALQPGDLLFWDASTDDGTAIDHVGIYLGVD
FT                   SNGKHRFVSSRKTVDGPTLGDVGGHSLLDNGTLYDRSWRAAKRL"
FT   sig_peptide     341412..341465
FT                   /locus_tag="Tbis_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.946 at
FT                   residue 18"
FT   gene            complement(343437..344342)
FT                   /locus_tag="Tbis_0297"
FT   CDS_pept        complement(343437..344342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0297"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   bph:Bphy_2413 transporter DMT superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87028"
FT                   /db_xref="GOA:D6Y3J9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3J9"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ADG87028.1"
FT                   /translation="MPELRRGVAYGVAAYAIWGLTPLYWPLLEPSGAVEILAHRMVWSL
FT                   VVVAALLAVRRRWSWIRELTGRQVLLLAIAAIVVSVNWGVYIYAVNSGHVVDASLGYFI
FT                   NPLVNVLFGIMIFGERLRTGQWVAVGLGTLAVAVLTYGYGRPPWIALVLAFTFGIYGVV
FT                   KKKARVEGTESLAVETLVMLLPAVVYLGTLHASGEGTFGRYGLGHALLVAGAGVVTALP
FT                   LIFFTIAALSIPLSLVGLLQYIAPILQFLCGVLIAHETMPPSRWAGFCIVWLALAVFTW
FT                   DTLRAARNARLAREAEPATV"
FT   gene            344477..345139
FT                   /locus_tag="Tbis_0298"
FT   CDS_pept        344477..345139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0298"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: acr:Acry_0406 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   PFAM: Methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87029"
FT                   /db_xref="GOA:D6Y3K0"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K0"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADG87029.1"
FT                   /translation="MHWLLGKHKTTMVAPAEALPGRAEPMPVADRHAVLGTPLAPPYPE
FT                   GTEIAEFALGCFWGAERRFWQTPGVVTTAVGYAGGYTPNPTYEEVCTGLTGHAETVRVV
FT                   FDPKVISYERLLKVFWESHDPTQGMRQGNDVGTQYRSVIFTHGPEQERLAVASRDAYQK
FT                   VLTEHGYGRITTEIVPAGEFYFAEDYHQQYLHKVPDGYCGFGGTGVGCPVGLTSGEA"
FT   gene            complement(345288..345836)
FT                   /locus_tag="Tbis_0299"
FT   CDS_pept        complement(345288..345836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce5012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87030"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87030.1"
FT                   /translation="MSVAETIEPLPPLVADAMVLIHFAKADRLDVLGTCLSSLSTTRIV
FT                   AAEVDKYCAEYPSITSISDLEWLAILPQDTLEELLAFERWVQLLGSGEHDLGEASVFAA
FT                   AEVHELVAITDDRDATRVGSKHGLEIHGTVWLLTRLHQRGKMTLPQICTLVDALRETGM
FT                   RLPCTGGELPRWAEERRLL"
FT   gene            complement(345833..346945)
FT                   /locus_tag="Tbis_0300"
FT   CDS_pept        complement(345833..346945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0300"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; protein of
FT                   unknown function DUF955; SMART: helix-turn-helix domain
FT                   protein; KEGG: sbp:Sbal223_3468 helix-turn-helix domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87031"
FT                   /db_xref="GOA:D6Y3K2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG87031.1"
FT                   /translation="MCDYRTMSSLDWQEIGERVRQARLAKGLSQLQLAQKVDLDRTMIT
FT                   KIEAGSRRLDALELARLAQALDVPIGHFLHPAPEVLSHRTPLAEDTATDASQPYYRLDN
FT                   ALAAWIRDIRLLMDLGTLQPQPIMQYPGKADGPEAAAEAARWVRGELGLGTAPVQSMAE
FT                   LSERCGQYVLVTELPGDGASAVDGDMAAAVVSLNGDPGRRRSTAAHELGHMVLGDAYST
FT                   DIGVAASRTEREAMIDAFAGELLLPVAAIRAAADVAKASTRSVLVRLAAEYRTSWSMAL
FT                   RQARKAGVITSQEEKRLRSSLPTYAEFRDSLGWTPQPDLEDIRVPPGFAHAVMTAYRTG
FT                   QITRRRAFELMHGQLRSEEDLPPVDEDEAP"
FT   gene            347400..347900
FT                   /locus_tag="Tbis_0301"
FT   CDS_pept        347400..347900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0301"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_3374 tetratricopeptide repeat
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87032"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87032.1"
FT                   /translation="MRRFWAASAVLTVICAAVGTAGLAALATGRGGPEPVQAPIAAERQ
FT                   AVRLPAGGVPEPSQGQVALQEEARSLPEGVAPQEVSRRQYRIMLRQCRYANTKALQEEC
FT                   LAEVQQRYTVGAFNPSLDCRTYSSITVCGELKLTPEERQCVREAVRQGMSYRRAEVECY
FT                   AFR"
FT   sig_peptide     347400..347474
FT                   /locus_tag="Tbis_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.609 at
FT                   residue 25"
FT   gene            347957..348352
FT                   /locus_tag="Tbis_0302"
FT   CDS_pept        347957..348352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87033"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87033.1"
FT                   /translation="MDPKSRGAADLLRALMGAAARFSETGGSLTREYFPHVGCEPISDL
FT                   AGPAVRLGMRVTLPGHELVAELAVRVTDAGFTIGGELMLDDAEPFLTLPPIETADVDKC
FT                   AALLHRYAEELTVPARLEVGRLLEHGC"
FT   gene            complement(348383..348736)
FT                   /locus_tag="Tbis_0303"
FT   CDS_pept        complement(348383..348736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0303"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87034"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K5"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ADG87034.1"
FT                   /translation="MTEQDNGPLLRPYMLTRGRTRPSGPEFDLLSVIRTAPSAHERTAG
FT                   LAPEHLRILRICRTPSTVADLASELGLSLNVLRILLSDLRDKGLISVRPQATVARLPDE
FT                   RILREVIQAFKAL"
FT   gene            complement(348733..350826)
FT                   /locus_tag="Tbis_0304"
FT   CDS_pept        complement(348733..350826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0304"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Nitrate and nitrite sensing domain protein;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG: scl:sce8108
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87035"
FT                   /db_xref="GOA:D6Y3K6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K6"
FT                   /inference="protein motif:PFAM:PF08376"
FT                   /protein_id="ADG87035.1"
FT                   /translation="MAVRRRSIRFKLFAILLVPFTALGAIWAFTATLIAEEGFKLLQID
FT                   AVYNHVVVPTRGVIVQLQRERSLSVQALGSAYSLQTDLERQRRLTDEAARTLARESAQA
FT                   ADETPPAMRQRIQALIAQVERLDDLRTRVDERRLSRLDAIDEYSAVLETAFQAYDHLMI
FT                   SQDLELIGQTKAIILIARSHEVAAQEAALLSGVVASGRYTVEDRDAFASMVSRRRLLYQ
FT                   LGTGQLDAELIKRYTAFNDSPVHKTFLAVEEQLTRRGEVGRTLPVGALNWPAAAEQLVH
FT                   RLTELNAATSRDIADRAAPLARGVLLRIGVAGALGAGTAIAAVFISLRFARKLSGELTG
FT                   LERAVVELAERRLPSVLARLRRGEDVDVAAETRPLGTDHGTTEVASLSRAFGSVQRTAI
FT                   EAAVEQAKLRKGVNKVFLNLARRNQSLLTRQFALLDTLEKEITDPDLLEKVFGIDHLAA
FT                   RMRRHAEGLIILSGAAPARGWRNPVNLHDVVRAATEQVEDYQRVDVQVPHTHALVGRAA
FT                   TNVIHLLAELIENATAFSPPQSKVLVRGEAVARGYSLEIEDRGLGMTPEDMERFNQRLA
FT                   DPPEIDLADSDRLGLFVVGLLAKRHGIKVALRASPYGGTSAIVLLPQELVVEHAAEDLE
FT                   LTPLQPQEPSAPALAIARPDGAPKSTLPRRIRQANLAPQLRQPRGDLYSAMRPGSDPRG
FT                   EGS"
FT   sig_peptide     complement(350719..350826)
FT                   /locus_tag="Tbis_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.639 at
FT                   residue 36"
FT   gene            350965..352014
FT                   /locus_tag="Tbis_0305"
FT   CDS_pept        350965..352014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0305"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gbm:Gbem_3934 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87036"
FT                   /db_xref="GOA:D6Y3K7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K7"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADG87036.1"
FT                   /translation="MRSGPLAIFAAAALWGTAGTAGALTDAGSVPLAAARLVLGGAVLA
FT                   ALAARSLAAADPRHHGRGAGEPADQDGHLLGHAREAEKYRRGGPAPAPARSGIGAALAS
FT                   GLGLVRGRPALLLAAVAVAAYQLCFFAAVARTGVAIGTVVAIGSGPVFTGLLSWLLDRR
FT                   PPTLRWALATTTAVAGCAVLVTGGEASGAEPGGIALALVGGLLYAFYAVMASRAIQTGL
FT                   ESGVVMGLLFGGAAVLMLPVLVVTAPGSLTEPRALLVAVYLGCATTALSYLLYGKGLRT
FT                   TPVATAATLALAEPAVAALLGLAVLGERLSGPAWAGLGLLAVGLIIVALPERARTAPEP
FT                   AAQRTASGA"
FT   sig_peptide     350965..351036
FT                   /locus_tag="Tbis_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.777 at
FT                   residue 24"
FT   gene            complement(352182..352832)
FT                   /locus_tag="Tbis_0306"
FT   CDS_pept        complement(352182..352832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0306"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vei:Veis_1972 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87037"
FT                   /db_xref="GOA:D6Y3K8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87037.1"
FT                   /translation="MLEARDITVIYDRRRVLDGAGIAVPPGTTVGLMGPSGCGKSTLAR
FT                   VLALLQRPASGRVAIDGTPVHRWRHRAPRELRTSVALIFQQPRLAVDPRLTLAEIIAEP
FT                   LRATGRPIGRAAELAEEMGLTPDLLDRRPHEVSDGQLQRACVARALTLRPRYLICDEMT
FT                   TMLDVSTQAHLVARIEAYRGATGAGVLAISHDRELLTRWCQGPERVHTWPPSA"
FT   gene            complement(352825..353805)
FT                   /locus_tag="Tbis_0307"
FT   CDS_pept        complement(352825..353805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0307"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: azc:AZC_1983 ABC transporter ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87038"
FT                   /db_xref="GOA:D6Y3K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3K9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADG87038.1"
FT                   /translation="MTTGAAAALGHAVTAQAARLRVAGLTVRFHLPGATVHAVTEAAFE
FT                   VEQGRCLALIGESGCGKSVMAHTLLGLLPGNATVTGSAWLEQPGRPPLDLIAAPERVLA
FT                   REVRGRRIGLIPQSPAAHLTPVRTARAQLTEALRELGGRYTADELAERAGLRPHELDRY
FT                   PHQLSGGMAQRVANAIALAGDPWLVIADEPTTGLDRPLVDATMAELRRLCDDGHAVLLI
FT                   THDLRAAEQVADDVAVMYAGRIVEIAPAADFFRAPRHPYAAGLLDALPTRAFTPIPGQP
FT                   PELTRLAGGCAFRPRCARADDACAVRPQITPDTPVACHHPLERHA"
FT   sig_peptide     complement(353752..353805)
FT                   /locus_tag="Tbis_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.840 at
FT                   residue 18"
FT   gene            complement(353840..354736)
FT                   /locus_tag="Tbis_0308"
FT   CDS_pept        complement(353840..354736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0308"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gbm:Gbem_2642
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87039"
FT                   /db_xref="GOA:D6Y3L0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG87039.1"
FT                   /translation="MRPETTTPMETAAPDLIHTSAAAGRSGRRSVRIAAATLALLGLAV
FT                   IVVPLVARVDERLVDLGSALLPPSPAHPFGTDEMGRDVLLRSVYGLRVSLLVGLVAAAV
FT                   SVVIGGLVGVIAGAAGGIVDRLLMRVVDGVNSLPHLLLGIFIVALFAPSVWAVIISVGV
FT                   THWTTAARIVRSEVLSLRGRPYIDAAINGGSSRMRIIRRHFVPALIPHLGLAAVLMVPH
FT                   AIWHETALSFLGLGLPPHLASLGNMINDGQRSLLTGAWWPSVFPGLFILIPTLAVAVLA
FT                   QYWRDRTSPRWRSELNL"
FT   gene            complement(354736..355725)
FT                   /locus_tag="Tbis_0309"
FT   CDS_pept        complement(354736..355725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0309"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcb:BCB4264_A0946
FT                   oligopeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87040"
FT                   /db_xref="GOA:D6Y3L1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADG87040.1"
FT                   /translation="MSVAGALARLVAWRLAFLVPLLLVVTAGMFALAKASPFDPVRQYL
FT                   GERALVTSQEIQDQIRANWGLDRPLAEQYLTWLGGLLTGDLGESRSFHRPVAEVIGERL
FT                   GWTMLVAGAAVVLMLAMGLVLGTIAAYRRGTWVDRLITGVAYANEAAPVFWIGLIAIWI
FT                   FSVTLGWLPAGGLTDAGSAVVSPGEVARHMILPVGVLAVSQSSWLVLFVRESVIATLRE
FT                   DFVIGARARGLRERTVLVRHALRSALLPFLTLFGARIPELVTGAILVESVFSWPGVAGT
FT                   AVRAALAVDFPLLAALTLLATVAVVAGNLIADAAYVIADPRVRVLGVS"
FT   sig_peptide     complement(355624..355725)
FT                   /locus_tag="Tbis_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.843 at
FT                   residue 34"
FT   gene            complement(355722..357251)
FT                   /locus_tag="Tbis_0310"
FT   CDS_pept        complement(355722..357251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0310"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: glo:Glov_2097 4-phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87041"
FT                   /db_xref="GOA:D6Y3L2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L2"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADG87041.1"
FT                   /translation="MLAACSAPAGAPADGDRDTFVLGLRSEFDTLNPVLGYAPDGGSLL
FT                   FDGLVTRAADLTLRPALAREIPEVDGTTVTFRLREGVTFHDGTPLTSEDVAFTYNAVLD
FT                   PANNSTIRGDYAAIERVEAPDPQTVIFHLKHPYAPILQRATLGIVPKRLLEGQDLDKAP
FT                   FNTKPVGTGPYRFVSWTPGDKIVLEANEDYWGGAPSIKRLVLAFVPDDNARATRMAAGE
FT                   LDATELPPKAAARFDGQDGITVHRVPSADYRAVMFPMKQPVTGDPAIRKAISAAVDRAA
FT                   MVTTILAGAGDPAFGPIAPGTKWHDPAVTGSPTADRERAVRILEEAGWKPGPDGIRVKD
FT                   GTPARFTLMYPANDSLRKELALAVASDAKRIGIDVQVAGLDWDAIEPRMAKDALIMGYG
FT                   SPYDPDYVNYELFHSSFSGQGFFNPGHFSDPRVDELLEKGRATADEGERKRIYGEFQRR
FT                   IRDQEAWTYLVYLQHVYVIRGEWTGIEPSVEAHEHATGGLFRNIHEWKRAA"
FT   gene            357496..358104
FT                   /locus_tag="Tbis_0311"
FT   CDS_pept        357496..358104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0311"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87042"
FT                   /db_xref="GOA:D6Y3L3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L3"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADG87042.1"
FT                   /translation="MFKPVSTVEALAAALRERVLSGDISPGTPLTEQELSTRYGVARPT
FT                   VREALAVLVHEGLLRRERNRSAYVPEITPEDFADLMYVRLPLEELMARALVGRRVAEAE
FT                   AALDRMDALRPDAPWAAVVAEHMALHQALIDAVGSPRLARLYGSLAAETRLALVRLRHA
FT                   YPDRRELVAEHRALLQVIADGPEEAALRAVRDHLTWRES"
FT   gene            358089..358517
FT                   /locus_tag="Tbis_0312"
FT   CDS_pept        358089..358517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_A0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87043"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87043.1"
FT                   /translation="MAGILNASCTRWPELDRIAPMHGDPVPDTYVYVTEEGVARHYADG
FT                   SVEALAWDDVVEVRVGPSRSSGDEGDVVIVLLDRAGEECVVPQSAVDASFVARLRYLPD
FT                   FDMERLSKAVERAGNGYDGYQVVWRSPHPPSMVDLDYD"
FT   gene            complement(358869..359930)
FT                   /locus_tag="Tbis_0313"
FT   CDS_pept        complement(358869..359930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0313"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: eba:ebA3150 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87044"
FT                   /db_xref="GOA:D6Y3L5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L5"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADG87044.1"
FT                   /translation="MVTESPNGKGLALIPRADGKLSLKDFKSDQEVRWCPGCGDYAILA
FT                   AVQSFLPELGIRRENIVFVSGIGCSSRFPYYMNTYGMHSIHGRAPAIATGLAASRPDLS
FT                   VWVVTGDGDALSIGGNHLIHALRRNINLTILLFNNRIYGLTKGQYSPTSEQGKITKSTP
FT                   YGSLDRPFNPISLALGAEATFVARTIDSDRKHLQQVLRAAAEHRGAALVEIYQNCPIFN
FT                   DGAFDPLKTPGLREEITIRLEHGKPIVFGPQGQEKAVRLTSTGGVEVVPRDQVADHEIL
FT                   VHDAHNPDPSLAFALSRLDEPAFAHVPIGIFRSVDRPSYEQLMADQIDQAVTAKGTGDL
FT                   MALLHSGDTWEIS"
FT   gene            complement(359920..361764)
FT                   /locus_tag="Tbis_0314"
FT   CDS_pept        complement(359920..361764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0314"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: afw:Anae109_1891 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87045"
FT                   /db_xref="GOA:D6Y3L6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L6"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADG87045.1"
FT                   /translation="MAKRVQQLDRVIIRFAGDSGDGMQLTGDRFTSETARFGNDLSTLP
FT                   NFPAEIRAPAGTLPGVSSFQLHFADHDILTPGDAPNVLVAMNPAALKANLADLPPGAEI
FT                   IVNTDEFTPRNLQKVGYTANPLEDDSLSSWRVHKVPLTSLTLRALEGFDISKKDAERAK
FT                   NMFALGLLSWLYNRPTEGTIRFLEQKFANRPEIAKANIAAFNAGWNYGETTESFSVSYE
FT                   VKPAKLAPGVYRNISGNQALAWGLIAASELSGLPLFLGSYPITPASDILHELSRHKNFR
FT                   VRTFQAEDEIAGVGAALGASFGGALGVTTTSGPGMVLKSETIGLAVAVELPLVIVDVQR
FT                   AGPSTGMPTKTEQTDLLMALYGRNGESPVPVVAPATPSECFAMAIEAARIALAYRTPVM
FT                   LLSDAYLANGSEPWRIPTREELPDISVPFATEPNGDGGRFLPFARDPETLARPWAIPGT
FT                   PGLEHRVGGLEKSDRTGEISYDPDNHDAMVRLRRAKIDGIKVPDLQVDDPDGSAKVLVL
FT                   GWGSTYGAISAAVRRVRATGRKVAQAHLRHLNPLPANTGQVLRSYEKVLLPEINLGQLA
FT                   MVLRARYLVDVIGYNRVRGLPFKAEELAGVIQDVIDGD"
FT   gene            362150..362521
FT                   /locus_tag="Tbis_0315"
FT   CDS_pept        362150..362521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0315"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 3; KEGG: bca:BCE_5425 NADH dehydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87046"
FT                   /db_xref="GOA:D6Y3L7"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L7"
FT                   /inference="protein motif:PFAM:PF00507"
FT                   /protein_id="ADG87046.1"
FT                   /translation="MNGYFGSYAVVLVLLGIGVAIVAGAMTVNRLLRPSRPTPEKLTTY
FT                   ECGVDPVGEGWAQSQIRYYVYAYLYVVFAVDAVFLFPWATVFSAPGYGLTTLVEMFVFL
FT                   GFIALGILYAWRKRVLTWT"
FT   sig_peptide     362150..362227
FT                   /locus_tag="Tbis_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.469 at
FT                   residue 26"
FT   gene            362573..363085
FT                   /locus_tag="Tbis_0316"
FT   CDS_pept        362573..363085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0316"
FT                   /product="NADH-quinone oxidoreductase, B subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: gbm:Gbem_3925 NADH-quinone oxidoreductase, B
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87047"
FT                   /db_xref="GOA:D6Y3L8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L8"
FT                   /inference="protein motif:TFAM:TIGR01957"
FT                   /protein_id="ADG87047.1"
FT                   /translation="MAVRDLPTIGPAARLAPRPMKFVLNWGRRYSLWVFNFGLACCAIE
FT                   FIATSMSRHDFIRFGVIPFANGPRQADLMIVSGTVTDKMAPAVKRLYEQMPDPKYVISF
FT                   GACSNCGGPYWDSYSVTKGVDQIIPVDVYVPGCPPRPEALLHGILKLQEKIAGESLADR
FT                   YGPGEDA"
FT   gene            363082..363726
FT                   /locus_tag="Tbis_0317"
FT   CDS_pept        363082..363726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0317"
FT                   /product="NADH (or F420H2) dehydrogenase, subunit C"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone) 30 kDa subunit; KEGG:
FT                   mlo:mll1369 NADH dehydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87048"
FT                   /db_xref="GOA:D6Y3L9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3L9"
FT                   /inference="protein motif:TFAM:TIGR01961"
FT                   /protein_id="ADG87048.1"
FT                   /translation="MTADIGAAIRERFGSRAEISDAFGQVVADVAPEDWVEALAFARSC
FT                   GFEFFDWLTGVDDPPEAIQVVAHVVNLTGVRHLLVRTRVPRDDPRLPSVTGVFRGADWH
FT                   ERETYEMFGVVFEGHPDLRPLLLPDGFEGHPLRKDFVLAARVAKAWPGAKEPGESGHEP
FT                   PSRRRMLPPGVPADWAKPAPEPREPAAERPGGPAAGRSGAGDPGAQGEGDG"
FT   gene            363719..364672
FT                   /locus_tag="Tbis_0318"
FT   CDS_pept        363719..364672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0318"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: bcb:BCB4264_A5417 NADH dehydrogenase (ubiquinone),
FT                   H subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87049"
FT                   /db_xref="GOA:D6Y3M0"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M0"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADG87049.1"
FT                   /translation="MADLLDIAVRLAVIVAAFLLLPLVVGQMEHKAMAHMQSRLGPMYA
FT                   GGFHGWAQLIADGIKFIQKEDVIPAAADRRVFALAPAVTLVPYLVVMVVIPIGPGLIGV
FT                   DLDAGLFFVLAVMGVGVLGSIMAGWASGNKFSLLGGIRSAAQLMSYELPLVLAASSVAM
FT                   AAGTLSLPGIVERWEWWWLPWQAIGAVVFFIAGLAELRRPPFDMPIAESELVMGPMTEY
FT                   TGLRFALFMLAEYAGIVVLSALTTVLFLGGWHGPLLPGPVWTLIKVFALAFVVIWVRVS
FT                   FPRLREDQLQRFAWTCLVPLALLQLALTGVVKIALG"
FT   gene            complement(364988..365854)
FT                   /locus_tag="Tbis_0319"
FT   CDS_pept        complement(364988..365854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GA26446 gene product from transcript GA26446-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87050"
FT                   /db_xref="GOA:D6Y3M1"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87050.1"
FT                   /translation="MLIRSTGHALGRPGAAGPSVRPRQATPLVRIVRGMHGYQGPPSYH
FT                   PHGREPYPPPPPWPPGPHPAVPYAAPPQRRARDTVLRIVWTLIPLFTCGVATPFMLAYA
FT                   AARLRSRALAAATAGYGAGLVIWITVAGHYPAIPFWADALAVTGWLATWLGGTVHAFAL
FT                   RRRLFGPRPNTGERANEEAVAKAMFRRMLREKARELAERDPSLARELRIGRPDLPREYD
FT                   DGGVVDVNHAPASVIATLPGMTPHLAEEVVRVRERLGRFVSAEDVAVAVNLSPHVVPEL
FT                   AEYTVYL"
FT   gene            365973..366677
FT                   /locus_tag="Tbis_0320"
FT   CDS_pept        365973..366677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0320"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ank:AnaeK_1272 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87051"
FT                   /db_xref="GOA:D6Y3M2"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M2"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADG87051.1"
FT                   /translation="MMVRVAHIPGEGLAKGLGVTLRHMLRKSDTQQYPEVKPDLPPRSR
FT                   GVIALVEENCTVCMLCARECPDWCIYIDSHKETLPAPEGGRPRVRNVLDRFAIDFSLCM
FT                   YCGICVEVCPFDALFWSPEFEYAEYDIRDLLHEKDRLREWAATVPPPPPLEAGAEPPKE
FT                   LAASRAPRPAARPAPAARPERRGEPGAAPGGARAAEAGTPPRRKPPMTMRDIRAIRPPG
FT                   SLPKREGPKEEP"
FT   gene            366674..367204
FT                   /locus_tag="Tbis_0321"
FT   CDS_pept        366674..367204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0321"
FT                   /product="NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase
FT                   chain 6; KEGG: aba:Acid345_1292 NADH-
FT                   ubiquinone/plastoquinone oxidoreductase, chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87052"
FT                   /db_xref="GOA:D6Y3M3"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M3"
FT                   /inference="protein motif:PFAM:PF00499"
FT                   /protein_id="ADG87052.1"
FT                   /translation="MTPGLWPPSGPEIVFLLLGLVALGSGVLVVTTKRLVHAALWLVVC
FT                   FGALAGCYLVLTAEFVAWVQVLIYVGAVVVLLLFGIMLTRAPTGRSEELDSGNRWAAAL
FT                   VALATAGVLVTVVISGFRDAYAPLEPGRGSAGEIGAGIFRTWVLPFEVLSLLLLAALIG
FT                   AIVISRTDITGRR"
FT   gene            367291..367632
FT                   /locus_tag="Tbis_0322"
FT   CDS_pept        367291..367632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0322"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   ank:AnaeK_4329 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87053"
FT                   /db_xref="GOA:D6Y3M4"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M4"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADG87053.1"
FT                   /translation="MHVVYPVVLSALLFSIGVYGVLARRNAILVMLSIELMLNAVNLNL
FT                   VAFDIWAGDRLHSGQALALFVIVIAAAEVGLGLAIVLAVFRTRKTIDVDRLRALSERER
FT                   ADDDAEART"
FT   gene            367629..369509
FT                   /locus_tag="Tbis_0323"
FT   CDS_pept        367629..369509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0323"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain L"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: mca:MCA1349 NADH dehydrogenase I, L subunit;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain L; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87054"
FT                   /db_xref="GOA:D6Y3M5"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M5"
FT                   /inference="protein motif:TFAM:TIGR01974"
FT                   /protein_id="ADG87054.1"
FT                   /translation="MTAVLALIPGLPFAAAVAGLLGSRWPRGRAGRPDPAARRRAAWFA
FT                   IAPLTGSAVLTLWLAGALSRGTRTSEGFWAALLPGRVAGAYPVIDTGSLPITLSLQADG
FT                   LSVLTGGLVVVIALAVQVYSVGYMRDDPRYPSYTAFISLFTSAMLLVVYAGDLILLYVG
FT                   WEVMGLCSYLLIGHWWEDRANSRAAIKAFLVTRLGDVGFLFGIFTLGTAAGSFRIDDVL
FT                   RAGIPEGTLILGTLLLLAGVAGKSAQVPLQTWLPDAMAGPTPISALIHAATMVAAGIFV
FT                   IARLYPLFLGAGPTLDALAVIAALGMLGAALAALAQDDLKRVLAYSTISQLAVMAAALA
FT                   AGSDQAAIFHLLTHGGFKALLFLCAGVVIHHAGSNLLGRMGGLRTALPITFVTMTIGFA
FT                   ALAGLPPASGFFSKDAVLTAIADGRGALRPVLFASALLTAGVTGAYATRAWLRAFFGPA
FT                   RAEPGAGHPPESGGEAPGSMLWPLVALAVPSLLFGFALPAFGGAVHGETAALGQAAALL
FT                   GIGAVWWAWRRDPEQDPARLLGPLRGVCERGFHVDAVYAALVTRPVLRLAGGVGRADVR
FT                   VIDRAVRGAGGTVTAVSRLVRLAQTGNAQLYLTGLLAGALLIAVAAVMSG"
FT   sig_peptide     367629..367685
FT                   /locus_tag="Tbis_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.588 at
FT                   residue 19"
FT   gene            369506..371113
FT                   /locus_tag="Tbis_0324"
FT   CDS_pept        369506..371113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0324"
FT                   /product="proton-translocating NADH-quinone oxidoreductase,
FT                   chain M"
FT                   /EC_number="1.6.99.5"
FT                   /note="KEGG: sme:SMa1536 NuoM2 NADH-
FT                   ubiquinone/plastoquinone (complex I) oxidoreductase;
FT                   TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
FT                   chain M; PFAM: NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87055"
FT                   /db_xref="GOA:D6Y3M6"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M6"
FT                   /inference="protein motif:TFAM:TIGR01972"
FT                   /protein_id="ADG87055.1"
FT                   /translation="MNWLLILLPALPLAGAAALATPAFRGRTGIGWGTGVSGLVLAGAV
FT                   AVAAAFDHRDAGRVQFEVDLPWVPALGVRFHLGVDGISLPLVVLTALLTFLCFVHLARH
FT                   RPEAGRPRALAFALLVLEVGMMGTFLALDLLLFFVFFEVVLVPMYFVIAIWGGDGRRAA
FT                   AVKFILYTLLGSALLLIGLLVVALQAGTLDMTALAERRGAGIPRAAQVVAFLAIGLGLA
FT                   VKTPMWPLHTWLPDAHTEAPTVGSVLLAGVLLKMGSYGFARIAIPALPEGAAAWAPWLG
FT                   AFAAIGIVYGALACLAQRDLKRLIAFSSVGHMGFVLLGLATLTPVGMNAALFGNIAHGL
FT                   ITGLLFFLAGAVKERYGTSDIARIGGGLLGRLPYLGSLLTFAGIASLGLPGLAGFWGEM
FT                   LALLGAFRPADALPRPLFLVFMVAGGVGAVLTAAYFLRMLSFVTHGRAIETVPVGPQLA
FT                   AVEERAGAAPPGEPPGAAAGPAGGRAFRRGRPADVTGHELAAWTPLVVLIVLLGLVPAI
FT                   LLSVTTPAVLAALTGVVP"
FT   sig_peptide     369506..369568
FT                   /locus_tag="Tbis_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.834 at
FT                   residue 21"
FT   gene            371110..372675
FT                   /locus_tag="Tbis_0325"
FT   CDS_pept        371110..372675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0325"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: gbm:Gbem_3913 proton-translocating NADH- quinone
FT                   oxidoreductase, chain N"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87056"
FT                   /db_xref="GOA:D6Y3M7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M7"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADG87056.1"
FT                   /translation="MILTLAVPPFASGPGGVIQSIDFAAIAVPLILACAAGLVLLLDAF
FT                   LPDRPGSGRAVGLVALGGVLAALAATAVQGAQGVERRTFCVPASLAADGAPPPCSFVAD
FT                   RFTLVFAAVVLAAGVVVVLLSMAELATGRVPVGEWYFLLLATLTGAVLLPASRDLITLV
FT                   VALEVVSLPVFALTALRRYDGRATEAALKLFLFSVVATAVTLFGASLLYGVTGSVFLDR
FT                   IALAQAGPGSPVTTVAIMLMLAGFAFKAAAVPFHSWAGDVYRGAPIPVAALLSVVSKAA
FT                   GFAGLILLLTTALGGRAATWAPVIAVVAALTMTVGNVLALRQRDAIRLLAWSSVAQSGY
FT                   ILAPLAAVPGPGGATAPGEPASAGSPVIGPAAGASIAYLIFYAAMNLIAFAVVMTVARR
FT                   EDGAELDGYRGLVRRSPVLGLGLAFSLISLAGLPPGLAGLFAKIVVFRAVLDGGLGWLA
FT                   VVVAVNTVIGLAYYLAWTARLFAPAAPEPGRTGPVPALVAVGLTVAVTLAFSVVPQAVL
FT                   ALAG"
FT   gene            372745..373593
FT                   /locus_tag="Tbis_0326"
FT   CDS_pept        372745..373593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0326"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: gbm:Gbem_3280
FT                   peptidase M48 Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87057"
FT                   /db_xref="GOA:D6Y3M8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M8"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADG87057.1"
FT                   /translation="MHHNGLRTAVLLGALSALLLAVGGWIGGGAGVRIAFVAALAVNGF
FT                   AYFFSDRIALSAMRARPVSEVEQPVLYRIVRSLSTEARRPMPRLYLSPTMQPNAFATGR
FT                   NPRNAAVCVTYGLLALLDERELRAVIGHELAHVYNRDILLSSVAGALATMITYVAQLGV
FT                   FFGSDDDETPGFFGTLLVMILGPVAATMIQLAISRSREFAADDLGARLTGDPLALASAL
FT                   RKIELGVRRIPLPENGRLASASHMMIANPFRGDGLGRLFSTHPPTAERIARLERMAGYR
FT                   R"
FT   sig_peptide     372745..372810
FT                   /locus_tag="Tbis_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.393 at
FT                   residue 22"
FT   gene            complement(373937..374677)
FT                   /locus_tag="Tbis_0327"
FT   CDS_pept        complement(373937..374677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0327"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: acr:Acry_0685 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87058"
FT                   /db_xref="GOA:D6Y3M9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3M9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87058.1"
FT                   /translation="MSTVEIRNVHKSFGDLEVLRGIDFSVESGQVVCIIGPSGSGKSTL
FT                   LRCVNLLEQPTSGQVFVDGIELTDPDVDIDAARRRIGMVFQQFNLFPHLTVMRNITIAQ
FT                   ERVLKRSRAEAERIATENLKKVGLLEKAKAYPAQLSGGQQQRVAIARALAMNPSLMLFD
FT                   EPTSALDPELVGEVLSVMRQLAQDGMTMLVVTHEMSFAREVADRVVFMDHGVIVEDGPP
FT                   EQVIGNPKHERTREFLRRVLNPVG"
FT   gene            complement(374674..375507)
FT                   /locus_tag="Tbis_0328"
FT   CDS_pept        complement(374674..375507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0328"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: acr:Acry_0684 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87059"
FT                   /db_xref="GOA:D6Y3N0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N0"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADG87059.1"
FT                   /translation="MSSVTEQQQALRPRGGLSPRKKQRISRGIQYAVLVIVVVVLAAIA
FT                   DWPAISQSFLNMDVAREGLPELFTVALKNTVIYTITGYAFGFVLGLVLALMRLSSVGPY
FT                   RWIAATYIEIFRGLPALVIFLMIINLPLAFPGFRLPGDVYGQAALGLGLVSAAYMAETF
FT                   RAGLQAVPKGQMEAARSLGMPYMRAMVSIIIPQAVRIVIPPLTNELVLLFKDSSLVLFL
FT                   GVTASQAELAKFGNDEAATFANPTPIFVAGVTYLLITVPLGYLARRLEARQGGGR"
FT   gene            complement(375504..376352)
FT                   /locus_tag="Tbis_0329"
FT   CDS_pept        complement(375504..376352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0329"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: acr:Acry_0683
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87060"
FT                   /db_xref="GOA:D6Y3N1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N1"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADG87060.1"
FT                   /translation="MAPWSTYRRVAGIGATALITALMVAACGGGGDTTASSPSEAASAA
FT                   GGVKLVNPGKLTTCTNIPYEPFQFQQGDKIVGFDVDIVDLVANKLGVQQEIVDIDFAAI
FT                   KSGAALNAGKCDVAAAGMTITEERKQNLDFSVPYFDASQALMAKKGSGVTSLDDVKAKG
FT                   LKLGAQASTTGLDYVKSQGFEPIEFADSQKQLNGLQAGRVDVIVQDLPVVLTWLKKPEI
FT                   SAEYEMVGSLDTGEQYGIGLKKGNTELLNVVNEVINQAKADGTYATIYKKWFGTEPPSN
FT                   S"
FT   sig_peptide     complement(376272..376352)
FT                   /locus_tag="Tbis_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.410 at
FT                   residue 27"
FT   gene            complement(376714..377235)
FT                   /locus_tag="Tbis_0330"
FT   CDS_pept        complement(376714..377235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0330"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: scl:sce6390 MarR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87061"
FT                   /db_xref="GOA:D6Y3N2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADG87061.1"
FT                   /translation="MPEHDTGDYAAFCAVEHQLGILFRRAQALSARMRSKVHPELEPGA
FT                   YGLLSSIDRNAPIRPSDLAACLGVGKATISRQVKVLEELGLVGREPDPLDRRAHRLVLT
FT                   PQGRQLLDRVRTARQQQLYSLLSSWPTEDVWLLARMLERFNALTERALLAEPAPGQEHA
FT                   EPDQARISPG"
FT   gene            complement(377448..379163)
FT                   /locus_tag="Tbis_0331"
FT   CDS_pept        complement(377448..379163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0331"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_2480 EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87062"
FT                   /db_xref="GOA:D6Y3N3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N3"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADG87062.1"
FT                   /translation="MSHRQVLEALSGLLVAMFVAILSGTIVANALPTIAAELHADETVY
FT                   TWIITTTLLAVTVSTPLWGKLADLFNKKLLIQLSLVIFICGSMFAALTQNVGMLITARA
FT                   VQGIGVGGLTALSQVIMAAMIPPRERGRYSGYLGAVFAVGTVGGPLIGGVIVDTPWLGW
FT                   RWCFCVGVPFSLIAMLVLQRTLRLPTTKRAVKVDWLGALLITAAVSLLLIWVSFAGHDY
FT                   DWLSWQTAAMVGGSLVLGALFVLAERTAKEPILPLRLFAVRTISLSSFASLFIGAAMFG
FT                   SSTFLVQYFQLARGETPTVAGLLTLPMIIGLALSSTISGRIITRTGRWKGFLVAGAITL
FT                   AAGMGLMGTMRYDTAYWVLALFMFCTGVGVGMTQQNLVLAVQNQVRLADLGAASSLVAF
FT                   LRSMGGAVGVSVLGAVLSHRVGGYLREGLAALGVKAGATAMDGSIPDLSALPAPIRTVV
FT                   QSAFGHAIADLFLFSAPAVLVALLAIFLIKEVPLRTTIAHTAEREPAPSTNGFRPGNGA
FT                   QATAQPASADGIGPADGARPADGSRPANGTRPGSADGTGPGHHGEVTQGERRGR"
