(data stored in ACNUC17686 zone)

EMBL: CP001878

ID   CP001878; SV 2; circular; genomic DNA; STD; PRO; 3858997 BP.
AC   CP001878;
PR   Project:PRJNA28811;
DT   08-FEB-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
DE   Bacillus pseudofirmus OF4, complete genome.
KW   .
OS   Bacillus pseudofirmus OF4
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
RN   [1]
RP   1-3858997
RX   PUBMED; 21951522.
RA   Janto B., Ahmed A., Ito M., Liu J., Hicks D.B., Pagni S., Fackelmayer O.J.,
RA   Smith T.A., Earl J., Elbourne L.D., Hassan K., Paulsen I.T., Kolsto A.B.,
RA   Tourasse N.J., Ehrlich G.D., Boissy R., Ivey D.M., Li G., Xue Y., Ma Y.,
RA   Hu F.Z., Krulwich T.A.;
RT   "Genome of alkaliphilic Bacillus pseudofirmus OF4 reveals adaptations that
RT   support the ability to grow in an external pH range from 7.5 to 11.4";
RL   Environ. Microbiol. 13(12):3289-3309(2011).
RN   [2]
RP   1-3858997
RA   Janto B., Ahmed A., Ito M., Liu J., Hicks D., Pagni S., Fackelmayer O.,
RA   Earl J., Elbourne L., Paulsen I., Ehrlich G.D., Boissy R., Ivey D.M.,
RA   Li G., Xue Y., Ma Y., Kolsto A.-B., Tourasse N., Hu F.Z., Krulwich T.A.;
RT   ;
RL   Submitted (25-JAN-2010) to the INSDC.
RL   Center for Genomic Sciences, Allegheny-Singer Research Institute, 320 E.
RL   North Ave. 11th Floor, Pittsburgh, PA 15212-4772, USA
RN   [3]
RC   Sequence update by submitter
RP   1-3858997
RA   Janto B., Ahmed A., Ito M., Liu J., Hicks D., Pagni S., Fackelmayer O.,
RA   Earl J., Elbourne L., Paulsen I., Ehrlich G.D., Boissy R., Ivey D.M.,
RA   Li G., Xue Y., Ma Y., Kolsto A.-B., Tourasse N., Hu F.Z., Krulwich T.A.;
RT   ;
RL   Submitted (15-DEC-2010) to the INSDC.
RL   Center for Genomic Sciences, Allegheny-Singer Research Institute, 320 E.
RL   North Ave. 11th Floor, Pittsburgh, PA 15212-4772, USA
DR   MD5; e959916d303389c8845c7ecab2710cdb.
DR   BioSample; SAMN02603086.
DR   EnsemblGenomes-Gn; BpOF4_05242.
DR   EnsemblGenomes-Gn; BpOF4_05243.
DR   EnsemblGenomes-Gn; BpOF4_r19917.
DR   EnsemblGenomes-Gn; BpOF4_r19919.
DR   EnsemblGenomes-Gn; BpOF4_r19921.
DR   EnsemblGenomes-Gn; BpOF4_r19923.
DR   EnsemblGenomes-Gn; BpOF4_r19925.
DR   EnsemblGenomes-Gn; BpOF4_r19927.
DR   EnsemblGenomes-Gn; BpOF4_r19929.
DR   EnsemblGenomes-Gn; BpOF4_r19931.
DR   EnsemblGenomes-Gn; BpOF4_r19933.
DR   EnsemblGenomes-Gn; BpOF4_r19935.
DR   EnsemblGenomes-Gn; BpOF4_r19937.
DR   EnsemblGenomes-Gn; BpOF4_r19939.
DR   EnsemblGenomes-Gn; BpOF4_r19941.
DR   EnsemblGenomes-Gn; BpOF4_r19943.
DR   EnsemblGenomes-Gn; BpOF4_r19945.
DR   EnsemblGenomes-Gn; BpOF4_r19947.
DR   EnsemblGenomes-Gn; BpOF4_r19949.
DR   EnsemblGenomes-Gn; BpOF4_r19951.
DR   EnsemblGenomes-Gn; BpOF4_r19953.
DR   EnsemblGenomes-Gn; BpOF4_r19955.
DR   EnsemblGenomes-Gn; BpOF4_r19957.
DR   EnsemblGenomes-Gn; BpOF4_r19959.
DR   EnsemblGenomes-Gn; BpOF4_t19767.
DR   EnsemblGenomes-Gn; BpOF4_t19769.
DR   EnsemblGenomes-Gn; BpOF4_t19771.
DR   EnsemblGenomes-Gn; BpOF4_t19773.
DR   EnsemblGenomes-Gn; BpOF4_t19775.
DR   EnsemblGenomes-Gn; BpOF4_t19777.
DR   EnsemblGenomes-Gn; BpOF4_t19779.
DR   EnsemblGenomes-Gn; BpOF4_t19781.
DR   EnsemblGenomes-Gn; BpOF4_t19783.
DR   EnsemblGenomes-Gn; BpOF4_t19785.
DR   EnsemblGenomes-Gn; BpOF4_t19787.
DR   EnsemblGenomes-Gn; BpOF4_t19789.
DR   EnsemblGenomes-Gn; BpOF4_t19791.
DR   EnsemblGenomes-Gn; BpOF4_t19793.
DR   EnsemblGenomes-Gn; BpOF4_t19795.
DR   EnsemblGenomes-Gn; BpOF4_t19797.
DR   EnsemblGenomes-Gn; BpOF4_t19799.
DR   EnsemblGenomes-Gn; BpOF4_t19801.
DR   EnsemblGenomes-Gn; BpOF4_t19803.