FT   sig_peptide     complement(379071..379163)
FT                   /locus_tag="Tbis_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.423 at
FT                   residue 31"
FT   gene            complement(380147..380638)
FT                   /locus_tag="Tbis_0332"
FT   CDS_pept        complement(380147..380638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0332"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   bha:BH2387 nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87063"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N4"
FT                   /inference="protein motif:PFAM:PF04461"
FT                   /protein_id="ADG87063.1"
FT                   /translation="MAEHSFDIVSKIDRQEVDNALNQAAKEIAHRFDFRGTGASVSWSG
FT                   KKEIEIKANSEERVKAALEVLKEKLIKRGQSLKILDAGEPKLSGKEYRLMVGLKEGIDQ
FT                   EHAKKISKIIRDEGPKGVKAQIQGDELRVSSKKKDDLQAVIALLKGKDLDIALQFTNYR
FT                   "
FT   gene            381051..381135
FT                   /locus_tag="Tbis_R0008"
FT                   /note="tRNA-Tyr1"
FT   tRNA            381051..381135
FT                   /locus_tag="Tbis_R0008"
FT                   /product="tRNA-Tyr"
FT   gene            382067..382399
FT                   /locus_tag="Tbis_0333"
FT   CDS_pept        382067..382399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0333"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   dvu:DVU0989 periplasmic divalent cation tolerance protein
FT                   CutA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87064"
FT                   /db_xref="GOA:D6Y3N5"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N5"
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /protein_id="ADG87064.1"
FT                   /translation="MGNEIEVRVTTSKRQEADQIVTAVVARRLAASAQVVAQVSSTYWW
FT                   EGEVQQAEEWLLLMKTTADRFDDLAACVRELHSYQVPQIVAVPIVRGTPDYLEWIRRET
FT                   DPGRGE"
FT   gene            complement(382365..383792)
FT                   /locus_tag="Tbis_0334"
FT   CDS_pept        complement(382365..383792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87065"
FT                   /db_xref="GOA:D6Y3N6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87065.1"
FT                   /translation="MLDALQKRNIGQVFRLIRQYAGVSQTRIGIAVNLSQGKVSEIMRG
FT                   SAQVTALDVFERIADGLRMPDSARLALGLAPRSPGRGQIIEAVLSRRAISSRDGAPAGQ
FT                   LLSVEGVLFGSRPSDDLWDVDLLTLAWVVGRLDSQMDRRTMLLLAAGMTVDTAASMADP
FT                   WKRLSRALRGPQMLDEETIERLEARTIGFHRLESVLPARAIYQGLTTHINELSTLLQSG
FT                   PPERYRRRLAATAGEAATLASWIAWDLKQPTQSAAFERVAALAAKESGHHIIQACTYAY
FT                   RSYAVTGPEAVEHIRRAQQFLPAEGDDATRAWLLAREAEELAALGDGQAVELLQRAEEA
FT                   HNQARPHRERAWTRFLDSGRMAAFQLSTYVRLGDEQRVTEASQAALAALGPDQDRKRVS
FT                   VVYADIAQAQLQLGDITEGVAYARRALEAAQRTESSWGMRHLAKIEKALAARPDQAARE
FT                   LLGDLRATRRALGQSPA"
FT   gene            384254..384499
FT                   /locus_tag="Tbis_0335"
FT   CDS_pept        384254..384499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87066"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87066.1"
FT                   /translation="MAADVHEGFGLALVSVWVDLVVWTDGRWFRWRSGRTSTSGRPVYA
FT                   FAPASDVVTAARRVAHRYGQLRQQYPPPPWLAGGSS"
FT   gene            384496..384789
FT                   /locus_tag="Tbis_0336"
FT   CDS_pept        384496..384789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87067"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87067.1"
FT                   /translation="MNVLDEPDRLHGAHVPIRRGSVRQLQWWEPTPAERVRVLAWTCDC
FT                   QARFYELCQSGGMVYIRRTVQKDPEPEISETHRWPVQEGWRVWFDLLTGEVR"
FT   gene            complement(384873..385190)
FT                   /locus_tag="Tbis_0337"
FT   CDS_pept        complement(384873..385190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0337"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: acr:Acry_1750 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87068"
FT                   /db_xref="GOA:D6Y3N9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3N9"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ADG87068.1"
FT                   /translation="MDFAPPKYARVIAAIQQRIRDGEYAPGDMLPSETQLVREFGVGRT
FT                   TVVRALQTLAMQGWIEREHGRGSFVKGRPPEPPADRARPLGVLGRSVLKRHQGPAINML
FT                   V"
FT   gene            complement(385288..385632)
FT                   /locus_tag="Tbis_0338"
FT   CDS_pept        complement(385288..385632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87069"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87069.1"
FT                   /translation="MSGTTTTAAQTTGTTKSSKSAVPRVPCPAVHLPWREGAEELAWHE
FT                   SRRFARVRVVAWTCHEHRTTWYELCEAGGLAFIRRHDGRQAKPRVRESHAWPLAEARTM
FT                   WVALLSGQVR"
FT   gene            complement(385629..385985)
FT                   /locus_tag="Tbis_0339"
FT   CDS_pept        complement(385629..385985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87070"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87070.1"
FT                   /translation="MTRRGHVAAALGLATSSREECLYCEGGELLAEMFDWEIFIPVDGV
FT                   DQLGPCGTSAWQATSMDALRAALRRMDPAAKPWGRIIHRFYDFGVLPDEWSRRVIFHAT
FT                   LDPAGSVRFERVGP"
FT   gene            386122..387378
FT                   /locus_tag="Tbis_0340"
FT   CDS_pept        386122..387378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0340"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: acr:Acry_1350
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87071"
FT                   /db_xref="GOA:D6Y3P2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P2"
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /protein_id="ADG87071.1"
FT                   /translation="MHDHLKAKRRSEGMHGNAFEPIHIPIWVWGREETRQILKKRDMAG
FT                   LFNIALKYAGASQVRISAATGIAQGRISQIMRGQRQVTDLEVLERIATGLGLPDHARML
FT                   LGLAPLDLAFPTDDHDEEHRQQAEELRTRIEAAATVDATTVQILATDTNNLRLLDRRLG
FT                   GLAIADKMRAQISQIERVHRHAVRPGIRAQLAHVLSETAALAGWQALDRCALADAWDYH
FT                   ETAISAAREADDPALLAYARGQQAYVLIDLGRPAEAAELLHHVRHTYDRRVPGHLRTWL
FT                   AAAEAEAAAILGDEATTRTALDQAATLLPKEDADPSLPYVALNAHHLARWRGNCLVRFG
FT                   DPETIEDLRSALAGMDGTFNRAEAGLRCDLAHALLARGEAEAAQPHLYRAEHLAMMIGS
FT                   RRHGRRIAELKRAVTRALR"
FT   gene            complement(387359..387919)
FT                   /locus_tag="Tbis_0341"
FT   CDS_pept        complement(387359..387919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0341"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: kpe:KPK_0067 putative
FT                   ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87072"
FT                   /db_xref="GOA:D6Y3P3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P3"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADG87072.1"
FT                   /translation="MATNEERSRWVVHGERLIYDNRWIRLGLVDVEIPGGERFEHHAVH
FT                   LGRAAMTVLVDDRDRVLMLWRHRFLFDRWGWELPGGLVEVGEDPMETAVREVVEETGYR
FT                   PVEIEHLITFQPMVGMVDSEHIVFLGRGAELIGEPTGEVEADLIEWIPLKALPDMIARG
FT                   DIWNSGSLVGLLYARERLNGARG"
FT   gene            388137..390849
FT                   /pseudo
FT                   /locus_tag="Tbis_0342"
FT   gene            391689..393137
FT                   /locus_tag="Tbis_0343"
FT   CDS_pept        391689..393137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0343"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sus:Acid_2490
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87073"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P4"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ADG87073.1"
FT                   /translation="MPKCPKIVGLLMLGTALSSGTMPVGTPAAASTGGAAVTGLGSAHR
FT                   AARAGGHDDPRDGQWQSVRARERQQQNLLRDVTLALTPMQQSETDSRALPYNRQKTDAM
FT                   TESYSDQRGLSDITSRASGDQKNSPDTNPPVTAWAPSDNAAGAAMLAYLRDLAARNRFT
FT                   GSALVVRRGRVLARFAAGWADEEKRIPNRPDTVYRVMSITKQFTSMLVLKLRDRGLLEL
FT                   DDPICPYLVPKYLKTCPAAWRPITIRMTLTHTSGIPNIETLPGYLANVTRPTTVRKLIR
FT                   QFVNLPLDFKPGTSWKYTNSGYVLAGAIIQAVTHKPYGVVLRKLITKPLKLRHTGYSRT
FT                   YPPRGYAKGYVKPGSPAPLLNGSELFSATGLYTTVDDIVRWDRAFGSYTVAPPATVKQA
FT                   FTPQAKCPPNGCLNLPSSAYAFGWLVDRLQGHRLRYHPGLFMGYTAMNMYLPDDDIQVV
FT                   VLSNVQDTDTAGIARHLATLALDL"
FT   sig_peptide     391689..391781
FT                   /locus_tag="Tbis_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.819 at
FT                   residue 31"
FT   gene            complement(393268..393801)
FT                   /locus_tag="Tbis_0344"
FT   CDS_pept        complement(393268..393801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0344"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sus:Acid_4614 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87074"
FT                   /db_xref="GOA:D6Y3P5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADG87074.1"
FT                   /translation="MSDSSDEPGAPSGILIRPMRETDAAQVLAIYQAGLDGGNAGFETT
FT                   APTWEAFDAAKLPRHRYVAADTASGQVVGWVAASAVSDRCVYAGVVEDSVYVHPDHGGR
FT                   GIGLALLNALIRSTEAEGIWTIQAGVFPENTASLRLHEKAGFRVVGTRHRIGRHHGRWR
FT                   DVILLERRSTVTGL"
FT   gene            complement(393843..394226)
FT                   /locus_tag="Tbis_0345"
FT   CDS_pept        complement(393843..394226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0345"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: maq:Maqu_3638 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87075"
FT                   /db_xref="GOA:D6Y3P6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P6"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADG87075.1"
FT                   /translation="MSNQALSATDAYGDTPTTACCTPLACKPLSESEAAELAPLFKALA
FT                   DPVRLRLLSLIACHEAGETCVCDLTAAFDLTPPTISHHLRVLKQAGLIDSERRGTWVFY
FT                   WIKPEVLARMASLLSPAAPARTA"
FT   gene            394345..394782
FT                   /locus_tag="Tbis_0346"
FT   CDS_pept        394345..394782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0346"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: scl:sce5616 lactoylglutathione
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87076"
FT                   /db_xref="GOA:D6Y3P7"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADG87076.1"
FT                   /translation="MPRVQLALRVPDLEGSIEFYSKLFGVEPAKRRPGYVNFAIAEPPL
FT                   KLVLIQGEEGEPTRMDHLGVEVEDVAQVTAATERLKAAGLATLEEKDVACCYAVQDKVW
FT                   VRGPGNEPWEVYVVKADADTLTKQGGSACCAGDAGQETVSG"
FT   gene            complement(394945..395580)
FT                   /locus_tag="Tbis_0347"
FT   CDS_pept        complement(394945..395580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0347"
FT                   /product="cadmium resistance transporter"
FT                   /note="PFAM: cadmium resistance transporter; KEGG:
FT                   quaternary amine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87077"
FT                   /db_xref="GOA:D6Y3P8"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P8"
FT                   /inference="protein motif:PFAM:PF03596"
FT                   /protein_id="ADG87077.1"
FT                   /translation="MDGILGTVGTAGAVFAGTNVDDIVILTVLFLSARAHGLPRPWQII
FT                   AGQYTGIAVTVVVSVIAALGLAILPDPWVGLVGSLPLAMGVRGLIEAVRAKDPADGSPP
FT                   AVASGLLSVASITVANGADNISVYTPVFRTIGVSASLITIAVFAVLVAVWCLIGSWLGS
FT                   HKKIIEFVERYGRWLVPLVFIAIGLVIVLESGVISLLADLVRHLLEPV"
FT   gene            complement(395740..395871)
FT                   /locus_tag="Tbis_0348"
FT   CDS_pept        complement(395740..395871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87078"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87078.1"
FT                   /translation="MPKASGGAVLEGVASARLPGEHANSGSLIGLRYARERLVGAGG"
FT   gene            396100..396936
FT                   /locus_tag="Tbis_0349"
FT   CDS_pept        396100..396936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0349"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pap:PSPA7_0575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87079"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87079.1"
FT                   /translation="MRVTFASEPATPAHPNEDFVGATADAAVLLDGASAPAGVTSGCSH
FT                   GVRWYSHTLGALLLAELTESTEPLPEILARGIERVTSLHQDTCDLSRGDSPSATVVMLR
FT                   RTGDRVDWLVLCDSVLLLDTGAAEPTVVCDDRLNHLLKPSRDRVRALEPGTPEHAEAMR
FT                   EHVALVNECRNRDGGFWVASTDPRAAEEALTGSVPAEKVRAVALLSDGASRLVDRFHLA
FT                   TWREVVGMVDRYGPAELIRRVRRAERSDPDGKRWPRGKPSDDASAVYCTHLNGHRP"
FT   gene            397308..400376
FT                   /locus_tag="Tbis_0350"
FT   CDS_pept        397308..400376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce6752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87080"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR031924"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q1"
FT                   /inference="similar to AA sequence:KEGG:sce6752"
FT                   /protein_id="ADG87080.1"
FT                   /translation="MVTVTHSSGSDLQRIGSYIAAEPGPGRFPLVAGGKAAPLVVASAD
FT                   HRGVLRVVNDLQADIERVTGVRPAVVHDRVPDADEVVLIGTIGASPLIDRLIAEGRLDV
FT                   TGIAGRWETSLEQVIEDPLPGVRRAFVIAGSDQRGTIFGAYDVSREIGVSPWYWWADVP
FT                   VPHRDELYVLPGRHTQGTPKVKYRGFFINDENPALGTWAPAYFGPGYAPGHPGGFTSRF
FT                   YAKVYELMLRLKANYLWPAVWGRAFAEDDPDNHRVAAEYGVVIGTSHEAPMMRGIEEWN
FT                   RHAVPAQRDEAGYIVVPGHDPYDGTGEWSFRRNGEAIKRYWADGIRRMREEGFEGVVTL
FT                   GMRGNGDLSLPDGDGIDLMESILAAQREILARESGRDVTTIPQVFTLYKEVQRYWDKGL
FT                   RPPDDVTVIFCDDNWGNLRKVPDPKFPARSGGYGLYYHFDYVGDGRNYKWVDTVNLANT
FT                   WEQLHLAYRYGIDRLWVVNVGDLKGEELPLQFFLDYAWDPDRWPLERLGEWRRRYAAQN
FT                   FGPEHADEIAEILDRYGRLQSRRKPELTNRRITVDPAKDLATDPGAVVYDDEASPFRLT
FT                   AYREMDRVTAEWRRLAERAERVRAALPKEYDDAYYELVYYQVKATANLYELRRAQFLNR
FT                   HYAEQGRAAANDLADLAEERFAEDQAMSDYYNNELAGGKWRGFQTQPKIGYGDVARYGP
FT                   DAGWQQPERDNEALPDAIYPPLRRIELPEKAELGVAVDGSDSWWPHETSPATLPVFSPY
FT                   QTQPPQYIEVFNRGTVPFEYTIEPAVPWVTVTPAAGRVEKEVRAVVEVDWSRAPVGRTE
FT                   VPITISGAGTTVEVLAIVDNPALPRREFRGHVEANGYVAIEADHYTRAVNTDGITWTLI
FT                   PGIGRTGNGMTPFPVTAGRRTPGGDGPRLEYTVTLFTAGEVRVTAYLSPRNNVFATDGL
FT                   AYAISIDDAEPQIVNITKATGADDTAMNRQWQRNTSDNINVTTTVHTVGAPGVHTLKFW
FT                   MVDPTVVVQRLVVDTGGLLDSYLGPPESLRVAS"
FT   gene            complement(400337..400441)
FT                   /locus_tag="Tbis_0351"
FT   CDS_pept        complement(400337..400441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87081"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87081.1"
FT                   /translation="MEAAAGDRLPREEAVTVAAVAGYDATRRLSGGPR"
FT   gene            complement(400569..401750)
FT                   /locus_tag="Tbis_0352"
FT   CDS_pept        complement(400569..401750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0352"
FT                   /product="glycoside hydrolase family 12"
FT                   /note="PFAM: glycoside hydrolase family 12; cellulose-
FT                   binding family II; SMART: cellulose-binding family II;
FT                   KEGG: endoglucanase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87082"
FT                   /db_xref="GOA:D6Y3Q3"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002594"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q3"
FT                   /inference="protein motif:PFAM:PF01670"
FT                   /protein_id="ADG87082.1"
FT                   /translation="MRPAAAPVMVHAMSMRRFLAGLTVLGSVAASLVIATSAAQADTVI
FT                   CEKWGTTTIQGGKYVVQNNNWGSDIQQCITVTDTGFTVSQANHNKPTNGAPGAYPSVFA
FT                   GCHYGTCSSGSRLPMQATDSLFDTIRTSVRMTYPSSGVYNASYDLWFDPTPRTDGQNTG
FT                   AEIMVWLNRVGSIQPIGSRVDTVNLAGATWEVWYGNTGWNVISYVRTTPVDSISFAVRE
FT                   FFDDAVRRGYAQRSWYLTSVQAGFEPWVGGTGLTVNEFSYSVGGSDPTEPSPPVTTSPP
FT                   ASPPPGGAACRVAYRKNEWLGGFTADVTVTNTGSSAINGWNLTFTFPSGQRVTNGWNAT
FT                   ISQSGATVTAQNMSYNASIPPGGSVSFGFQGTWTGSNGDPADFTLNGTRCQTA"
FT   sig_peptide     complement(401625..401750)
FT                   /locus_tag="Tbis_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.953 at
FT                   residue 42"
FT   gene            complement(401994..402341)
FT                   /locus_tag="Tbis_0353"
FT   CDS_pept        complement(401994..402341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0353"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   swp:swp_1613 anti-anti-sigma factor family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87083"
FT                   /db_xref="GOA:D6Y3Q4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q4"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ADG87083.1"
FT                   /translation="MVTWTIHTPGSTQWTVLSLRGELDLYAVDELRRPVLTAIAAHGPW
FT                   LAVDLTAVNFIDTTGLGMLVRLLNKLREKNGDLALIGPRGQVKRILQWTNLNRLFPVFD
FT                   SAAAIPEPARN"
FT   gene            402853..403062
FT                   /locus_tag="Tbis_0354"
FT   CDS_pept        402853..403062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87084"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87084.1"
FT                   /translation="MRSRWIGPDGYEIVPARIGGRQVLRVQRYGDFVADCLSVEEVAQY
FT                   VDLADLCEVIPLPVRRDDTQTAVR"
FT   gene            403125..403571
FT                   /locus_tag="Tbis_0355"
FT   CDS_pept        403125..403571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87085"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87085.1"
FT                   /translation="MRLPLTACLMYRATLAVSMLGLGLTACASHRETPTTARPQVYVLN
FT                   FYGAEEGRAEQRPRDLVLSEFTTINAVTWQSWGPTRAVGRGKLSGMWCLPECGDAPYDA
FT                   TVTLGAVVPVRGKGYFSRYAVTARLPDDQRKRADLTGRLPIPGE"
FT   sig_peptide     403125..403211
FT                   /locus_tag="Tbis_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.813) with cleavage site probability 0.611 at
FT                   residue 29"
FT   gene            403658..403730
FT                   /locus_tag="Tbis_R0009"
FT                   /note="tRNA-Thr1"
FT   tRNA            403658..403730
FT                   /locus_tag="Tbis_R0009"
FT                   /product="tRNA-Thr"
FT   gene            403886..403961
FT                   /locus_tag="Tbis_R0010"
FT                   /note="tRNA-Met1"
FT   tRNA            403886..403961
FT                   /locus_tag="Tbis_R0010"
FT                   /product="tRNA-Met"
FT   gene            404041..404205
FT                   /locus_tag="Tbis_0356"
FT   CDS_pept        404041..404205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0356"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: bcy:Bcer98_3067 50S ribosomal protein
FT                   L33"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87086"
FT                   /db_xref="GOA:D6Y3Q7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q7"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADG87086.1"
FT                   /translation="MASTDVRPKITLACQECKHRNYITRKNRRNDPDRLELKKYCPNCK
FT                   THRVHRETR"
FT   gene            404593..405042
FT                   /locus_tag="Tbis_0357"
FT   CDS_pept        404593..405042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0357"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mxa:MXAN_4673 MaoC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87087"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q8"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADG87087.1"
FT                   /translation="MALNRDFIGRSGKSSAPYEVSRVKIKEFAEAIGDMNPIYHDREAA
FT                   IAAGHPDVVAPPTFPIVFSLAEAGKVLSDPELGLNYAMVVHGEQRFEYDRPIYAGDRLL
FT                   TTTTITEIRSVGRNEFVTLRSDITTVDGEPVCRAYCMLVEREGAA"
FT   gene            405045..405473
FT                   /locus_tag="Tbis_0358"
FT   CDS_pept        405045..405473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0358"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mxa:MXAN_4672 MaoC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87088"
FT                   /db_xref="GOA:D6Y3Q9"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3Q9"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADG87088.1"
FT                   /translation="MTAKVKYDEVEVGQEIPAAGYRVRRLDLVKYAGASGDFNPIHWNE
FT                   RYAKSVGLPDVIAHGMYTMAQGGRFLTDWAGDPAAVVEYGVRFSSMVVVPDDEEGATVT
FT                   VSGRIEEKLPDNRVVVALTATSNGSRVLSKARAVVRLA"
FT   gene            405548..406597
FT                   /locus_tag="Tbis_0359"
FT   CDS_pept        405548..406597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0359"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.1.1.158"
FT                   /note="KEGG: scl:sce7823 UDP-N-acetylmuramate
FT                   dehydrogenase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase domain protein; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87089"
FT                   /db_xref="GOA:D6Y3R0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3R0"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ADG87089.1"
FT                   /translation="MTDRLAGVRLAPYTTLRVGGPARAFAEAGSAEELIGLVAGADRDG
FT                   EPVLVLGGGSNLVVADEGFAGLVVRVRSRGVAVSAEGERVVVTAEAGEDWDALVARCVA
FT                   EGLAGIECLSGIPGLAGATPIQNVGAYGQEVAQTITSVRVYDRRAGATTVLTPEECRFG
FT                   YRHSLFKEDPGRYVVLSVSYALTRSRLSTPIAYRELAAALGVEQGERAPLAEVRAAVLE
FT                   LRRRKGMVLDPGDPDTRSAGSFFTNPILTREQAAELELRAPGFPRWDMPDGTVKVPAAW
FT                   LIENAGFPKGYARGRARISTKHTLAITNPSGEATAREVLALAREIRAGVQEKFGVELVN
FT                   EPVMVGISL"
FT   gene            406843..407400
FT                   /locus_tag="Tbis_0360"
FT   CDS_pept        406843..407400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0360"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   sat:SYN_01349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87090"
FT                   /db_xref="GOA:D6Y3R1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3R1"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ADG87090.1"
FT                   /translation="MQAFWTSLAVIFVAELGDKSQLMAMTFATRFRALTVLTGITLATL
FT                   LVHLVSVVFGRAVGDALPEGLISVIAGLAFLGFALWTLRGDELSEEEKSKAATVTRNAL
FT                   IAVTVAFFLSELGDKTMLATITLATQHGWFGTWIGSTLGMVAADAVAILVGRYLGTALP
FT                   EKWIKYGAAAAFAVFGVLLLIG"
FT   gene            complement(407496..410417)
FT                   /locus_tag="Tbis_0361"
FT   CDS_pept        complement(407496..410417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0361"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; TPR repeat-
FT                   containing protein; Tetratricopeptide TPR_4; Bacterio-
FT                   opsin activator HTH domain protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: regulatory protein LuxR;
FT                   Tetratricopeptide domain protein; KEGG: rle:pRL120769
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87091"
FT                   /db_xref="GOA:D6Y3R2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y3R2"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADG87091.1"
FT                   /translation="MLVPMTRRPVSPAFVGRDAELESLRDAFDQARKRATTTVLIGGEA
FT                   GVGKTRLLARFAEEAGLDGAHVLIGGCVELSAEGLAYAPFIAVLRQLVRELSAAEVTAL
FT                   LPDGAARDLARLLPEFGEPNADGDTESARIRLFELILILVERLAERRPVLLAIEDVHWA
FT                   DRSSRDLIAFLSRNLTAAPVLMVLTYRSDELHRTHPLRPVLAELGRLGSVVRIELPRFT
FT                   RHEVALQVAGILGTTPEYDRVTTIFERSGGIPLFVEALLEAGEDCAVPESLHDLILRPV
FT                   DRLPERTQQVLRIAAAGGVRVGHDLLAAVSGLSDAELEDALRPAIAANVLQVADGRAYA
FT                   FRHALIREAVHDELLPGEHARLHARYAEEIGNDHALVPPGRAAFEIAHHWYAARNDLWA
FT                   LISAWEAAEAAHRSFAYTEQAQFLDRVLALWDKVPDAAERIGADHVGVLERAAEAAFVS
FT                   GDMERGLRYVKAALAELDEKTAPERVAELLVRRANINFQRGRPGALDDLRRAERLVPEP
FT                   SDTRTTVLLRLGYVLLLNGQVTEGTKATQEALEIARRKGDERNEADLVLNLSLGHWLAG
FT                   DLEQARVLDDRAISLGKRLNFPLVVLRALANKIDTLDNLGRSEEAVALADEGERLARQY
FT                   GRYRHQGVFIANNRAEALVSLGRWDEAVEVVERALAMDPAPRVRAHCLRVRTDIAIARG
FT                   EQDVARAGLAELRALTDVQAEGVQELANNTRLLICWHLLMGEPLRAIEVAERLFDAPLR
FT                   NKPLLAWRLSATIRYACEAAAAVAPERAAALRARVAELSYGDRPVEGHGPVCEAYRHVA
FT                   RGSFDTAAEMWRRLNRPYERALALVHAAQTVVASGDREGVAVRLREAHPIATQLGAAPL
FT                   AARIETLARRHQIPLGRPGTARAGSAGPGTAGAGSAGGVALTPREREVLRLVAAGRTNR
FT                   EIAAELFISAKTVSVHVSNILAKLGAATRGEAAAAAHRLSLLD"
FT   gene            complement(410570..410755)
FT                   /locus_tag="Tbis_0362"
FT   CDS_pept        complement(410570..410755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87092"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y438"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87092.1"
FT                   /translation="MFPELQYQLVLMHMDELRDEALGEARARKARRSRKRNEDEEAEPV
FT                   GRRRAPRIALRGRQWS"
FT   gene            411275..412216
FT                   /locus_tag="Tbis_0363"
FT   CDS_pept        411275..412216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0363"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: scl:sce5008 putative deoxyribose-phosphate
FT                   aldolase; TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate aldolase/phospho-2-
FT                   dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87093"
FT                   /db_xref="GOA:D6Y439"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y439"
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /protein_id="ADG87093.1"
FT                   /translation="MTAPLAEVAASNASLRAFLHGLPGVDRVGAEARAAMLGTRSIKTT
FT                   AKKHAIDLAIRMLDLTTLEGADTPGKVRAMCAKAVRPDPSDPDAPSVAAVCVYPDLVPV
FT                   AVAALQGTGVKVASVATAFPSGRSSLNVKVAETEYAVAAGASEVDMVIDRGAFLAGDYL
FT                   KVYEEIAAVKAACAGRAHLKVILETGELATYDNVRRASWLAMLAGADFIKTSTGKVSPA
FT                   ATPAVTLIMLEAVRGYLKATGRRVGVKPAGGIRTTKDAIKYLVLVNETAGPDWLDPEWF
FT                   RLGASSLLNDLLMQRQKLATGRYAGPDYFTLD"
FT   gene            412221..413657
FT                   /locus_tag="Tbis_0364"
FT   CDS_pept        412221..413657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0364"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: scl:sce5007
FT                   putative aldehyde dehydrogenase (NAD(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87094"
FT                   /db_xref="GOA:D6Y440"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y440"
FT                   /inference="protein motif:PRIAM:1.2.1.8"
FT                   /protein_id="ADG87094.1"
FT                   /translation="MFEYAPAPESRDIVDIQPSYGLFINGEWVEPHSEERHPTVNPATE
FT                   EPLSEIAWADEADVDRAVETARKAFVTWSAMRGAERAKYLFRIARIIQERARELAVLET
FT                   LDNGKPIRESRDVDLPLVAAHFFYYAGWADKLAYAGLGRPGREPRPIGVAGQVIPWNFP
FT                   LLMLAWKVAPALACGNTVVLKPAETTPLTALAFADICRQADLPPGVVNIVTGAGETGAA
FT                   LVRHPGVDKVAFTGSTEVGKLIAKAVAGTGKRLTLELGGKAANIVFDDAPIDQAVEGIV
FT                   NGIFFNQGHVCCAGSRLLVQESIADELIEALKRRIALLRVGDPLDKNTDIGAINSAEQL
FT                   AKIRELAESGEAEGAERWSPPCTLPDRGYWFPPTVFTNVAQSHRIAREEIFGPVLSVLT
FT                   FRTPAEAVEKANNTPYGLSAGVWTEKGSLMLWMASRLRAGVVWSNTYNRFDPASPFGGY
FT                   KESGYGREGGRHGLEEYLAL"
FT   gene            413828..414694
FT                   /locus_tag="Tbis_0365"
FT   CDS_pept        413828..414694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0365"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: scl:sce5006
FT                   putative aldehyde dehydrogenase (NAD(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87095"
FT                   /db_xref="GOA:D6Y441"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y441"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ADG87095.1"
FT                   /translation="MTERLAVRKTYKLFIGGAFPRSESGRSYVVHSSSGEFLANAAKAS
FT                   RKDARDAVVAARKAFPGWWGATPYNRGQIIYRAAEMLEGRRAQFAAETAALEGIDLERA
FT                   GELVDAAVDRLVWYAGWSDKIAAVLGSANPVAGPYFNLSSPEPAGVVAVIAPQTASLLA
FT                   LVSVIAPVIVTGNTCVVVAAERAPLPAITFAEVLATSDLPGGVVNILTGSTEELAPWLA
FT                   GHMDVNAIDLTGAGPELAVRCEELAAENLKRVLRPPAMPIDWSADPGIERMAAFLEIKT
FT                   VWHPMGA"
FT   gene            complement(414906..415484)
FT                   /locus_tag="Tbis_0366"
FT   CDS_pept        complement(414906..415484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87096"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y442"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87096.1"
FT                   /translation="MELAALQEQTRLLLRQKITVMVNQYTVHLAEPDGTPGPVVAFAEQ
FT                   KRLALKEQVTVYTDESRSRVLTGFKARTVVDFAGEYDVVDEAGKPIGKFWKRGMRSLLR
FT                   STWHLQQPGLPTLTGQERNPVVAVLRRFVDALSWLPYHFDFSIGASIAFSVDSRWGIRD
FT                   TYLINVRDPRLDRRLVIAMAIALDALEGR"
FT   gene            415692..415904
FT                   /locus_tag="Tbis_0367"
FT   CDS_pept        415692..415904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0367"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: hne:HNE_3296 phage
FT                   shock protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87097"
FT                   /db_xref="GOA:D6Y443"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y443"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ADG87097.1"
FT                   /translation="MVYRSREHKIIAGVCGGIAERFGMRPTTVRLLFLLSCILPGPQFV
FT                   IYLLLWILLPKAPPTYAPPYHGRHW"
FT   gene            416018..416656
FT                   /locus_tag="Tbis_0368"
FT   CDS_pept        416018..416656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0368"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="2.3.1.181"
FT                   /note="KEGG: aba:Acid345_4305 lipoate-protein ligase B;
FT                   TIGRFAM: lipoate-protein ligase B; PFAM: biotin/lipoate A/B
FT                   protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87098"
FT                   /db_xref="GOA:D6Y444"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y444"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ADG87098.1"
FT                   /translation="MFQPRPLALIQDDLVEYEKAMERMAAMVEERQKDERPDTLWLLSH
FT                   PPVFTVGKRTRAEHLPDPSFGIPVVPTNRGGQLTYHGPGQLVGYLIVRLRPGEGIVDYI
FT                   REVELRLVEALRRLGVPAERRDTPPGSELLTGVWTTNTNRKIVSIGMRSSRSVTSHGFA
FT                   LNVDGDLTPWTLAVPCGMPDVEMTSILRELGHASMEETRRVVAEVFEAS"
FT   gene            416753..417523
FT                   /locus_tag="Tbis_0369"
FT   CDS_pept        416753..417523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0369"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   ade:Adeh_0783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87099"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y445"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ADG87099.1"
FT                   /translation="MPILVGTSGWQYDSWSGLLYPGVPRRLWLERYAEAFATVENNNAF
FT                   YRLPKRETFEAWRERTPADFVMAVKASRFLTHIKRLKDPEEPVDRLMGVAAGLGGKLGP
FT                   ILLQLPPTLEAEPERLRRCLARFPDGVRIAVEPRHASWWSGEVRDLLTGYGAALCWADR
FT                   LGRPVGPLWRTTDWVYLRFHEGAGRDWPHYGERALRSWVDRLGGVADAYVYFNNDPGGA
FT                   AVRNAIDFAGYARAAGYAVTRARLPERPPAASPV"
FT   gene            417875..418804
FT                   /locus_tag="Tbis_0370"
FT   CDS_pept        417875..418804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0370"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   mpo:Mpop_2998 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87100"
FT                   /db_xref="GOA:D6Y446"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y446"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADG87100.1"
FT                   /translation="MLSLISRSLCIALLVLTAVACGGASGPPSADGSRLNVVATTTQVA
FT                   DFAANIGGDKVRVHGLLKPNVDPHDYEPTPLDMRMLAEADVVVKNGVGFEKWLDQAIEA
FT                   SGFRGTLVDASQGVRLRTGEGASADPHIWHDPRNAKTMAANIARAFAAADAANAAVYEQ
FT                   NLAAYQARLDELDAEIEKKIQSIPEDRRKLVTDHDTFGYYADRYGLTVVGSVIPSFDTS
FT                   AELSAKQITDLVARIKAAGVTAIFSEASLPPKTAEAIGREAGVRVVAGEDALYGDSLGP
FT                   EGSAGATYLQMMRHNTDTIVAALGGAAT"
FT   sig_peptide     417875..417967
FT                   /locus_tag="Tbis_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 31"
FT   gene            418801..419571
FT                   /locus_tag="Tbis_0371"
FT   CDS_pept        418801..419571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0371"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mes:Meso_2852 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87101"
FT                   /db_xref="GOA:D6Y447"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y447"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87101.1"
FT                   /translation="MTERPPSTPALILDRVSVAYGDVPVLEDVTGTVNPGESVALIGPN
FT                   GAGKSTLIKAVLGMVPVVRGRIEVLGGPPAQARRHVAYVPQADTLDPDFPISVEQVVLM
FT                   GRYRWMGRFRRASRADREEVAAALEAVGLADRARDRFGTLSGGQRQRVLLARAIAARPR
FT                   LLLLDEPFNGVDAVSQHALLEALAGLKAQGTAVVVSTHDLAIAHLACEEVCLINRHQFG
FT                   FGPTGEVLTPERLRATYGGRALELRGDRVIVGQT"
FT   gene            419568..420440
FT                   /locus_tag="Tbis_0372"
FT   CDS_pept        419568..420440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0372"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: bha:BH1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87102"
FT                   /db_xref="GOA:D6Y448"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y448"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADG87102.1"
FT                   /translation="MSLIEPFQTPFMARALAELIILGVLGGTVGVVVLLRRLAFLSDAL
FT                   SHTIFPGVVAGYLLAGEDGVFWGALAAGIATAALLTLLTRRVAQDAALALLLTTLFAAG
FT                   VVLVSRRSGYASDLTAFLFGRVLTVTPEQLWQTAAVAAVVIALLAALRRPLLLRAFDPV
FT                   GAEAAGVRVGLLDLVVNVAVALTVVAAVRAVGMVLVIALLIVPAAAARVLSDRLTVIVP
FT                   LACLIGAAGGWLGLVVSWEASIGYGLRLASGGTVVLVLVAMYGLAQAAGLVRRRVRLGR
FT                   ARTGLEAVQ"
FT   gene            420437..421267
FT                   /locus_tag="Tbis_0373"
FT   CDS_pept        420437..421267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0373"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: bha:BH1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87103"
FT                   /db_xref="GOA:D6Y449"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y449"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADG87103.1"
FT                   /translation="MTWFDSSVHRALAEAVLVGALGGVVGVHVLIRRLPFFTMALTHAT
FT                   FPGIVIAALLGADLYLGGGVFGLLITLAVVLFSRVRGQDFTAATGIALAGGFALGVVLV
FT                   SAQDGFAKDLTAYTVGDILAVSARDLAITAGIAAAVTLLLVVFRRELLITAFDPVGAAA
FT                   LGLRTALIDFILLAAVVVTVVATVPALGVILTVALLVGPAATARLLTDRYALLFPISAA
FT                   IGVSCGVAGVWLSTVWNVAAGASIALLVGVVFGLVFLGSHGAALVRRRAAARPL"
FT   gene            complement(421308..422108)
FT                   /locus_tag="Tbis_0374"
FT   CDS_pept        complement(421308..422108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0374"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   mxa:MXAN_2293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87104"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y450"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADG87104.1"
FT                   /translation="MEKIPPGIDPSVPSPARIYDYLLGGKDNFASDREAAAKLIQAAPN
FT                   AQEEVRANRRFLIRAVEYLADQGIRQFLDIGTGLPTQENVHEVALRKAPDSRIVYVDND
FT                   PIVLAHARALLGRNPQVAVAQGDLREPESILDNPEVTEHLDFNEPVGLLLVAILHFLPD
FT                   EAAYPAVAKLRDRLAPGSHLVISHGSAGRLDDKGVAAIRRVYARSSAGEAVARTREEIL
FT                   RFFEGCELVEPGVVTVDEWRPREGEPVRTRTEGAVVYGGVGVVG"
FT   gene            complement(422407..423207)
FT                   /locus_tag="Tbis_0375"
FT   CDS_pept        complement(422407..423207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0375"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87105"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y451"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADG87105.1"
FT                   /translation="MEQVPPGIDPDVPSAARIYDFFLGGKENFAVDRAVAQKLLELSPN
FT                   IKESARANRRFLVRAVEYLADQGIRQFLDIGAGLPTQENVHEVALRKAPDSRIVYVDND
FT                   PIVLAHARALLACNAQTIAVAGDLREPESILDNPEVTAHLDFNEPVGLLLVSILHFIPD
FT                   EAAYPAVAKLRDRLAPGSHLVISHVSAGDLDERTLEKGRRIYTQSQAGVAVPRSREDIA
FT                   RFFDGFELVEPGLVRIREWRPRKDEVIMPGLPGVGGFAGVGVLR"
FT   gene            complement(423504..424304)
FT                   /locus_tag="Tbis_0376"
FT   CDS_pept        complement(423504..424304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0376"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87106"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y452"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADG87106.1"
FT                   /translation="MDKFPQGVDPNVPSPARIYDYLLGGKDNFAVDRAAAEKILEHAPN
FT                   AKEAAQANRRFLIRAVEYLADQGIRQFLDIGAGLPTQENVHEVALRKAPGSRIVYVDND
FT                   PIVLAHARALLACDAQTIAVAGDLREPESILDNPEVTAHLDFNEPVGLILVAILHFIPD
FT                   EAAYPAVAKLRDRLAPGSHLVISHASMGQIDEKGLAEVKQIYARSSAGSAIPRTREEIE
FT                   RFFDGFEVVEPGLVWVEDWRPRDDEVKLPRLPGVDGYAGVGILR"
FT   gene            complement(424625..425425)
FT                   /locus_tag="Tbis_0377"
FT   CDS_pept        complement(424625..425425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0377"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87107"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y453"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADG87107.1"
FT                   /translation="MDKVPPKIDPTVPSPARIYDYLLGGKDNFASDRAAAEKVLQLSPN
FT                   AREVARANRRFLIRAVEYMTQQGIRQFLDIGTGLPTQENVHQVALRHAPDSRVVYVDND
FT                   PIVLVHARALLADEKRVVAVEGDLRRPESILDNPQVTKHIDLGQPVGLLLVAVLHFIPD
FT                   EAAYPAVAKLRDRLAPGSHLAISHISAEDLDEKTVQEGKQVYAKSSAGALVPRSRGDIQ
FT                   RFFGEYGLVEPGLVWPDDWRRTEGEDRIPRMQGSDCYAGVAIVR"
FT   gene            complement(425934..426749)
FT                   /locus_tag="Tbis_0378"
FT   CDS_pept        complement(425934..426749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0378"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   mxa:MXAN_2293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87108"
FT                   /db_xref="InterPro:IPR006764"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y454"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADG87108.1"
FT                   /translation="MGCRMENAPQIDPTVPSPARIYDYLLGGKDNFPADREAAENLLRL
FT                   SPNLKEGAQANRRFLIRAVEYMTQQGIRQFLDIGAGLPTQENVHQVALRHAPDSRVVYV
FT                   DNDPIVLTHARALLADEKRVVAVEGDLRRPESILDNPEVTQHIDFGQPVGLLLVAVLHF
FT                   IPDEAAYPAVAKLRDRLAPGSHLVISHGSVSRDLNEDVIEKGKEIYARSSAGMAIPRSR
FT                   EEILRFFDGFELVEPGLVPWPDDWRPREDEVRLPRLPGVDSYAGVGILR"
FT   gene            426902..427018
FT                   /pseudo
FT                   /locus_tag="Tbis_0379"
FT   gene            complement(427270..427617)
FT                   /locus_tag="Tbis_0380"
FT   CDS_pept        complement(427270..427617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0380"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG:
FT                   transcriptional regulator ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87109"
FT                   /db_xref="GOA:D6Y455"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y455"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ADG87109.1"
FT                   /translation="MPSAAPGRVLEHPKPEEIRLEAVLHALADPVRLQVVRRLAELGTE
FT                   APCSAIELAVSKSTSTYHFRVLREAGVITQVYRGTAKMNALRRDDLDRLFPGLLDAVLA
FT                   ADAAQRRRTGA"
FT   gene            427747..428835
FT                   /locus_tag="Tbis_0381"
FT   CDS_pept        427747..428835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0381"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   gme:Gmet_2577 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87110"
FT                   /db_xref="GOA:D6Y456"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y456"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADG87110.1"
FT                   /translation="MSVLFEPLRLRGLTIPNRVWMSPMCQYSAAETGPDQGVPNDWHFV
FT                   HLGTRAIGGAGLIMVEATAVTPEGRISPYDLGLWNERQQEAFARITRFLREHGAVPAIQ
FT                   LAHAGRKASTDRPWLGGRPVGPEHHGWRPVAPSPVPFADGHPVPAELSVEQIKGLVEAF
FT                   AAAARRALAAGFQVVEIHGAHGYLINEFLSPHSNHRTDAYGGSFENRIRFALEVADAVR
FT                   AVWPDDLPVFFRVSATDWLAENGRAGWTVDDTVRLAKELLAHGVDLLDVSSGGITGGVT
FT                   IPAGPGYQVPFAARVKAETDLAVSAVGLITEPRQAEEIVASGKADAVMLGRELLRNPYW
FT                   PRYAARELGAEPGWPNQYHRAV"
FT   gene            429081..430043
FT                   /locus_tag="Tbis_0382"
FT   CDS_pept        429081..430043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0382"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   mno:Mnod_7147 luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87111"
FT                   /db_xref="GOA:D6Y457"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y457"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADG87111.1"
FT                   /translation="MAEIGYTLLCEQAPPRQLVDDAVTAERIGFGFAVISDHYFPWLEE
FT                   MGHSPYAWSVLGAVAQATERIPLMTFVTCPIMRYHPAVVAQKAATMGVLSGGRFTLGLG
FT                   SGENLNEHVVGLGWPAVSARHEMFREAVEIIKDLFEGGYRSYRGAYFDLESAKLYDRPD
FT                   PPVPIAIAASGERSVNLAVEYGDALVCADPDGDLVRRYRSIGGEGRPVYGQVALCYDRD
FT                   RDAAVERAHRLWRWSVTGWKVMSELPAPVNFAAATTTVRPEDVARQVPCGPDVDAVVAA
FT                   VQRYVDAGFTHVALLQIGHAEHQREFFDWAEKELLPALR"
FT   gene            complement(430305..431047)
FT                   /pseudo
FT                   /locus_tag="Tbis_0383"
FT   gene            431573..432025
FT                   /locus_tag="Tbis_0384"
FT   CDS_pept        431573..432025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0384"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gur:Gura_3338 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87112"
FT                   /db_xref="GOA:D6Y458"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y458"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ADG87112.1"
FT                   /translation="MRLDRFHGGVLSLFRMVVGLLFLTHGAASLFNVFGGHMGTGQAIP
FT                   AGAWPGWWAALIQLVCGGLVLVGLFTRVSALLCSGSMAYAYFVVHQPKALLPLQNGGEL
FT                   AALFCWGFFLIAVLGPGPWAVERLIPRRAKGGREGSRASLATPAGA"
FT   gene            432237..432569
FT                   /locus_tag="Tbis_0385"
FT   CDS_pept        432237..432569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0385"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   rce:RC1_1321 divalent cation tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87113"
FT                   /db_xref="GOA:D6Y459"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y459"
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /protein_id="ADG87113.1"
FT                   /translation="MECIEVRVTAGSREEAERICTEAVSRRLAACAQVVAPITSTYRWQ
FT                   GEIERSEEWLLLLKTTAGRFEELARCVTELHSYEVPEIIAVPITHGSAAYLDWVRRETA
FT                   PESAAE"
FT   gene            432763..433569
FT                   /locus_tag="Tbis_0386"
FT   CDS_pept        432763..433569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0386"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain protein; KEGG:
FT                   afw:Anae109_1735 SARP family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87114"
FT                   /db_xref="GOA:D6Y460"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y460"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADG87114.1"
FT                   /translation="MGFDFRFLGPLQVWRGGRFIEIRAPKQRALLAVLAIRAGQVVSID
FT                   RLIEELWGGAPPPSARTTLYSLVFRLRRRLHAGVEVMGTRSPGYLLRVAPGALDFRRFE
FT                   AGLVRGRAELAAQDHARAARTFRDALALWRGQAFADVPEIPLVQAEARRLEELRLTALE
FT                   DRIEADLALGRHALVAAELYALVEEYPLRERLWEMLMLALYRSARQVDALRAFEQAQQA
FT                   LAGHWGLTPGPGLKRMYERILAADPGLMPMERSEPPPTALGDPRDR"
FT   gene            433919..435037
FT                   /locus_tag="Tbis_0387"
FT   CDS_pept        433919..435037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0387"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: dps:DP1685 thiamin
FT                   biosynthesis protein (ThiF)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87115"
FT                   /db_xref="GOA:D6Y461"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y461"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADG87115.1"
FT                   /translation="MESRLDVPTWRPRLRDSVIVQRDGDELLFICTGDRTVKRFSADER
FT                   AMRLLPLLTGRKTVAELAEAVGAASVEEIRPVLQVLEEERLLSKASDFDGDFLTLGSRR
FT                   AYYYDRQLRLFQDFCDEELLADLSGVDVQRRLDGATVVICGVGGLGGWIAHLLGLAGVG
FT                   TLRLCDFDRVELTDLARQPLFTVEDVGRSKVDAAAARIGDLNPHVTVEQFMRKMSGPDD
FT                   LGDLVAGADLVIAAADEPSPVDVATWISEACREGIPHIIGGGYAYHLGVVGTTVIPGRS
FT                   ACWECVRSVTLAEHGRAQAITLIPRRQRTGGLGVLNGLVASVLAWEAIRVVVGLPPALT
FT                   DRWLEIDLWSLTKRVRSIERRPDCPACGDAGA"
FT   gene            complement(435192..436520)
FT                   /locus_tag="Tbis_0388"
FT   CDS_pept        complement(435192..436520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0388"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="KEGG: hypothetical protein; TIGRFAM: esterase, PHB
FT                   depolymerase family; PFAM: cellulose-binding family II;
FT                   SMART: cellulose-binding family II"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87116"
FT                   /db_xref="GOA:D6Y462"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y462"
FT                   /inference="protein motif:TFAM:TIGR01840"
FT                   /protein_id="ADG87116.1"
FT                   /translation="MRSTAGRLVAVVIAALLAVAGAILALPASAASLVEVTDFGPNPTN
FT                   LRMHLYVPDRVQQRPPVLVAVHYCTGSGPAFYAGTEFASLADRYGFIVIYPSATRSGQC
FT                   FDVSSPETLRHNGGSDSLAIVSMVRYVLQRYNADPDRVYVTGASSGAMMTNVLLGAYPD
FT                   VFKAGAAFMGVPFGCFATTDGSSWNSACANGQLIRTPQQWGDLVRAAYPGYQGPWPRIQ
FT                   IWHGTEDNILRYPNFQEQIKQWTNVHGLSQTPSYTDRPQWNWTRTRYGGTGVQVPVEAI
FT                   SIQGAGHDLPQAGMAQMAIAFFGLDQTGPGPSPSPSTPASPSPSPSTPASPSPQPSGTC
FT                   RVQYDMNAWNTGFTTSVTITNTGSSPINGWELTFTLPSGQSVVSAWNATISPSSGQVTA
FT                   RNVSYNALIPPGGSTSFGFQGVHTGNTGKPASFSLNGVSCAVS"
FT   sig_peptide     complement(436428..436520)
FT                   /locus_tag="Tbis_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 31"
FT   gene            436938..438119
FT                   /locus_tag="Tbis_0389"
FT   CDS_pept        436938..438119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0389"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; helix-
FT                   turn-helix domain protein; SMART: helix-turn-helix domain
FT                   protein; KEGG: protein of unknown function DUF955"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87117"
FT                   /db_xref="GOA:D6Y463"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y463"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ADG87117.1"
FT                   /translation="MAGDITAARVRQLIKESGLTQAEFAGRVGLDASKMSKSLSGVRRF
FT                   TSLDLARIADLCGVTVDWLLGVDSLTPSLATRTAPLSSSADAAIKEAERLARMRADLAF
FT                   LGYRREVPAFELTGGSLIDQGTDLARKAAEHAARERINFWETRDLADAVEKAFGVDVRI
FT                   YECPNAFDGLVWSDEHSPLIVVSTSRLSAQRLPTRQRFTIAHALGHLLARDDRRLIVDE
FT                   NIHDREHKSTKQEMLANAFAAELLLPARLLRDEAARTRWTREDFAALACRLWVAPNTLA
FT                   WRLFNLGLIDRNRCEDFGRLTAWDAASIAGVAGTFGEWLQSASRARMPFMLVRDAFQAY
FT                   ADGKSTLRPLANLLGVDTDLLRQVMHGKKEDSPLASWPITGSPTPLCSATSPP"
FT   gene            438116..438373
FT                   /locus_tag="Tbis_0390"
FT   CDS_pept        438116..438373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87118"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y464"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87118.1"
FT                   /translation="MSELTLLARILRGRGRWTEAIAYEVSRSAKVYPELNTIASDGWLG
FT                   EPIEIDNDDEIEQIERVRRAVFGGTVHEPLKHLGEARPAT"
FT   gene            438370..438597
FT                   /locus_tag="Tbis_0391"
FT   CDS_pept        438370..438597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87119"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y465"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87119.1"
FT                   /translation="MILNRPEFRGSYWITDDRDAREYAQFQGITTLDTADLLAEGVIEN
FT                   CCGTSEALRLLRRMQQEGRNVRIPRDLGQR"
FT   gene            438900..439349
FT                   /locus_tag="Tbis_0392"
FT   CDS_pept        438900..439349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87120"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y466"
FT                   /inference="similar to AA sequence:KEGG:BRADO1780"
FT                   /protein_id="ADG87120.1"
FT                   /translation="MTTSVAHVHSIEHTIHTTNRWLNHLSEAIGTSDREFVHGLLRTWL
FT                   HAVRDALTVQASAHFAAQLPDLIRGIYYNGWNASAVPIRRDRQEFIDHFATSGRIAHSD
FT                   VPKLAPLVTEFLCRELSEPVVKQALAQLPQDVRALLRPKAMAGTG"
FT   gene            complement(439394..439975)
FT                   /locus_tag="Tbis_0393"
FT   CDS_pept        complement(439394..439975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0393"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: bph:Bphy_1094
FT                   signal-transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87121"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR017158"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y467"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADG87121.1"
FT                   /translation="MFVYEVMRTPVITLRPDDTVRQAIRVLYGNHITAAPVVGERGELA
FT                   GMVSEIDLLTAELRAANTLDRNFPETSLRVANVMSRTVVTVTEDTEVSALLDLMINMRV
FT                   KTVPVIRGFELVGIVTRRDLMAMLATPDETLRDVIVELLRRECPAAASCDVVVRDGEVE
FT                   LRGGLGEWDSREAEELIRTVPGVVRVTRAG"
FT   gene            440338..440943
FT                   /locus_tag="Tbis_0394"
FT   CDS_pept        440338..440943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0394"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: smd:Smed_2997 putative
FT                   signal-transduction protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87122"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y468"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADG87122.1"
FT                   /translation="MLVREVMTSPVVTVPVSWSVRQAIRLLYDKDITAAPVVDEQGRMV
FT                   GIISEMDLLRGEFDTDRRVFLRPSAPVDLAPSPGIEEVMTPNVRTVQEDDDVMAAVDLM
FT                   ITMGVKSVPVLRGEQLTGIVSRRDLMGMVAYGDARIRDDVLAALRDSDETSAWRVAVHD
FT                   GVVELYGDAADASAARKAEMIARSVPEVVDVVLRGGGW"
FT   gene            complement(440970..441344)
FT                   /locus_tag="Tbis_0395"
FT   CDS_pept        complement(440970..441344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0395"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: nha:Nham_0217 CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87123"
FT                   /db_xref="GOA:D6Y469"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y469"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADG87123.1"
FT                   /translation="MTTILLVFAGGAIGAPARYLTDRFVQRRLGGVFPWGTLTVNVTGS
FT                   FLLGCLLGLQFARGLPDGVTTLLGTGFCGAFTTFSTFGYETVRLLEEGSTWAAGVNAFA
FT                   GLLLGVPAAVTGLLLAGVLG"
FT   gene            complement(441341..441688)
FT                   /locus_tag="Tbis_0396"
FT   CDS_pept        complement(441341..441688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0396"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   noc:Noc_2284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87124"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y470"
FT                   /inference="protein motif:PFAM:PF02641"
FT                   /protein_id="ADG87124.1"
FT                   /translation="MRQQARRLMIFINENDQYHHRPLYAEIVDRAHRMGLAGATVLRGI
FT                   EGYGHSSQIHTSRLLSLSEAQPVTIIIVDDAERIEAFRLVLDELITEGLVVCDPVEVRR
FT                   YPAAGQAEERA"
FT   gene            complement(441685..442185)
FT                   /locus_tag="Tbis_0397"
FT   CDS_pept        complement(441685..442185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0397"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: pde:Pden_0789 CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87125"
FT                   /db_xref="GOA:D6Y471"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y471"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADG87125.1"
FT                   /translation="MRRRAHRSGGRIRRAVPSPRRAAGTAPARTWDVLAVIGLGGGIGS
FT                   VARHLAGAAIPAHPYGFPWATFLVNVTGCLAIGGLMAVVDALPGRRYLRPFTGVGLLGG
FT                   YTTFSTYANELVTLVHHGAWAVAGGYALGSILAGLAAVRLGKDAAGAAIRRAAHRRRRG
FT                   GAP"
FT   gene            442458..443306
FT                   /locus_tag="Tbis_0398"
FT   CDS_pept        442458..443306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87126"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y472"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87126.1"
FT                   /translation="MDAAYVGDIYAEHLTEADLQLLAEAAGHQGGAAELRRDPAIIPDL
FT                   LDHPRVFAVLFGRSGSASRDLTAISPFLLFAAAVHRAAAELAVRGAVPYPRVPAADVRQ
FT                   MSGFLESPSRRLFLAELLSSFVRVTGGRYWVRTEEGERLRELTELDLPRLAEILDAVPE
FT                   TDRPGVLRRLGDVALFLAGVLPGYAIRHVFGGVDATALWFTVRGAAEPWAGEPAGTAAE
FT                   EPAVEMLEYLGSHWYRRAWELAPVRSARLAVLPEVAEGFRPARRVLNYVAGRYLFAASG
FT                   R"
FT   gene            443556..445080
FT                   /locus_tag="Tbis_R0011"
FT   rRNA            443556..445080
FT                   /locus_tag="Tbis_R0011"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            445261..448299
FT                   /locus_tag="Tbis_R0012"
FT   rRNA            445261..448299
FT                   /locus_tag="Tbis_R0012"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            449013..449312
FT                   /locus_tag="Tbis_0399"
FT   CDS_pept        449013..449312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87127"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y473"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87127.1"
FT                   /translation="MTTESPPDVNVTALAINVEIPEPLRWTDSRRDVEYVLTTLNVRLL
FT                   PDGRLAAKAYGRPVAGGPGAYTSFRVPGRPELADLIKRAADRAAQLWAAHRGFD"
FT   gene            449864..450583
FT                   /locus_tag="Tbis_0400"
FT   CDS_pept        449864..450583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS3116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87128"
FT                   /db_xref="GOA:D6Y474"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y474"
FT                   /inference="similar to AA sequence:KEGG:BAS3116"
FT                   /protein_id="ADG87128.1"
FT                   /translation="MAGRRLRRFVPPQHGAWAMLAVPYLAGLLTAGFHWPAVPLLGAWI
FT                   AGYLLSYFVFQALKSRRPRRYRDQLLGYGLIAAPLLLVVVVAAPRVLWYAPAYAVLFAI
FT                   NAWYAWRRRERDLANDLASIAESCLMVFVVATIADTPPSAVLVPFLLCAAYFAGTVPYV
FT                   KTMIRERGNVAYYRWSIGYHVVALAVAAYLSPWAGVLFAWFLARAVLFPRHGLTAKQIG
FT                   VTEVVNSVLLLTCIALI"
FT   gene            450815..451495
FT                   /locus_tag="Tbis_0401"
FT   CDS_pept        450815..451495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_1209 binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87129"
FT                   /db_xref="GOA:D6Y475"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y475"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87129.1"
FT                   /translation="MIKSQRADRLQGSSRAVRILGSLAGALAIGAGFGAATAFMNALSL
FT                   SHADLESRAYTESGWSYAEIISVLLDSGWAWAGCGVVVGWAVTRGDGGRRSGLALGATA
FT                   AALALIAATIAYGIGEAIADGGQTPWFGADELVWGTAAIVLGAPLGAIGACARWPGALG
FT                   LLARLTVPVGAAVQMIVLPPGRNEVVQAIGKTIVWTAAAVSIALIVAHFVVTRRRSRPA
FT                   AETP"
FT   sig_peptide     450815..450931
FT                   /locus_tag="Tbis_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.473 at
FT                   residue 39"
FT   gene            complement(451848..453374)
FT                   /locus_tag="Tbis_0402"
FT   CDS_pept        complement(451848..453374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0402"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_0279 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87130"
FT                   /db_xref="GOA:D6Y476"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y476"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADG87130.1"
FT                   /translation="MSSAGLPAGQEREQLRYAWRALSVVCMASVLATIGGNALNVALPK
FT                   LVDQTKASAAAASWILLAFQLTTTVLTVIFGRLADMFGRRTMYLCGLGVYTLASLLAGM
FT                   APDPWLIVGMRVVQAAGMAMLLTNSAALISDAFPRHRLGEGMGVYTASFSISQLAGPTL
FT                   GGLLVEHLGWRWLFWYNVPLGMACLIWGAIVLRRPAPGEDGQRLDLPGSFMILLSLGGL
FT                   LLALSEVTRLGWAHPVILAGLAFFVVLLPVFIAWELRSPHPVVDIRMFRDPTFGLGTLA
FT                   SFLSSIARMGVVILIALFFQAVHGDTAVEASLKLLPLSIAAMIASVTSGFLQRRFSPRS
FT                   LAMFGSSLSTAGLGTLLLVIGADAPALAIMAGLLVLGFGSGTFLPSNATVLLSELPSNR
FT                   LGIMNAMRLMLQSVGIVVGTALSLSIITAPLPPAMHDHVFAGTLSHVSDAAVQRLVTGY
FT                   RWALACLVGISALATLTCLWRGHLGEPGGDRRGHRGGGHADPAARRPVAG"
FT   gene            complement(453667..454281)
FT                   /locus_tag="Tbis_0403"
FT   CDS_pept        complement(453667..454281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0403"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hne:HNE_0651
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87131"
FT                   /db_xref="GOA:D6Y477"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y477"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG87131.1"
FT                   /translation="MARKSGSWEWSRTAETRKNMLRAAREVFCEQGFAETSVADIVSRA
FT                   GSSVGSLYHHFGGKSELFLALWEEHQAAHEKAAASAVAEARASGVTDPVELFITGARAV
FT                   LEGSWERRDLVRMFMDGDGPPGFELMRRTRGREWVRQNAVLLGAGTGPLDRMTVSVLTT
FT                   VIGEAGREVATCETREEADEVIEAAVTLIRRLAAPWPGETK"
FT   gene            455233..456462
FT                   /locus_tag="Tbis_0404"
FT   CDS_pept        455233..456462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0404"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   dal:Dalk_3948 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87132"
FT                   /db_xref="GOA:D6Y478"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y478"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADG87132.1"
FT                   /translation="MQWHGHEQTKAHFAMEYHKMVKVRKVAIFSLAVAVTMLSAGCSQG
FT                   LLGSGGDSGSAAEQGPIVLGMLIPQSGSEAAVGPYMQNAAQMAVDEINEQGGVLGRKLE
FT                   LKVADDACDPQTAVAGANKLVTEGIAVSVGGYCSGATLPTLPVFGKANIPMIIPAANSQ
FT                   ELVDQRLKHVFLINGTGAQQAAAAVKWITKRGAKNVALVHDNTSYSKDIAVRTQQILDE
FT                   PGGPETAIVEAVTPKESDYSANVTNILAKKPDFVYWTGYFQEGGLLTRQLRQAGYKGDI
FT                   MVADGAVSEKLVEIAGGEHAEGVYATMTYTPDTIEGAEGWIENYKKKFGTAPGPYSNQA
FT                   YDAVRLAAEAIKRAGSTDGDKIIAALEGIDGFPMFSGPLKFTPEHTLATGGFQILVVKS
FT                   GTFVLQDSLQ"
FT   gene            456581..457474
FT                   /locus_tag="Tbis_0405"
FT   CDS_pept        456581..457474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0405"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dvl:Dvul_2253 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87133"
FT                   /db_xref="GOA:D6Y479"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y479"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADG87133.1"
FT                   /translation="MTQLIWNGLFVGSFYALVALGYSMVYGIIKLLNFAHGDIYMLGAF
FT                   AGFAILGATGGVSPDMQLPLLLGVLVVTMGFTGMCGVLLERIAYRRLRSAPRLSLLITA
FT                   VGASFSLEYGVRVIAGPDPQVYPVRLGGTTIHVLGASITVQQIVLMVVAVALMVALNLL
FT                   VTRSREGRAMRAIALDPRTSALMGINVNAVIARTFFLGSALAGAAGVMAGAYYGKIDFM
FT                   MGFLIGLKAFTAAVIGGIGNIPGTMLGGLLLGMLESFGTYWLGGEWRDVFAFGVLILFL
FT                   TVRPTGLLGERVTERV"
FT   gene            457471..458454
FT                   /locus_tag="Tbis_0406"
FT   CDS_pept        457471..458454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0406"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dvl:Dvul_2395 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87134"
FT                   /db_xref="GOA:D6Y480"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y480"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADG87134.1"
FT                   /translation="MSVQTPTSTPTRRRRKGTALGRAITRTFDNRWAGLAALAIALLAP
FT                   FVIATPYALSVMTSAAIFVMLAAGLNIVVGYCGLLDLGYAAFFAVGAYTSGVLSTRFDL
FT                   PLLATLPAVIVVTIIAGIVIGAPTLRLRSDYLAIVTLGFGEIIRITANNLEITGGPSGI
FT                   YGIPGLTDNAVVFYYLTVVVVAVAVAGAARLGRSRLGRAWRFIREDEDAAEAMGVHTYR
FT                   VKLAAYIAGAIWGGLAGVLFAAHLSAISPGSFTFLQSALVLMAVVLGGMGSTPGVVLGA
FT                   IVISLLPEVLRDFADYRYFAFGVLLIIFMLVRPQGLWPHRSREASA"
FT   sig_peptide     457471..457620
FT                   /locus_tag="Tbis_0406"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.805 at
FT                   residue 50"
FT   gene            458451..459272
FT                   /locus_tag="Tbis_0407"
FT   CDS_pept        458451..459272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0407"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: acr:Acry_0357 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87135"
FT                   /db_xref="GOA:D6Y481"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y481"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87135.1"
FT                   /translation="MTLLSVENLRLSFGGLLAIDDLSFSVGEAEIVSVIGPNGAGKTSA
FT                   FNCVTGFYKPTAGRILFRGRDITGLRPSKIAGLGVARTFQNLRLFGEMSVLDNVRAGAH
FT                   LWLKQSVFDALLHTPRYRRSERECTEQAHHWLDFVGLRGDRYGPARALPYGEQRRVEIA
FT                   RALARKPDLLLLDEPGAGLNHGEKAEMRDLIRRIRHDLGIAIVLIEHDMGLVMEVSERV
FT                   VVLNFGRKIADGRPEEVRRDPAVIEAYLGKDEDETPAGEQMEVGGGHDAGA"
FT   gene            459259..459972
FT                   /locus_tag="Tbis_0408"
FT   CDS_pept        459259..459972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0408"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dde:Dde_0262 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87136"
FT                   /db_xref="GOA:D6Y482"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y482"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87136.1"
FT                   /translation="MPALEIDSLHVHYGGVHALRGLSLTVEEGEIVALLGNNGAGKTTT
FT                   LSAVSGLVRPSAGRIVFQGRDVTRARPEEIVKAGLVHVPEGRRVFSTLTVHENLQLGGY
FT                   LVRDHAELRRRIDRVYTLLPRLAERRDQQAGTLSGGEQQMLAIGRALVTGPRLLLLDEP
FT                   SMGLAPLVVASVMELVREVNSQGVSVLLVEQNAKAALKIAHRGYVIENGECVLGGSAAE
FT                   LRGDQRVVAAYLGGA"
FT   gene            460278..461285
FT                   /locus_tag="Tbis_0409"
FT   CDS_pept        460278..461285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0409"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: bsu:BSU08760
FT                   sporulation-control gene"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87137"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y483"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ADG87137.1"
FT                   /translation="MVFKRMLGALGVGAPSVDTVLANPRVQPGGTLTGEVRLKGGDFDA
FT                   EIEHITLSLVAQVEIEHGDRERRGVGEFYRYQVSGPTVLRKGENRVLPFQMSVPWETPI
FT                   TEVDGQHLTGMAVGVRTELAIAKAVDKGDLDPIAVMPLPSQRAVLDAFPRLGFAFKGAD
FT                   LEAGHIYGVQQMLPFYQEIEFYAPPQYAGVVSEVELTFVTNPGGMDVVLEVDGRRLGDA
FT                   IGRFTVSHDEALRTDWVAEIDRWVASLGQYGAPAPGYGAYGDPHGYGPYGHPDPHAYGP
FT                   HGHPYPPHHSSGPGWGTVAAAGAAGLIGGMIAGEVVEEIVEEIFEDDGGDGGDW"
FT   gene            461355..461729
FT                   /locus_tag="Tbis_0410"
FT   CDS_pept        461355..461729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0410"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: pmy:Pmen_4121
FT                   signal-transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87138"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y484"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADG87138.1"
FT                   /translation="MRIGNVYRPDVFGCWVDERLPDVARRMAEKDVGALAVLDGNEVVG
FT                   VITERDLVRALAESPDVYSARVSEFATTDVETADVEDDSREVAERMLEAGFRHMPVTQN
FT                   GEMVGMVSMRDLLALETWSG"
FT   gene            complement(461856..462080)
FT                   /locus_tag="Tbis_0411"
FT   CDS_pept        complement(461856..462080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_A1472 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87139"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y485"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87139.1"
FT                   /translation="MNPFLGSLVLTLALQLTDSAHAGNRARADQRLEHRTGICPAARRR
FT                   ERPRRGAERRARRRGDAFSLARHGRSAVM"
FT   sig_peptide     complement(462012..462080)
FT                   /locus_tag="Tbis_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.518 at
FT                   residue 23"
FT   gene            complement(462336..462974)
FT                   /locus_tag="Tbis_0412"
FT   CDS_pept        complement(462336..462974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0412"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mxa:MXAN_0214
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87140"
FT                   /db_xref="GOA:D6Y486"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y486"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG87140.1"
FT                   /translation="MTATPEAEVPTNARGAPLSKRGERTRRKLLDAAEQVFAELGYYEA
FT                   SIVKITEAAGVSQGTFYIYFESKQQIFDELVADLNRRVRHAMSEAAKKGRTRAERERLG
FT                   FAGYFRFTAEHPALYRIIRQAEFVSPDAMRRHYAKIAEGYMEGLRQAMDDGEIVRADPE
FT                   VLAYALMGIGELIGMRWILWDDKQPPRQVPEDVFEEMHRFITRGLGATA"
FT   gene            463114..463869
FT                   /locus_tag="Tbis_0413"
FT   CDS_pept        463114..463869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0413"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   reh:H16_A2258 enoyl-CoA hydratase/carnithine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87141"
FT                   /db_xref="GOA:D6Y487"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y487"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG87141.1"
FT                   /translation="MQGLILTQVDGPVATIVLNRPERHNSLVPELLRDLLTALEKVADA
FT                   RAVVLAAEGRSFSTGGDVRAFAERDGDALRDYANELVGLLGETMLAIMRLPAPVIAAVH
FT                   GMVTGGSLGLLLASDIVLIHPSVTIAPWYTTVGFAPDGGWTALLPYRIGASRAAVVQYT
FT                   NTPIDAETAVAWGLATRVESDVRRAAAELARTIAGQRPGAVRATKRLINGDLDAIAARL
FT                   DAEREAFVRQITTPEAREGMTAFLSRAAR"
FT   gene            463890..466301
FT                   /locus_tag="Tbis_0414"
FT   CDS_pept        463890..466301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0414"
FT                   /product="NHL repeat containing protein"
FT                   /note="PFAM: NHL repeat containing protein; KEGG:
FT                   sfu:Sfum_2158 NHL repeat containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87142"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013017"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y488"
FT                   /inference="protein motif:PFAM:PF01436"
FT                   /protein_id="ADG87142.1"
FT                   /translation="MRKRPAAAFAAALLLAVAAGLVRPAAEAGAATVLTFADEDRSSEL
FT                   TGHVVHQRYQFNTPTTVTYDRDTITGNPAAARVYVADMGNHVIRVFDLNGKQIGRLDDA
FT                   DTQLAPDSPASSVPQITAPLGIYFLSKSEAVDDRLAGLYINDVGVHKLHFFRTDPSNPD
FT                   RFYYVTSFGQEGHGGGADLKLPRNMTVTPDGLLYVSDEFNHRIKGFRIDPDTWTATLVT
FT                   TVGSQGGPIIPGTDKDYGTDSTHYDDYAGEPLKRDGFRIPQGMTYWRTPDGSRTYLYVA
FT                   DNGNNRVKIFEVAASGTLTLVDILGRFTRNGTADHLKRPRGVRVDVNGNLYVADTYGGR
FT                   IIRFPNLGTNTAKYRTSLSADAAASWVYGRLGIHQVEMRTPATALTEDEAFQLPNDVVP
FT                   VETPSGARYTENIWSWGVYYPGARVLLVSDTGNHRIKKCWEHPTQNTILRCSVSAGVGG
FT                   VTAHEFWGHPRTLAGQLHAVGGMDLLPGQGSDPDTLLVSDTPNTVIYRYGLDGSYKGKF
FT                   TGGSISYGVTGLSVYPVSGSHHVGVLVAADATLPYPYTGDSSLRIYNRAGGSVNVFNLT
FT                   TRTSGASKISYTGGNFPVAIDIVPEGGSYGVFISTSGNRLYRFTLSGSSLTLNWVTGGP
FT                   DPSKGSDSGSTWNLGPNFYGEGAAGTFDQIQDVTAGGGRVYAVDRRNQRIQVFNASTGA
FT                   YIAKIGKGGGTYDHPASITPDEFFLPHGVRLDGGLLVGDGFNMIVRDYDDPTGLTPDSS
FT                   GRLPVTMRGYWVDPHLGTRKGGLFATQHVLRAGPYVFVDSLISNRITRIS"
FT   sig_peptide     463890..463976
FT                   /locus_tag="Tbis_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.744 at
FT                   residue 29"
FT   gene            466314..468176
FT                   /locus_tag="Tbis_0415"
FT   CDS_pept        466314..468176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0415"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; MaoC
FT                   domain protein dehydratase; KEGG: rce:RC1_3527 acyl-CoA
FT                   synthetase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87143"
FT                   /db_xref="GOA:D6Y489"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y489"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADG87143.1"
FT                   /translation="MKVPDLLGKGAELSPDSTALVDTLSGREFDYATASERAGRAARYL
FT                   SEGLGVRPGDRVAVLSGNRVELMELLFACGRLGALLVPLNWRLSADELAGIMADCTPTV