DR   EnsemblGenomes-Gn; BpOF4_t19805.
DR   EnsemblGenomes-Gn; BpOF4_t19807.
DR   EnsemblGenomes-Gn; BpOF4_t19809.
DR   EnsemblGenomes-Gn; BpOF4_t19811.
DR   EnsemblGenomes-Gn; BpOF4_t19813.
DR   EnsemblGenomes-Gn; BpOF4_t19815.
DR   EnsemblGenomes-Gn; BpOF4_t19817.
DR   EnsemblGenomes-Gn; BpOF4_t19819.
DR   EnsemblGenomes-Gn; BpOF4_t19821.
DR   EnsemblGenomes-Gn; BpOF4_t19823.
DR   EnsemblGenomes-Gn; BpOF4_t19825.
DR   EnsemblGenomes-Gn; BpOF4_t19827.
DR   EnsemblGenomes-Gn; BpOF4_t19829.
DR   EnsemblGenomes-Gn; BpOF4_t19831.
DR   EnsemblGenomes-Gn; BpOF4_t19833.
DR   EnsemblGenomes-Gn; BpOF4_t19835.
DR   EnsemblGenomes-Gn; BpOF4_t19837.
DR   EnsemblGenomes-Gn; BpOF4_t19839.
DR   EnsemblGenomes-Gn; BpOF4_t19841.
DR   EnsemblGenomes-Gn; BpOF4_t19843.
DR   EnsemblGenomes-Gn; BpOF4_t19845.
DR   EnsemblGenomes-Gn; BpOF4_t19847.
DR   EnsemblGenomes-Gn; BpOF4_t19849.
DR   EnsemblGenomes-Gn; BpOF4_t19851.
DR   EnsemblGenomes-Gn; BpOF4_t19853.
DR   EnsemblGenomes-Gn; BpOF4_t19855.
DR   EnsemblGenomes-Gn; BpOF4_t19857.
DR   EnsemblGenomes-Gn; BpOF4_t19859.
DR   EnsemblGenomes-Gn; BpOF4_t19861.
DR   EnsemblGenomes-Gn; BpOF4_t19863.
DR   EnsemblGenomes-Gn; BpOF4_t19865.
DR   EnsemblGenomes-Gn; BpOF4_t19867.
DR   EnsemblGenomes-Gn; BpOF4_t19869.
DR   EnsemblGenomes-Gn; BpOF4_t19871.
DR   EnsemblGenomes-Gn; BpOF4_t19873.
DR   EnsemblGenomes-Gn; BpOF4_t19875.
DR   EnsemblGenomes-Gn; BpOF4_t19877.
DR   EnsemblGenomes-Gn; BpOF4_t19879.
DR   EnsemblGenomes-Gn; BpOF4_t19881.
DR   EnsemblGenomes-Gn; BpOF4_t19883.
DR   EnsemblGenomes-Gn; BpOF4_t19885.
DR   EnsemblGenomes-Gn; BpOF4_t19887.
DR   EnsemblGenomes-Gn; BpOF4_t19889.
DR   EnsemblGenomes-Gn; BpOF4_t19891.
DR   EnsemblGenomes-Gn; BpOF4_t19893.
DR   EnsemblGenomes-Gn; BpOF4_t19895.
DR   EnsemblGenomes-Gn; BpOF4_t19897.
DR   EnsemblGenomes-Gn; BpOF4_t19899.
DR   EnsemblGenomes-Gn; BpOF4_t19901.
DR   EnsemblGenomes-Gn; BpOF4_t19903.
DR   EnsemblGenomes-Gn; BpOF4_t19905.
DR   EnsemblGenomes-Gn; BpOF4_t19907.
DR   EnsemblGenomes-Gn; BpOF4_t19909.
DR   EnsemblGenomes-Gn; BpOF4_t19911.
DR   EnsemblGenomes-Gn; BpOF4_t19913.
DR   EnsemblGenomes-Gn; BpOF4_t19915.
DR   EnsemblGenomes-Gn; EBG00001444379.
DR   EnsemblGenomes-Gn; EBG00001444380.
DR   EnsemblGenomes-Gn; EBG00001444381.
DR   EnsemblGenomes-Gn; EBG00001444382.
DR   EnsemblGenomes-Gn; EBG00001444383.
DR   EnsemblGenomes-Gn; EBG00001444384.
DR   EnsemblGenomes-Gn; EBG00001444385.
DR   EnsemblGenomes-Gn; EBG00001444386.
DR   EnsemblGenomes-Gn; EBG00001444387.
DR   EnsemblGenomes-Gn; EBG00001444388.
DR   EnsemblGenomes-Gn; EBG00001444389.
DR   EnsemblGenomes-Gn; EBG00001444390.
DR   EnsemblGenomes-Gn; EBG00001444391.
DR   EnsemblGenomes-Gn; EBG00001444392.
DR   EnsemblGenomes-Gn; EBG00001444393.
DR   EnsemblGenomes-Gn; EBG00001444394.
DR   EnsemblGenomes-Gn; EBG00001444395.
DR   EnsemblGenomes-Gn; EBG00001444396.
DR   EnsemblGenomes-Gn; EBG00001444397.
DR   EnsemblGenomes-Gn; EBG00001444398.
DR   EnsemblGenomes-Gn; EBG00001444399.
DR   EnsemblGenomes-Gn; EBG00001444400.
DR   EnsemblGenomes-Gn; EBG00001444401.
DR   EnsemblGenomes-Gn; EBG00001444402.
DR   EnsemblGenomes-Gn; EBG00001444403.
DR   EnsemblGenomes-Gn; EBG00001444404.
DR   EnsemblGenomes-Gn; EBG00001444405.
DR   EnsemblGenomes-Gn; EBG00001444406.
DR   EnsemblGenomes-Gn; EBG00001444407.
DR   EnsemblGenomes-Gn; EBG00001444408.
DR   EnsemblGenomes-Gn; EBG00001444409.
DR   EnsemblGenomes-Gn; EBG00001444410.
DR   EnsemblGenomes-Gn; EBG00001444411.
DR   EnsemblGenomes-Gn; EBG00001444412.
DR   EnsemblGenomes-Gn; EBG00001444413.
DR   EnsemblGenomes-Gn; EBG00001444414.
DR   EnsemblGenomes-Gn; EBG00001444415.
DR   EnsemblGenomes-Gn; EBG00001444416.
DR   EnsemblGenomes-Gn; EBG00001444417.
DR   EnsemblGenomes-Gn; EBG00001444418.
DR   EnsemblGenomes-Gn; EBG00001444419.
DR   EnsemblGenomes-Gn; EBG00001444420.
DR   EnsemblGenomes-Gn; EBG00001444421.
DR   EnsemblGenomes-Gn; EBG00001444422.
DR   EnsemblGenomes-Gn; EBG00001444423.
DR   EnsemblGenomes-Gn; EBG00001444424.
DR   EnsemblGenomes-Gn; EBG00001444425.
DR   EnsemblGenomes-Gn; EBG00001444426.
DR   EnsemblGenomes-Gn; EBG00001444427.
DR   EnsemblGenomes-Gn; EBG00001444428.
DR   EnsemblGenomes-Gn; EBG00001444429.
DR   EnsemblGenomes-Gn; EBG00001444430.
DR   EnsemblGenomes-Gn; EBG00001444431.
DR   EnsemblGenomes-Gn; EBG00001444432.
DR   EnsemblGenomes-Gn; EBG00001444433.
DR   EnsemblGenomes-Gn; EBG00001444434.
DR   EnsemblGenomes-Gn; EBG00001444435.
DR   EnsemblGenomes-Gn; EBG00001444436.
DR   EnsemblGenomes-Gn; EBG00001444437.
DR   EnsemblGenomes-Gn; EBG00001444438.
DR   EnsemblGenomes-Gn; EBG00001444439.
DR   EnsemblGenomes-Gn; EBG00001444440.
DR   EnsemblGenomes-Gn; EBG00001444441.
DR   EnsemblGenomes-Gn; EBG00001444442.
DR   EnsemblGenomes-Gn; EBG00001444443.
DR   EnsemblGenomes-Gn; EBG00001444444.
DR   EnsemblGenomes-Gn; EBG00001444445.
DR   EnsemblGenomes-Gn; EBG00001444446.
DR   EnsemblGenomes-Gn; EBG00001444447.
DR   EnsemblGenomes-Gn; EBG00001444448.
DR   EnsemblGenomes-Gn; EBG00001444449.
DR   EnsemblGenomes-Gn; EBG00001444450.
DR   EnsemblGenomes-Gn; EBG00001444451.
DR   EnsemblGenomes-Gn; EBG00001444452.
DR   EnsemblGenomes-Gn; EBG00001444453.
DR   EnsemblGenomes-Gn; EBG00001444454.
DR   EnsemblGenomes-Gn; EBG00001444455.
DR   EnsemblGenomes-Gn; EBG00001444456.
DR   EnsemblGenomes-Gn; EBG00001444457.
DR   EnsemblGenomes-Gn; EBG00001444458.
DR   EnsemblGenomes-Gn; EBG00001444459.
DR   EnsemblGenomes-Gn; EBG00001444460.
DR   EnsemblGenomes-Gn; EBG00001444461.
DR   EnsemblGenomes-Gn; EBG00001444462.
DR   EnsemblGenomes-Gn; EBG00001444463.
DR   EnsemblGenomes-Gn; EBG00001444464.
DR   EnsemblGenomes-Gn; EBG00001444465.
DR   EnsemblGenomes-Gn; EBG00001444466.
DR   EnsemblGenomes-Gn; EBG00001444467.
DR   EnsemblGenomes-Gn; EBG00001444468.
DR   EnsemblGenomes-Gn; EBG00001444469.
DR   EnsemblGenomes-Gn; EBG00001444470.
DR   EnsemblGenomes-Gn; EBG00001444471.
DR   EnsemblGenomes-Gn; EBG00001444472.
DR   EnsemblGenomes-Gn; EBG00001444473.
DR   EnsemblGenomes-Gn; EBG00001444474.
DR   EnsemblGenomes-Gn; EBG00001444475.
DR   EnsemblGenomes-Gn; EBG00001444476.
DR   EnsemblGenomes-Gn; EBG00001444477.
DR   EnsemblGenomes-Gn; EBG00001444478.
DR   EnsemblGenomes-Gn; EBG00001444479.
DR   EnsemblGenomes-Gn; EBG00001444480.
DR   EnsemblGenomes-Gn; EBG00001444481.
DR   EnsemblGenomes-Gn; EBG00001444482.
DR   EnsemblGenomes-Gn; EBG00001444483.
DR   EnsemblGenomes-Gn; EBG00001444484.
DR   EnsemblGenomes-Gn; EBG00001444485.
DR   EnsemblGenomes-Gn; EBG00001444486.
DR   EnsemblGenomes-Gn; EBG00001444487.
DR   EnsemblGenomes-Gn; EBG00001444488.
DR   EnsemblGenomes-Gn; EBG00001444489.
DR   EnsemblGenomes-Gn; EBG00001444490.
DR   EnsemblGenomes-Gn; EBG00001444491.
DR   EnsemblGenomes-Gn; EBG00001444492.
DR   EnsemblGenomes-Gn; EBG00001444493.