FT                   LISDDTHAEKALRLDGNAVRFGADYERALAEADPIWGPTEWPDEKDPWYLLYTSGTTGR
FT                   PKGVIQTYGMAVVNHLNIGVAIGLTSVDTTLNVLPMFHTGGINLYTMPTLIVRGTAIIQ
FT                   HEFDAALALRLLSERATVFFGVPTVYQMLYDHPDFATTDLSRVRSWSSGGASMPVPLLH
FT                   KLAEKGVVVRQGMGMTETGPTIFLIDEAHALSKAGSVGKPQAFTEVKLVDRNGDPADEG
FT                   EMLVRGPGVTPGYWNQPEATRAAFTEDGWLRTGDVARRDEDGYYTIVDRVKDMYISGGE
FT                   NVYPAEVEKVLLTHPAVAEAAVVGVPDDRWGEVGKAYLVVRAGMTVDADEIRAFCKERL
FT                   AGYKVPKHVEVIEALPRNATGKVLKDRLRVVTWSEEFTVTQKDFDRFAALSGDDNPIHV
FT                   DPEYAKTTRFGGTVAHGMLIFTLIRAAVRRHHPGAELTEQFLKFPAPTPAGERVTITAR
FT                   ESAAGPDRITCDITVTRTDGTTVCEAVTTIRRPAAGGDREQEDA"
FT   gene            468173..468562
FT                   /locus_tag="Tbis_0416"
FT   CDS_pept        468173..468562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0416"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mmr:Mmar10_0309 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87144"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y490"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ADG87144.1"
FT                   /translation="MSDWWEQAVGRSATLERTFTAEDLAEYRSLSGDTTEDPAGGESVP
FT                   EPLIAGLFSTLLGTDLPGNGTMYLKQEMRFLGRAKPGETVRAEVTVTAVRPEKALVDLD
FT                   TVAKVGDRVVCEGKALVMAPQYGHR"
FT   gene            468752..469933
FT                   /locus_tag="Tbis_0417"
FT   CDS_pept        468752..469933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0417"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bja:bll0887 ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87145"
FT                   /db_xref="GOA:D6Y491"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y491"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ADG87145.1"
FT                   /translation="MKRYGVALSALLALTLTACGSSGGEDTSASGSSGGGSPVKVGVLT
FT                   STSGLVAGYGKQFIEGFKAGLDHATKGTGEVAGRKIEVTYHDDAGDPAKATAEATDLIG
FT                   KGYKILTGTVSSGVAMQLAPLAGQNKVLYIAGAAAADGVTGSNAYTFRSGRQTWQDVKA
FT                   AEGLAGGVQGKKVMVFAQDYAFGQANVDAVKAVLGEAGGATVTPVLVPLKTTDFTPFAR
FT                   QIVDAKPDLVFVAWAGDTAPNMWRTLAQQGVFDVTKVVTTLADRATFGSFGPAGDKIDF
FT                   VAHYFAEATDNEPAKALASALGTTADIFHTDGFTAAQMVVRAIEQGGDDVEKMITALEG
FT                   WTFTSPKGEMTIRAEDHALLQPMFHATLEGEKPRAVATLGPEQVAPPANPIKR"
FT   sig_peptide     468752..468826
FT                   /locus_tag="Tbis_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.551 at
FT                   residue 25"
FT   gene            469930..470682
FT                   /locus_tag="Tbis_0418"
FT   CDS_pept        469930..470682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0418"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcr:BCAH187_A2032 branched-chain amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87146"
FT                   /db_xref="GOA:D6Y492"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y492"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87146.1"
FT                   /translation="MSAILETHGLGVAIGGVRILSDVSLSVRRGEIMAVLGPNGAGKTT
FT                   LFNLLTGLRRPSAGRIVLNGTDITGAPVFRRARLGLVRSFQITSLFPSLTVLENARLAA
FT                   QVHLGGSLALWRRVRPTDAAVAMARAALETVGIAEYADEPAGSLSHGAKRKLEVALAIV
FT                   GKPAVLLLDEPTAGMSAEDVPELTEVIRRVRDRHGTTILLVEHRMDVAIGLADRMAVMH
FT                   HGTLLACDTPDAVMADPLVQSAYLGEAL"
FT   gene            470679..471401
FT                   /locus_tag="Tbis_0419"
FT   CDS_pept        470679..471401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0419"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dac:Daci_6027 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87147"
FT                   /db_xref="GOA:D6Y493"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y493"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87147.1"
FT                   /translation="MTKATEGTMLSVRGLHVHLGESHVLQGVSFDVRAGGVTALLGRNG
FT                   AGKTTTMRGLLGLVPRRGEVILDGEDISRLPTHEVVRRGIGYVPENREVFAGLTVQENL
FT                   LLAERPGSPHHYDLVYELFPRLKERLKQRAGTMSGGEQQMLALARALLNDNRLLLIDEP
FT                   SQGLAPYLVAELTEALARAAELVTIVLVEQNLRMVQRLARDAVVLDQGRVVWSGGAADL
FT                   LGDGELTRQYLGVGVAKA"
FT   gene            471398..472264
FT                   /locus_tag="Tbis_0420"
FT   CDS_pept        471398..472264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0420"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ABC-transporter ; K01997 branched-chain amino acid
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87148"
FT                   /db_xref="GOA:D6Y494"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y494"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADG87148.1"
FT                   /translation="MSTFILLTVTGLGLAALYFLVASGLSLIYGLMDVLNFAHGAFLTL
FT                   GAYTAWVVVDATGSLLLGVAVAIAVGAVLAVLMETALLRRMYGSHVPQVLLTVGLLLAI
FT                   TALIRSIFGTDALQLATPEWMNEVTEILGAPIPNNRFVLIVTAVLVYLAMSAFLAKTRY
FT                   GLIIRAGVENRAMVTALGIDVRRAFTLVFAIGGALAALAGALAGVINNAVSPEQGMSLL
FT                   IFAFIVVIIGGLGSFRGSALAAVLVGLLQQYANFYGAVGAGDLIVVLMLAAILLVRPQG
FT                   LLGRAAS"
FT   sig_peptide     471398..471472
FT                   /locus_tag="Tbis_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.788 at
FT                   residue 25"
FT   gene            472261..473319
FT                   /locus_tag="Tbis_0421"
FT   CDS_pept        472261..473319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0421"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   aav:Aave_3172 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87149"
FT                   /db_xref="GOA:D6Y495"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y495"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADG87149.1"
FT                   /translation="MTDQMIRTRPAVEPRTRRGPRAWAKPVVLAALPLLAAALPYLDVQ
FT                   VPLLFDGPLGSPGVLHVLSLMCVMAAVAVTYDLLFGFTGLLSFGHGLYVALGMYTTGIV
FT                   LTHTDLGFAGAVAWVAVLGLVVPLVLGAICLRVGGIAFAMATLAFGQAGAIFVVRDPLR
FT                   ITGGELGLALPYEKLPEPLVGVINAGNRYWLALALLVVTYAVVRWALASRPGRVWRAIR
FT                   DNETRVLVLGLRPYAFKLMAFVLSSFLASLAGLVYALIAGGAHAEVTEATFTLGLLVMV
FT                   VLGGSGHPYGALIGGLVYTYLNHRLGQLSTTLGGPLSEPLFILGVLFVVLILFLPGGIV
FT                   SLVRRTESKGGA"
FT   gene            473316..474332
FT                   /locus_tag="Tbis_0422"
FT   CDS_pept        473316..474332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0422"
FT                   /product="Beta-ketoacyl-acyl-carrier-protein synthase I"
FT                   /EC_number="2.3.1.41"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; 3-Oxoacyl-[acyl-carrier-
FT                   protein (ACP)] synthase III; KEGG: bcz:BCZK1748
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87150"
FT                   /db_xref="GOA:D6Y496"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y496"
FT                   /inference="protein motif:PRIAM:2.3.1.41"
FT                   /protein_id="ADG87150.1"
FT                   /translation="MTVCIAGTSSYLPSRWMTAAEISAASGVPEDVIIERFGLRGKHIA
FT                   APDEHVTDMAARVGAQVLAETGTDPADVDAVVYFGSTWKEHPVWHAAPKIAHMLGTHRA
FT                   FALELDYVSCGTPVAMRVCRDMMLAEPHLNRVLAVAASRESYLLDYTNVRSRFAFNFGD
FT                   GAAGVLFTRDQGVAEVYETEMITDGSFAHQVRVPAGGSVEPASEETVRKGRHKLDVYDP
FT                   ASMKEGLDRVSLPNFVRAAEGALKRSGLGLGDVDHLCVLHMKRSMHLGLLDALGIPADR
FT                   ALYLDDTGHMSGVDPLLALDRAARAGRLSEGDIVLLLAAGTGYTWAATALRWIGPRS"
FT   gene            474859..475287
FT                   /locus_tag="Tbis_0423"
FT   CDS_pept        474859..475287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0423"
FT                   /product="protein of unknown function DUF101"
FT                   /note="PFAM: protein of unknown function DUF101"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87151"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y497"
FT                   /inference="protein motif:PFAM:PF01951"
FT                   /protein_id="ADG87151.1"
FT                   /translation="MVSSGYRAIPRAAGLVVEAWGDSREECLAEAVRAVVDSFAEIGDA
FT                   VPDGSVEFALAVRDDDALLLTVLDEVIDQIQVEERVPVDVSIDEGTGIAMGEFEIRLAT
FT                   VPLEAVREVGALPEAVQPAGSWFRRESGVWRAHALIEV"
FT   gene            475457..475948
FT                   /locus_tag="Tbis_0424"
FT   CDS_pept        475457..475948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0424"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: pde:Pden_4582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87152"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y498"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ADG87152.1"
FT                   /translation="MAVTLFHRGPSLAALHDEYAARGRIDHEAPVRSSSGTVVAAPAER
FT                   VWAIMADVASWPSWASNLQVLELGEVRPGETFRWRLGPVTIRSRFARVDPGRELTWTGT
FT                   FFWYRAVDRHVLEPPGDGTTRVTIEESLAMPLLPLLYGEARLRANHERWLAELKAVAEA
FT                   "
FT   gene            476071..476469
FT                   /locus_tag="Tbis_0425"
FT   CDS_pept        476071..476469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0425"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: bcy:Bcer98_1820 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87153"
FT                   /db_xref="GOA:D6Y499"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y499"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG87153.1"
FT                   /translation="MFNIGEFARLGRVSVRMLRHYDALGLLRPARVDPVTGYRYYEARQ
FT                   LSRLNRLLALKDLGLAGRRGTADERGRPGTTAHPDAGDHPIRGTLTSGVPGVSGCRSGW
FT                   ISRTRPRHAVANGIPSGRRCAGRSRCPR"
FT   gene            476917..478263
FT                   /locus_tag="Tbis_0426"
FT   CDS_pept        476917..478263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0426"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: scl:sce2618 putative cytosine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87154"
FT                   /db_xref="GOA:D6Y4A0"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A0"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADG87154.1"
FT                   /translation="MASALGNDDYAISRVPLQARYSWWSVAVQRFGQLSALSQFLLGAT
FT                   LGFGMTFWESFWAITFGAVILEVVAIALGVIGMREGMSTSMLARWCGFGQAGSALIGLA
FT                   IGISLVGWFGIQSGVSAEGLYQLLPVMPVWAWSLVFGLAVTAIVVKGFHSMAWTAYLTV
FT                   PAFMLLVAWSIGSELANHSLADLVASAPAGPRLSLLEGTTLVAGGFIVGAVITPDMTRY
FT                   NRSVGDVIKQTLVGITLGEYVIGLAGVLLAHAVKSANIVTIVTSTVGLIGVLVIVTGTL
FT                   KINDWNLYSSGLGVVNFIGTVFGRQANRAVVTLCVGVVGSVLAAAGILERFTDFLTLLG
FT                   VTFPPIAGIMIAEYFVVRTWRRQLTATNKAGTMPAEAPRWVPATLVIWLIASAIGKFVT
FT                   WGLPSINSLVAAFALYVIAGWLGLIRGYGTAHTESVESGAAQTSAPSAS"
FT   gene            478290..479849
FT                   /locus_tag="Tbis_0427"
FT   CDS_pept        478290..479849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0427"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: mlo:mll9131
FT                   hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87155"
FT                   /db_xref="GOA:D6Y4A1"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A1"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ADG87155.1"
FT                   /translation="MRIGIDVGGTNTDAVLMDGQRVLAAVKTATTRDVTSGINTALAEL
FT                   KRQRAFDPVAIQAVMIGTTHFINALVEAERLAPTAAIRLGLPATASLPPMVDWPERLVR
FT                   AISGRYYLCHGGHEFDGRHISELREDEIRRVAEDLRRHGIRSLAISSVFSPVNAEFEQR
FT                   AAEILSEELPDVAISLSSEIGRMGLLERENATIINASLRELASQIVDGLAGSLEKAGIT
FT                   APLYLSQNDGTLMDVEFARRYPVATFASGPTNSMRGAAFLSGVETCAVVDVGGTTSDIG
FT                   VLRHGFPREATTEVSVAGIRTNFRMPDVLSLGIGGGSRVRSGDDGVTVGPDSVGYRLTE
FT                   EALVFGGSTLTATDVAVAAGRAEIGDPSLVRGLDRSLVEAALRRIAKDVEDAIERIRTS
FT                   PEPLPVIAVGGGSIVLPDEIGDSGPIHRPDHFAVANAIGAAIAQIGGEVDRIYPVEPGR
FT                   RQAVLDEAKQEAVDRAIASGARPGSVRIVEVDEVPLAYLPGNATRIRVKAVGELQLEAA
FT                   DA"
FT   gene            479842..480930
FT                   /locus_tag="Tbis_0428"
FT   CDS_pept        479842..480930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0428"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   mlo:mll9130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87156"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A2"
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /protein_id="ADG87156.1"
FT                   /translation="MPERLITEADLDDIAVGAAILGTGGGGDPHIGRLLAHAAVRAHGP
FT                   VRLVGLDTVPDDAVTMVVAMMGAPTVMLEKVPSAEQASRAVEALAAYLGRTPTHLACAE
FT                   AGGVNALVPVVAAAQLGLPLIDADGMGRAFPELQMVMPTLYGIGATPMSIADEKGNSGV
FT                   FATIDNHWAERLARSATIDMGCSAMISLFPMNGEQARKALVPGTLSLCAELGRLVREER
FT                   AAHRDPVAAVTERLGGVELFHGKVVDVSRRTEGGFARGEAVLDGLGGCTGERMELRFQN
FT                   ENLVAERDGTVVASVPDLICVLDAEAGTAITTETLRYGQRVRVIAAPCDPRWHTPEGIE
FT                   LVGPRYFGYDHDPVRVGMGVGA"
FT   gene            480927..482030
FT                   /locus_tag="Tbis_0429"
FT   CDS_pept        480927..482030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0429"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   scl:sce2619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87157"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A3"
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /protein_id="ADG87157.1"
FT                   /translation="MSYTLEREDLADLARGAALLGTGGGGDPYIGRLLVEQALREGDGK
FT                   ITVLDPSDLRDDDLVIPTAQMGAPTVVVEKIPHGDEPVAALRALEERLGRRADATMPIE
FT                   CGGINSMIPLLVAARTGLPVVDADGMGRAFPELQMETFSVYGVPGSPLAIGGENGETVI
FT                   IDTGADNKRMEWLARGVTIRLGGVAHIAEYAMSGAEVRRTAVPNTLTLGLRIGRALRTA
FT                   RERHGDFIEALAGALEGSGYDNIRVLFRGKVVDVERRTVGGFARGHATFAAFDGPERLE
FT                   LTFQNENLVARVDGEVRCVVPDLICVLEAETGEPITTEGLRYGQRAVVVGISTPELMRT
FT                   PEALAVFGPRAFGLDVEFEPVERLVSP"
FT   gene            482035..483099
FT                   /locus_tag="Tbis_0430"
FT   CDS_pept        482035..483099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0430"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   scl:sce2619 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87158"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A4"
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /protein_id="ADG87158.1"
FT                   /translation="MPYHLGERDVDHLARGVTLLGSGGGGQTDTAGRLLRRTLAGDRVA
FT                   LLRRDELPGGDIVPVGIVGAVSAFTERLPAGGEWGPVVAAVTERTGVRPAGLMSIEAGG
FT                   VNGILVFVAARELGLPVIDADLMGRALPRLDQTSTAAAGEPLTPLAIGDATGRLLILDG
FT                   LSPTAAERIVRSALSEFGGWAAVALRPLPAGRLDRVAIPGSFARALRLGACHAAWHRAA
FT                   DPYAMAAALGARVLVLGRVVEVVRHRAGTGFGRGSVIIRATGGRTLVRLEMENEYLLAL
FT                   ADGRPVASTPDILCVLDRATGVAISCDSVRGGAEVVVLHLPGPAFWWRPEAVGAVAPRA
FT                   FGLDIDPVGPEDRR"
FT   gene            483096..484640
FT                   /locus_tag="Tbis_0431"
FT   CDS_pept        483096..484640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0431"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="KEGG: xcv:XCV4471 sugar diacid utilization
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87159"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A5"
FT                   /inference="protein motif:COG:COG2508"
FT                   /protein_id="ADG87159.1"
FT                   /translation="MRRGAPTLRELLGHPRLAAAVPLAGEDDLDRPVTGVTLIDPADTS
FT                   PVQAGDIALCPAVPPGFLSGWRLDATLRRLHDQRAAALAVPVGENGALLDSTRQLARHL
FT                   HLPVLGLRTAPLRWAGEAIALVHAPEVDAAEVLRRAHRALTREPMSPQEVARALSGILD
FT                   RPVGVFSPDGTPTGVTPEPSPRFNPRATVAQIVTEHGRTTVAVPVPGTTVGAVDLWLAA
FT                   ALGQAPAYWAAAVRDVLQAGALAVQRWQAVRRVVLERDARLRAGLFSDLLEGRLGTGDV
FT                   PRERASEIGWRLDGWHVAFHIAALGQVDLLRHTDAVSAAIAAEGIDAAVVERGDGWSGW
FT                   TTTRDEPDQDADRELLAALRRVRRRLATRFDCAIGVGRAYLGPAGLTRSLAEAWDAARL
FT                   ARGRPQAGRLAHIDRLGLAQLLVAWASTETFAPTAARLLKPLESQPGDLIATLTAYLDA
FT                   GGSVAETAAVLGVHRNTVTARLRRIEELLTVDLANPDDRLALHLACRVTQGRQSGG"
FT   gene            484977..485990
FT                   /locus_tag="Tbis_0432"
FT   CDS_pept        484977..485990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0432"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: cps:CPS_2928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87160"
FT                   /db_xref="GOA:D6Y4A6"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A6"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG87160.1"
FT                   /translation="MTRTPYVARHRSRLGYRLAYALRHPGKVWPYLRRLTRDARLRLTT
FT                   RDHISYYRAVMRADIKEMGPDAAIGSHSRRSWLRVGKMQFDYLIAHGLSPQDRVLDIGC
FT                   GNLRLGWRLIHYLEPGHYYGIDISPEILLAAADTVAWYGLQAKLPYLALVDDLTFAALP
FT                   DAYFTVVHAHSVFSHSPIEVIDECLRHVGRILHPDGFFDFTFDRTEKEEHHVLREDFYY
FT                   RTETLVELAARYGLRAEFMADWERYRHKQSRIRVRHARRRAVGRGEGGRRPGGRAVRSP
FT                   VSRPAVTGRAREAAVGGRGRPPSRSRSAALPGIPRRRVIRPAGRGRRGPGRRRCTW"
FT   gene            complement(485935..487116)
FT                   /locus_tag="Tbis_0433"
FT   CDS_pept        complement(485935..487116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0433"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: rpi:Rpic_1910 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87161"
FT                   /db_xref="GOA:D6Y4A7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A7"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG87161.1"
FT                   /translation="MESGEKILVIDGARTPVGSFGGALKDVPAHELGAIAVREALRRAG
FT                   VDGSDVGEVVMGCIGQVGPDAYNARRVAVAAGLPVGTPAYTVNRLCGSGLQAVWSAAMQ
FT                   LRWGDIDFAVAGGDESMSRMPFYDFGARSGYKLGDRTLYDGTVMMLTDPFHNIHMGRTA
FT                   EAVARKYGVSRQEQDEFALRSQRRAASPEAKAAFAEEITPVEVKGRKPYTVEADEHPRP
FT                   DTTLEALARLKPVFEENGTVTAGNASGINDGAAALVLTRESVAAERGLRALVSLEAVVT
FT                   AAMEPELMGYAPVLALRKLFERTGTGPKDIDVFEVNEAFAAQAVAVIRDAGLDPEKTNP
FT                   YGGAIALGHPVGATGAILTLRVAKHLVRHDKELGVVTMCIGGGQALAALFRRV"
FT   gene            complement(487232..487423)
FT                   /locus_tag="Tbis_0434"
FT   CDS_pept        complement(487232..487423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87162"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87162.1"
FT                   /translation="MGNRMAARGVATGQGNTSARETEPRSIPAGTGGGYCRGAPCYRHR
FT                   GWEAGAGMALALFTLTSY"
FT   gene            complement(487854..488225)
FT                   /locus_tag="Tbis_0435"
FT   CDS_pept        complement(487854..488225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0435"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: tgr:Tgr7_1925 putative transcriptional
FT                   regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87163"
FT                   /db_xref="GOA:D6Y4A9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4A9"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADG87163.1"
FT                   /translation="MSIQDRLAAGAATWCAPLTCKPLSEDEAAEIAPLFKALADPVRLR
FT                   LLSLIASHEGGEVCVCDLTVAFDVTPPTISHHLKVLRQAGLIEGDRRGTWVYYRANPEV
FT                   LAKLAAVIGPAPAVQAGTA"
FT   gene            488619..489872
FT                   /locus_tag="Tbis_0436"
FT   CDS_pept        488619..489872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0436"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   pst:PSPTO_2801 prolidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87164"
FT                   /db_xref="GOA:D6Y4B0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B0"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADG87164.1"
FT                   /translation="MSAFVLENANLLDLESGEFRPATSVRVEGDRIVEVSEPGATLTAP
FT                   DDVPRLAAGGRTLLPGLIDAHVHAAITTMDFAALGRRAYTRIGIEAKAILERMLRRGFT
FT                   TVRDAGGLDAGLKEALQLGLISGPRVFRSGRVLSQTGGHGDTIPPNPAAEPHLCACSIH
FT                   STGFAHIADGPDAVRRAVREELKGGADQIKVMAGGGVASPSDPIDMVQYSEEEIRVAVE
FT                   EAARRRTYAFAHAYVPDAIVQAVRAGVRSIEHGNLIDAEAARVMAEHGCYLVPTLVTYD
FT                   QLVELGRQLSLPPESMAKLDAVVNAGKSAIETALAAGVRIGFGTDLLGETHDAQSKEFL
FT                   LRAEVQPPLDVLRSATLVNAELLGKTGELGVIAPGAYADLLLVDGDPLADISVLTGQGE
FT                   RLDLIVRGGEIVVNRLPG"
FT   gene            complement(490130..491134)
FT                   /locus_tag="Tbis_0437"
FT   CDS_pept        complement(490130..491134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0437"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="KEGG: sde:Sde_3061 xylanase/chitin deacetylase-like;
FT                   PFAM: glycoside hydrolase family 11; SMART:
FT                   cellulose-binding family II"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87165"
FT                   /db_xref="GOA:D6Y4B1"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="InterPro:IPR033119"
FT                   /db_xref="InterPro:IPR033123"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B1"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ADG87165.1"
FT                   /translation="MFRSPRGHGRGRRFIGRICALAVAVITGLTMSVGTAHAQTISSNQ
FT                   TGYHDGYFYSFWTDAPGTVSMTLGSGGNYSTSWWNTGNFVAGKGWATGGRRTVTYSASF
FT                   NPSGNAYLALYGWTRNPLVEYYIVESWGTYRPTGTYKGTVTTDGGTYDIYETTRYNAPS
FT                   IEGTRTFKQFWSVRQSKRTSGTITTGNHFDAWARAGMQLGSFDYMIMATEGYQSSGNSN
FT                   VTLGTGGGGGTTPPPGGGGGGGGGGCQATIIPGQVWADRFNLSVQVTGTDNWVVTVTVT
FT                   PPQKIIATWNGNPTWDYTGNVMTMRPNGSGNTFGFTIMHNGNWSWPSVTCRVA"
FT   sig_peptide     complement(491018..491134)
FT                   /locus_tag="Tbis_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 39"
FT   gene            complement(491711..492013)
FT                   /locus_tag="Tbis_0438"
FT   CDS_pept        complement(491711..492013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_2843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87166"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B2"
FT                   /inference="similar to AA sequence:KEGG:Sama_2843"
FT                   /protein_id="ADG87166.1"
FT                   /translation="MREHCCAEMTRRVAWRCAEHDDPFDCPDAVVIFDARFQEYGLIVR
FT                   DGGRSFIEIHYCPWCGSRLPESRRDRWFAELEQRGIDPWTDEIPPEYQDDRWLHS"
FT   gene            complement(492179..492865)
FT                   /locus_tag="Tbis_0439"
FT   CDS_pept        complement(492179..492865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0439"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR; KEGG: rso:RS05447 transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87167"
FT                   /db_xref="GOA:D6Y4B3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B3"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ADG87167.1"
FT                   /translation="MRPVDLAREHGLSTQAVRNYESAGILPPAGRTAAGYRVYTPVHAA
FT                   ALRAFLSLVAGHGHAMATAIMQAVNRGAVDEALRLIDESHARLLEDRRTLEAVEAALRD
FT                   LAPAPPPEPGGVHIGALARRLGVRPATLRKWEKAGLVRPRRDPRTGYRVYGAADVRDAR
FT                   LVHQLRRGGYLLAQIAPLIAQVRAAGGVEPLESAIRSWRERLAARGRAMLTGAADLEAF
FT                   LRARQG"
FT   gene            492956..494131
FT                   /locus_tag="Tbis_0440"
FT   CDS_pept        492956..494131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0440"
FT                   /product="Erythromycin esterase"
FT                   /note="PFAM: Erythromycin esterase; KEGG: swi:Swit_1817
FT                   erythromycin esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87168"
FT                   /db_xref="GOA:D6Y4B4"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B4"
FT                   /inference="protein motif:PFAM:PF05139"
FT                   /protein_id="ADG87168.1"
FT                   /translation="MEIRDAARPLDGAAVSAFLRSLPARPDLLGLGEAMHFVTELGEAR
FT                   NAIFRHLVEHEGFRAFAIESDCLKALLVDEYVTTGAGDLDEVMERGFSHGFGAFPANRE
FT                   LVRWMREHNERHGDRLRFFGIDGPLEYWAASPREALAGLYALVDGPPCSWETIDELLGP
FT                   DARWSDEATVLDPSRSIGQSDDARRLRLITDDLITLLETQAPRLSPADRERAELYARTA
FT                   VGLLRYHHWMADTSPARVSRLSAVRDALMAANLRAIAAHGPVLVFSHNLHLQRSGSTMT
FT                   FGDQELAWWSAGALVSAHLGDRYAFIASALGALGDDGPPPGTLEGALATLPWERALADA
FT                   RALAAAVPGAAPRTSPHYAYFPLDPAQIGTADGVLFLGRVRVPDWPRGPRE"
FT   gene            494320..494907
FT                   /locus_tag="Tbis_0441"
FT   CDS_pept        494320..494907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0441"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_02830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87169"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87169.1"
FT                   /translation="MVDTALATDPAAIERAVRDEPVGTTWPWNSGPKAIEAFLHRVVDA
FT                   MNGMRELCVVEAEFGHYGSGYASFVDVFLTKRDGSLRETFADGWTRFTGWTLALCRLAP
FT                   FAVLFGNSRVWYGPRPGTRSSSIPHRDRLPEDTVPASRTELWELAELLEGYGFAFLDPE
FT                   ILMLPIDPTLEIDTTLGERPYRVWDAWFHWAD"
FT   gene            complement(494938..495252)
FT                   /locus_tag="Tbis_0442"
FT   CDS_pept        complement(494938..495252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0442"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   rce:RC1_2954 multidrug resistance protein SugE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87170"
FT                   /db_xref="GOA:D6Y4B6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B6"
FT                   /inference="protein motif:PFAM:PF00893"
FT                   /protein_id="ADG87170.1"
FT                   /translation="MAWVVLIVSGMLETAWAVALAESKGLTRPLPTALFVLSLAASMLG
FT                   LGYALRSIPVGTAYAVWVGIGAVGTAVYGMVVLGEPATAGRLICLALIISGVVGLKLLH
FT                   "
FT   gene            495336..495815
FT                   /locus_tag="Tbis_0443"
FT   CDS_pept        495336..495815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV1106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87171"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B7"
FT                   /inference="protein motif:COG:COG4994"
FT                   /protein_id="ADG87171.1"
FT                   /translation="MNDRVLSVVSGSGLTVMVREPPGNRLIDMGGEHDDPVQAAITGEM
FT                   RLLEWEVRSSAVLLGELLDPEFTEIGASGRLWDRHSLINALTQESDAPPYRITVSEMKG
FT                   RLLAPGIVHLTYVSDENGRRARRSSIWRRSEQGWRLYFHQGTLLPPQEPMPADLG"
FT   gene            496054..496434
FT                   /locus_tag="Tbis_0444"
FT   CDS_pept        496054..496434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0444"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: dsh:Dshi_3967 ArsR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87172"
FT                   /db_xref="GOA:D6Y4B8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADG87172.1"
FT                   /translation="MISREALAPAAALFRSLADPVRLSIVQRLARGEARVVDLTRELAL
FT                   PQSTVSKHLACLRDCRLVDYRAEGRQSFYFIATPELLDLLRSAEALLAATDQAVALCPT
FT                   YGTACAGSRPAEAPAVGEGTAG"
FT   gene            496431..497153
FT                   /locus_tag="Tbis_0445"
FT   CDS_pept        496431..497153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0445"
FT                   /product="cation efflux protein"
FT                   /note="PFAM: cation efflux protein; KEGG: sus:Acid_3868
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87173"
FT                   /db_xref="GOA:D6Y4B9"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR026765"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4B9"
FT                   /inference="protein motif:PFAM:PF01545"
FT                   /protein_id="ADG87173.1"
FT                   /translation="MTALTVGPSPERRAVLMRRVRLLVAATISYNVIEAVVAIAAGSVA
FT                   SSGALVAFGLDSVIEVASAAAVAWQFSARDPEVVERRERRALRMIALSFFALALYVSVD
FT                   SVAALLGGGEAEHSTPGLILAALSLVIMPVLSYAQRRAGRELGSASAVADSKQTLLCTY
FT                   LSAVLLAGLAVNSLFGWAWADPVAALVIAGVAVKEGLEAWRGDACCQPPLHPAAALSGR
FT                   ADGEPGCSACGPGCACCS"
FT   gene            497188..497814
FT                   /locus_tag="Tbis_0446"
FT   CDS_pept        497188..497814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce8712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87174"
FT                   /db_xref="GOA:D6Y4C0"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C0"
FT                   /inference="similar to AA sequence:KEGG:sce8712"
FT                   /protein_id="ADG87174.1"
FT                   /translation="MALTALAVYLVSLALAFGVRTWVQWRRTGDTGFRGGGLRPGSVQW
FT                   WARLLFIAALVAVAAGPVAELAGLAAVPALDVPVVRVSGLILALLGTAAVLAAQASMGA
FT                   SWRIGVDESERTDLVTTGAFAMVRNPIFTAMMITAAGLAAMVPNVVSLAALALTVVSIE
FT                   VQVRAVEEPYLLRVHGEAYARYAARVGRFLPGLGRLRRSGAPAGR"
FT   sig_peptide     497188..497253
FT                   /locus_tag="Tbis_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.801) with cleavage site probability 0.473 at
FT                   residue 22"
FT   gene            complement(498036..499166)
FT                   /locus_tag="Tbis_0447"
FT   CDS_pept        complement(498036..499166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0447"
FT                   /product="Pectinesterase"
FT                   /EC_number="3.1.1.11"
FT                   /note="PFAM: Pectinesterase; KEGG: cja:CJA_0181 pectin
FT                   methylesterase, putative, pme8C"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87175"
FT                   /db_xref="GOA:D6Y4C1"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR033131"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C1"
FT                   /inference="protein motif:PRIAM:3.1.1.11"
FT                   /protein_id="ADG87175.1"
FT                   /translation="MSHTPLIGRRQVLAGAAGILGLALASPARAAHVPPFGRYGSPRHR
FT                   LNDRTLYVDSQGRGDYTTVQAAVDATPDSPAEGWTLVIAAGTYRETVLVPQAKTGLCFL
FT                   GATGDARDVVIVYDNAAGTPKPDGGTYGTSGSATATIQADGFTAAHVTFANDWLRADHP
FT                   EITDTQAVAAKVMGDRSYFERCRFLGHQDTLYADTRNVATFARQYYRECYIEGDVDFVF
FT                   GRATAVFERCELTTLARDVTFRPYGFVFAPSTAAANPHGFLAVHCVINGPAADASFGLA
FT                   RPWRPSSDPTAVPSLVVRETWMGPSIDAATPYVDMSSGYHWRDARFGEFHNKGPGAAIP
FT                   VPENRPQLTPQQAAEHTPRKYLGDWHPRPALLPRPH"
FT   sig_peptide     complement(499074..499166)
FT                   /locus_tag="Tbis_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.901 at
FT                   residue 31"
FT   gene            complement(499421..499494)
FT                   /locus_tag="Tbis_R0013"
FT                   /note="tRNA-Gly5"
FT   tRNA            complement(499421..499494)
FT                   /locus_tag="Tbis_R0013"
FT                   /product="tRNA-Gly"
FT   gene            499776..500351
FT                   /locus_tag="Tbis_0448"
FT   CDS_pept        499776..500351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0448"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: amc:MADE_01987
FT                   deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87176"
FT                   /db_xref="GOA:D6Y4C2"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C2"
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /protein_id="ADG87176.1"
FT                   /translation="MLLSDRDLRAEIESGRIKIDPWDPEMLQPSSIDVRLDRYFRVFEN
FT                   HRYPHIDPAVEQPDLTRLVEPVGDEPFILHPGEFVLASTYEVISLPDDVAARLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFEGHVTLELSNVATLPIKLWPGMKIGQLCMFRLSSPAEYPYG
FT                   SPRYGSRYQGQRGPTPSRSYLNFHRTKV"
FT   gene            500497..501114
FT                   /locus_tag="Tbis_0449"
FT   CDS_pept        500497..501114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0449"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   aba:Acid345_3130 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87177"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C3"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADG87177.1"
FT                   /translation="MRLRLTPREDSYYDLFAHAANNIVTASRVLVEIISDGSDREALAE
FT                   KMRACEHAGDEHTHAIMNRLNESFITPFDREDIYRLASNLDDVMDFMEAAADLIVLYQI
FT                   DRLPRDVIQQVEVLERAAELTADAMPRLRSMQHLNGYWIEINRLENQADQIYRRLLAKL
FT                   FSGEYDALTVMKMREVIEQLELAADAFEHVANTIESIAVKES"
FT   gene            501115..502116
FT                   /locus_tag="Tbis_0450"
FT   CDS_pept        501115..502116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0450"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: sfu:Sfum_2275
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87178"
FT                   /db_xref="GOA:D6Y4C4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C4"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADG87178.1"
FT                   /translation="MELALVIGVIVIALIFDYTNGFHDAANAIATSVSTRALTPRTALI
FT                   MAAVMNFIGAHLGTSVAQTVGKGIIAPPDGQQGLLIVGGALIGAILWNLITWYFGLPSS
FT                   SSHALIGGLVGSALAAGAGVSWSGVVEKVVIPMILSPVIGFTLGALIMIAILWIFRRSN
FT                   PHRTGKGFRYAQTVSAAAMALGHGLQDAQKTMGVIFLALVVGGYVAPTDPIPEWVITIA
FT                   AAAISLGTYAGGWRIMRTLGRRIIHLNAPAGFAAEMAAASVLYGAAMGFGAPISTTHTI
FT                   TTAIMGVGATRRLSAVRWGVAGNIVTAWVLTIPAAAVVAALSYGLLHLIFRV"
FT   gene            complement(502118..503005)
FT                   /locus_tag="Tbis_0451"
FT   CDS_pept        complement(502118..503005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0451"
FT                   /product="mycothiol biosynthesis acetyltransferase"
FT                   /note="TIGRFAM: mycothiol biosynthesis acetyltransferase;
FT                   PFAM: GCN5-related N-acetyltransferase; KEGG: predicted
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87179"
FT                   /db_xref="GOA:D6Y4C5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017813"
FT                   /db_xref="UniProtKB/Swiss-Prot:D6Y4C5"
FT                   /inference="protein motif:TFAM:TIGR03448"
FT                   /protein_id="ADG87179.1"
FT                   /translation="MTVRVEIRETPGDQEAVLALAEAAAEADGVRPLNEQTLLALRYGG
FT                   PSGARFLLLYDGDELAGFAYLEPSDPPSGELVVHPGFRGRGLGGRLLAAVLDTGGKGVR
FT                   LWAHGDLPAAARLAAGFGMTRARALWRMRRPLTTPLPAPELPEGVRLRTFEPGRDEEAW
FT                   LALNARAFADHPEQGSWTLEDLKRRQQEPWFDPAGFFLAERAGTLVGFHWTKVHAQAEG
FT                   ADGPIGEVYVVGVDPEERGTGLGRALTLAGLAHLRSRGLDQVMLYVDEANTAAVRLYES
FT                   LGFTRWTVDVMYRR"
FT   gene            503136..504872
FT                   /locus_tag="Tbis_0452"
FT   CDS_pept        503136..504872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0452"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: scl:sce7039 putative
FT                   5'-nucleotidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87180"
FT                   /db_xref="GOA:D6Y4C6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C6"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ADG87180.1"
FT                   /translation="MTKAFLTRLAVAGTAVAGVLALAALPAGADPAPQSASKGRGNGGS
FT                   KPDHSVPVRLLTINDLHGNLEPPTGSSGRIVDETGQTVDAGGAAYLAAHLKRLRDRNTL
FT                   VVAAGDLIGASPLISAAYHDEPTVSLLDKLGLATSAAGNHEFDEGYAELKRIMDGGCHP
FT                   TDGCSPAGKWKGARFDYLAANVVREKNGAEALPPYVIKQVNGVKIGFIGLVTQTTPSIV
FT                   TSSGIQGLEFTDEVEAANRVSRLLAAKGVKAQVVLVHEGDQVATPQSPDTCPVVPGPGS
FT                   RIAAGLDPEIDLVISGHSHQAYICKIKDPAGQDRYHTQGSSFGRIITQIDFRVDRKTRD
FT                   VIRSSVSADNHVVTRTITPDPEVEAYVQTWKERVSVVANRPVGNITATIARDPSGAGES
FT                   PLGNLIADAQLEAAREGGAEIALMNPGGVRADLTYPASGSEGDGVVTYGEAFTVQPFNN
FT                   LVQVVTLTGEQLRRLLEQQWTESYTRVLQPSASLTYTADLTKPIGSRVSDIKINGIPVT
FT                   DTQRIRVAANNFLIGGGDGFTVFTEGTELWSGPLDIDAFVAYLSAHSPVDPPATDRITF
FT                   IR"
FT   sig_peptide     503136..503225
FT                   /locus_tag="Tbis_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 30"
FT   gene            complement(505014..505769)
FT                   /locus_tag="Tbis_0453"
FT   CDS_pept        complement(505014..505769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0453"
FT                   /product="putative two component transcriptional regulator,
FT                   winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: bcb:BCB4264_A1351 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87181"
FT                   /db_xref="GOA:D6Y4C7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C7"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ADG87181.1"
FT                   /translation="MSNLLLLTNALEPSTEILPALGLLLHPVRVAPAEASALIDAPPAD
FT                   AILVDARRELIHAKSLCRLLRTTGLTAPLIAIVTEGSLAAINAEWGVDDVVLESAGPAE
FT                   VEARLRLAIGKLSTSEAEKAPGEIRSGDLSIDEATYTARIRGRVLDLTFKEFELLKYLA
FT                   QHPGRVFTRAQLLQEVWGYDYFGGTRTVDVHVRRLRAKLGSEYESLIGTVRNVGYRFVP
FT                   DRGGDQQNKVAREKAREAAREKNPEEQHA"
FT   gene            505996..506244
FT                   /locus_tag="Tbis_0454"
FT   CDS_pept        505996..506244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0454"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: ade:Adeh_1120
FT                   molybdopterin synthase subunit MoaE / molybdopterin
FT                   synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87182"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C8"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ADG87182.1"
FT                   /translation="MASGTVRYWAAAKDAAGVAEEPFEAETLGELIRRISGNPELERVL
FT                   RRSSFLVNGAPAGTRDPGTIRLPEGAVVEVLPPFAGG"
FT   gene            506376..507056
FT                   /locus_tag="Tbis_0455"
FT   CDS_pept        506376..507056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: methyl-accepting chemotaxis sensory transducer
FT                   with cache sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87183"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4C9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87183.1"
FT                   /translation="MRKLLVSVFVLAALLVGLDRVAVVGAEREIARRVQAVFDLPDPVS
FT                   VDITGFPFLTQALSGRLEEISLSAGEVTKAGITLSRIDATLEGVTAPLGELIEDSANAD
FT                   VRAERITGTAVISMKTIAEFAPPGIRVTGTGGDTVKVSGRVTAFGQRVPVDAEMKIHVG
FT                   RGEIRLTPVSVNVGGGMQVPNAERLLTFTVPIPNLPLGLKVTRVTSTSDGLALTGTATD
FT                   VRFR"
FT   sig_peptide     506376..506444
FT                   /locus_tag="Tbis_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.435 at
FT                   residue 23"
FT   gene            507040..507618
FT                   /locus_tag="Tbis_0456"
FT   CDS_pept        507040..507618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0456"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   rpa:RPA0550 RNA polymerase sigma factor RpoE"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87184"
FT                   /db_xref="GOA:D6Y4D0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADG87184.1"
FT                   /translation="MSDSAEPGRAGEPPGPAVRDKGVGTGAGTGEELVRALFAHHAGPL
FT                   YGYALRLTGDPGKAEDVVQETLLRAWRHPAVLEGRPVRAWLFTVARNLVVDQHRARQAR
FT                   PQETGDEALARVPADDELERAVESWEIAEAIASLRPEHRDVLLEVYYRGKSVKEAAEAL
FT                   GIPPGTVKSRTYYALRALKLALEERGLAP"
FT   gene            507636..508391
FT                   /locus_tag="Tbis_0457"
FT   CDS_pept        507636..508391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0457"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: ank:AnaeK_0242 Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87185"
FT                   /db_xref="GOA:D6Y4D1"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87185.1"
FT                   /translation="MSLGVYVLGALDADEEAAVRAHLEACAACRAEAEELSGLTPLLAR
FT                   VTERDIEQVGEPPRAVLDRLITTAARRGRRRRLLLALAASVSVVALAGTAWLTVAQGAR
FT                   NGAAESAADTSTAQTADISAADRPEIALDRASTPGDGRTTMATEARGANGDMRVAVRLI
FT                   PREGGTEVVARVAGVPAGTLCTLRAIGTDGTVAPVGSWSVAPGLYREDNVVFEGRTGLQ
FT                   LPYIQRLELTGSDGDVLVTVPVRHRPGPG"
FT   gene            508576..509103
FT                   /locus_tag="Tbis_0458"
FT   CDS_pept        508576..509103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0458"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_4125 cytochrome c biogenesis
FT                   protein transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87186"
FT                   /db_xref="GOA:D6Y4D2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87186.1"
FT                   /translation="MVGVIVLAVTLAVGVVIGLFLRHRDGRMRTVSAPASDQAPQERSP
FT                   GEPSAGATVLTSEDIGAELGERATLVQFSTAFCQPCRATRVVLGEVARIVPGVRHVEID
FT                   AESRLDLVRRLGIMRTPTVLVLDRSGNVVKRASGRPRKVDVIAALGAVVDDDAPRPAAE
FT                   TSHEPSQHSDKV"
FT   gene            509296..509706
FT                   /locus_tag="Tbis_0459"
FT   CDS_pept        509296..509706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_0151 CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87187"
FT                   /db_xref="GOA:D6Y4D3"
FT                   /db_xref="InterPro:IPR016942"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87187.1"
FT                   /translation="MQIDPRGPRFSAVITTLVLAAVLVTGSAWLLAFQALVFVLGIFDA
FT                   SPYGLIYKRLVRPRLGPPSELEDAAPPRFAQGVGSVFAIAGLIGFATGITPLAYGATAA
FT                   ALLAAFLNAAFGLCLGCQMYLIIRRLQPGRVQ"
FT   sig_peptide     509296..509388
FT                   /locus_tag="Tbis_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.344 at
FT                   residue 31"
FT   gene            509703..510542
FT                   /locus_tag="Tbis_0460"
FT   CDS_pept        509703..510542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0460"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="KEGG: cja:CJA_2345 rhodanese-like domain protein;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87188"
FT                   /db_xref="GOA:D6Y4D4"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D4"
FT                   /inference="protein motif:PRIAM:2.8.1.1"
FT                   /protein_id="ADG87188.1"
FT                   /translation="MSRSAVLVDADWVEANLDTPGVVIVEVDEDTTAYDKGHIRGAIKL
FT                   DWKKDLQDPVRRDFIDKAGFEALLSERGIANDDTVVLYGGNNNWFAAYAYWYFKLYGHE
FT                   KVKLLDGGRKKWELESRELVTEVPQRPRTNYKAKDQDLSIRAFRDDVINAIGKLNLVDV
FT                   RSPDEFVGKLLAPAHLPQEQAQRPGHVPTARNIPWSKAVNDDGTFKSDEELRKIYSDAG
FT                   VDFSKDTIAYCRIGERSAHTWFVLHELLDLPNVKNYDGSWTEYGSLVGVPIELGEAR"
FT   gene            510542..510841
FT                   /locus_tag="Tbis_0461"
FT   CDS_pept        510542..510841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87189"
FT                   /db_xref="GOA:D6Y4D5"
FT                   /db_xref="InterPro:IPR010814"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87189.1"
FT                   /translation="MSQGCGAPAQTVTLPVGVDLSSQAIIQGVVTGTGGTAYARLLDRT
FT                   GEFAGEVVVSDEGVFRFFAAPGRWTVRIIAAGGVTRDVEVEAKLGEVTQVSIDL"
FT   gene            511331..512695
FT                   /locus_tag="Tbis_0462"
FT   CDS_pept        511331..512695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB1601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87190"
FT                   /db_xref="GOA:D6Y4D6"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87190.1"
FT                   /translation="MRQVSGTSAHAVADQPAVRRRPAWLLSPYALPLHALRIAGACALP
FT                   LIIWFSLGRVIRWGLLLLAATISHGEWYQARLVVVMFLFTLVVMASLVTTIGMLYILRG
FT                   ALMETQARRAAGEAHESLLNALNRTALVFCGIYLTWGFLAEDARDFMNIDLLRQPDRIF
FT                   IDAFAGEESTVMRGLIGLDLIVSAVTMAVAWVVKTLFARRHEAGRGRFSGVIATCGELA
FT                   FVLYGLNAVTTVLGARSDWVGSRVVIVAWQEWMEKARESIPGWKSVTDFIGEVWPYVVD
FT                   ALVLPLTWLTVGILVYGAYAEDTRTTIRGTPLERAAAPLERRTHALTRRALDRLTEGWT
FT                   SRWIPLLHSLRLTMRGGAPLFGMFALCYVGLHIGGIYLERAGRYLLDTGEPYFWIFTSV
FT                   PIEFVSELIVTTLSMCLIAATFDLAATRDRLARAQVSAGSAARDRSSPETSPLPS"
FT   gene            complement(512634..514322)
FT                   /locus_tag="Tbis_0463"
FT   CDS_pept        complement(512634..514322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SL44-1; basic proline-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87191"
FT                   /db_xref="GOA:D6Y4D7"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87191.1"
FT                   /translation="MSQPPRNGTPSGNTPEGQEWYVLPPDRPSDADPSAGTSGAFGMPA
FT                   QPPGGGAPAHGPYPQGGPADLPYGPHPGGHRGDLGYHFPVQPHGPRPGEGPHSAPASPP
FT                   PAAQPGPSLAAQPGEGGFPAPSPSHGQRPGEGGYPTPAPSHGQQPGEGGYSTPAPSSGT
FT                   QPADITYGAAPPPQGSHPGGEPQPGDITYGAALPPQPGDPAYEPAPPVPGAQPGEGAHG
FT                   TPPPPDITYSAALPPQGGRPGGEPRPDDVTYGAPLPAQGPQPGGEPQPGDITYSGPLPS
FT                   QGSPDITYSGRLPAQEPRPASSRVRPPQDKRVWPPEDDEDRSTQPFPALRGTRTLPPQP
FT                   PQQAEGPGRPEPPATAESGAAAQEGAAPGTGKGTSRARRTILLGGAAVLSVALAVGVPG
FT                   WFHYSVYRYGRPADHVHIVPKGESMVWQHVEWRATLFEIPPPDSSPGSTDRKWLKAVIT
FT                   RTALDQEGAIRHGTPEVMLTDRAGRTWRMEELSNETPPSTEQNRIGVTYRMEFIGVAPP
FT                   EVADEVELLVRPSTYRDVPGQSTEDFMKAAAKSQERNDHVLRFRR"
FT   gene            complement(514322..514999)
FT                   /locus_tag="Tbis_0464"
FT   CDS_pept        complement(514322..514999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0464"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SMc02592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87192"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87192.1"
FT                   /translation="MTVTQPQLPSVEGPAAEARPAKAGAGRRIARGLIGLALAAAAVYA
FT                   QTFEPSYEEQLSNLTVHGRIGEVVHTSRYSVKVNWIKAALSVDTKNFGVGDTIQVRTSN
FT                   LFLVVNISARGVREPFRLSQGSPPVLRTRDDRVYWPTDKVDSSLTLFSKWIQPGLWSSG
FT                   VLVYEVPKDAVPGARLVFAPPAGLLVVDLYQPETEIDLGLTGGAAARLIDEAEEYHTLV
FT                   NKK"
FT   gene            complement(514996..515655)
FT                   /locus_tag="Tbis_0465"
FT   CDS_pept        complement(514996..515655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87193"
FT                   /db_xref="GOA:D6Y4D9"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4D9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87193.1"
FT                   /translation="MTSSRGGKRRRRPILIPAAIAIAAAGLGVTALLGGLQEAPEKPPP
FT                   EVAPGKIIDQGRFSTQFIKAIDTTEQDRYGTPKRSLQLVLKVKNVSNETAPVGGIPKPD
FT                   AKPSMGFGEFASSLLRIAPEIKSEYGPSVYVLSYGVQSRQLHPGITTTVVVKYDLKPTD
FT                   PAPSEITIDVGSFVYEEIGLRDKTRQWRLAGELDDEEFTPTVAARITLPVRQEQGQ"
FT   sig_peptide     complement(515551..515655)
FT                   /locus_tag="Tbis_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.343 at
FT                   residue 35"
FT   gene            515800..517716
FT                   /locus_tag="Tbis_0466"
FT   CDS_pept        515800..517716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87194"
FT                   /db_xref="GOA:D6Y4E0"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87194.1"
FT                   /translation="MGDPHPDHAQLQADRIYLGWQYAQLYPDPGPPPKRPPREEIPEEP
FT                   LDDEWLRRQRFQEDLFNRPVRLLRTSAAMIAALILLLGVTGVLMWPLVLLGLAAAGGVA
FT                   LICSYAIYKGRRTVDARIEERRERLQRERERRKRELLAAEEEHAAKYREWAERKRRYEE
FT                   QVTWYAVTVPDDIDRIDVAGGTLAGWSALITLVGATRLHSGGDLTVLDLSEGAIATDLI
FT                   ELARRGGDKPLVWVLPADLPRLDLGARLGPEAFADVLAHVVSVSEETGRDIGFDNAILE
FT                   RVLQVLGEDATISQVTAALRALAQVGDPRDDMRRGLLTAAQLERIGTLFGRGVADRVVI
FT                   ERAWAMESQLRKLEPLGSEAVPLPPARLRVISMDRQAGVFGNRVLGTYVATALTHLLRR
FT                   SPANRRPWDHTIIVAGADKLRGDVLDRLMDACETSRTGLVFTYRTLTPTVRERLGRGHA
FT                   AVAFMRLGNAEDARVASEHIGTGHRLELARLTERLSASAGGMAGRYTSTVGPQQASAGE
FT                   RSEGDLREDITRSTEWGRRATEVAHGAPHLSREFLVEPHQLQQLPTTSVIVTHATAEGR
FT                   RVRLADANPAILTFPKSTLRDIDEVLRALPDGGEEEASPAGADAPPPNLGPPPPRLDWR
FT                   KRP"
FT   gene            517813..520917
FT                   /locus_tag="Tbis_0467"
FT   CDS_pept        517813..520917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0467"
FT                   /product="ATPase-like protein"
FT                   /note="KEGG: bca:BCE_1138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E1"
FT                   /inference="protein motif:COG:COG0433"
FT                   /protein_id="ADG87195.1"
FT                   /translation="MHPFPLSGPWYRIQAITAPARSPSAEWDFVTVLPAVLSAAQRNRP
FT                   FVIGWLSRGAGAPLELITNAGPLEPPRQPKRAATTGDPPPAGPQPLLFPGGARGVEIGD
FT                   DWLADLADLVWTPCPGRQAPPLQGRAGTDAESGRPTLFESTLVTLMSRPFAWLVIAEPT
FT                   DLLDAEIAHLRTQLNVLRQYGDASERSRFDVERAERRMQELDAFREAGLWNVRVLAGAA
FT                   NAEELRQIAPVLVGSVEMSHHPYRLRTALSGAGLAGKDSGPGAGPVYAFTEALSLDLRD
FT                   PTDGAATPFAATAGALAALAGLPHREVPGVRVLDAGFFDVTSEAEVDGSSEVIDLGTIV
FT                   DGQDRPVGTFRVPLSTINRHVFVTGATGSGKSQTVRHLLEQLTEAGIPWLAIEPAKSEY
FT                   AAMAGRIEHLAPLTVINPSAPDNVPISVNPLAPEPGYPVQAHIDMVRALFMAAFDAEEP
FT                   FPQIMSLALQRVYEANGWDVVTGAGIPGAAVQPAVPTLEQLQQHALEVIQEIGYGNEVQ
FT                   ADVEGFISLRLRSLRVGSAGRFFEGGHPADIGGLLQRNVVLAIEDVANDEDKAFLMGTL
FT                   IIRIVEHLRMRARQEPREELAGGLRHVIVIEEAHRLLRNRGAGRASTHAVELLAGMLAE
FT                   IRAYGEGIIVAEQIPTKLVSDVVKNTALKIVHRLPAEDDRRLVGAAMNLSEDQSRQVVS
FT                   LRPGYAAVFADGMDRPLRVKIPLGEDRERPMLSPVPPIRGRRSAACGRECRTGKACTLV
FT                   ELREADLLAAAPEWAWLRIWTDTVILAFVTNRPLPGVPRVLADIWAELPPRRRECLLAT
FT                   LIERSVSRRAWSLRTWFDPALLTERAAEVAAGLLDPESVEGELPPMRPGDRPGPSWVIP
FT                   QVRWLHEVERLFPYGRPAPDLRDPAPPMEYPLFGTDPAGRPYPHPGVNGSVQPEGKGEG
FT                   AVAVGARVELLGHRAKALRHHPLSMEVDRNRALAWRVILGDDEHEGIQRDITIVAIGVE
FT                   PHERLRFVAQTMGASWLETVLSWPRRFVLPFDGDAPTELSFPDAG"
FT   gene            520950..522224
FT                   /locus_tag="Tbis_0468"
FT   CDS_pept        520950..522224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0468"
FT                   /product="domain of unknown function DUF1727"
FT                   /note="PFAM: domain of unknown function DUF1727; Mur ligase
FT                   middle domain protein; KEGG: aeh:Mlg_2195
FT                   UDP-N-acetylmuramoylalanine--D- glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87196"
FT                   /db_xref="GOA:D6Y4E2"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E2"
FT                   /inference="protein motif:PFAM:PF08353"
FT                   /protein_id="ADG87196.1"
FT                   /translation="MSQLPLRAQLATALGRTAATLSRATGRGDGSVIGGRIGLMLDPDL
FT                   LRKLAAHRKLALVSATNGKTTTTRLIAAALQELGEVATNAFGANMPAGHVTALASAKNA
FT                   PYGVLEVDEKYLPEVLDTTGAQVVCLMNLSRDQMDRAAEIWLLAQKWRRALSGKPAHAI
FT                   ANCDDPLVAWAASTAARVTWVAAGQRWREDSWCCPECGGPLDRPEPGTIGQGIGVSSAA
FT                   GAMWACRECTFHRPEPNWVLDGEEVIDPRGTRWRLDLQLPGQANRSNAAMALAVAAAFG
FT                   LEPARALPRLRTVTSVAGRYTTVERDGRVLRLLLAKNPAGWLEAFDVTDPALPVILSVN
FT                   AQVPDGRDTSWLWDVDYGVLKGRPVVVTGERRLDLALRLHVAGVPFQLCDSFGEAVSAV
FT                   PAGRVDVIANYTAFQQIRAEFGRAV"
FT   gene            522214..522921
FT                   /locus_tag="Tbis_0469"
FT   CDS_pept        522214..522921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0469"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase; KEGG: adenosylcobyric acid synthase ;
FT                   K02232 adenosylcobyric acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87197"
FT                   /db_xref="GOA:D6Y4E3"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E3"
FT                   /inference="protein motif:PFAM:PF07685"
FT                   /protein_id="ADG87197.1"
FT                   /translation="MQSDLCLVWIYPDLLSTYGDQGNVLVLEHRARARGIPARTIHVRS
FT                   SDPVPQQGHIYLIGGGEDRPQILATERLRRDGGLHAAVANGAVVFAVCAGYQLIGRVYA
FT                   GDEGQPVEGVGLLDISSGRGQRRAVGELAAEPDPALGLPTLTGFENHMGVTTLGPGVRP
FT                   LARTVAGVGNGDGTEGCYAGRVVGTYMHGPALARNPALADLLLSWVVGALPPMDDTWYE
FT                   RLRQERLAAVLSK"
FT   gene            complement(523295..523657)
FT                   /locus_tag="Tbis_0470"
FT   CDS_pept        complement(523295..523657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87198"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E4"
FT                   /inference="similar to AA sequence:KEGG:MCA0352"
FT                   /protein_id="ADG87198.1"
FT                   /translation="MARSLVIKVTAGMDAPERCNQAFTVAAAAVASGVPVSLWLTGESA
FT                   WFALPGRAKEFRLPEATPLEDLLDAVLTGGKVTLCTQCAARRGITVDDVIEGIRIAGAP
FT                   TFVEEVLAEGAQALVY"
FT   gene            524048..524545
FT                   /locus_tag="Tbis_0471"
FT   CDS_pept        524048..524545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0471"
FT                   /product="Domain of unknown function DUF1794"
FT                   /note="PFAM: Domain of unknown function DUF1794; KEGG:
FT                   Os01g0679600; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87199"
FT                   /db_xref="GOA:D6Y4E5"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E5"
FT                   /inference="protein motif:PFAM:PF08768"
FT                   /protein_id="ADG87199.1"
FT                   /translation="MDVHPELEPIAFLLGRWEGAGVIGYPTIESANFGQEVVFGHNGKP
FT                   FLTYQSRTWLLDRDGNRVRPLAMESGFWRMLPDRQVEVCLSHPTGIVEIYVGEVVFHKI
FT                   ELHTDVVARTVTAKEYNAGRRLYGLVNGNLMYAFDMAAMGQSLQAHASAELKKVADFVP
FT                   GE"
FT   gene            524574..524735
FT                   /locus_tag="Tbis_0472"
FT   CDS_pept        524574..524735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87200"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87200.1"
FT                   /translation="MGLRVEKREEPRARFRRRRAGWTWAESVLGHRLPGVRCLLWIRRD
FT                   VTDIQAEA"
FT   gene            524911..525321
FT                   /locus_tag="Tbis_0473"
FT   CDS_pept        524911..525321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0473"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: scl:sce0007
FT                   ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87201"
FT                   /db_xref="GOA:D6Y4E7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E7"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADG87201.1"
FT                   /translation="MAKAWHEELRARGYRITPQRQLVLEAVAKLGHATPEDICAEVRET
FT                   ARGINISTVYRTLELLEKLGLVTHTHLNRNAPTYHLASEADHVHLVCRGCGEVTEVSPD
FT                   MAAGLVSSLEEKLGFETDISHLTVYGHCRNCR"
FT   gene            525419..526258
FT                   /locus_tag="Tbis_0474"
FT   CDS_pept        525419..526258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0474"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: sus:Acid_0527 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87202"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E8"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADG87202.1"
FT                   /translation="MTVQAEAAIRRTKELFLEQDGRLLDQWSEKANISADELRELYRAL
FT                   RTALSGKEEDFTDVRGLLAEFSRTRVRQGYTPSETARTVFALKDAMYEIVEADGSPEAL
FT                   RGFAWFSRLVDDLGLFTFETFSNAREKIILDQTEQLLELSTPVVKLWEGIVAVPLVGTL
FT                   DSARTQVVMEKLLQTLMETGSQHAVIDITGVPAVDTQVAHHLLKTVMAARLMGAECVIS
FT                   GIRPQIAHTIVTLGIEFGDIVTKASLADALAHALRRSGAEIKVNGRRPDEEETESSP"
FT   gene            526255..526617
FT                   /locus_tag="Tbis_0475"
FT   CDS_pept        526255..526617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0475"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: dac:Daci_4410 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87203"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4E9"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADG87203.1"
FT                   /translation="MTRPPILKLGDILIVSIQTDLDDQEAVALQDDLAEAAVASGARGV
FT                   IIDITAVDVVDSFIGRTFATIAAITRILDAETVVVGMQPAVAITMVELGLSMGGVRTAL
FT                   NLTQAIEMLNHARSPG"
FT   gene            526614..527018
FT                   /locus_tag="Tbis_0476"
FT   CDS_pept        526614..527018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0476"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mrd:Mrad2831_5231 putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87204"
FT                   /db_xref="GOA:D6Y4F0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG87204.1"
FT                   /translation="MSTEPQELTIATNGDIVQARRQVRIAAAELGLSLVDQTKVVTVAS
FT                   ELARNALVHAGGGHMRVEVVHNGPRRGLRLTVVDEGPGIEDIEQALTEGFSTANGLGLG
FT                   LSGSRRLVDEFDLVSAPQQGTRVTVIKWAR"
FT   gene            527018..528010
FT                   /locus_tag="Tbis_0477"
FT   CDS_pept        527018..528010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0477"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: sus:Acid_0530
FT                   putative anti-sigma regulatory factor, serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87205"
FT                   /db_xref="GOA:D6Y4F1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F1"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADG87205.1"
FT                   /translation="MDGRADVWIRTEDPSAVGAVRRAAAELAREAGFDATRTGEVGVAV
FT                   TEAVSNLVKHAVDGVVLLRPHPEMARAVELVAIDSGPGIADLGQALRDGYSTTGTLGIG
FT                   LGAIRRLASRLDAYSLPGRGSVLVAVFTPHGMPAPPQRCSGLCRPIGEEVVCGDAFAFV
FT                   ATEDSVIVTVCDGLGHGGAAAQASQQAVRIFLKQPHMSPAEILERVHRGLGQTRGGAVA
FT                   VGLVRPGSVSFAGLGNVSGLIVTAEGKVAMTSQPGIAGHPGGLTHQYEYPLPQHAVVVF
FT                   HSDGLSDRWEPTTFPGLLTHSPAVICATLLRDVGTRRDDACVVAVRARP"
FT   gene            528007..529689
FT                   /locus_tag="Tbis_0478"
FT   CDS_pept        528007..529689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0478"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: sus:Acid_0531 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87206"
FT                   /db_xref="GOA:D6Y4F2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG87206.1"
FT                   /translation="MTGEEITRVGFGDDQDAFAIRRLAREIAERVGLEAQDRIRMATAL
FT                   SEIVREVLALGGEGVVIISLTEESLIMTVDYRVGEDLRQSEGMALAGRLVDEVVHAEPG
FT                   SITLVKRVPAHVARRSPAEVRAGLSPVVRVTAMDELREQNRELAGTLEEGQRLNVELTE
FT                   TNKGILALYNQLSAELEETNRGVVALYAELEEKSARLRELAEARQRFWVSVSHELRTPL
FT                   NSIIGLVRLLLGPGGEPLSEEQEHQIRLIGSSAETLLAMVSELLDMAKAESGRIQPQPV
FT                   AVDVAALAEEVCTALRPAAPHRVALIVDVAADVGEMFADKAILARILHNLLYNALKFTY
FT                   EGEVRLSVRLDPDAGDVVFTVADTGIGIPAKYLERVFEEFFQVPGPVAVKAEGSGLGLP
FT                   YARRLAEALGGTLTLTSREGEGTTATLRVPRRMARPEVNRVLIADGDAGFRAAARRLLT
FT                   GFATHVMEAADGITALQLMTAHPPDVVLIDEFLPRMDGATLLQRMAEAARLRDVPVVVV
FT                   GYPSQQADRGFPVLSRQELDRDRLLATIRAVRAARTGGGPEHG"
FT   gene            529682..531271
FT                   /locus_tag="Tbis_0479"
FT   CDS_pept        529682..531271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0479"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; protein phosphatase 2C domain protein; KEGG:
FT                   aba:Acid345_2411 PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87207"
FT                   /db_xref="GOA:D6Y4F3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F3"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ADG87207.1"
FT                   /translation="MGDTRATVLVVDDTPTKRYILSSWLRRAGHRVVEATGGGEALFLV
FT                   GEVKPDLVVLDIRMPDISGFEVCERIKGDPATAAIPVIQVSAAAIAASDRTEGLERGAD
FT                   AYLTEPIEPDEFTATVEATLRYYWARRRAERMAARLAQLVEITLRINEAETFDEVLRVA
FT                   AGGAAQMLERPAGLLALAPNGKTRAYIARPGRETTAMSATPGSLDRLTGRSLGEAAGVR
FT                   LLETGVDEWTRIVPGCGITSGVRGVVCRTKTGRPPVYLGVASRPPMDEGDTNLLRQLGQ
FT                   ALALAVDALRAYTEEHTIALTLQRSLLPRRVPDIPGLRISVRYQPAAKEVGGDFYEVLP
FT                   LGERVLVALGDVQGHSLHAATVMAELRHALRASLLDKVDPAHSMGLLNTVLRRYHPLIT
FT                   ATVCLLLIAPATGEVELVNAGHIPPLLAGKDARYHPFGDLMLGVTDETYRVERLILPED
FT                   GTILLFTDGLIEDRGRMLDDGLETARRLAEDVGDDLDAFCDRLIGAFGAREDDFALVAV
FT                   RRTGERKPYPSE"
FT   gene            531282..532340
FT                   /locus_tag="Tbis_0480"
FT   CDS_pept        531282..532340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0480"
FT                   /product="folate-binding protein YgfZ"
FT                   /note="TIGRFAM: folate-binding protein YgfZ; PFAM: glycine
FT                   cleavage T protein (aminomethyl transferase); KEGG:
FT                   mxa:MXAN_6341 glycine cleavage system T protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87208"
FT                   /db_xref="GOA:D6Y4F4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F4"
FT                   /inference="protein motif:TFAM:TIGR03317"
FT                   /protein_id="ADG87208.1"
FT                   /translation="MRSPLLDALGAVPGERPDETVAAHYGDPYAEQRALVRGEALTDRS
FT                   NRGVVRVSGPDRLSWLNSLSSQKLDTLRPGVPTQTLILDPHGRIEHHLTLVDDGTAVWA
FT                   HVEPGTAADLIAFLEKMRFMLRVEIEDRTAEYAVVSVGAPGTEPAPRTLPEGIIAIGGD
FT                   LLVPRDRLAGIADELGLRLAGLWAYEALRIAAHIPRLGFETDHKTIPHEVGWIEKAVHL
FT                   NKGCYRGQETVARVHNLGHPPRRLVFLHLDGSVDILPPHGAPVTLAGPAAAAGEPGAEP
FT                   DAGDRGQVGFVGSSARHYELGPIALALVKRTVPVDAPLLAGGVAASQEVIVPPDAGRNV
FT                   KIDPALARRRLR"
FT   gene            complement(532538..532978)
FT                   /locus_tag="Tbis_0481"
FT   CDS_pept        complement(532538..532978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0481"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: bcy:Bcer98_3122
FT                   D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87209"
FT                   /db_xref="GOA:D6Y4F5"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F5"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ADG87209.1"
FT                   /translation="MRAVVQRVTSASVTVDGKVVGAIDEPGLLVLVGVTHTDGRAEAAR
FT                   LAAKLWGLRILHGEKSCSDLNAPLLVISQFTLYGDARRGRRPTWQAAAPAPVAEPLVDA
FT                   VVEELRALGARVETGVFGADMKVTLTNDGPVTLVLHVDAPSA"
FT   gene            533204..534142
FT                   /locus_tag="Tbis_0482"
FT   CDS_pept        533204..534142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0482"
FT                   /product="L-asparaginase II"
FT                   /note="PFAM: L-asparaginase II; KEGG: mlo:mlr7616
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87210"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F6"
FT                   /inference="protein motif:PFAM:PF06089"
FT                   /protein_id="ADG87210.1"
FT                   /translation="MPELVVEVVRSGFVECVHRVRVHVVDAQGEPVMVRGDTAALASPR
FT                   SAMKPLQALAMLRHGLPLTGELLALACSSHCGEAFHVDGVRKILASAGLDESALRCPPD
FT                   LPYDEESRLRVIRSGGTAERIYMNCSGKHAAMLATCAVNGWPLDSYLHPGHPLQRAIRA
FT                   AVEEFTGERIAATGVDGCGAPLLFVSMTGVVRAYRRLVLAEGGPERRIADAMRAHPEWT
FT                   TGTARPETVLMRAIPGLLVKSGAEGFVVWAHSDGRAGAVKVEDGGERARMPATVAALRA
FT                   AGLDAPELAGLATAPLFGGGEPVGEVRVRPA"
FT   gene            534287..535165
FT                   /locus_tag="Tbis_0483"
FT   CDS_pept        534287..535165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0483"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: cak:Caul_1717
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87211"
FT                   /db_xref="GOA:D6Y4F7"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040212"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F7"
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /protein_id="ADG87211.1"
FT                   /translation="MRNDGEPSMTALMAAAARAAHLIVDEEPHIFRDTLAYRLLGERAE
FT                   TLVGFHRAHGTEPVLAGARTAAVTRSRYTEDRLTEAIGRGIGQYVILGAGLDSFAYRSP
FT                   YAGKIRVFEVDHPDTQGWKRALLTASGIPTPPSLRFVPADLEEQFDRLAYGGLDPSRPA
FT                   FVSWLGVTMYLTRGAVERTLAWLGRLAPGTELVVEYLLPEALWDAAGREYAEHVRAAAA
FT                   GFGEPWVTFFAPEEMSALLERHGFEVIEQARQREAIDAALWHRSDSLSACDLSVFAHAR
FT                   VRRDPAAGGGA"
FT   gene            complement(535414..536910)
FT                   /locus_tag="Tbis_0484"
FT   CDS_pept        complement(535414..536910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_4521 membrane-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87212"
FT                   /db_xref="GOA:D6Y4F8"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87212.1"
FT                   /translation="MELRTDGVLHVKESVTLAGGPVQRKLITRTRYDDTRDRLYRISNV
FT                   KGASFDGQTLTMAKSGTVEYDVTGAVTPLPGSVELRWFPVAGPAESATVTVTGPQPIHH
FT                   LSCFAGPPSSVIGCTSASMDHTGASATFEQQNLRAGELLTVAVGFPQGAAKAQPILERR
FT                   FELSTAFTLNAVTGTALAALLVVLLGGVGLLYWTRGRDARVISTESGPLSGHRNGVFTP
FT                   PDGVRPGQIGTLIDEQADVVDVTATILDLAVRGYLRIDEQPRQAYDAPDWRLVKLPGAR
FT                   VDELLPYERALYDALFDGRDSVLLSELHGSFAERLDAVRDALYEDVVRQGWFARRPDSV
FT                   RSRWTTLGIITIVIGVLGTVLLAWFTTYGLLGLAVIIAGAALAYGGQFMPAKTAKGSAA
FT                   LAHTLGFRRYLAEGGIDDVPPERRIELFSRYLPYAVIFDNVDPWARVVSSFTGNGERAD
FT                   HLYWYQGPAEWDLSKFADSMRTFTVTTSGAISASRRFRSL"
FT   gene            537088..538056
FT                   /locus_tag="Tbis_0485"
FT   CDS_pept        537088..538056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0485"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: mlo:mlr5644 metal-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87213"
FT                   /db_xref="GOA:D6Y4F9"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4F9"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ADG87213.1"
FT                   /translation="MARSRLYRNGALAAEGFPAAEVAGLIRDPSAVVWLDLCAPGREEL
FT                   EALGAELGVHELAVEDAVKRRQRPKLDAYDGHLFLSVHAARFDAGSGGLRVAEAAAFVA
FT                   RNVLVTVREPDFPIDEVVRRWDEQAGLAAHGVMFLLYGLLDYVVDTHFDAVERIDDEVE
FT                   ALEETVFGDGPVTPADQRRAYRIRKSLVRLRRIVVPMREVVNGLMRREEELGDGRMRPY
FT                   LLDVYDHVLRATEWTESLRELLADIREAHLTMQGNRMNMIMKRVTSWAAIIAVPTLITG
FT                   FYGQNLPFPGFGQVWGFWVSNALIVIASVTLYLTFRSRDWL"
FT   gene            complement(538072..538413)
FT                   /locus_tag="Tbis_0486"
FT   CDS_pept        complement(538072..538413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpd:RPD_4397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87214"
FT                   /db_xref="GOA:D6Y4G0"
FT                   /db_xref="InterPro:IPR019662"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4G0"
FT                   /inference="similar to AA sequence:KEGG:RPD_4397"
FT                   /protein_id="ADG87214.1"
FT                   /translation="MFGPVNSILSLIFWLISVTAFVMSVWALVHAVRIPARAFAAAGKQ
FT                   TKQLWLIILGFATLFTFAAAVNYGGIGTGLPNIFTIAAIIASGIYLADVKPAVTMYRSG
FT                   GSEGPYGPW"
FT   sig_peptide     complement(538330..538413)
FT                   /locus_tag="Tbis_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.383 at
FT                   residue 28"
FT   gene            complement(538667..539050)
FT                   /locus_tag="Tbis_0487"
FT   CDS_pept        complement(538667..539050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecs:ECs0774 cell envelope integrity inner
FT                   membrane protein TolA"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87215"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4G1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87215.1"
FT                   /translation="MTLATEVKKITRSKPFYALTGAGDLALEKARSYALTVQGKAETVA
FT                   RDMPEKARKYADSAAQRLTRLYDELAARGQRVVGRVSGETARELTKVAQSAAREFSAAA
FT                   KEAERGAAEQSKKSTRAKAGSRR"
FT   gene            complement(539054..539491)
FT                   /locus_tag="Tbis_0488"
FT   CDS_pept        complement(539054..539491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0488"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bbr:BB0746 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87216"
FT                   /db_xref="GOA:D6Y4G2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4G2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADG87216.1"
FT                   /translation="MELPKVGSLGEFIRQQRQQAKISLRQLAAQASVSTPYLSQVERGL
FT                   RKPSAEILNQIAKALSISAQALYERAGLIENGDGTSDVLTAIRADMTLTPRQRQVLIDI
FT                   YESFRKENRAASAQPRPSAEPLGDGDPASSRDGVTPESQEG"
FT   gene            complement(539559..540473)
FT                   /locus_tag="Tbis_0489"
FT   CDS_pept        complement(539559..540473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0489"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; peptidase M56 BlaR1;
FT                   KEGG: afw:Anae109_4097 peptidase M56 BlaR1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87217"
FT                   /db_xref="GOA:D6Y4G3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4G3"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADG87217.1"
FT                   /translation="MIAAAVLAALAMGCVLAAKRLTAAKWTHRAPHIGILLWQAIGVAW
FT                   GLATIGALLAFALEPYGKGVFYGMAAMVTAPEYGGVESPHDVARLTALVLGLALLAVLI
FT                   AVPIVAAVQTLRARRRHRDLLALIAREDPSVPGVRVVDFPAAAAYCVPGLKSQVVISDG
FT                   TLSLLSPGELDAVLAHEAAHVRERHDLVLLPFGALRRALPWSGLVRDAQASVELLVEMA
FT                   ADDRARQRCCPKRLASALLRFGTAAVPVPQGALGASAAESVMARVERLLRPQSALPPAQ
FT                   RFLLLAASVALAASAPALWFLPG"
FT   sig_peptide     complement(540420..540473)
FT                   /locus_tag="Tbis_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.543 at
FT                   residue 18"
FT   gene            complement(540470..540793)
FT                   /locus_tag="Tbis_0490"
FT   CDS_pept        complement(540470..540793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0490"
FT                   /product="transcriptional repressor, CopY family"
FT                   /note="PFAM: Penicillinase repressor; KEGG: sus:Acid_7418
FT                   CopY family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87218"