DR   EnsemblGenomes-Gn; EBG00001444494.
DR   EnsemblGenomes-Gn; EBG00001444495.
DR   EnsemblGenomes-Gn; EBG00001444496.
DR   EnsemblGenomes-Gn; EBG00001444497.
DR   EnsemblGenomes-Gn; EBG00001444498.
DR   EnsemblGenomes-Gn; EBG00001444499.
DR   EnsemblGenomes-Gn; EBG00001444500.
DR   EnsemblGenomes-Gn; EBG00001444501.
DR   EnsemblGenomes-Tr; BpOF4_05242-1.
DR   EnsemblGenomes-Tr; BpOF4_05243-1.
DR   EnsemblGenomes-Tr; BpOF4_r19917-1.
DR   EnsemblGenomes-Tr; BpOF4_r19919-1.
DR   EnsemblGenomes-Tr; BpOF4_r19921-1.
DR   EnsemblGenomes-Tr; BpOF4_r19923-1.
DR   EnsemblGenomes-Tr; BpOF4_r19925-1.
DR   EnsemblGenomes-Tr; BpOF4_r19927-1.
DR   EnsemblGenomes-Tr; BpOF4_r19929-1.
DR   EnsemblGenomes-Tr; BpOF4_r19931-1.
DR   EnsemblGenomes-Tr; BpOF4_r19933-1.
DR   EnsemblGenomes-Tr; BpOF4_r19935-1.
DR   EnsemblGenomes-Tr; BpOF4_r19937-1.
DR   EnsemblGenomes-Tr; BpOF4_r19939-1.
DR   EnsemblGenomes-Tr; BpOF4_r19941-1.
DR   EnsemblGenomes-Tr; BpOF4_r19943-1.
DR   EnsemblGenomes-Tr; BpOF4_r19945-1.
DR   EnsemblGenomes-Tr; BpOF4_r19947-1.
DR   EnsemblGenomes-Tr; BpOF4_r19949-1.
DR   EnsemblGenomes-Tr; BpOF4_r19951-1.
DR   EnsemblGenomes-Tr; BpOF4_r19953-1.
DR   EnsemblGenomes-Tr; BpOF4_r19955-1.
DR   EnsemblGenomes-Tr; BpOF4_r19957-1.
DR   EnsemblGenomes-Tr; BpOF4_r19959-1.
DR   EnsemblGenomes-Tr; BpOF4_t19767-1.
DR   EnsemblGenomes-Tr; BpOF4_t19769-1.
DR   EnsemblGenomes-Tr; BpOF4_t19771-1.
DR   EnsemblGenomes-Tr; BpOF4_t19773-1.
DR   EnsemblGenomes-Tr; BpOF4_t19775-1.
DR   EnsemblGenomes-Tr; BpOF4_t19777-1.
DR   EnsemblGenomes-Tr; BpOF4_t19779-1.
DR   EnsemblGenomes-Tr; BpOF4_t19781-1.
DR   EnsemblGenomes-Tr; BpOF4_t19783-1.
DR   EnsemblGenomes-Tr; BpOF4_t19785-1.
DR   EnsemblGenomes-Tr; BpOF4_t19787-1.
DR   EnsemblGenomes-Tr; BpOF4_t19789-1.
DR   EnsemblGenomes-Tr; BpOF4_t19791-1.
DR   EnsemblGenomes-Tr; BpOF4_t19793-1.
DR   EnsemblGenomes-Tr; BpOF4_t19795-1.
DR   EnsemblGenomes-Tr; BpOF4_t19797-1.
DR   EnsemblGenomes-Tr; BpOF4_t19799-1.
DR   EnsemblGenomes-Tr; BpOF4_t19801-1.
DR   EnsemblGenomes-Tr; BpOF4_t19803-1.
DR   EnsemblGenomes-Tr; BpOF4_t19805-1.
DR   EnsemblGenomes-Tr; BpOF4_t19807-1.
DR   EnsemblGenomes-Tr; BpOF4_t19809-1.
DR   EnsemblGenomes-Tr; BpOF4_t19811-1.
DR   EnsemblGenomes-Tr; BpOF4_t19813-1.
DR   EnsemblGenomes-Tr; BpOF4_t19815-1.
DR   EnsemblGenomes-Tr; BpOF4_t19817-1.
DR   EnsemblGenomes-Tr; BpOF4_t19819-1.
DR   EnsemblGenomes-Tr; BpOF4_t19821-1.
DR   EnsemblGenomes-Tr; BpOF4_t19823-1.
DR   EnsemblGenomes-Tr; BpOF4_t19825-1.
DR   EnsemblGenomes-Tr; BpOF4_t19827-1.
DR   EnsemblGenomes-Tr; BpOF4_t19829-1.
DR   EnsemblGenomes-Tr; BpOF4_t19831-1.
DR   EnsemblGenomes-Tr; BpOF4_t19833-1.
DR   EnsemblGenomes-Tr; BpOF4_t19835-1.
DR   EnsemblGenomes-Tr; BpOF4_t19837-1.
DR   EnsemblGenomes-Tr; BpOF4_t19839-1.
DR   EnsemblGenomes-Tr; BpOF4_t19841-1.
DR   EnsemblGenomes-Tr; BpOF4_t19843-1.
DR   EnsemblGenomes-Tr; BpOF4_t19845-1.
DR   EnsemblGenomes-Tr; BpOF4_t19847-1.
DR   EnsemblGenomes-Tr; BpOF4_t19849-1.
DR   EnsemblGenomes-Tr; BpOF4_t19851-1.
DR   EnsemblGenomes-Tr; BpOF4_t19853-1.
DR   EnsemblGenomes-Tr; BpOF4_t19855-1.
DR   EnsemblGenomes-Tr; BpOF4_t19857-1.
DR   EnsemblGenomes-Tr; BpOF4_t19859-1.
DR   EnsemblGenomes-Tr; BpOF4_t19861-1.
DR   EnsemblGenomes-Tr; BpOF4_t19863-1.
DR   EnsemblGenomes-Tr; BpOF4_t19865-1.
DR   EnsemblGenomes-Tr; BpOF4_t19867-1.
DR   EnsemblGenomes-Tr; BpOF4_t19869-1.
DR   EnsemblGenomes-Tr; BpOF4_t19871-1.
DR   EnsemblGenomes-Tr; BpOF4_t19873-1.
DR   EnsemblGenomes-Tr; BpOF4_t19875-1.
DR   EnsemblGenomes-Tr; BpOF4_t19877-1.
DR   EnsemblGenomes-Tr; BpOF4_t19879-1.
DR   EnsemblGenomes-Tr; BpOF4_t19881-1.
DR   EnsemblGenomes-Tr; BpOF4_t19883-1.
DR   EnsemblGenomes-Tr; BpOF4_t19885-1.
DR   EnsemblGenomes-Tr; BpOF4_t19887-1.
DR   EnsemblGenomes-Tr; BpOF4_t19889-1.
DR   EnsemblGenomes-Tr; BpOF4_t19891-1.
DR   EnsemblGenomes-Tr; BpOF4_t19893-1.
DR   EnsemblGenomes-Tr; BpOF4_t19895-1.
DR   EnsemblGenomes-Tr; BpOF4_t19897-1.
DR   EnsemblGenomes-Tr; BpOF4_t19899-1.
DR   EnsemblGenomes-Tr; BpOF4_t19901-1.
DR   EnsemblGenomes-Tr; BpOF4_t19903-1.
DR   EnsemblGenomes-Tr; BpOF4_t19905-1.
DR   EnsemblGenomes-Tr; BpOF4_t19907-1.
DR   EnsemblGenomes-Tr; BpOF4_t19909-1.
DR   EnsemblGenomes-Tr; BpOF4_t19911-1.
DR   EnsemblGenomes-Tr; BpOF4_t19913-1.
DR   EnsemblGenomes-Tr; BpOF4_t19915-1.
DR   EnsemblGenomes-Tr; EBT00001822053.
DR   EnsemblGenomes-Tr; EBT00001822054.
DR   EnsemblGenomes-Tr; EBT00001822055.
DR   EnsemblGenomes-Tr; EBT00001822056.
DR   EnsemblGenomes-Tr; EBT00001822057.
DR   EnsemblGenomes-Tr; EBT00001822058.
DR   EnsemblGenomes-Tr; EBT00001822059.
DR   EnsemblGenomes-Tr; EBT00001822060.
DR   EnsemblGenomes-Tr; EBT00001822061.
DR   EnsemblGenomes-Tr; EBT00001822062.
DR   EnsemblGenomes-Tr; EBT00001822063.
DR   EnsemblGenomes-Tr; EBT00001822064.
DR   EnsemblGenomes-Tr; EBT00001822065.
DR   EnsemblGenomes-Tr; EBT00001822066.
DR   EnsemblGenomes-Tr; EBT00001822067.
DR   EnsemblGenomes-Tr; EBT00001822068.
DR   EnsemblGenomes-Tr; EBT00001822069.
DR   EnsemblGenomes-Tr; EBT00001822070.
DR   EnsemblGenomes-Tr; EBT00001822071.
DR   EnsemblGenomes-Tr; EBT00001822072.
DR   EnsemblGenomes-Tr; EBT00001822073.
DR   EnsemblGenomes-Tr; EBT00001822074.
DR   EnsemblGenomes-Tr; EBT00001822075.
DR   EnsemblGenomes-Tr; EBT00001822076.
DR   EnsemblGenomes-Tr; EBT00001822077.
DR   EnsemblGenomes-Tr; EBT00001822078.
DR   EnsemblGenomes-Tr; EBT00001822079.
DR   EnsemblGenomes-Tr; EBT00001822080.
DR   EnsemblGenomes-Tr; EBT00001822081.
DR   EnsemblGenomes-Tr; EBT00001822082.
DR   EnsemblGenomes-Tr; EBT00001822083.
DR   EnsemblGenomes-Tr; EBT00001822084.
DR   EnsemblGenomes-Tr; EBT00001822085.
DR   EnsemblGenomes-Tr; EBT00001822086.
DR   EnsemblGenomes-Tr; EBT00001822087.
DR   EnsemblGenomes-Tr; EBT00001822088.
DR   EnsemblGenomes-Tr; EBT00001822089.
DR   EnsemblGenomes-Tr; EBT00001822090.
DR   EnsemblGenomes-Tr; EBT00001822091.
DR   EnsemblGenomes-Tr; EBT00001822092.
DR   EnsemblGenomes-Tr; EBT00001822093.
DR   EnsemblGenomes-Tr; EBT00001822094.
DR   EnsemblGenomes-Tr; EBT00001822095.
DR   EnsemblGenomes-Tr; EBT00001822096.
DR   EnsemblGenomes-Tr; EBT00001822097.
DR   EnsemblGenomes-Tr; EBT00001822098.
DR   EnsemblGenomes-Tr; EBT00001822099.
DR   EnsemblGenomes-Tr; EBT00001822100.
DR   EnsemblGenomes-Tr; EBT00001822101.
DR   EnsemblGenomes-Tr; EBT00001822102.
DR   EnsemblGenomes-Tr; EBT00001822103.
DR   EnsemblGenomes-Tr; EBT00001822104.