FT                   /db_xref="GOA:D6Y4U3"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4U3"
FT                   /inference="protein motif:PFAM:PF03965"
FT                   /protein_id="ADG87218.1"
FT                   /translation="MNILWAAETPLTAREVGRRIEDRELAPTTVMTVLDRLVRKGFLNR
FT                   TRDGRAWRYQPAASRDAYVAELMLEALDLTGDRHAALTHFARSVSGAEAEVLRKALMEL
FT                   EKR"
FT   gene            540878..541393
FT                   /locus_tag="Tbis_0491"
FT   CDS_pept        540878..541393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0491"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: sun:SUN_1457
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87219"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR039658"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4U4"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ADG87219.1"
FT                   /translation="MALILVQGDITQQRVDAIVNAANSSLLGGGGVDGAIHRRGGPQIL
FT                   EECRIWRATQYPDGLPTGKAVATTAGRLPARWVIHTVGPVYSRSEDRSHLLASCYRESL
FT                   RIADALGARTVAFPAISTGAFGWPMEDAARIALTTVRRADPGIDEVRFVLFDAEAYSVF
FT                   ERVLKEIK"
FT   gene            complement(541461..542327)
FT                   /locus_tag="Tbis_0492"
FT   CDS_pept        complement(541461..542327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_2356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87220"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4U5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87220.1"
FT                   /translation="MSLTAPADRRAGRGAHVLDPRSRAGARARPIGMITRGTTGQNRLR
FT                   RCDRWIAAVYGPLLRSAAPPLVVDLGFGASHVTTLELFTRLRRVCPSVEVVGVEIDPAR
FT                   VAAAKPYEREGLSFTLGGFELPVGRPPLLVRAFNVLRQYEEEAAWAHWDLLRSGIHPDG
FT                   VIVEGTCSEVGHRATWVALGAEGPRTLTFAARFTGFERPSDLAERLPKTLIHRNVPGER
FT                   IHAFLTDWDRAWAACAPFGAFGMRQRWIKTAELLARDWPVATAPPLGGRSRWRLGELTL
FT                   PWSAVAP"
FT   gene            complement(542324..543076)
FT                   /locus_tag="Tbis_0493"
FT   CDS_pept        complement(542324..543076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0493"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bmv:BMASAVP1_A0832 short chain dehydrogenase/reductase
FT                   family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87221"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4U6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG87221.1"
FT                   /translation="MTKKTAVVTGASSGIGAATARRLAAEGYQVVAGARRRDRLEKLAA
FT                   EVDGIIPVTLDVTSQESVDALAASLDRCDVLVNNAGGAIGLEPVAEGSVEDWQRMYDVN
FT                   VLGTFRMTRALLPKLIESGDGVLVLVTSVAGHVSYEGGGGYCAAKHAQASMAATLRLEL
FT                   CGRPVRVIEVAPGMVKTEEFSLTRFRGDAERAAKVYEGVPDPLTADDIADVIAFAVTRP
FT                   PHVNIDQIVVRPRAQAAQHKVHRVTQDA"
FT   sig_peptide     complement(543002..543076)
FT                   /locus_tag="Tbis_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.826 at
FT                   residue 25"
FT   gene            543210..544496
FT                   /locus_tag="Tbis_0494"
FT   CDS_pept        543210..544496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0494"
FT                   /product="UDP-N-acetylglucosamine"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine; PFAM: glycosyl
FT                   transferase group 1; KEGG: bmn:BMA10247_A2262 glycosyl
FT                   transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87222"
FT                   /db_xref="GOA:D6Y4U7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:D6Y4U7"
FT                   /inference="protein motif:TFAM:TIGR03449"
FT                   /protein_id="ADG87222.1"
FT                   /translation="MAARRRRVNRVATISVHTSPLDQPGTGDAGGMNVYIVEVARRLAD
FT                   LGIEVEIFTRRTARDLPPAVELHPGVLVRHVTAGPYEELDRADLPGQLCSFLSGVLRTE
FT                   AMYEPGRYDVIHSHYWLSGQVGWLAKERWGVPLVHTMHTMAKVKNLRLAEGDKPEPAIR
FT                   VLGEEQVVDVADRLVANTVTEARELIELYHAPPERVTVVNPGVNLNIFRPAPKAAARRR
FT                   LGLPADARVLLFVGRIQPLKAPDVMLRAAAIMIAERPELRSRLIVACVGGPSGNGLARP
FT                   SLLADLAAELGIADVVRLEPPAPQPELADWYRAADLTVVPSHNESFGLVALESQACGTP
FT                   VAAASVGGLRTAVRHGVSGVLVDGHDPRQWAASLAELLDDPDRLAALSAGAVRHAARFG
FT                   WSATAARLAEVYTEALERVHRTVPVGANS"
FT   gene            544527..545048
FT                   /locus_tag="Tbis_0495"
FT   CDS_pept        544527..545048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87223"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4U8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87223.1"
FT                   /translation="MRSDLEGVIESALAAAVLSYERPRPGAFLVKLPGQHKLATMTWLI
FT                   LGDQALNIEAFFCRKPDENHAEFYRWLLRKNGSMYGVHFALDEIGDVYLVGRIPIDAVT
FT                   PEEIDRLLGCVLTYADESFERAIELGFASSIRREWEWRVKRGRVFGQPPAVRPGRRGRL
FT                   GELTPGRSIR"
FT   gene            545108..545851
FT                   /locus_tag="Tbis_0496"
FT   CDS_pept        545108..545851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0496"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /EC_number="5.4.2.4"
FT                   /note="KEGG: YALI0B02728p ; K01834 phosphoglycerate mutase;
FT                   TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87224"
FT                   /db_xref="GOA:D6Y4U9"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4U9"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ADG87224.1"
FT                   /translation="MATLVLLRHGESEWNLKGLFTGWVDVTLSPAGEEEARRGGRLLVE
FT                   KGIYPDVVHTSVLTRAIKTANLALEAAGLLWLPVKRSWRLNERHYGALQGKDKAQTRAQ
FT                   FGDEQFMLWRRSYDVPPPPIADDDEFSQRGDRRYANLPPELIPRTECLKDVVARLLPYW
FT                   YDEIVPDLAAGKTVLVVAHGNSLRALVKHLEGISDQDIVGLNIPTGIPLRYELDENFRP
FT                   KGPGEYLDPEAAKAAIEAVANQGKK"
FT   gene            complement(546443..547099)
FT                   /locus_tag="Tbis_0497"
FT   CDS_pept        complement(546443..547099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0497"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG:
FT                   bmc:BAbS19_I20060 PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87225"
FT                   /db_xref="GOA:D6Y4V0"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V0"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ADG87225.1"
FT                   /translation="MRDAYHEELNALTARLLEMCRFVRSAMSRGTTALLGADLALAESV
FT                   IADDAEIDRRYAEVDSSIQLLLATQQPVAVDLRTVITALRISADLERMGDHAERIAKIA
FT                   RMRHPEPAVPAEVRDTIAEMGAIAEDLISKTASVIESRDVDLARRLVKEDDEMDRLHRR
FT                   LFRVLLSADWPHGVEAAIDVTLIGRYYERYADHAVRIAQDVIYLATGDRDADGAG"
FT   gene            547213..548388
FT                   /locus_tag="Tbis_0498"
FT   CDS_pept        547213..548388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0498"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: gbm:Gbem_2951 multi-sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87226"
FT                   /db_xref="GOA:D6Y4V1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADG87226.1"
FT                   /translation="MLRVNELLASLAAMGGFLVGAFVMLAIVRTLEFSMRQRDRGDDLA
FT                   PGVASVLAVLPSSAVVLDRDDRVLRASPAARAFGLVRGDTLMAAELLAMARKVRRDGEI
FT                   RESEIETRGGRFGQDTTTFAVRVAPLGTDGQVLVLAEDQTERQRVEAVRRDFVANVSHE
FT                   LKTPVGALSLLAETVMAAADDPEAVRRFAGRMQHEAARLTNLIQDLITLSRIQGGEPIP
FT                   SPAPVLVDDVIREAIDRCNTKASAKGIQLVTAGAQGLQVWGDDDLLVTALRNLIDNAIA
FT                   YSPEKTRVVVSSRSAHGHVEVSVADQGIGIPEEAQQRIFERFFRVDAARSRATGGTGLG
FT                   LAIVKHVAVAHGGEVTVWSKEGSGSTFTLRLPAYAGEPASSRTDTPVEAAQ"
FT   sig_peptide     547213..547290
FT                   /locus_tag="Tbis_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.461 at
FT                   residue 26"
FT   gene            548385..549074
FT                   /locus_tag="Tbis_0499"
FT   CDS_pept        548385..549074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0499"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bcb:BCB4264_A5589 DNA-binding response
FT                   regulator YycF"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87227"
FT                   /db_xref="GOA:D6Y4V2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADG87227.1"
FT                   /translation="MTRVLVVEDEESFSDALSYMLRKEGFEVAVAASGPEALEVFDREG
FT                   ADLVLLDLMLPGLPGTEVCRSLRQRSKVPVIMLTAKDSEIDKIVGLELGADDYVTKPFS
FT                   SRELVARIRAVLRRRGDAEEPSSSVLAAGPVRMDVDRHVVTVRGEKVQLPLKEFELLEV
FT                   LLRNAGRVLTRGQLIDRVWGADYVGDTKTLDVHIKRLRAKIEPDPSKPRYILTVRGLGY
FT                   KFETAEN"
FT   gene            complement(549171..549818)
FT                   /locus_tag="Tbis_0500"
FT   CDS_pept        complement(549171..549818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GI15809 gene product from transcript GI15809-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87228"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87228.1"
FT                   /translation="MLPIYVRTKETCTVTSSRRRAIAAGALLAAVIPALAACGAGFTAN
FT                   TNKPYAPTEAGVLISAESDGPFSNPYEVKGIQVPQAFILGPDSGAQIAAGGSAPLYLTL
FT                   TTSGGTDTLTAVTPDEQKATQVTLPGPVQVTSEGLARTTGALLQGLKQPLRGGEYIQLR
FT                   LQFQNAGEIPLTVPVVTRSREFATLPPAPQPTETAATPTETPEPSPSPTTEP"
FT   sig_peptide     complement(549699..549818)
FT                   /locus_tag="Tbis_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.757 at
FT                   residue 40"
FT   gene            550052..550543
FT                   /locus_tag="Tbis_0501"
FT   CDS_pept        550052..550543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0501"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG:
FT                   bcb:BCB4264_A4827 transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87229"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V4"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ADG87229.1"
FT                   /translation="MTFKVGDTVVYPHHGAARIEAITTRTINGQEKTYLVLKVDKGDLT
FT                   VQVPAENAELVGVRDVVGQEGLERVFDVLRMPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLYRRDKERGLSAGEKRMLAKARQILVSELALAENTNEDKAEALLDEVLNSARC
FT                   "
FT   gene            550569..551030
FT                   /locus_tag="Tbis_0502"
FT   CDS_pept        550569..551030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0502"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: afw:Anae109_2497 2C-methyl-D-erythritol 2,4-
FT                   cyclodiphosphate synthase; TIGRFAM: 2C-methyl-D-erythritol
FT                   2,4- cyclodiphosphate synthase; PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87230"
FT                   /db_xref="GOA:D6Y4V5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V5"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADG87230.1"
FT                   /translation="MGIGVDVHPFSPGRELYLAGLHWPGEPGLAGHSDGDAAAHACCDA
FT                   LLSAAGLGDLGGLFGTADPRWAGASGAVLLEETARRVRAAGFEIGNLAVQIIGNRPKVA
FT                   PRRAEAEKALGAAAGAPVSVAATTTDGLGLTGRGEGIAAIATAIVFPRS"
FT   gene            551230..551505
FT                   /locus_tag="Tbis_0503"
FT   CDS_pept        551230..551505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0503"
FT                   /product="transglycosylase-associated protein"
FT                   /note="KEGG: prw:PsycPRwf_0043 transglycosylase-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87231"
FT                   /db_xref="GOA:D6Y4V6"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V6"
FT                   /inference="similar to AA sequence:KEGG:PsycPRwf_0043"
FT                   /protein_id="ADG87231.1"
FT                   /translation="MTAIIGAIIIGAIVGVIARLLLPGKQQITWVWTIAIGIVAALIGT
FT                   ALAQVMGVATTPGIDWIELFMQILLAVVGVALFSGIRGRSRGRSRV"
FT   gene            complement(551882..553465)
FT                   /locus_tag="Tbis_0504"
FT   CDS_pept        complement(551882..553465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: PT repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87232"
FT                   /db_xref="GOA:D6Y4V7"
FT                   /db_xref="InterPro:IPR021235"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87232.1"
FT                   /translation="MDAIPPARPGVAEPPARRPSAFATVLRRLAIGAASLALAALTVAA
FT                   CALSFDDLRAFALAGGAPAELAALYPAAFDVLLAVALLTLPLVRGGSRLLLFQAGFVLC
FT                   VLLVAAAATTSTMAAGLTLDPHTASIVIALLPWVMLAIGLWLLLLLLAHARANRVEPDG
FT                   TAGADDLLPFEPARPEPAEPPAEVRQAGPQARDAGDAQGPAGDRTADAETAEVRPAAQA
FT                   DEPTASGTALAASEPSGDEHAAAEPPDRPAGGPDATEPPSHEPSGAESPAPADPAAETG
FT                   TASPGRQEPHDAATPGAEPAPATAPVADAGTPSPEPEAAEPAESAARTAPQPESPQAPE
FT                   AEAQPAGGDRREDGSDTGSARARSARARRSAAAAEAPEAAAEAPEPDPAQAPGRTRPLR
FT                   WGDLRRPPKGDVLVYPKRSQEAAEQATADASPSAPASSTEPAASPSARAETASGSAADP
FT                   ETGGAPAQPEAEDTQPVRRPRRGRAAKAEQAAQPATEEPGAQPEDSSAEPTVPLQPPSG
FT                   RMRSTPRPPR"
FT   gene            553598..553975
FT                   /locus_tag="Tbis_0505"
FT   CDS_pept        553598..553975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0505"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: cak:Caul_2456 pyridoxamine 5'-phosphate
FT                   oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87233"
FT                   /db_xref="GOA:D6Y4V8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V8"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADG87233.1"
FT                   /translation="MLPDSARELFDGVNHATVACLNPDGSPHTSVVWVKTDGGDILFST
FT                   VKGRRKHRNILRDPRVSILVMDSGNPYRYAEVRGIATMIDDPEADLIQELSRKYTGRPW
FT                   DVHPDGERVIVRITPKKVFVR"
FT   gene            554099..555493
FT                   /locus_tag="Tbis_0506"
FT   CDS_pept        554099..555493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0506"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: gme:Gmet_0057 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia ; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87234"
FT                   /db_xref="GOA:D6Y4V9"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4V9"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADG87234.1"
FT                   /translation="MSLHLYDTSTRTVREFVPINPGRVSIYLCGATVQAPPHIGHIRCG
FT                   VAFDVLRRWLMRLGYDVTFCRNVTDLDDKIIKVAAEEGVPWFVVAERNQRLFTWAYDQL
FT                   GCLPPTVEPRAMGHIPEMIELIKRLLDKGHAYVAGNDVYFDVRSFADRYGRLSNQRLEH
FT                   MRPAGDTENESLKRDPRDFALWKGAKPGEPSWPTPWGRGRPGWHLECSAMATKYLGETF
FT                   DIHGGGVDLIFPHHENEIAQSQAAGDGFARYWVHNGLLKVGGEKMSKSLGNSLLISEIL
FT                   RKVRPIELRYYLVAAHYRSELDYSEEALKEAAAAFRRIEGFVNRAAEMIHDVDAAAPLP
FT                   QPFVDAMNDDLNVPQALAVVHEVVREGNIAISQVNKEQVARLLAETQNMLDVLGLDPRA
FT                   EPWRSRNGSAMREVVDALVSIALEQRQAARARKDYATADAIRDRLAAAGIVVEDTPQGT
FT                   RWELAR"
FT   gene            555516..556484
FT                   /locus_tag="Tbis_0507"
FT   CDS_pept        555516..556484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0507"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: bsu:BSU00960
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87235"
FT                   /db_xref="GOA:D6Y4W0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W0"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADG87235.1"
FT                   /translation="MARKTSGKPAKKQKGSGGKIRGSLEGRGPTPPAHMRHWYKERVRA
FT                   AERQRKAAAAAQAPALARTPSRPFLEEGAEIIAGRNPVVEALRADIPARVLYVAYRIDT
FT                   DDRVREAIKIAADRDIPMVEVSRDRLDQLTGGAVHQGIGLEIPPYEYAHPDDLVEAAHQ
FT                   AGEVPLIVALDGVTDPRNLGAIARSAAAFGAHGIVVPSRRSVGVTSGAWKTSAGTLATL
FT                   PVARASNLTQTLKAYRKEGLFVVGLDGDAKEEIADNTLLTEPLVLVVGSEGKGLSRLVR
FT                   ETCDMLARIPMGERVESLNAGVAAGIALYEIARRRRQAVTQ"
FT   gene            556524..556596
FT                   /locus_tag="Tbis_R0014"
FT                   /note="tRNA-Thr2"
FT   tRNA            556524..556596
FT                   /locus_tag="Tbis_R0014"
FT                   /product="tRNA-Thr"
FT   gene            557647..557991
FT                   /pseudo
FT                   /locus_tag="Tbis_0508"
FT   gene            complement(558031..558915)
FT                   /locus_tag="Tbis_0509"
FT   CDS_pept        complement(558031..558915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0509"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: bra:BRADO7087 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87236"
FT                   /db_xref="GOA:D6Y4W1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W1"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ADG87236.1"
FT                   /translation="MADGLAAGGVGTAHARPCTVDPMGLLADLVADGEVVVLSGAGLST
FT                   ESGIPDYRGVNGRLRRSQPMTYQTFIGSAAARRRYWARSHLGWRHMAEARPNAGHHAVA
FT                   ELQRRGLVAGIITQNVDGLHQAAGARDVIELHGSLSRVRCLGCGERTPREVLDRRLREA
FT                   NPGWTARAGAVNPDGDVELSDEEIAGFRVVDCASCGGVLKPDVVFFGENVPRDRVAACL
FT                   ELAERAGLLLVLGSSLAVMSGYRLVRHAADHGIPIAIINQGPTRGDAHALVTIDARLGS
FT                   ALPRLLARLDAAW"
FT   gene            559070..559576
FT                   /locus_tag="Tbis_0510"
FT   CDS_pept        559070..559576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0510"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   dac:Daci_5358 HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87237"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W2"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ADG87237.1"
FT                   /translation="MGLKRREWFSRVIKLRNVPREARPRECSIADTLDLVGERWSLLVI
FT                   REISYGVRRFDGIVRHTGAPRDILTTRLRKLEAAGVIRREQYRDHPVRYEYHLTPAGAE
FT                   LFDVLLMLMKWGDRHLNSGDPPVRWHHSCGEVLDPVVVCRHCGGEARTGAHSPIGRGVA
FT                   TPERI"
FT   gene            559932..561692
FT                   /locus_tag="Tbis_0511"
FT   CDS_pept        559932..561692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0511"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG: exoO;
FT                   beta-D-1,6 glucosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87238"
FT                   /db_xref="GOA:D6Y4W3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADG87238.1"
FT                   /translation="MEAEGVGAVDVSVVVPAYGSRTSLDRCLTSLLVQRVRKEIIVVDD
FT                   GASEEVRRLLRLYAVYHPGVVRVIQEPGPGLPGRMRNRGLDAARGRFVYFGDPEEELGP
FT                   EVLGRMLAVADGQGADIVLRAAEGRAFPRAAAREALADGSVYDDLTCAKLFRRSMLERH
FT                   RIRFDETLRIGEDMVFAVHAYCHAEVISAVAVGERGGPPSRREEPSGDPLAWLQMIRVP
FT                   LAVLGRHVPPGPLRDRLLARHFRLDVLSQLGAPFLAAREEDREKIVAETADICAQWLTR
FT                   GVLDLLSLTDRARVEALDDITHLVRLAEVEQARLTHRLTGLEWQGDRLLICGRVALDGI
FT                   PGRPGLILRERASGREWRPGVTSVADLICAVIPARSLPAGVWDVHAVVECHGTRRTAPF
FT                   GQVRDANVTVPRLRFAGRRVVGPFFTPDGRLGVDVGGHVIRVPGSVRLTRTEWVGRRLR
FT                   VDGRVRVAKAPAAPAVRQLVWRERTSGLEVREPAAVTGPGTFSAQTCGFWPGVWDAYLE
FT                   LDVGGPPLRFPVKVDCPENLGRSLRWWRGPVRWTARPYATAVNRRLSTSVVVSSPRVVF
FT                   RRLVRRIRRT"
FT   gene            561765..562796
FT                   /locus_tag="Tbis_0512"
FT   CDS_pept        561765..562796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0512"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: sus:Acid_6714 cobalamin (vitamin B12)
FT                   biosynthesis CbiM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87239"
FT                   /db_xref="GOA:D6Y4W4"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W4"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ADG87239.1"
FT                   /translation="MHVPDGFFNLPVSVGTGLVAAAGVAVSLRGARRELDDRTAPMAGL
FT                   VAAFIFAAQMLNFPVAAGTSGHLLGGALAAILAGPYTAVLCLAVVLLVQAVFFADGGLT
FT                   ALGVNITLMAIVGSAVGWGVFRLVTRGRPRSRAVAVAGSFLAALVSVPVVALAFTLLFW
FT                   LGGTAPIDVAAVAAAMGGVHVLIGIGEGLITALVVSAVLAVRPDLVYGARGLAGPLVLR
FT                   TSEGEKVVTPEQPDAQPARTGLRPFLLGGGLVALLLAGVVSLFASSAPDGLERVAEDKG
FT                   FDTVAQPHPLEDGPMADYAVKGVENEMLATGAAGVIGVGITVVAGGLIFTAARRRNRDK
FT                   AAA"
FT   gene            562793..562984
FT                   /locus_tag="Tbis_0513"
FT   CDS_pept        562793..562984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87240"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87240.1"
FT                   /translation="MTPPMGGATPWTRGTPPGVAGAAVNGTAGPAHAGRDDTPSAAVRP
FT                   GAVSPVRVVRPSPSGRRG"
FT   gene            563054..563812
FT                   /locus_tag="Tbis_0514"
FT   CDS_pept        563054..563812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0514"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   gsu:GSU1280 cobalt ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87241"
FT                   /db_xref="GOA:D6Y4W6"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W6"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADG87241.1"
FT                   /translation="MSAGHRLHLPGDTPVHRLPPQCKLAATLAFAVAVVATPRERFWAF
FT                   GVYALLLAGVALAARVPAAFLLRRMTIEVPFVLFAVAIPIIGMGERVEVLGVPLSVEGL
FT                   WASWNILAKATLGVAASILLAATTEPRMLLYGAERLRLPQLMVQIAMFMLRYLDVILDE
FT                   MRRMRIARESRGFVARDLRQAPVLAKSLGALFIRAYERGERVHIAMLSRGYTGRMPVID
FT                   ELPASGRQWAAAASVPVLAAVTAVLAWTLP"
FT   gene            564192..565007
FT                   /locus_tag="Tbis_0515"
FT   CDS_pept        564192..565007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0515"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: gme:Gmet_2439 cobalt transport protein ATP-
FT                   binding subunit; TIGRFAM: cobalt ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87242"
FT                   /db_xref="GOA:D6Y4W7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W7"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /protein_id="ADG87242.1"
FT                   /translation="MSGPAGERHAEGAERAAGAPPSLVVRDLAYAYPDGTQALFGVNFT
FT                   IRRGERVALLGPNGAGKTTLVLHLNGILTPGHGTVEVAGIPVRKDTLREVRRRVGLVFQ
FT                   DPDDQLFMPTVREDVAFGPANLGVRGAELERRVRDALARVGMLDAIDRPPHHLSFGQRR
FT                   RVAVATVLAMEPEILVLDEPSSNLDPASRRELAEILKSLDVTVLMVTHDLPYALELCER
FT                   SLILSGGVIVADGPTAELLADADLLAAHRLELPYGFSVPAAQRSFTHPA"
FT   gene            565040..565819
FT                   /locus_tag="Tbis_0516"
FT   CDS_pept        565040..565819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0516"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: pna:Pnap_0798 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87243"
FT                   /db_xref="GOA:D6Y4W8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADG87243.1"
FT                   /translation="MDLNGAAAIVTGGASGLGEATARELARIGATVLVADINAERGKKI
FT                   ADEIGGVFAQTDVADEASVQAAVDAAVATGKPLRAVINCAGIGWAERTVNRDGSPHSLA
FT                   SYRKVIDVNLIGTFNFMRIGAAAMAKTDPVDSDNSRGVIINTSSVAGIEGQTGQVAYSA
FT                   SKGGIIGMTLPAARDLSVIGVRVLTICPGIIDTPIYGTIGSKDVEEFKARLLAPVAFPK
FT                   RMGRPEEFAHLVRSLIENDYMNGEVIRFDAGIRFQPK"
FT   gene            565831..566595
FT                   /locus_tag="Tbis_0517"
FT   CDS_pept        565831..566595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0517"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   cti:RALTA_A1582 crotonobetainyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87244"
FT                   /db_xref="GOA:D6Y4W9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4W9"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ADG87244.1"
FT                   /translation="MADEVLVSVDGGVGVITINRPQAKNAVNAAVARGIADAIDDLDAR
FT                   KDVSVLVLTGAGGTFSAGMDLKAFLAGELPMIEGRGFGGITEAPPKKPIIAAVEGYALA
FT                   GGFELVLSCDLIVASEEAKFGLPEPKRGLVAAAGGVMRLPRRIPYHIAMEIALTGDFYP
FT                   ATRLHELGLVNRITPAGKALEEATELAKKIAANAPLALAATKKIMVESIDWSLDEMFAK
FT                   QDEITGPVFTSKDAMEGAAAFAEKRAPVWKGE"
FT   gene            566695..567327
FT                   /locus_tag="Tbis_0518"
FT   CDS_pept        566695..567327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0518"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: lpp:lpp0886
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87245"
FT                   /db_xref="GOA:D6Y4X0"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X0"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADG87245.1"
FT                   /translation="MGDYWPSVPPPPRNPGNRLAHGLGGALGGISLVVLLVAAMWVIEI
FT                   VDTLLLGQLDQLGIIAQEPYGLPGILFAPFLHAGFGHLMANSVPLLILGSLAAIRGVGK
FT                   FVTASFLITMVSGIGVWLTSPPNTLTLGASGLVFGYFGYVVARGLFDRRPLDIVLSVIV
FT                   VLLYSSLLLGVLPVQPGVSWQGHLFGLIGGVLAAWLLRRRRYRPLYY"
FT   gene            complement(567826..568938)
FT                   /locus_tag="Tbis_0519"
FT   CDS_pept        complement(567826..568938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0519"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V; KEGG: zmo:ZMO1684 phosphoserine
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87246"
FT                   /db_xref="GOA:D6Y4X1"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X1"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ADG87246.1"
FT                   /translation="MADIVIPADIKPADGRFGSGPSKVRPEQLAALAASGASVLGTSHR
FT                   QKPVKSLIARIKAGLTELFSLPDGYRVVLGNGGTTAFWEIAAFGLIRQKSQHLKFGEFS
FT                   SKFTKVAQKAPWLSEPTVIESEPGSHPTPVAEEGVDVYALTHNETSTGVAMPIKRVADD
FT                   DSLVLVDATSAAGGLPVSAEEFDVYYFAPQKCFASDGGLWIALMSPKALERAAEIAGSG
FT                   RYIPEFFSLPTAIDNSQKDQTYNTPSVATLFLLAEQIDWMNSQGGLAWTTARCADSASR
FT                   LYTWAEKTSYTTPFVADPAQRSNVVGTIDFVDGVDAATVAKVLRANGIVDTEPYRKLGR
FT                   NQLRIAMFPAIDPADIEALTACIDYVVERL"
FT   gene            complement(569228..570334)
FT                   /locus_tag="Tbis_0520"
FT   CDS_pept        complement(569228..570334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0520"
FT                   /product="Citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="PFAM: Citrate synthase; KEGG: mlo:mll3842 citrate
FT                   synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87247"
FT                   /db_xref="GOA:D6Y4X2"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X2"
FT                   /inference="protein motif:PRIAM:2.3.3.1"
FT                   /protein_id="ADG87247.1"
FT                   /translation="MSDFKPGLEGVVAFETEIAEPDKEGGALRYRGVDIEELVGKVSYG
FT                   HVWGLLVDNSFLPGLPAMEAFPLPVRSGDVRVDVQSALALLGPAFGFQPLLDIDDQQAR
FT                   DDLARASMLALSFVAQSARGLGKPMVPQRLVDEGKTIVEQFMIMWRGEPDPRHVKAIDA
FT                   YWTSAAEHGMNASTFTARVIASTGADVAAALSGAVGAMSGPLHGGAPARVLHMIEAVER
FT                   IGDAKKYVQSELDKGNRLMGFGHRVYRAEDPRARVLRRTAQELGAPRYEVAAALEKAAL
FT                   EELQARKPDRVLATNVEYWAAVVLDFAEVPANMFTSMFTCARTAGWAAHILEQKRTGRL
FT                   VRPSARYVGPSQRSINEVPGAAEVIGKL"
FT   gene            570508..571152
FT                   /locus_tag="Tbis_0521"
FT   CDS_pept        570508..571152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0521"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: bph:Bphy_0514 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87248"
FT                   /db_xref="GOA:D6Y4X3"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X3"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ADG87248.1"
FT                   /translation="MDSASHLPGLRSAYDGEPLIESDMADDPLDQFTEWFADAVDARLP
FT                   EPNAMVLATSSAGGRPSARLVLLKGYDERGFVFFTNYESRKGRDLAENPRACLLFPWHA
FT                   IRRQVRIEGTVVRLPREESESYFHSRPYRSRIAAWASRQSAVLESRAVLEERFRRLAER
FT                   WPENPPMPDFWGGFRVIPQEIEFWQGGADRMHDRIRYRRGRDAWIRERLAP"
FT   gene            complement(571171..571797)
FT                   /locus_tag="Tbis_0522"
FT   CDS_pept        complement(571171..571797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0522"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   ank:AnaeK_2690 phage SPO1 DNA polymerase- related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87249"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X4"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADG87249.1"
FT                   /translation="MGNSGDKRFLPDGEPSLPALREAARRCQGCSLYRNATQTVFGTGP
FT                   PDATFMFVGEQPGDQEDRQGAPFVGPAGRVLARAIEEAGIDRDRVYLTNAVKHFKFQTR
FT                   GKRRIHERPSAAEIAACRPWLTAELRVVDPVVTVVLGATAARALLGPAFRVTRRRGEPI
FT                   PRGVGSYYVATIHPSAVLRAPSGQRGPAYEGFLADVRVAARLGGR"
FT   gene            571875..572579
FT                   /locus_tag="Tbis_0523"
FT   CDS_pept        571875..572579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0523"
FT                   /product="iron (metal) dependent repressor, DtxR family"
FT                   /note="PFAM: iron dependent repressor; FeoA family protein;
FT                   SMART: iron dependent repressor; KEGG: sus:Acid_2178 DtxR
FT                   family iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87250"
FT                   /db_xref="GOA:D6Y4X5"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X5"
FT                   /inference="protein motif:PFAM:PF02742"
FT                   /protein_id="ADG87250.1"
FT                   /translation="MTSNGLIDTTEMYLRTIFELEEEGIVPLRARIAERLQQSGPTVSQ
FT                   TVARMQRDGLVIVHDDRHLSMTETGRLLATRVMRKHRLAECLLTQVIGLPWEEIHIEAC
FT                   RWEHVMSEQVERRLVDLLNAPRYCPHGNPIPGLAELGVPEAEPAGEEKISTMASVATQE
FT                   PTKVVIRRISEQVQSDPALMLKLKQVGIQPGREVTLATSDDGVRVTGDDQAGGTDMDLP
FT                   RGVAAHLFVASA"
FT   gene            572703..574937
FT                   /locus_tag="Tbis_0524"
FT   CDS_pept        572703..574937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0524"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: protein serine phosphatase with GAF(s)
FT                   sensor(s); TIGRFAM: PAS sensor protein; PFAM: Stage II
FT                   sporulation E family protein; GAF domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART:
FT                   protein phosphatase 2C domain protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87251"
FT                   /db_xref="GOA:D6Y4X6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X6"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADG87251.1"
FT                   /translation="MRSWGDLPQDITERMTAEAILEQTDMAVVVADRFSNILYWNPFAE
FT                   RLFGKSGKPTAKDSLANLGMADKDRPVAGELARHVLRGGVWEGTFDVIRGDGTMVYVRA
FT                   QAVPMRHPSGSVSGIVLTAREAMRSNEREKDRIGLLERIGERLAGSLYLEETLDRVADV
FT                   LVPQFADHCFIELFEGNRLIRKVSRHAHGWQPPADAWKGVGDEINYPPGHYAESALRYQ
FT                   ETVLVEDFSQVSFPATSEAAARVCAEVGITSAIAAPLCARGEVLGLLYLALSNLSDRSS
FT                   HHYDSFDRDLVGAIATRVALAVDNALLFEEERHTAESFQKHLLPRDFPEFDGLQVAAWY
FT                   YPAAPLPSRGQGIQTQVGGDWYDVIPLSAGRVGIVIGDVEGRGAKAAAIMGQLRAALRA
FT                   FATDDKPPADILTKLDEWTRIVVEPERDEYGADVSSPPIVTCLYMVYDAWSRQLSYANA
FT                   GHAPPLLIVDGTVQELDISEVGHPLGVRAKGMHADLVYKEETRTLPPGATLLLYTDGLV
FT                   DRRPPRDADGTPMSDDDALRTLCDTLAKVANEPVERIAEAASRAIPGEIDDDMAILVVR
FT                   SVDDDLEFEERTFPAQPIMVGEARRMAAEAFASWQVPEERAELACLLVSEVVTNVVLHA
FT                   ANSNVPRRALVLDGPPLPFDESWDTWDFPGADDEVVGDKEFTLRLRRGKKSIWVEVFDQ
FT                   DLRLPRIRSAGENDEGGRGLYLVDQLAARWGSRPTRDGKAVWFEINISGH"
FT   repeat_region   575392..575835
FT                   /rpt_unit_range=575392..575422
FT                   /note="CRISPRs"
FT   gene            576138..576302
FT                   /locus_tag="Tbis_0525"
FT   CDS_pept        576138..576302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87252"
FT                   /db_xref="GOA:D6Y4X7"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87252.1"
FT                   /translation="MDSGLILLVFLAFLFAWALNRVRRFFKLTPLRYAGVMVVFIVVML
FT                   LLWGQEQIR"
FT   sig_peptide     576138..576194
FT                   /locus_tag="Tbis_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.895 at
FT                   residue 19"
FT   gene            complement(576492..577637)
FT                   /locus_tag="Tbis_0526"
FT   CDS_pept        complement(576492..577637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0526"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: pag:PLES_48141
FT                   putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87253"
FT                   /db_xref="GOA:D6Y4X8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X8"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADG87253.1"
FT                   /translation="MQRDLFEEEHLLFRDTVREFLAREVVPHHAQWEKDGIVPRDVWKK
FT                   AGELGLFALSVPEQYGGSGIRDFRYNAVLDEEIIRAGASGLGFSLHNDVVAPYLLDLTN
FT                   DEQKERWLPGFVSGELITAIAMTEPGAGSDLQGIRTTAIRDGDHYVLNGQKTFITNGIN
FT                   ADLVIVVAKTDPSAGARGITLLVVERGMEGFTRGRNLEKIGLHAQDTAELFFDNVRVPV
FT                   ANRLGPEEGQGFIQLMQNLPQERLSIAVAAVAASERVLEMTIEYCRNRKAFGRSIGSFQ
FT                   NTRFVLAELATEVEIARHYVDKCIRALNAGELTAVDAAKAKWWTTDLQNKVIDRCLQLH
FT                   GGYGYMLEYPVAKAWLDGRVQSIYGGTNEIMKEIIGRSFGF"
FT   gene            577861..579303
FT                   /locus_tag="Tbis_0527"
FT   CDS_pept        577861..579303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87254"
FT                   /db_xref="GOA:D6Y4X9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4X9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87254.1"
FT                   /translation="MSQWTARRRRGLAAAVASVVGGMLLATPATPAQAQTAEIDLTYRC
FT                   RGGLVSSTPVQLKATLTVQTALTVGQPLDIRWDIKYADTSRFVSPDYFAAGGRLSATGA
FT                   VKVTGQQWSGELHSSGAQEQEQLRKGDALTLPSLISGAVSTTQPGTFEIVPERLTLGFI
FT                   PPASERIVNDDDPAVTYHGDHWRDDNDRPAHFNDIHNDVHATDKAWHRVEFKFTGTGVD
FT                   FITEQDHRAGRLEFKIDGRPGVPQHADASKDENGNPVTVVNRGNHTLWSVRGLPYGEHT
FT                   LEITNTEDKWAIVDGFRVVTEELLDPPSQFRVTCTAVNKPTAIRVVISEGGAGSPSNGP
FT                   GNGGPSSTPSVSPSNGNGGNGDGGGNGNESPSPGPSDGGQSPSPGTSGSPTPSGSPRPT
FT                   VTTTVTATATPTVAQVLVTPRGGVQTGEAPAGNAAGAAMLLGSGGLLLALAAGSGVALA
FT                   RRRAAHATGPAAGEGGDEHHTG"
FT   sig_peptide     577861..577965
FT                   /locus_tag="Tbis_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 35"
FT   gene            579284..580390
FT                   /locus_tag="Tbis_0528"
FT   CDS_pept        579284..580390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0528"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   bja:blr0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87255"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y0"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ADG87255.1"
FT                   /translation="MSTTPGDAPTPEEQPAASGEGVTPGAASGESASAGPTGHPAHRPA
FT                   DPAPAGPYGTAEGSPGAPQTPAPPQSPAAPQMPSSPHVPAVQHVPAAQAMPAAQPVPAA
FT                   QPVPGAAPGRRSLPQPVLAGMLIAGSLGGIVAVMAGTLALLSPSAEEADPVNAQRAGVS
FT                   GAALAPTVGPGGTDQPLTAAAATAPPPDPAARPRRPLTLTPKNASAARMTLARTKGRPV