DR   EnsemblGenomes-Tr; EBT00001822105.
DR   EnsemblGenomes-Tr; EBT00001822106.
DR   EnsemblGenomes-Tr; EBT00001822107.
DR   EnsemblGenomes-Tr; EBT00001822108.
DR   EnsemblGenomes-Tr; EBT00001822109.
DR   EnsemblGenomes-Tr; EBT00001822110.
DR   EnsemblGenomes-Tr; EBT00001822111.
DR   EnsemblGenomes-Tr; EBT00001822112.
DR   EnsemblGenomes-Tr; EBT00001822113.
DR   EnsemblGenomes-Tr; EBT00001822114.
DR   EnsemblGenomes-Tr; EBT00001822115.
DR   EnsemblGenomes-Tr; EBT00001822116.
DR   EnsemblGenomes-Tr; EBT00001822117.
DR   EnsemblGenomes-Tr; EBT00001822118.
DR   EnsemblGenomes-Tr; EBT00001822119.
DR   EnsemblGenomes-Tr; EBT00001822120.
DR   EnsemblGenomes-Tr; EBT00001822121.
DR   EnsemblGenomes-Tr; EBT00001822122.
DR   EnsemblGenomes-Tr; EBT00001822123.
DR   EnsemblGenomes-Tr; EBT00001822124.
DR   EnsemblGenomes-Tr; EBT00001822125.
DR   EnsemblGenomes-Tr; EBT00001822126.
DR   EnsemblGenomes-Tr; EBT00001822127.
DR   EnsemblGenomes-Tr; EBT00001822128.
DR   EnsemblGenomes-Tr; EBT00001822129.
DR   EnsemblGenomes-Tr; EBT00001822130.
DR   EnsemblGenomes-Tr; EBT00001822131.
DR   EnsemblGenomes-Tr; EBT00001822132.
DR   EnsemblGenomes-Tr; EBT00001822133.
DR   EnsemblGenomes-Tr; EBT00001822134.
DR   EnsemblGenomes-Tr; EBT00001822135.
DR   EnsemblGenomes-Tr; EBT00001822136.
DR   EnsemblGenomes-Tr; EBT00001822137.
DR   EnsemblGenomes-Tr; EBT00001822138.
DR   EnsemblGenomes-Tr; EBT00001822139.
DR   EnsemblGenomes-Tr; EBT00001822140.
DR   EnsemblGenomes-Tr; EBT00001822141.
DR   EnsemblGenomes-Tr; EBT00001822142.
DR   EnsemblGenomes-Tr; EBT00001822143.
DR   EnsemblGenomes-Tr; EBT00001822144.
DR   EnsemblGenomes-Tr; EBT00001822145.
DR   EnsemblGenomes-Tr; EBT00001822146.
DR   EnsemblGenomes-Tr; EBT00001822147.
DR   EnsemblGenomes-Tr; EBT00001822148.
DR   EnsemblGenomes-Tr; EBT00001822149.
DR   EnsemblGenomes-Tr; EBT00001822150.
DR   EnsemblGenomes-Tr; EBT00001822151.
DR   EnsemblGenomes-Tr; EBT00001822152.
DR   EnsemblGenomes-Tr; EBT00001822153.
DR   EnsemblGenomes-Tr; EBT00001822154.
DR   EnsemblGenomes-Tr; EBT00001822155.
DR   EnsemblGenomes-Tr; EBT00001822156.
DR   EnsemblGenomes-Tr; EBT00001822157.
DR   EnsemblGenomes-Tr; EBT00001822158.
DR   EnsemblGenomes-Tr; EBT00001822159.
DR   EnsemblGenomes-Tr; EBT00001822160.
DR   EnsemblGenomes-Tr; EBT00001822161.
DR   EnsemblGenomes-Tr; EBT00001822162.
DR   EnsemblGenomes-Tr; EBT00001822163.
DR   EnsemblGenomes-Tr; EBT00001822164.
DR   EnsemblGenomes-Tr; EBT00001822165.
DR   EnsemblGenomes-Tr; EBT00001822166.
DR   EnsemblGenomes-Tr; EBT00001822167.
DR   EnsemblGenomes-Tr; EBT00001822168.
DR   EnsemblGenomes-Tr; EBT00001822169.
DR   EnsemblGenomes-Tr; EBT00001822170.
DR   EnsemblGenomes-Tr; EBT00001822171.
DR   EnsemblGenomes-Tr; EBT00001822172.
DR   EnsemblGenomes-Tr; EBT00001822173.
DR   EnsemblGenomes-Tr; EBT00001822174.
DR   EnsemblGenomes-Tr; EBT00001822175.
DR   EuropePMC; PMC3228905; 21951522.
DR   EuropePMC; PMC3818039; 24192355.
DR   EuropePMC; PMC5938343; 29765360.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001878.
DR   SILVA-SSU; CP001878.
CC   On Dec 15, 2010 this sequence version replaced gi:288544186.
CC   Genome was manually curated based on annotation generated by the
CC   NCBI Prokaryotic Genomes Automatic Annotation Pipeline Group.
CC   Information about the Pipeline can be found here:
CC   http://www.ncbi.nlm.nih.gov/genomes/static/Pipeline.html.
FH   Key             Location/Qualifiers
FT   source          1..3858997
FT                   /organism="Bacillus pseudofirmus OF4"
FT                   /strain="OF4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:398511"
FT   gene            816..2168
FT                   /gene="dnaA"
FT                   /locus_tag="BpOF4_07955"
FT   CDS_pept        816..2168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BpOF4_07955"
FT                   /product="chromosomal replication initiation protein"
FT                   /note="COG0593 ATPase involved in DNA replication
FT                   initiation"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07955"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49649"
FT                   /db_xref="GOA:D3FQH7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQH7"
FT                   /protein_id="ADC49649.1"
FT   gene            2348..3490
FT                   /gene="dnaN"
FT                   /locus_tag="BpOF4_07960"
FT   CDS_pept        2348..3490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="BpOF4_07960"
FT                   /product="DNA polymerase III subunit beta"
FT                   /note="COG0592 DNA polymerase sliding clamp subunit (PCNA
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07960"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49650"
FT                   /db_xref="GOA:D3FQH8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQH8"
FT                   /protein_id="ADC49650.1"
FT   gene            3744..3959
FT                   /locus_tag="BpOF4_07965"
FT   CDS_pept        3744..3959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_07965"
FT                   /product="hypothetical protein"
FT                   /note="COG2501 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07965"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49651"
FT                   /db_xref="GOA:D3FQH9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQH9"
FT                   /protein_id="ADC49651.1"
FT   gene            3971..5086
FT                   /gene="recF"
FT                   /locus_tag="BpOF4_07970"
FT   CDS_pept        3971..5086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BpOF4_07970"
FT                   /product="recombination protein F"
FT                   /note="COG1195 Recombinational DNA repair ATPase (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07970"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49652"
FT                   /db_xref="GOA:D3FQI0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI0"
FT                   /protein_id="ADC49652.1"
FT   gene            5098..5373
FT                   /locus_tag="BpOF4_07975"
FT   CDS_pept        5098..5373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_07975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07975"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49653"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI1"
FT                   /protein_id="ADC49653.1"
FT   gene            5432..7372
FT                   /gene="gyrB"
FT                   /locus_tag="BpOF4_07980"
FT   CDS_pept        5432..7372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BpOF4_07980"
FT                   /product="DNA gyrase subunit B"
FT                   /note="COG0187 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07980"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49654"
FT                   /db_xref="GOA:D3FQI2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI2"
FT                   /protein_id="ADC49654.1"
FT                   ENAQYVKNLDI"
FT   gene            7399..9966
FT                   /gene="gyrA"
FT                   /locus_tag="BpOF4_07985"
FT   CDS_pept        7399..9966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BpOF4_07985"
FT                   /product="DNA gyrase subunit A"
FT                   /note="COG0188 Type IIA topoisomerase (DNA gyrase/topo II,
FT                   topoisomerase IV), A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07985"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49655"
FT                   /db_xref="GOA:D3FQI3"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI3"
FT                   /protein_id="ADC49655.1"
FT   gene            10150..11259
FT                   /locus_tag="BpOF4_07990"
FT   CDS_pept        10150..11259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_07990"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="COG2206 HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07990"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49656"
FT                   /db_xref="GOA:D3FQI4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI4"
FT                   /protein_id="ADC49656.1"
FT   gene            11542..13102
FT                   /locus_tag="BpOF4_r19933"
FT   rRNA            11542..13102
FT                   /locus_tag="BpOF4_r19933"
FT                   /product="16S ribosomal RNA"
FT   gene            13337..16278
FT                   /locus_tag="BpOF4_r19947"
FT   rRNA            13337..16278
FT                   /locus_tag="BpOF4_r19947"
FT                   /product="23S ribosomal RNA"
FT   gene            16356..16471
FT                   /locus_tag="BpOF4_r19917"
FT   rRNA            16356..16471
FT                   /locus_tag="BpOF4_r19917"
FT                   /product="5S ribosomal RNA"
FT   repeat_region   16755..16876
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_1F"
FT   gene            complement(16980..17942)
FT                   /locus_tag="BpOF4_07995"
FT   CDS_pept        complement(16980..17942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_07995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_07995"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49657"
FT                   /db_xref="InterPro:IPR026988"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI5"
FT                   /protein_id="ADC49657.1"
FT   gene            18102..19559
FT                   /gene="quaB"
FT                   /locus_tag="BpOF4_08000"
FT   CDS_pept        18102..19559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="quaB"
FT                   /locus_tag="BpOF4_08000"
FT                   /product="inosine 5'-monophosphate dehydrogenase"
FT                   /note="COG0516 IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08000"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49658"
FT                   /db_xref="GOA:D3FQI6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI6"
FT                   /protein_id="ADC49658.1"
FT   gene            19684..21018
FT                   /gene="dacA"
FT                   /locus_tag="BpOF4_08005"
FT   CDS_pept        19684..21018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BpOF4_08005"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="COG1686 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49659"
FT                   /db_xref="GOA:D3FQI7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI7"
FT                   /protein_id="ADC49659.1"
FT   gene            21184..22068
FT                   /gene="pdxS"
FT                   /locus_tag="BpOF4_08010"
FT   CDS_pept        21184..22068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxS"
FT                   /locus_tag="BpOF4_08010"
FT                   /product="pyridoxal biosynthesis lyase PdxS"
FT                   /note="COG0214 Pyridoxine biosynthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49660"
FT                   /db_xref="GOA:D3FQI8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI8"
FT                   /protein_id="ADC49660.1"
FT                   TLQPSERMQERGW"
FT   gene            22105..22701
FT                   /gene="pdxT"
FT                   /locus_tag="BpOF4_08015"
FT   CDS_pept        22105..22701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxT"
FT                   /locus_tag="BpOF4_08015"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /note="COG0311 Predicted glutamine amidotransferase
FT                   involved in pyridoxine biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08015"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49661"