FT                   RIRIPAIGVSAPVEPVGVDAKGEMQVPPLSKPNLVGWYRLGPAPGEQGPAILLGHVNTR
FT                   AGAAVFYRLRELKRGNKIAIRRADGKTAIFTVDGIEQVSKLTFPTKRVYGNTATASLRL
FT                   ITCGGLYDAKTHHYTDNVIVYATLTSVV"
FT   gene            580629..581528
FT                   /locus_tag="Tbis_0529"
FT   CDS_pept        580629..581528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87256"
FT                   /db_xref="GOA:D6Y4Y1"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87256.1"
FT                   /translation="MGARSVRESKATGRIAARAALAGAIGASVLLGGGFLIEADAAPVT
FT                   VAYTCTAAQSRATHAPELTVSLAGPASAAPSQPVTVVWANTQPTEPGKFLPAPGPIPAT
FT                   QPITLTGQLVVAGPSATTTAQAAGSSTPGLEVPSGVPVPLPPMTATVTPAAAGAMTITA
FT                   QAFTLQLSTGDTPVTYSCTPAPGATPASHVVTVAAGPVTSPTPSGSASPSLPTSPSPTP
FT                   SPTTPRPTRTVYKTVTMQPTQGVQVTRTPKGGANTGGGGEAGPDGRVLILTGGALVLAS
FT                   AAGGLALRARTRGVRQRS"
FT   gene            581542..582438
FT                   /locus_tag="Tbis_0530"
FT   CDS_pept        581542..582438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0530"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87257"
FT                   /db_xref="GOA:D6Y4Y2"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y2"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ADG87257.1"
FT                   /translation="MTMPPAGQYPPGPPHGAPIDPNLPAGPPPVLQPVVLPPVVPQAPV
FT                   PPEPEPVAGSASLALRGVLLFAAVAGIITVIIGVISVVSSPEEYAAPDRSTIRLQREEP
FT                   GGLAPSVGPGGPGEPLTQAAATAPPPVPAEPPAAPLQPATPKRLIIPKLGVDAPIISVG
FT                   TDRNGELESPPMDEPNLVGWYRGGPTPGQAGPAVLLGHKDTRTRSAVFSRLHELRYGDR
FT                   IEVVRMDGTVAVFTVGGVEQASKDTFPTERVYGRTEYAELRLITCGGVYNRVSGHYLDN
FT                   VIVYARMTATERVDRAS"
FT   gene            582579..583724
FT                   /locus_tag="Tbis_0531"
FT   CDS_pept        582579..583724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0531"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: swi:Swit_3630 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87258"
FT                   /db_xref="GOA:D6Y4Y3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y3"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADG87258.1"
FT                   /translation="MAEAYIVGAVRTPVGKRNGGLSTIHPTDLAAHTLAALIERTGVDP
FT                   AAVDDVIMGCVSQIGPQSLDIARNAWLSAGLPESVPGVTIDRQCGSSQQAIHFAAQAVM
FT                   SGTQDLVVAAGVESMSMVPIGSNVTIPLEKGMPFPYGEKWVERYGNQEISQFRGAELMC
FT                   EKWGFSREDLEKYALESHQRASKAIANGYFAEQIVPINGVEHDEGPRPDTSLEKMAALP
FT                   TLRPDGKITAATSSQVSDGAGAVLIASERAVREHNLTPRARIHTLALAGDDPVYMLTAP
FT                   IPATKKALQRAGLSIDDIDVIEINEAFAPVPLAWLREIGADPAKTNPNGGAIALGHPLG
FT                   GTGAILMTKLLHELERIGGRYGLQTMCEGGGQANVTIIERL"
FT   gene            complement(584160..586031)
FT                   /locus_tag="Tbis_0532"
FT   CDS_pept        complement(584160..586031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0532"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: ade:Adeh_1417
FT                   acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87259"
FT                   /db_xref="GOA:D6Y4Y4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y4"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ADG87259.1"
FT                   /translation="MTDYAKAREVAEEAREQWIRPSFGKQLFLGDFRLDLVYPAPPEPE
FT                   AAVAKGEEFLRVLTEFLRERVDPMAIERNAMIPDEVVKGLAEIGAFGMTIGEEYGGLGL
FT                   SHYHYCKALALTASYSPALCALLSAHQSIGVPKPIQLFGTEEQKRRFLPRCARGEISAF
FT                   LLTEPDVGSDPARLSTTAVRDGDSYVIDGVKLWTTNGVVADLLVVMARTGEKISAFVVE
FT                   ADSPGITVENRNSFMGLRGIENGVTRFHQVRVPAENLIGREGQGLKIALTTLNTGRLSL
FT                   PATCAGAVKWALKIAREWGDQRVQWGKRIGGHEAIAKKIAFIAATAYAIDAIVDLTCRL
FT                   ADDERNDIRIEAALAKLYATEMAWLAMDELVQMRGGRGYETAESLHARGERGVPAEQFL
FT                   RDLRINRIFEGSTEIMHLLIAREAVDTHLSVAGALIDPKADLKTKGRAAAKAGGFYAKW
FT                   LPSLLAGSGQLPSAYAAFGPVARHLRFVERTSRKLARNTFYGMSRWQGRLEHRQAFLAR
FT                   LVDIGAELYAMTAVCVRAKEDAAKAGPGAYAIADVFCRQARLRVKDLFRRLWVNTDAED
FT                   TGLARRVLEGDYLFVEEGILDPSIEGPWVAPARPGPSERPDVHRHIG"
FT   gene            complement(586872..587654)
FT                   /locus_tag="Tbis_0533"
FT   CDS_pept        complement(586872..587654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0533"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: mxa:MXAN_1023 putative pristinamycin I
FT                   synthase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87260"
FT                   /db_xref="GOA:D6Y4Y5"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y5"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADG87260.1"
FT                   /translation="MIANYTCHDRQRVNEDLMSGYDRVVQPAAGDDALENHLGGDEAKN
FT                   YRRYEFDMVAPHVGRSMLEIGSGLGHFAEQFLPRVDRLVVSDFDPYCVERLRERFAGHG
FT                   NVSVLQFALPAEVPLDEPVESVVMMNVLEHIAEDVDALRSVAKVTVPGGRIVIWVPGYM
FT                   QLYGDFDRKVGHVTRYTPTTLRRTVTAAGLDIEVLKPINFLGGIAWWAAVKRGGVGYPD
FT                   PRLVKIYDRTVVPLTRFIERFIRPPFGQTVFCVARVPG"
FT   gene            complement(587959..589155)
FT                   /locus_tag="Tbis_0534"
FT   CDS_pept        complement(587959..589155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0534"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: aba:Acid345_0045 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87261"
FT                   /db_xref="GOA:D6Y4Y6"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y6"
FT                   /inference="protein motif:TFAM:TIGR01430"
FT                   /protein_id="ADG87261.1"
FT                   /translation="MRHDKRMARPLDRLPKAHLHLHFTGSMRHATLIELAEKHGVHLPD
FT                   ALVREWPPRLRATDERGWFRFQRLYDIARSVLRRPEDVQRLLREAAEDEAREGSRWLEI
FT                   QVDPSGYAQWFGGLTSTLELILDAADRASKDTGVGIAVIVAANRTRHPLDARTLARLAA
FT                   QYVGKGVVGFGLSNDERRGRARDFDHAFRIAKRAGLLAVPHGGELLGPSSVRECVEDLQ
FT                   ADRVGHGVRAAESPWLMERLAERQIACEVCPLSNVSLGVAQRPEDVPLRRLFDAGVPIA
FT                   LGADDPLLFGARLLPQYELARQVYGFSDAELAEMARQSIRASAAPDSVKKELLAEVDAW
FT                   LASPPEPVSPPEPVSPAEAVPAAPSQAEPVPAEPAAAGPAPGGSPVPAPAPGLMAQPA"
FT   gene            complement(589475..590680)
FT                   /locus_tag="Tbis_0535"
FT   CDS_pept        complement(589475..590680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0535"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   ppd:Ppro_2189 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87262"
FT                   /db_xref="GOA:D6Y4Y7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADG87262.1"
FT                   /translation="MTRPRISARISAISESATLAVDAKAKAMKAAGRPVIGFGAGEPDF
FT                   PTPDYIVEAAVEACRNPRFHKYTPAGGLPELKEAIAAKTKRDSGFEVEPSQVLVTNGGK
FT                   QAVYEAFATLLDPGDEVLVPAPYWTTYPEAIKLAGGVQVDVVTDESTGYLASVDQLEER
FT                   LTERTKALLFVSPSNPTGAVYSPDQVAEIGRWAAEKGLWVVTDEIYEHLVYGDAKFSSI
FT                   ATLVPELRDRVVVLNGVAKTYAMTGWRVGWLIGPKDVVKAATNLQSHATSNVCNVAQAA
FT                   ALAAVSGDLSAVERMREAFDRRRRTMVRMLNEIPGVVCPEPKGAFYAYPSVKALLGKEI
FT                   RGRRPQTTTELAELILEEAEVALVPGEAFGTPGYFRLSYALGDEDLVEGVSRVAKLLAE
FT                   AR"
FT   gene            590948..591020
FT                   /locus_tag="Tbis_R0015"
FT                   /note="tRNA-Trp1"
FT   tRNA            590948..591020
FT                   /locus_tag="Tbis_R0015"
FT                   /product="tRNA-Trp"
FT   gene            591097..591354
FT                   /locus_tag="Tbis_0536"
FT   CDS_pept        591097..591354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0536"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: psa:PST_0771
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87263"
FT                   /db_xref="GOA:D6Y4Y8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y8"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ADG87263.1"
FT                   /translation="MAIDTRGETAGKPGKAAGQKKAKRTSPVLFYRQVVAELRKVIWPR
FT                   RNELITYTAVVLVFVLIMVGIVFGLDTLMGKVVLMVFGGS"
FT   gene            591427..592167
FT                   /locus_tag="Tbis_0537"
FT   CDS_pept        591427..592167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0537"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: bha:BH0118 transcription antitermination
FT                   protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM: NGN domain
FT                   protein; KOW domain protein; SMART: NGN domain protein; KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87264"
FT                   /db_xref="GOA:D6Y4Y9"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Y9"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ADG87264.1"
FT                   /translation="MPAEGSRTEWEAEQDEVVEEAGTSAADSTAGEANSAEDASTADGE
FT                   GESAPDPVEEFKEKLRGLPGEWYVVHSYAGYENRVKQNIESRIISLNMEDYIYQVEVPT
FT                   HTVTEIKGGKKTPVKERVLPGYVLVRMVLTDESWAAVRNTPGVTGFVGLSNKPSPLGLD
FT                   DVARLLAPEPEEEEAAAKASAKSAAPAVEFEVGESVTVMDGPFATLPATVSEVSPESQK
FT                   LKVLVSIFGRETPVELSFDQVAKL"
FT   gene            592295..592726
FT                   /locus_tag="Tbis_0538"
FT   CDS_pept        592295..592726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0538"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: sus:Acid_6326 50S ribosomal protein L11P;
FT                   TIGRFAM: ribosomal protein L11; PFAM: ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87265"
FT                   /db_xref="GOA:D6Y4Z0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z0"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ADG87265.1"
FT                   /translation="MPPKKKVAALVKVQLPAGQATPAPPVGTALGPHGVNIMEFVKQYN
FT                   AATESQRGNIIPVEITIYEDRSFTFVTKTPPAPELIKKAAGLQKGSANPHREKVGKITR
FT                   EQLRQIAETKMKDLNAKDLDAAERIIAGTARSMGVTIVD"
FT   gene            592884..593597
FT                   /locus_tag="Tbis_0539"
FT   CDS_pept        592884..593597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0539"
FT                   /product="ribosomal protein L1"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: bcb:BCB4264_A0118 ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87266"
FT                   /db_xref="GOA:D6Y4Z1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z1"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ADG87266.1"
FT                   /translation="MKRSKNWRNAAALVDRERLYSPLEGIRLAKKTVTTKFDPTVEVAI
FT                   RLGVDPRKADQMVRGTVNLPHGTGKTARVLVFATGERAEEARAAGADIVGGDELIQEVA
FT                   NGRLDFDAVVATPELMGKVGRLGRVLGPRGLMPNPKSGTVTTDVAKAVRDIKGGKIEFR
FT                   VDRHANLHLIIGKASFDERQLLENYAAAIDEVLRLKPSAAKGRYIKKVTVATTMGPGIP
FT                   IDPNVTRNITAELGS"
FT   gene            594226..595095
FT                   /locus_tag="Tbis_0540"
FT   CDS_pept        594226..595095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87267"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87267.1"
FT                   /translation="MRRLLGAALAAAAIVTAGCGADGTSSAPKTSSLGNYELTAAQALQ
FT                   RSAERADDVTSYIASLNLDIPDYKEGPVNAQATVRYQEHPRLAWEITLDRSAVNGNEVP
FT                   GGVRVILFEDVAYAQIEMLKGLLDTDKPWLKIDLKQRPADRAKVDRIFEQFRSADLKSN
FT                   LAMLTASKDVEQAGREPVGGVETTHYSGTFPVEEALRLLPAEQRAKVTFPPGGEKVKFD
FT                   VWVDDEGLPRKLQLSEVQTGIGTATATVFFKSFNEPMSIEAPPADQTGELPEEQVPSLE
FT                   RFEVPQRG"
FT   sig_peptide     594226..594291
FT                   /locus_tag="Tbis_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.670 at
FT                   residue 22"
FT   gene            595322..595846
FT                   /locus_tag="Tbis_0541"
FT   CDS_pept        595322..595846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0541"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: mgm:Mmc1_0838 LSU
FT                   ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87268"
FT                   /db_xref="GOA:D6Y4Z3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z3"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ADG87268.1"
FT                   /translation="MAKADKNGIIAELTREFEGSSAAVLTEYRGLTVAQLKELRGSLGG
FT                   HAKFAVAKNTLAKIAAKRAGITSLDPLLQGPTAIAFVKGDVVEAAKGLRDFAKANPLLV
FT                   IKGGVVEGKSMTPEEITKLADLESREVLLAKLAGALKAKQSQAAAVFAALPTQMARLAE
FT                   ALRAKREQAGE"
FT   gene            595922..596323
FT                   /locus_tag="Tbis_0542"
FT   CDS_pept        595922..596323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0542"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: rpa:RPA3269 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87269"
FT                   /db_xref="GOA:D6Y4Z4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z4"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ADG87269.1"
FT                   /translation="MAKLTTEELLEAFKEMTLLELSEFVKAFEEAFDVKAAAPVAVAAA
FT                   PAAGGAAAGAPAEQAEEQDEFEVILEAAGDKKIQVIKEIRALTNLGLKEAKDLVDGAPK
FT                   PVFDGKVNKEQAQKAKEALEKVGATVTIK"
FT   gene            597261..600728
FT                   /locus_tag="Tbis_0543"
FT   CDS_pept        597261..600728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0543"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: bha:BH0126 DNA-directed RNA polymerase subunit
FT                   beta; TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 3; RNA polymerase Rpb2
FT                   domain 2; RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87270"
FT                   /db_xref="GOA:D6Y4Z5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z5"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ADG87270.1"
FT                   /translation="MAASRNASAAFASPRLSFARIQEPLEVPDLLAVQIESFDWLIGNE
FT                   RWKARVEAARKAGRKDIPMQSGLEEVFEEISPIEDFSGTMSLSFRDHRFEPPKHTIEEC
FT                   RDKDMTYSASLFVTAEFINNTTGEIKSQTVFMGDFPLMTPKGTFIINGTERVVVSQLVR
FT                   SPGVYFDRTVDKTSDKDVYSCKIIPSRGAWLEFEIDKRDSVGVRIDRKRKQPVTVLLKA
FT                   LGWTNDRILERFGQYESMRATLEKDHTTGQEDALIDIYRKLRPGEPPTKESAQALLENL
FT                   YFNPKRYDLAKVGRYKLNKKLGVDADITQGTLTEDDIVATIEYLVRLHAGEETMIGANG
FT                   REVIVETDDIDHFGNRRLRTVGELIQNQVRLGLARMERVVRERMTTQDVEAITPQTLIN
FT                   VRPVTASIREFFGTSQLSQFMDQTNPLAGLTHKRRLNALGPGGLSRERAGFEVRDVHPS
FT                   HYGRMCPIETPEGPNIGLIGSLATYARVNAFGFVETPYRKVVDGRVTDQIEYLTADEED
FT                   RYVVAQANTVVNPDGTFAEKRVLARRKGGEFEAVDPSEVDYMDVSPRQMVSVATAMIPF
FT                   LEHDDANRALMGSNMQRQAVPLLRSEAPLVGTGMEYRAATDAGDVIIAEKSGVVEEVSA
FT                   DYITVLNDDGTRTTYRVVKFKRSNQGTCYNQKPIVEEGDRVEQGQVIADGPCTENGEMA
FT                   LGKNLLVAFMPWEGHNYEDAIILSQRLVQDDVLTSIHIEEHEVDARDTKLGPEEITRDI
FT                   PNVSEEVLADLDERGIIRIGAEVTTGDILVGKVTPKGETELTPEERLLRAIFGEKAREV
FT                   RDTSLKVPHGESGKVIGVRVFRREDGDELPPGVNELVRVYVAQKRKITDGDKLAGRHGN
FT                   KGVIAKILPVEDMPFLEDGTPVDIILNPLGVPGRMNLGQVLETHLGWAAKQGWDISGVE
FT                   EEWAKRLREKGMEKVGPDTKVATPVFDGAREEEIVGLLQHTLPNRDGQRLVGPNGKAIL
FT                   YDGRSGEPFPYPVSVGYIYILKLAHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFG
FT                   EMEVWALEAYGAAYALQELLTIKSDDVTGRVKVYEAIVKGENIPEAGIPESFKVLIKEM
FT                   QSLCLNVEVLSSDGMSIEMREAEEDVFRAAEELGIDLSRREPSSVEEV"
FT   gene            600753..604625
FT                   /locus_tag="Tbis_0544"
FT   CDS_pept        600753..604625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0544"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: bha:BH0127 DNA-directed RNA polymerase subunit
FT                   beta'; TIGRFAM: DNA-directed RNA polymerase, beta' subunit;
FT                   PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase alpha
FT                   subunit; RNA polymerase Rpb1 domain 5; RNA polymerase Rpb1
FT                   domain 3; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87271"
FT                   /db_xref="GOA:D6Y4Z6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z6"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ADG87271.1"
FT                   /translation="MLDVNFFDELRIGLATADDIRQWSHGEVKKPETINYRTLKPEKDG
FT                   LFCEKIFGPTRDWECYCGKYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDLAPKDLEKVIYFAAYMITWVDTEARERDLPSLEAKVSVERQHIE
FT                   QRRDAEIEARQKKLEADLAEAEAEGKSAADRRKIREAADREIRQIRERAQRELDRLEEV
FT                   WTRFKNLKVQDLEGDEQLYREMRDRFGRYFRGAMGAQAIKERLENFDLEAEAEKLREII
FT                   RTGKGQKKARALKRLKVVAAFLNTKNSPKAMVLDCIPVIPPDLRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDALFDNGRRGRPVTGPGNRPL
FT                   KSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLHQCGLPKQMALELFKPFVMK
FT                   RLVDLNHAQNIKSAKRMVERARPVVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLV
FT                   EGKAIQIHPLVCTAFNADFDGDQMAVHLPLSAEAQAEARILMLSTNNILKPADGKPVTM
FT                   PTQDMVIGLYWLTRERAGAKGEGRVFSSVAEAIMAFDRRELDLQAKIQVRLQDVPPPRD
FT                   WKAPEGWEEGQPYRLETTLGRCLFNETLPDTFPFVNYAVGKKELSGIVNELAERYRKVE
FT                   VAHALDALKDAGFYWATRAGVTISIEDIVAPPNKARIMEEYERRAEKVQREYERGLITD
FT                   EERRQELIEIWTHATAEVEADMVKAFPDDNPVWMMVNSGARGNRMQVRQIAGTRGLVSN
FT                   TKGETIPRPIKSSFREGLSVLEYFISTHGQRKGLADTALRTADSGYLTRRLVDVAQDVI
FT                   VRELDCGTDRYVQLPVAQRTSDGRLVKAEYAETNVCARNLAEDVEVDGKLIAAKGTDIN
FT                   DAVLTKLVEAGVETVKVRSVLVCESKIGVCAMCYGRSLATGKLVDVGEAVGIIAAQSIG
FT                   EPGTQLTMRTFHTGGVAGADITHGLPRVQELFEARVPKGVAPISEVAGRVRIDETDKTR
FT                   KIVIIPDDGSEEVAYPVSMRARLLVSDGDHVEVGQQLIAGAKNPNEVLRILGPRAVQLH
FT                   LVEEVQAVYRSQGVSIHDKHIEIIVRQMLKRVNVLESGDTELLPGELVERPKFEAINRK
FT                   TVAEGGQPASGRPVLMGITKASLATESWLSAASFQETTRVLTDAAIHAKSDQLLGLKEN
FT                   VIIGKLIPAGTGMPQYRNIRVEPTEEAKAAMYSVGGYDSSGEYSFGTGTGESVPLEDYD
FT                   FGQYNR"
FT   gene            complement(604806..606020)
FT                   /locus_tag="Tbis_0545"
FT   CDS_pept        complement(604806..606020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0545"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: gsu:GSU0030 oxygen-independent
FT                   coproporphyrinogen III oxidase, putative; PFAM: Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87272"
FT                   /db_xref="GOA:D6Y4Z7"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z7"
FT                   /inference="protein motif:PRIAM:1.3.99.22"
FT                   /protein_id="ADG87272.1"
FT                   /translation="MTRPLLLYVNIPFCNSKCHFCDWVVQIPVRDLRLDQQAPGRIAYL
FT                   DAVRAQIRGQAPVLREHYQPAIIYWGGGTASILGESEIESLYTCLRSEFDLSHVRETTI
FT                   EGSPESLTPQKLRRLRELGFDRISIGVQSFDDQRLRRLGRAHSAEQAVEVVKNAHAAGF
FT                   RNINIDLIVGFPGQTDAEVAESVRTALTLPINHFSIYPYRASPGTILRKQVERGGHLDL
FT                   NRQLAAYYITRDLLEEAGFPEYAMSYFGAPRCEADQAYYRLTMDWIGFGSGANSLLGHR
FT                   YLAFRKGRLHAYNQNPLRFDVNAPASSPQLTLHWLSQALTTVEGMDARVYQERTGTPLR
FT                   VACEEPEVQAYLRRMSEHGRLIIDRNGIRIHREDIARVIIALNWIDTPGGDQKVTRLTP
FT                   VSATS"
FT   gene            complement(606239..607411)
FT                   /locus_tag="Tbis_0546"
FT   CDS_pept        complement(606239..607411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0546"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: scl:sce8913 cytochrome
FT                   P450 CYP109C2"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87273"
FT                   /db_xref="GOA:D6Y4Z8"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:5VWS"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z8"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADG87273.1"
FT                   /translation="MMELPGQPSLTDGGAALFAWLRTMRNEHPVWRDQFGIYHVFRYDD
FT                   VRQILGDYQTFSSDRTRLMPTAQGFGKGGITMIDPPEHRHQRRLITHAFTPQSISAMEP
FT                   RIRQIADHLLDELPGPEFDLVEHFAYPLPVIVIAELLGVPPGDRHLFRTWSDRLMSLQV
FT                   ENYADPELARTVAAAMTEMNDYLREHCRSRRTHPRDDLLTRLVQAEVEGKRLDLEEVVN
FT                   TASLLLLAGHLTTTVLIGNTMLCLWDHPEAEKAVRADPSLIPAALEESLRLRSPFLQAG
FT                   RVTTRDVTIAGETIPANRFVMAWILSANHDDRRFPDPERFDLHRQTTGHIAFGHGVHFC
FT                   LGAQLGRLEGRIALERLLGRFTEIHPWPREGISFYQSAIFGASRMPVRCG"
FT   gene            complement(607412..608632)
FT                   /locus_tag="Tbis_0547"
FT   CDS_pept        complement(607412..608632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0547"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: scl:sce8913 cytochrome
FT                   P450 CYP109C2"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87274"
FT                   /db_xref="GOA:D6Y4Z9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y4Z9"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ADG87274.1"
FT                   /translation="MNEPLTAQGTPTMTMPAAQRPRISHGGQALLKWLDEMRESQPVWR
FT                   DGFGIFHVFRHADVQRVMADYATFSSDINRLRPGGDPFSAGSLMLTDPPEHRKLRRLIS
FT                   QAFSPKMSADMKPRIAELTEELLDDIEEDEFDLVEKFAHPLPIMVIAELLGIPIHDRGL
FT                   FRTWADRLIALHVDDPTDVEIGRMVGEAMREMGEYVQTHVRKRRADPQDDLVSKLIAAE
FT                   VDGERLTDAEIVNTSCLLLLAGQITSTMALGNTFLCFRDAPDAERAVRADFSLLGPAFE
FT                   EVLRLRPPLTQAARLTTTDVEVAGTLIPAGSLVINWLLSANYDERQFPNPYRFDLTRSP
FT                   NRHFAFGHGIHHCLGAPLARVEGRVALELLLRRFSEITIDPDAELSYYEDPMFGVKSLP
FT                   VRVRRAA"
FT   gene            complement(608653..609342)
FT                   /locus_tag="Tbis_0548"
FT   CDS_pept        complement(608653..609342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0548"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bha:BH2145
FT                   TetR/AcrR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87275"
FT                   /db_xref="GOA:D6Y500"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y500"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADG87275.1"
FT                   /translation="MDITRALLLQSGYKRTTIDEIARKADIGKGTVYLSWDTKDDLIRS
FT                   LVIHDIIDVCDDVSNWAGTESDAPTLPSLSRRMFTLIFKYPLFRALYTRDRYILGRTCD
FT                   DPSLNFQSYRITTFTPFRKYLGMLADNRALDGTTGRDSQYFSLDALMWGFIKLHLLSST
FT                   EASINDSAANLAELVRRSFGPWRTPAAATLKTISRKTAEIFKAAADEYRAMLGVPFFGT
FT                   RTATASA"
FT   gene            609854..610003
FT                   /locus_tag="Tbis_0549"
FT   CDS_pept        609854..610003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87276"
FT                   /db_xref="PDB:5WA4"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y501"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87276.1"
FT                   /translation="MDLNDLPMDVFELADSGVAVESLTAGHGMTEVGASCNCFCYICCS
FT                   CSSA"
FT   gene            610088..612664
FT                   /locus_tag="Tbis_0550"
FT   CDS_pept        610088..612664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0550"
FT                   /product="Lantibiotic dehydratase domain protein"
FT                   /note="PFAM: Lantibiotic dehydratase domain protein; KEGG:
FT                   scl:sce9070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87277"
FT                   /db_xref="InterPro:IPR006827"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y502"
FT                   /inference="protein motif:PFAM:PF04737"
FT                   /protein_id="ADG87277.1"
FT                   /translation="MRLVERRFPVAMTSTAPKVAVRECGLPVSAIESLCCTDSFALIRR
FT                   QVRETAWLKGEGKRLAVDLGLLIGERGDGDDGLRPVLVGLRRALHTGRLPDAREWTPRV
FT                   ASALPAELAARVADWVTRMRALTRARRELPELFAAEARVKEKVLAQVAADPGFRRALSL
FT                   ASPELAADLDRWLAEPARRPKTQKLLRLAKYVARAAVKTSPYSTFTSMGVAVWENGEDW
FT                   ADGAIVRFAPREPPSVILEPSGEWLHGALRAWLARPENLVRSRLRLNPSLVIRADKAEF
FT                   LGFPPREPIIRMGLTPVVATVLRLAEPAADADGWIDPMGFRDRLARDLPAEPEQVDRLL
FT                   RSLIEAGVLEAHPLTRAGLPETGEWAEIRAALRHDPHGEDPEAYRVRLARLKRAMTMMW
FT                   PQGDTTALLHETAVVTRPVASLNPTAWGRGLSDLDVVRRWLSVFDGKLPIRIVVAEYLR
FT                   ARYGEHARVPFLTFHRHVQEEIAGDAPSGADLRTFVGRSAAIWAPPLAHSRLPRLRELA
FT                   KLREAARELALGRPEHDGIQRVDPEELIKQMATWPEWIVVPRSCACYVQPAPEGRLVLN
FT                   VVHGGHGRGLRRLSHLIGRVRGEAVDHPMVADEPEGTVYAELSGSLGSTLNVHVPGTRY
FT                   EIDYPFSPGDRSRDRRLPLSDLEVVLAPETGLAELRSRRLGFRVIPLHLGMAAEFQLPP
FT                   AARFLERAFGVTYLLHPSAPPLLRIGEVPPPQEVTRYPRVEVGRVVVQRRRWLAPAGTL
FT                   PIRAKGEDDASYLLRLVAWTDANGIPTRSFVRAWQERMVQAGQDKARKPLFLDLANPFL
FT                   VKVFERQIRDCAFVLFEEALPDPADAPPREGSDLPRVIEFLVELGE"
FT   gene            612661..613557
FT                   /locus_tag="Tbis_0551"
FT   CDS_pept        612661..613557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC5083 lantibiotic biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87278"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y503"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87278.1"
FT                   /translation="MTPHEAEVIWVSAHIFHQGPLDRLVTEVAGPLFVELAAAGLSTQG
FT                   FFLRYWEGGPHLRFRVRLLPGADAAETRRLIRERACAYLRRYPSQDVLDREEYARLAEV
FT                   LAAREGLTGHARELYPNDSVQFISYRPEHHRYGRGPSLEAVERHFAESSRIALELLHAG
FT                   LTIPQRGAVWLTMLMATWLLAGSRGEDAFRPWPDARKEQAFDRERERLTGLARHARQLT
FT                   LRPPDPEAQGVLAAWHGSVARLADALAASGFTATRTATVLDLCAHLLANRLGIRIQDEA
FT                   RLRYLASRALDEAEVTV"
FT   gene            613557..614633
FT                   /locus_tag="Tbis_0552"
FT   CDS_pept        613557..614633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC5082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87279"
FT                   /db_xref="InterPro:IPR023809"
FT                   /db_xref="PDB:5WA3"
FT                   /db_xref="PDB:5WA4"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y504"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87279.1"
FT                   /translation="MAAGERWWRFRVDYHAGPMDDLILDGVRPAFAAFAAQAPMAYFLR
FT                   HWRRGPHLRIYVSTTREALEAVVRPAIEHVVGGYLRARPSPGMADPSAFLPLHERLAEL
FT                   EGEDGPLMPWSPDNTIHAEGERPEPLTVRDVLLADFYADTTPSVYHALERVRSGASLPT
FT                   IAFDLVVATAHALSTGGLPVARTSLRSHAEAYLARRSDGVRLRELWRDHYARNREAFTE
FT                   RLIAVASSAESAENGAHLPHVREWVRRLRPIRERARALLESGELTLEYASPAEGARDLP
FT                   SLAEVSAFHRELESRPEWARLRDSPAFGAYRLVINCTYLHLTRLGLTPHQRFLVCHLAA
FT                   DAAADVYGIAAHEEVATR"
FT   gene            614630..616006
FT                   /locus_tag="Tbis_0553"
FT   CDS_pept        614630..616006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87280"
FT                   /db_xref="GOA:D6Y505"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y505"
FT                   /inference="similar to AA sequence:KEGG:M446_3966"
FT                   /protein_id="ADG87280.1"
FT                   /translation="MTIPPGLTERYALRAGVHSAVLPDGVMRLFAWPHAESIGALSADE
FT                   TTLLKELAEGPREIADPALRPFVERLFRGGWLKRTLSRGEHDLYTLDPLRRPGSRPAPP
FT                   DDPVLSRFAAVRRRPSGFVIESPLAWCDVHVHDPALLPDLLEPAGGRAGRSSLAPQIRR
FT                   QALADLAWAGLVVPRGAEDGALRTRQWAPHELDFHQRSRLYHRGYLGDGFGGTFWARGT
FT                   FDPPQARPQRYPGDPIPLHRPDLNALRAADPPLTAVLEDRRSVREYDDDAPMTVEQLGE
FT                   LLYRSARIRDVKVIDGVEYVRKPYPSGGSVYELEIYPVVRHVAGLAPGMYHYDAYEHVL
FT                   RPVRPAGHPAVRRMLTVASHGSAVGIRPQLLLVVSARVGRVMWKYEGMGYALILKHVGV
FT                   LYQTLYCVATAMGLAPCAIGSGDSAAFSEATGRDPLEECAVGDFLLGSRPASGSTVEES
FT                   "
FT   gene            616003..617886
FT                   /locus_tag="Tbis_0554"
FT   CDS_pept        616003..617886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0554"
FT                   /product="protein of unknown function DUF181"
FT                   /note="PFAM: protein of unknown function DUF181; KEGG:
FT                   acp:A2cp1_3940 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87281"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y506"
FT                   /inference="protein motif:PFAM:PF02624"
FT                   /protein_id="ADG87281.1"
FT                   /translation="MIPARPVLTPGVRYAPTSDGVAFLTRDGIVSITGVSIHRWIDRIA
FT                   PHLTGERSVAELTDGLAPERRAFVLRLLQALADRGLIIDAAGGREPRLERGTACALHVT
FT                   ETCGPYRESLPKLARSLADALTRAGLDVRLASASEPCDPERCHALVHLTAADEVGLAAA
FT                   ERLDRLSERWGVPIAHVVVWGGEIWRTEAGTVGEDGLPLAAGWRRLTALRPDTEERVPI
FT                   SPTAAVVVAGQVAADVRDRLTTATRAGRRPRLHVVEPARLTCRAHHFIPHFHTMPLTGD
FT                   APLAEELTEEEFSRRAAALMDDRTGVFTEIAEGDFGQLPLHVAVTTVADPVGLLGPAGD
FT                   RPRVIGVGPDFATARYRTARAAIALYGLLAVDPRRLVDADGEPLAGPRTSAAELEDLLG
FT                   RIRAGGLPAFVRAEDVRGGPPRLLPASSVFPFATARALLAGTVPTGTAVGYSEEGALRA
FT                   ALLDHCRERTLADLASRRVARLTPDTAPSDPVTARYLAFLRAIGLPFDVLDATGPLGVP
FT                   VYVGVLDGRVVAAEAGASPGEAFRSVLEGILRGLQGIPAARSLPDTLPPVLPEAMAVPD
FT                   GSPLSAEALAAALARAGLSVSVVRLDHDRRVHALIPHCVRVMVTGEESAHV"
FT   gene            617879..619852
FT                   /locus_tag="Tbis_0555"
FT   CDS_pept        617879..619852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0555"
FT                   /product="protein of unknown function DUF181"
FT                   /note="PFAM: protein of unknown function DUF181; KEGG:
FT                   bcy:Bcer98_0958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87282"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR022291"
FT                   /db_xref="InterPro:IPR027624"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y507"
FT                   /inference="protein motif:PFAM:PF02624"
FT                   /protein_id="ADG87282.1"
FT                   /translation="MSDALAAAIIGAGLLADELAAAFRPYGEVIRLDEVERAETEAHRL
FT                   RALVMACDGWDTSIYRETRERCRRLGIPWLPVRTEHGIAVIGPLERPGEPGCAHCFELR
FT                   RERARPDAAAYRAILNHHGPELAKRPSPYLDELAAATIAALGVRMIDQGSGCHVWYVRL
FT                   NGLTVERHAFLPEPLCPECGSLPMDDRDSAVIVLRSQPKRAPDDYRTRDIVDELDALVA
FT                   DYVDGESGLIRPLVRDTQGGLVIAGAMLPLRFAGGSEPGVGRTRGYRTSEVTAILEALE
FT                   RWGGVEPGGKRTVIRAAFRDIAADALDPRTLGVHSPEAYAAEDFPFRPFTEDEETEWVW
FT                   GYSFARRSPILVPETVAYYYVHRDRPRQERPFLYEISNGCALGSGMEEAILYGILEVVE
FT                   RDAFLMTWYGRLGVPRIDLDSAKNRMVPLQAAAISAETGYRIEVYDTTMEHGIPSVWAL
FT                   AIRGGEEPTAAPRPRMVCAAAAHLDPEQAVLSALSELGPLLADLLRRYPDEAERARRMV
FT                   DDPGLVTTMHDHSTLYGADEAFGRLEFLTGTASTRDLAAMRESTVAFRSADLRDDLLEV
FT                   IGRILAEGMDVIVVDQTTPEHRVHGFTCVKVLIPGMIPMTFGHRNRRLDGLTRPLVIPY
FT                   RLGYRPAPLTPEALNPHPHPFP"
FT   gene            619864..621192
FT                   /locus_tag="Tbis_0556"
FT   CDS_pept        619864..621192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0556"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: nmu:Nmul_A0853
FT                   peptidase M20D, amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87283"
FT                   /db_xref="GOA:D6Y508"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y508"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADG87283.1"
FT                   /translation="MTSRQRSAPASILQGVEALLRPLAVFRADLHRNPELSGQERRTAE
FT                   RLARWLGHAGCEVFTGVGGHGVVARLRNGEGPLVLLRAELDALPVREETGLSYASTVTA
FT                   ARPDGRVVPVAHACGHDIHMTCLAGTAELLAANRASWRGTVLLVGQPAEETLTGAAAML
FT                   DDGLYQRFGVPDVALAQHVAPLPAGVVAHAPPGEPLTAAGAELRIVIRGRGGHGGMPHL
FT                   AVDPVVVAASVVLRLRAMAVQERRPGEHVVVTVGALHAGERANVIPDSAVLEAIVRAPS
FT                   LAAVDRVVEVARRVVEDECLAARCPDPPEFTVVTRVPAGISDPVAAARVRRAHLAVFGA
FT                   GRVVEVPQGQASEDFPLFGADGRVPTVYWYVGSVPPAVWDRAPGAGPLEKLHSLPAAHS
FT                   PKFSPDPVATLRAGITALAAGALAWLGTGPLGNGEIMSFGSLP"
FT   gene            621600..621974
FT                   /locus_tag="Tbis_0557"
FT   CDS_pept        621600..621974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0557"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: afw:Anae109_1907 30S ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87284"
FT                   /db_xref="GOA:D6Y509"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y509"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ADG87284.1"
FT                   /translation="MPTIQQLVRKGRQDKVTKTKTPALKGSPQLRGHCVRVYTTTPKKP
FT                   NSALRKVARVRLTSGIEVTAYIPGVGHNLQEHSIVLVRGGRVKDLPGVRYKIIRGALDA
FT                   QGVRGRKQARSRYGAKKEKS"
FT   gene            621976..622446
FT                   /locus_tag="Tbis_0558"
FT   CDS_pept        621976..622446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0558"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: bha:BH0130 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87285"
FT                   /db_xref="GOA:D6Y510"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y510"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ADG87285.1"
FT                   /translation="MPRKGSPGRRQLPPDPVYNSPLVTALINKVLRDGKRSLAQKIVYS
FT                   ALEGCRQKTGNDPVVTLKRALDNVKPTLEVRSRRVGGATYQVPVEVRAARSTTLALRWI
FT                   VQYARQRREKTMIERLTNELIDASNGLGASVKRREDTHKMAESNKAFAHYRW"
FT   gene            622477..624579
FT                   /locus_tag="Tbis_0559"
FT   CDS_pept        622477..624579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0559"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small GTP-
FT                   binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: gme:Gmet_0623 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87286"
FT                   /db_xref="GOA:D6Y511"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y511"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ADG87286.1"
FT                   /translation="MATTTALDLAKVRNIGIMAHIDAGKTTTTERILFYTGINYKIGET
FT                   HEGSATMDWMEQEQERGITITSAATTCKWLDHTINIIDTPGHVDFTVEVERSLRVLDGA
FT                   VAVFDGVAGVEPQSETVWRQADRYGVPRICFVNKMDRVGAEFHRCVDMIESRLGAVPLV
FT                   IQLPWGVEADFKGVIDLVRMKGLYWRPEAVKGDMYDLTDIPAEHLDLAREWRDKLIETV
FT                   AEHDDEMMELFLEGEEPTEEQLRAAIRRATIKGAVTPVLCGSAFKNKGIQPLLDAIVYY
FT                   LPAPTDIPAFQGHAVGNEDEVVERHADPNEPFAALAFKITSDQHLGKLTYIRVYSGKID
FT                   AGTTVINSTKGKKERIGKIYQMHANKREERPSASAGQIVAVMGLKDTTTGDTLCDPNAP
FT                   VVLESMNFPAPVINVAIEPKTKGDQEKLATAIQRLAEEDPTFQVRRDEETGQTVIWGMG
FT                   ELHLEIIVDRMRREFKVEANVGRPQVAYRETIRRKVTGVEYTHKKQTGGAGQFGRVVID
FT                   LEPLGEGNDGYEFVNNITGGRIPREFIPSVDAGCQEAAEFGVLAGYPMVGVKVTLQDGA
FT                   YHEVDSSEMAFKIAGSMAFKEAARKAEPILLEPLMAVEVTTPEEYMGDVIGDLNGRRGQ
FT                   IQAMEDRTAGIKVIRALVPLAEMFGYVGDLRSKTQGRAVYSMQFHSYAEVPPGIAKEIV
FT                   AKARGE"
FT   gene            624694..625887
FT                   /locus_tag="Tbis_0560"
FT   CDS_pept        624694..625887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0560"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: sus:Acid_6322
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87287"
FT                   /db_xref="GOA:D6Y512"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y512"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ADG87287.1"
FT                   /translation="MAKAKFERTKPHMNIGTIGHIDHGKTTLTAAITKVLHDRYPDLNV
FT                   ATPFDKIDKAPEERARGITISISHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTKEHVLLARQVGVPYIVVALNKADMVDDEEILELVELEVRELLSSQ
FT                   GFPGDEVPVVRVSALKALEGDPKWAESIIELMNAVDEHVPEPQREVDKPFLMPIEDVFS
FT                   ITGRGTVVTGRIERGVIKVNDTVEIIGIRDKSLSTTVTSIEMFNKTLDEGHAGDNAALL
FT                   LRGIKRDQVERGMCVIKPGSTTPHTEFEAQVYVLSKDEGGRHTPFFNGYRPQFYFRTTD
FT                   VTGVVQLPEGTEMVMPGDNTEMRVQLIQPVAMEEGLKFAIREGGRTVGAGRVTKIIK"
FT   gene            626136..626444
FT                   /locus_tag="Tbis_0561"
FT   CDS_pept        626136..626444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0561"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: bha:BH0133 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87288"
FT                   /db_xref="GOA:D6Y513"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y513"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ADG87288.1"
FT                   /translation="MAGQKIRIRLKAYDHEVIDSSAKKIVETVTRTGAKVAGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFVMRTHKRLIDIIDPTPKTVDSLMRLDLPAGVDISIKL"
FT   gene            626458..627114
FT                   /locus_tag="Tbis_0562"
FT   CDS_pept        626458..627114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0562"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: mgm:Mmc1_0847 LSU
FT                   ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87289"
FT                   /db_xref="GOA:D6Y514"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y514"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /protein_id="ADG87289.1"
FT                   /translation="MARQIKGVLGKKLGMTQVFDEANRVVPVTVVEAGPCVVTRVRTPE
FT                   KDGYSAIQLGYGQIDPRKVNKPLGDYLRKHNITPRRYFAEIRTDDASEYTLGQEITVDI
FT                   FQPGDYVDVTGRSKGKGFAGVMKRHGFRGLGGSHGTQRKHRSPGSIGACATPGRVFKGL
FT                   RMAGRMGNARTTVQNLKVQAVDAEKNLILVKGAIPGANGSLVLIRTAVKKGAAAK"
FT   gene            627111..627761
FT                   /locus_tag="Tbis_0563"
FT   CDS_pept        627111..627761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0563"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG:
FT                   bcu:BCAH820_0123 ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87290"
FT                   /db_xref="GOA:D6Y515"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y515"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ADG87290.1"
FT                   /translation="MSTTIDVLDANGAKAGTVELPEEIFGAKVNVPLMHQVVVAQLAAR
FT                   RQGTHATKTRGDVSGGGKKPYRQKGTGRARQGSIRAPQFTGGGTVHGPQPRSYDQRTPK
FT                   KMKAAALRGALSDRASCGRVHVVTNLITGDTPKTKVALAALRKVTQAPRVLVVVDENDE
FT                   LTWRSLRNVPEVHLLDAGQLNTYDVLVNDDVVFTREAFEQVVARLGKSGKEEA"
FT   gene            627761..628063
FT                   /locus_tag="Tbis_0564"
FT   CDS_pept        627761..628063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0564"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: bra:BRADO3068
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87291"
FT                   /db_xref="GOA:D6Y516"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y516"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ADG87291.1"
FT                   /translation="MEKITDPRDIIIKPIISEKSYGLIDEQNKYTFLVRKDANKTQVKI
FT                   AIEQIFGVKVTGVNTINRKGKVKRTRRGFGRRPDTKRAIVSLAEGHRIDIFGPAS"
FT   gene            628191..629024
FT                   /locus_tag="Tbis_0565"
FT   CDS_pept        628191..629024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0565"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: dvu:DVU1306 50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87292"
FT                   /db_xref="GOA:D6Y517"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y517"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ADG87292.1"
FT                   /translation="MGIRKYKPTTPGRRGASVSDFSEITRSRPEKSLLAPLHRKGGRNH
FT                   HGRVTARHQGGGHKRAYRIIDFRRNDKDGIPAKVAHIEYDPNRTARIALLHYADGEKRY
FT                   ILAPVGLKQGDLVENGPTADIKPGNCLPLRNIPTGTFIHAVELRPGGGAKLARSAGAQI
FT                   QLLAKEGNYATLRMPSGEMRMVDVRCRATVGQVGNTEQANISIGKAGRNRWKGKRPSVR
FT                   GVAMNPVDHPHGGGEGKTSGGRHPVNPKGKPEGRTRRPNKPSDRLIIRRRSKKKR"
FT   gene            629036..629314
FT                   /locus_tag="Tbis_0566"
FT   CDS_pept        629036..629314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0566"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: bha:BH0138 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87293"
FT                   /db_xref="GOA:D6Y518"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y518"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ADG87293.1"
FT                   /translation="MPRSLKKGPFVDDHLMKKVIAQNEKGTKNVIKTWSRRSMIVPEMI
FT                   GHTIAVHDGRKHVPVFITEAMIGHKLGEFAPTRTFRSHVKEDRRSRR"
FT   gene            629348..629725
FT                   /locus_tag="Tbis_0567"
FT   CDS_pept        629348..629725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0567"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: bsu:BSU01210 50S ribosomal protein
FT                   L22"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87294"
FT                   /db_xref="GOA:D6Y519"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y519"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ADG87294.1"
FT                   /translation="MEARAQVRFARHTPRKARRVVDLIRGLPASEAQAVLKFAPQAASK
FT                   TVYKVLQSAIANAEHNFKLDKDTLWVSRAWVDEGPTLKRFRPRAQGRAYRINKRTSHIT
FT                   VIVESRPQQQPQQQKKKRRAR"
FT   gene            629725..630561
FT                   /locus_tag="Tbis_0568"
FT   CDS_pept        629725..630561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0568"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: ank:AnaeK_1939 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3- domain
FT                   protein; KH type 2 domain protein; Ribosomal protein S3
FT                   domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87295"
FT                   /db_xref="GOA:D6Y520"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y520"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ADG87295.1"
FT                   /translation="MGQKVHPHGFRLGITTDFKSRWYAEKLYKDYVAEDVAIRRMLQKG
FT                   MERAGISRVEIERTTDRVQVDIHTARPGIVIGRRGAEADRIRGDLEKLTGKQVQLNILE
FT                   VKNPEIDAQLVAQGVAEQLSSRVSFRRAMRKAMQTAMKSGAKGIRIQCSGRLGGAEMSR
FT                   SEFYREGRVPLHTLRADIDYGFYEARTTFGRIGVKVWIYKGDVPTNRAEREALAAASAR
FT                   ASQRQERRGERPRRGGGSERPRRGGASRGERAPKTEAAAQAAPESGPAEQPGAGGS"
FT   gene            630564..630983
FT                   /locus_tag="Tbis_0569"
FT   CDS_pept        630564..630983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0569"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: bha:BH0141 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87296"
FT                   /db_xref="GOA:D6Y521"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y521"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ADG87296.1"
FT                   /translation="MLIPRKVKHRKQHRPRRSGMAKGGTRVVFGDYGIQALEHAYVTNR
FT                   QIEAARIAMTRHIRRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWIANVKPGRVMF
FT                   ELSGVPEPVAREALRRAMHKLPMKCRFVKREVGEV"
FT   gene            630983..631219
FT                   /locus_tag="Tbis_0570"
FT   CDS_pept        630983..631219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0570"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: bsu:BSU01240 50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87297"
FT                   /db_xref="GOA:D6Y522"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y522"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ADG87297.1"
FT                   /translation="MAKSPTAAELRLEDHDTLVQKLKEAKEELFNLRFQAATGQLQNTA
FT                   RLRAVRREIARIYTVMRERELGIVTVEKESSDG"
FT   gene            631212..631502
FT                   /locus_tag="Tbis_0571"
FT   CDS_pept        631212..631502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0571"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: gme:Gmet_0635 30S
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87298"
FT                   /db_xref="GOA:D6Y523"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y523"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ADG87298.1"
FT                   /translation="MADTAEATGTGRQTRGRRKTREGIVVSDKMDKTVVVAVEDRVKHP
FT                   LYGKVIRRTSKYKAHDEHNACGVGDRVLLMETRPLSATKRWRVVRIIEKAQ"
FT   gene            631692..632060
FT                   /locus_tag="Tbis_0572"
FT   CDS_pept        631692..632060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0572"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: bcy:Bcer98_0114 50S ribosomal
FT                   protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87299"
FT                   /db_xref="GOA:D6Y524"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y524"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ADG87299.1"
FT                   /translation="MIQQESRLKVADNTGAKEILCIRVLGGSGRRYAGIGDVIVATVKD
FT                   AIPGGSVKKGDVVKAVVVRTAKERRRPDGSYIRFDENAAVLIRDSGDPRGTRIFGPVGR
FT                   ELRDKKFMRIISLAPEVL"
FT   gene            632060..632377
FT                   /locus_tag="Tbis_0573"
FT   CDS_pept        632060..632377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0573"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: bcy:Bcer98_0115 50S ribosomal protein L24;
FT                   TIGRFAM: ribosomal protein L24; PFAM: KOW domain protein;
FT                   SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87300"
FT                   /db_xref="GOA:D6Y525"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y525"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADG87300.1"
FT                   /translation="MPKLHVKKGDLVQVIAGKDKGAKGRVIRALPREQRVVVEGVNLIK
FT                   KHSKVTHQGPRGAKEGGVLTMEAPIHVSNVKKLKDDEKAEKPEKKAAAKGDTTEATGED
FT                   K"
FT   gene            632377..632946
FT                   /locus_tag="Tbis_0574"
FT   CDS_pept        632377..632946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0574"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: mmw:Mmwyl1_4264
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87301"
FT                   /db_xref="GOA:D6Y526"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y526"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ADG87301.1"
FT                   /translation="MTVTTQERVVPRLKLRYREEIVPKLREQFGYKNIMQVPKLTKIKV
FT                   NMGIGEAARDSKLIEGAIRDLAAITGQRPAIARARKSIAQFKLREGMPIGAHVTLRGDR
FT                   MWEFLDRLLSLALPRIRDFRGLSPKQFDGRGNYTFGLTEQLMFHEVDQDKIDRLRGMDI
FT                   TIVTTATDDEQGRALLKLLGFPFKEA"
FT   gene            632990..633175
FT                   /locus_tag="Tbis_0575"
FT   CDS_pept        632990..633175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0575"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: nis:NIS_0236 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87302"
FT                   /db_xref="GOA:D6Y527"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y527"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ADG87302.1"
FT                   /translation="MAKTALIVKARRKPKFKVRAYTRCTRCGRPRSVYRKFGLCRVCFR
FT                   EMAHRGELPGVTKASW"
FT   gene            633313..633711
FT                   /locus_tag="Tbis_0576"
FT   CDS_pept        633313..633711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0576"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: bha:BH0148 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87303"
FT                   /db_xref="GOA:D6Y528"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y528"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ADG87303.1"
FT                   /translation="MTMTDPIADMLTRLRNANAAYHDTVSMPYSKIKAHIAEILQQEGY
FT                   IQSWSVEDAKVGKNLVIELKFGPNRERALAGLRRVSKPGLRVYAKKDNLPRVLGGLGIA
FT                   ILSTSSGLMTDKQARKRGVGGEVLAYVW"
FT   gene            633731..634273
FT                   /locus_tag="Tbis_0577"
FT   CDS_pept        633731..634273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0577"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: glo:Glov_1361
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87304"
FT                   /db_xref="GOA:D6Y529"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y529"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /protein_id="ADG87304.1"
FT                   /translation="MSRIGRLPIPVPAGVEVTIDGRHVQVKGPKGTLSHTVAEPIQVSR
FT                   AEDGSIQVTRPNDENKVRALHGLTRTLIANMVTGVTQGYSKTLEIVGVGYRVQAKSPTQ
FT                   LEFALGYSHPIVVDAPEGITFRVEKPTLFHVEGIDKQKVGQVAANIRKLRKPDPYKGKG
FT                   VRYQGEVIRRKVGKAGK"
FT   gene            634276..634659
FT                   /locus_tag="Tbis_0578"
FT   CDS_pept        634276..634659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0578"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: bcy:Bcer98_0120 50S ribosomal
FT                   protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87305"
FT                   /db_xref="GOA:D6Y530"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y530"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADG87305.1"
FT                   /translation="MASKIAFRKRTAARVVARARRHRRVRKKIFGTAERPRLVVTRSTR
FT                   HMFVQIVDDTKGHTLVSASTMDASLRGLEGTKTEKARKVGELLAQRAKAAGITQVVFDR
FT                   GGNRYAGRIAALADSAREGGLVF"
FT   gene            634724..635356
FT                   /locus_tag="Tbis_0579"
FT   CDS_pept        634724..635356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0579"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   scl:sce7946 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87306"
FT                   /db_xref="GOA:D6Y531"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y531"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ADG87306.1"
FT                   /translation="MAAAPRRGAGGGGERRDRREDRRGGAADKGVSYIERVVKINRVAK
FT                   VVKGGRRFSFTALVVVGDGNGLVGVGYGKAKEVPAAIAKGVEEAKKHFFRVPRIQGTIP
FT                   HAVIGEEAAGVVLLRPASPGTGVIAGGPVRAVLECAGIHDVLSKSLGSDNPINIVHATV
FT                   KALKSLNRPEEIAARRGLPLEEVAPAAMLRARAEGLAEAAAAAKAVS"
FT   gene            635359..635556
FT                   /locus_tag="Tbis_0580"
FT   CDS_pept        635359..635556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0580"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: bpt:Bpet4932 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87307"
FT                   /db_xref="GOA:D6Y532"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y532"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADG87307.1"
FT                   /translation="MARLKITQVRSQIGSRQNQRDTLRSLGLKRIGDVVIKDDRPEIRG
FT                   MVATVSHLVQVTELTEEGGN"
FT   gene            635559..636014
FT                   /locus_tag="Tbis_0581"
FT   CDS_pept        635559..636014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0581"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: dde:Dde_2238 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87308"
FT                   /db_xref="GOA:D6Y533"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y533"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ADG87308.1"
FT                   /translation="MTERSPLKIHDLRPAPGANRPRIRKGRGEASKGKTAGRGTKGSKA
FT                   RTTIRPGFEGGQLPLQRRVPKLKGFSNSLFKKTYQVVNLSQLAKLYPQGGEVTPEDLVA
FT                   KGAVRKNQPVKVLGNGEISVALNVKAHAFSASAKEKIAAAGGSVSQL"
FT   gene            636199..637506
FT                   /locus_tag="Tbis_0582"
FT   CDS_pept        636199..637506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0582"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: sus:Acid_5098 protein translocase
FT                   subunit SecY/sec61 alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87309"
FT                   /db_xref="GOA:D6Y534"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y534"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ADG87309.1"
FT                   /translation="MLTAITRAFRTPDLRKKLLFTLGIIVLFRLGSVLPTPGVNSENIR
FT                   LCLEQAQAGDAGNIYGMVQLFSGGALLKLSVFALGIMPYITASIILQLLTVVIPRLETL
FT                   KKEGQAGQAKITQYTRYLTVALAVLQSTAFIALARSGQLFPSCTEPILVSEDIFPLVTM
FT                   VVTMTAGTAVIMWLGELITDRGIGNGMSLLIFTQVIAVFPAELVNIYRQSPLKFVVVMA
FT                   VGVVIIGVVIFIEQAQRRIPVQYAKRLVGRRMYGGTSTYIPLKVNQAGIIPVIFASSLL
FT                   YLPQLAVTLFGNTENPNVIIEWFAENLVRGDHPVYMAAFFALIIFFTYFYVSITFNPAE
FT                   VADNMKKYGGFIPGIRPGRPTAEYLNYVLTRLTAAGAPYLGVISLIPIVALAVAGASQN
FT                   FPFGGTSILIMVGVGLDTVKQIESQLQQRNYEGFLR"
FT   gene            637506..638159
FT                   /locus_tag="Tbis_0583"
FT   CDS_pept        637506..638159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0583"
FT                   /product="adenylate kinase"
FT                   /note="TIGRFAM: adenylate kinase; PFAM: adenylate kinase;
FT                   adenylate kinase lid domain protein; KEGG: pca:Pcar_0722
FT                   adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87310"
FT                   /db_xref="GOA:D6Y535"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y535"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADG87310.1"
FT                   /translation="MRVVLVGPPGAGKGTQAQYIASHLSVPKISTGDIFRANVSRGTEL
FT                   GKLAKEYMDRGELVPDEVTIAMVRDRLLQDDAREGFLLDGFPRNVPQAEVLKEMLAEFG
FT                   ASLDVVLELKVDDEEVIRRLSGRRTCRSCGKVWHVVFDPPAVEGVCDACGGELFQRDDD
FT                   REETIRRRLEVYQEQTAPLISFYEKEGILAGIDATGPVEEVTQRALSVLRRFGN"
FT   gene            638252..639067
FT                   /locus_tag="Tbis_0584"
FT   CDS_pept        638252..639067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0584"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: aba:Acid345_1248 methionine aminopeptidase,
FT                   type I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87311"
FT                   /db_xref="GOA:D6Y536"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y536"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADG87311.1"
FT                   /translation="MFRKSRHGIQIKTKEQIELMRAAGLVVARTLELLRKEVRPGITTL
FT                   DLDRIAEEAIRDQGAIPSFKGYHGYPATICASVNHEVVHGIPHDRRRLREGDIISIDCG
FT                   AILDGWHGDAAITVPVGEVSPELTKLMQVTEEAMWRGISALRVGGHLSDIGFRIERYVR
FT                   SQGRYGIPPEYGGHGIGTEMHMEPWVANYGKPGRGPRFEVGMCFAIEPMVNLGTPRTRV
FT                   LSDEWTVVTLDGRPSAHFEHSVALTEDGPLVLTALDGGASRLKGQGAAN"
FT   gene            complement(639182..639433)
FT                   /locus_tag="Tbis_0585"
FT   CDS_pept        complement(639182..639433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87312"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y537"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87312.1"
FT                   /translation="MRAPEPGRIRTPPQAGPQDRVPALEHAPLPFRVEQPLPTLRYGDL
FT                   ALTSTRPADGAGGRVQVVRRRPGGTWERIIDRPEPPTA"
FT   gene            complement(639420..640013)
FT                   /locus_tag="Tbis_0586"
FT   CDS_pept        complement(639420..640013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0586"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I2309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87313"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y538"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87313.1"
FT                   /translation="MLESMPAPLWIVSGPPGAGKSTVCELLLARLDPVPALLDKDTVYG
FT                   GFVAAMLAAYGRPEGEREGPWYDRHVKVHEYAGLTATARQIRSHGCPVMLAGPFTSQVH
FT                   DAELWRRWVDELGGGVVHLLWVRSDGPTLGRRLVERGLTRDAGKLANFENFLRAIRVDE
FT                   PPVVPHVEIDNRLGAPPLAEQIDRCVRAWQGARS"
FT   gene            640130..640570
FT                   /locus_tag="Tbis_0587"
FT   CDS_pept        640130..640570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0587"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87314"
FT                   /db_xref="GOA:D6Y539"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y539"
FT                   /inference="protein motif:PFAM:PF08044"
FT                   /protein_id="ADG87314.1"
FT                   /translation="MSISPEMRASDRDRDRVAEALREHLAEGRLTVDEFNERLERVYQS
FT                   RTYGELAKITADLPEIDLHRPPAPAPSKEVARKRRPAEVALKASWAAWATASSINWVIW
FT                   LIVSITTGTWIYPWPLWVMGPWGAALLVGTIFGRQFGHGRNG"
FT   gene            641061..641282
FT                   /locus_tag="Tbis_0588"
FT   CDS_pept        641061..641282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0588"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: bsu:BSU01390 translation initiation factor IF-
FT                   1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein; SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87315"
FT                   /db_xref="GOA:D6Y540"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y540"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADG87315.1"
FT                   /translation="MAKKDGAIEIEGTVVETLPNAMFRVQLDNGHMVLAHISGRMRMHY
FT                   IRILPDDRVVVELSPYDLSRGRIVYRYK"
FT   gene            641326..641439
FT                   /locus_tag="Tbis_0589"
FT   CDS_pept        641326..641439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0589"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: aba:Acid345_1250 LSU ribosomal protein
FT                   L36P"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87316"
FT                   /db_xref="GOA:D6Y541"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y541"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ADG87316.1"
FT                   /translation="MKVRPSVKKICDKCRVIRRHGRVMVICENLRHKQRQG"
FT   gene            641599..641979
FT                   /locus_tag="Tbis_0590"
FT   CDS_pept        641599..641979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0590"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: gsu:GSU2834 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87317"
FT                   /db_xref="GOA:D6Y542"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y542"
FT                   /inference="protein motif:PFAM:PF00416"
FT                   /protein_id="ADG87317.1"
FT                   /translation="MARLVGVDLPRDKRLEIALTYIYGIGRSRAKEILKATGINPDLRV
FT                   YQLTDAELVPIRDYIEANYKVEGDLRREVQADIRRKIEIGCYQGIRHRKGLPVRGQRTQ
FT                   TNARTRKGKRKTVAGKKKPGKK"
FT   gene            642013..642423
FT                   /locus_tag="Tbis_0591"
FT   CDS_pept        642013..642423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0591"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: bha:BH0161 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87318"
FT                   /db_xref="GOA:D6Y543"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y543"
FT                   /inference="protein motif:PFAM:PF00411"
FT                   /protein_id="ADG87318.1"
FT                   /translation="MPPKSRQGATSSKKSRRKEKKNVAHGHAHIKSTFNNTIVSITDTN
FT                   GNVISWASAGHVGFKGSRKSTPFAAQMAAENAARRAMEHGMRKVDVFVKGPGSGRETAI
FT                   RALQATGLEVDSIQDVTPVPHNGCRPPKRRRV"
FT   gene            642442..643068
FT                   /locus_tag="Tbis_0592"
FT   CDS_pept        642442..643068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0592"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: ppd:Ppro_0705 30S ribosomal protein S4;
FT                   TIGRFAM: ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87319"
FT                   /db_xref="GOA:D6Y544"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y544"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADG87319.1"
FT                   /translation="MARYTGPDCKLCRREKTKLFLKGKKCESAKCPIEIRPYPPGEHGR
FT                   GRPKESEYQLQLREKQKTRRIYGVLEKQFHRYYEEASRRPGKTGENLLQILESRLDNVV
FT                   YRAGFAESRDAARQQVRHGHFLVNGRKVNIPSYRVREHDVIEVRENKRHLMPYEVARAT
FT                   HSEKKIPAWLGVSTEHMRILVHQLPTRQQIDTLVQEQLIVELYSK"
FT   gene            643228..644250
FT                   /locus_tag="Tbis_0593"
FT   CDS_pept        643228..644250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0593"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: bha:BH0162 DNA-directed RNA polymerase subunit
FT                   alpha; TIGRFAM: DNA-directed RNA polymerase, alpha subunit;
FT                   PFAM: RNA polymerase insert; RNA polymerase alpha subunit
FT                   domain protein; RNA polymerase dimerisation; SMART: RNA
FT                   polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87320"
FT                   /db_xref="GOA:D6Y545"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y545"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ADG87320.1"
FT                   /translation="MLIAQRPTLQEEPLSEYRSRFILEPLEPGFGYTIGNSLRRTLLSS
FT                   IPGAAVTSIRIEGVLHEFSTVPGVKEDVTDIILNLKQLVVSSEHDEPVVMYLRKQGPGE
FT                   VTAADIAPPAGVEVHNPELHIATLNGKAKLEMELTVERGRGYVSAAQNKQPGQEIGRIP
FT                   IDSIYSPVLKVTYKVEATRVEQRTDFDRLILDVETKPSIKPRDAVASAGKTLVELFGLA
FT                   RELNVEAEGIEIGPSPTDAALAADLALPIEELNLTVRSYNCLKREGIHTVGELVSRSEQ
FT                   DLLDIRNFGAKSIEEVKQKLAEMGLTLKDSPPGFDPATVAGGGGRLDDEDRGFIETEQY
FT                   "
FT   gene            644409..644981
FT                   /locus_tag="Tbis_0594"
FT   CDS_pept        644409..644981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0594"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: dol:Dole_0734 ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87321"
FT                   /db_xref="GOA:D6Y546"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y546"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ADG87321.1"
FT                   /translation="MPKPTKGARLGGSPAHERLILANLATQLFQHGRIRTTEAKAKRLR
FT                   PFAERLITKAKKGDLHNRRQVLAVIRDKSVVHHLFTEIAPTFAERPGGYTRITKIGPRR
FT                   GDNAPMAIIELVTEPMRPVRVARKAPAAAEQQAEQPKAAEEQKAAQEEQAAEAKAEAAQ
FT                   EQAETAAEAEKAEAAEGGKQDEKKDEA"
FT   gene            645093..645977
FT                   /locus_tag="Tbis_0595"
FT   CDS_pept        645093..645977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0595"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: acp:A2cp1_0410 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: tRNA
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87322"
FT                   /db_xref="GOA:D6Y547"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y547"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADG87322.1"
FT                   /translation="MDRDPVRFRLDLGYDGTDFQGWARQPGLRTVQGELEAALATLLRL
FT                   EAPPRLTVAGRTDAGVHARGQVVHVDLPLAALAILEPRGRETATPPAERLPELCSALVR
FT                   RLAAVLPPDVRVFAVSVPPDGFDARFSALCRRYCYRVCDAPGGVDPLRRREVLWYPKPL
FT                   DVELMNAASVRLLGEHDFAAFCKKREGATTIRELRRFEWARRDDGIIEATVVADAFCHS
FT                   MVRSLVGAVLAVGEGKRPVEWPAEVLARAVRDSAVRVAPAHGLTLEEVRYPETAEELAR
FT                   RAAQARRVRTLTS"
FT   gene            complement(645967..647571)
FT                   /locus_tag="Tbis_0596"
FT   CDS_pept        complement(645967..647571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG02561"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87323"
FT                   /db_xref="GOA:D6Y548"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y548"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87323.1"
FT                   /translation="MPRSWPPPAAYGTERPAPVPADGSAPRPGASSPADPRSGTPDASQ
FT                   AAGRPGEHTGTAEPATATAAAQGDAPKEGAPAAGPGAPRPEPAKETEPTGDGGGPTGDR
FT                   PPRDGSATRPPQAAAPERPAEAGARPAGAEAQPAGTETSPGETGTRPTGTDTRPAGTDA
FT                   AEAAPAPGASAPAAGETAPEASDPPGQTAEERPADDRPASEEQDDPAQSEGQHTMPLRL
FT                   PRSDTSSGEQATSPAQDRRDPSAPGSMFTPVIPAKAARPPMPPPFGAPPPPQSRADGPG
FT                   ASPETGRPSSQQDPGRRTLSGAAKKVVIAAASVVAVAAIGTGAFLAYGGPDEGTARSGA
FT                   TSSAAPATTEPEPEPTGPDAKLDSETTDPNTLTLNEAFPETRVTVAGRTFRRVKVHSTD
FT                   ECDQAATGAFATALAEQHCRRVLRATYVDRERDFAVTTGIAVLPTKEAALTVDRAKDLG
FT                   RNVWFRGLNGKQGSGAERMEIAGGYGAGLVWGRYIVFSYATYSDGRTPGPDDTKLAPVS
FT                   GAFRDHTTKVIEKRLKK"
FT   gene            complement(649137..650075)
FT                   /locus_tag="Tbis_0597"
FT   CDS_pept        complement(649137..650075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0597"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87324"
FT                   /db_xref="GOA:D6Y549"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y549"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADG87324.1"
FT                   /translation="MDTGHAPLGGAHGPEPGGTPQGAAPHQPEPGPGPGGPGPGEESPS
FT                   RRDEQSRTAPGRRQRPAEQAEPAWDPDARGPQWIKPLILTGGVMALIGALFFGLWTAAK
FT                   NEKPAAPVATPKPSSSLPSFPTGKYGFAASRKTDKTPLTVKELFGKAKFATKGRGYVRT
FT                   VWRKEKRCEDGVNGDKIKKALRSGRCTQLIRASFRDTKNKIIGTVGVANLATSAAAKKV
FT                   ATAGGGKEREDYLKPLPGKDEATKQLGNGDAYAGGWTYGHYAVLLWFQFKDGHKPNKNE
FT                   LKQLYRAANDIADQTVFPALEHRSLTGGRRA"
FT   gene            complement(650477..651307)
FT                   /locus_tag="Tbis_0598"
FT   CDS_pept        complement(650477..651307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0598"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG: mxa:MXAN_5965
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87325"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y550"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ADG87325.1"
FT                   /translation="MPHLLILGCNMRQTIRSTQPTRTPRPGTLLGLLSCAAALLLTGVV
FT                   IGRVTAAEGNGGEQVYLHFPETQPSTAVTPAGVAEHTSRSAERWGDRPPLDPVRRTPAP
FT                   TPSARATRTPAPRATSEAGGPDGGGTVVHAHSAGEEADGPHWDATGHPELEREVLRLVN
FT                   LARVAHGCRRLRLDPRLVRSARRHAAQMAASGRFSHTWSDGTTAWDRMAAADYPDGAAE
FT                   TIARGYRSAEAVVAGWMARKADRRTLLDCRIVAVGIGVSIGPTGYWWTGDFGYS"
FT   sig_peptide     complement(651152..651307)
FT                   /locus_tag="Tbis_0598"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.965 at
FT                   residue 52"
FT   gene            651568..652011
FT                   /locus_tag="Tbis_0599"
FT   CDS_pept        651568..652011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0599"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: dvm:DvMF_0969 ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87326"
FT                   /db_xref="GOA:D6Y551"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y551"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADG87326.1"
FT                   /translation="MRTFSPKSSDVERRWWVIDATDVVLGRLASQVAILLRGKHKPIYA
FT                   PHVDTGDFVIVVNADKVALTGNKLTQKRAYRHSGYPGGLRSVTYEELMKKRPDRVVEKA
FT                   VRGMLPKNSLGRKMAKKLKVYAGPEHPHQAQKPVPYQITQIAQ"
FT   gene            652042..652563
FT                   /locus_tag="Tbis_0600"
FT   CDS_pept        652042..652563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0600"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: rde:RD1_2612 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87327"
FT                   /db_xref="GOA:D6Y552"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y552"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADG87327.1"
FT                   /translation="MAEPSGIDTLVAGEPEGYSAEEYPSHYTTESAPADDSAVRKPVIT
FT                   GASYGTGRRKEAVARVRIKPGTGQWTINGRSLESYFPNKIHQHLVNEPFAVLGAEGAFD
FT                   VFVRVHGGGISGQAGAIRLGLSRALAALDTEVNRPPLKKAGFLTRDARVVERKKYGLKK
FT                   ARKAPQYSKR"
FT   gene            652565..653920
FT                   /locus_tag="Tbis_0601"
FT   CDS_pept        652565..653920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0601"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II; KEGG: bsu:BSU01770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87328"
FT                   /db_xref="GOA:D6Y553"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y553"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ADG87328.1"
FT                   /translation="MGRLFGTDGVRGVAGRDLTAELAMDLAVAAANVLGDAGELSAGSG
FT                   RRGRPVAVVGRDSRASGEFLEAAVVAGLASSGVDVLRLGVLPTPAVAYLTSALGADLGV
FT                   MLSASHNPAPDNGIKFFARGGFKLPDAVEDEIEARLGERRPRAVGAAVGRIREAYGEAE
FT                   RYVSHLLDSLPHRLDGLRIVVDCAHGAAHLVAPEALRRAGAQVETIGASPDGLNINDGV
FT                   GSTHLETLQRAVVERGADLGVAYDGDADRCLAVTGGGEPVDGDQILAILALAMNAEGRL
FT                   AKGTVVATVMSNLGLKIALERAGLKLVQTAVGDRYVLEAMQANGYNLGGEQSGHVIMLD
FT                   HATTGDGLLTSLHLLARVAASGSSLTELAAVMTRLPQVLVNVRDVDKSKASAPELREAV
FT                   AEAEAELGETGRVLLRPSGTEPIIRVMVEAGSQEHAESIAHRLAEVVRKVCG"
FT   gene            complement(654079..654795)
FT                   /locus_tag="Tbis_0602"
FT   CDS_pept        complement(654079..654795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0602"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   rsq:Rsph17025_3324 NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87329"
FT                   /db_xref="GOA:D6Y554"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y554"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADG87329.1"
FT                   /translation="MNAVVANITYRAMLGRKRVWPLVLLPVFLLLMAGALRLLNGQDEQ
FT                   LAVNMLRSFAIGTVVPLIALIVGTGVIAPEIEDGTIVHLLAKPIPRAVIAFTKFTVAAT
FT                   LVVAFAVVPTVAAAWVLIGMESGVTAGYALGALAAGVVYTAVFLALGIVTRHAITIGVG
FT                   YVLIWENLIAPRVPGARRVSVQQWAHTIADQISSSVFVKSDVALGLALPAVVIVTAGAL
FT                   LWAARRLRAFSLTGDA"
FT   gene            complement(655178..656131)
FT                   /locus_tag="Tbis_0603"
FT   CDS_pept        complement(655178..656131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0603"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_7687 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tbis_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADG87330"
FT                   /db_xref="GOA:D6Y555"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D6Y555"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADG87330.1"
FT                   /translation="MTVTTPPATVTGQNVIQLTNVSRWYGNVVAVNDVTMTIGPGVTGL
FT                   LGPNGAGKSTLVHMMAGFLAPSTGTVTLGGEPIWRNHEVYRRIGLVQEKEAVYGFLTGW
FT                   EFVLSAARLHRLPDPAGAAHRAIELVEMTGAADRRIETYSKGMRQRIKVAAALVHDPQV
FT                   LLLDEPFNGMDPRQRLHLMELIRRMGEEGRTVLFSSHILEEVERVAQQIEVVVAGRHAA
FT                   SGDHREIRRRMTDRPHLFRVRSSDDRLLAAALIRDASSTAVSVTADGLEVQTADFSRFT
FT                   ALLPKVARDLGVRLWQVSPADEDLESVFAYLTSGSS"
FT   gene            complement(656128..656991)
FT                   /locus_tag="Tbis_0604"
FT   CDS_pept        complement(656128..656991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tbis_0604"
FT