FT                   /db_xref="GOA:D3FQI9"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQI9"
FT                   /protein_id="ADC49661.1"
FT   gene            23003..24277
FT                   /gene="serS"
FT                   /locus_tag="BpOF4_08020"
FT   CDS_pept        23003..24277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BpOF4_08020"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="COG0172 Seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08020"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49662"
FT                   /db_xref="GOA:D3FQJ0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQJ0"
FT                   /protein_id="ADC49662.1"
FT   gene            complement(24323..25336)
FT                   /locus_tag="BpOF4_08025"
FT   CDS_pept        complement(24323..25336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08025"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /note="COG4608 ABC-type oligopeptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49663"
FT                   /db_xref="GOA:D3FQJ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQJ1"
FT                   /protein_id="ADC49663.1"
FT   gene            complement(25317..26345)
FT                   /locus_tag="BpOF4_08030"
FT   CDS_pept        complement(25317..26345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08030"
FT                   /product="oligopeptide ABC transporter ATP-binding protein"
FT                   /note="COG0444 ABC-type dipeptide/oligopeptide/nickel
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08030"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49664"
FT                   /db_xref="GOA:D3FQJ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQJ2"
FT                   /protein_id="ADC49664.1"
FT                   TS"
FT   gene            complement(26378..27298)
FT                   /locus_tag="BpOF4_08035"
FT   CDS_pept        complement(26378..27298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08035"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /note="COG0601 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49665"
FT                   /db_xref="GOA:D3FQJ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQJ3"
FT                   /protein_id="ADC49665.1"
FT   gene            complement(27316..28212)
FT                   /locus_tag="BpOF4_08040"
FT   CDS_pept        complement(27316..28212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08040"
FT                   /product="oligopeptide ABC transporter (permease)"
FT                   /note="COG1173 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49666"
FT                   /db_xref="GOA:D3FQJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQJ4"
FT                   /protein_id="ADC49666.1"
FT                   NIFGDGLRDALDPKMKN"
FT   gene            28536..30152
FT                   /locus_tag="BpOF4_08045"
FT   CDS_pept        28536..30152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08045"
FT                   /product="oligopeptide ABC transporter
FT                   (oligopeptide-binding protein)"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49667"
FT                   /db_xref="GOA:D3FQX1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX1"
FT                   /protein_id="ADC49667.1"
FT   gene            30268..30360
FT                   /locus_tag="BpOF4_t19823"
FT   tRNA            30268..30360
FT                   /locus_tag="BpOF4_t19823"
FT                   /product="tRNA-Ser"
FT   gene            30436..30924
FT                   /gene="yaaJ"
FT                   /locus_tag="BpOF4_08050"
FT   CDS_pept        30436..30924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaJ"
FT                   /locus_tag="BpOF4_08050"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="COG0590 Cytosine/adenosine deaminases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49668"
FT                   /db_xref="GOA:D3FQX2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX2"
FT                   /protein_id="ADC49668.1"
FT   gene            31413..33098
FT                   /gene="dnaH"
FT                   /locus_tag="BpOF4_08055"
FT   CDS_pept        31413..33098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaH"
FT                   /locus_tag="BpOF4_08055"
FT                   /product="DNA polymerase III gamma and tau subunits"
FT                   /note="COG2812 DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49669"
FT                   /db_xref="GOA:D3FQX3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX3"
FT                   /protein_id="ADC49669.1"
FT   gene            33117..33428
FT                   /locus_tag="BpOF4_08060"
FT   CDS_pept        33117..33428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08060"
FT                   /product="hypothetical protein"
FT                   /note="COG0718 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49670"
FT                   /db_xref="GOA:D3FQX4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX4"
FT                   /protein_id="ADC49670.1"
FT   gene            33440..34036
FT                   /gene="recR"
FT                   /locus_tag="BpOF4_08065"
FT   CDS_pept        33440..34036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BpOF4_08065"
FT                   /product="recombination protein RecR"
FT                   /note="COG0353 Recombinational DNA repair protein (RecF
FT                   pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08065"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49671"
FT                   /db_xref="GOA:D3FQX5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX5"
FT                   /protein_id="ADC49671.1"
FT   gene            34053..34280
FT                   /locus_tag="BpOF4_08070"
FT   CDS_pept        34053..34280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08070"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49672"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX6"
FT                   /protein_id="ADC49672.1"
FT   gene            34345..34608
FT                   /locus_tag="BpOF4_08075"
FT   CDS_pept        34345..34608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08075"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49673"
FT                   /db_xref="GOA:D3FQX7"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX7"
FT                   /protein_id="ADC49673.1"
FT   gene            34943..36503
FT                   /locus_tag="BpOF4_r19935"
FT   rRNA            34943..36503
FT                   /locus_tag="BpOF4_r19935"
FT                   /product="16S ribosomal RNA"
FT   gene            36738..39679
FT                   /locus_tag="BpOF4_r19949"
FT   rRNA            36738..39679
FT                   /locus_tag="BpOF4_r19949"
FT                   /product="23S ribosomal RNA"
FT   gene            39757..39872
FT                   /locus_tag="BpOF4_r19919"
FT   rRNA            39757..39872
FT                   /locus_tag="BpOF4_r19919"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(39890..40009)
FT                   /locus_tag="BpOF4_08080"
FT   CDS_pept        complement(39890..40009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49674"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX8"
FT                   /protein_id="ADC49674.1"
FT   gene            complement(40205..40345)
FT                   /locus_tag="BpOF4_08085"
FT   CDS_pept        complement(40205..40345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49675"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQX9"
FT                   /protein_id="ADC49675.1"
FT                   A"
FT   gene            40514..40720
FT                   /gene="csfB"
FT                   /locus_tag="BpOF4_08090"
FT   CDS_pept        40514..40720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csfB"
FT                   /locus_tag="BpOF4_08090"
FT                   /product="conserved protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08090"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49676"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY0"
FT                   /protein_id="ADC49676.1"
FT   gene            40859..42310
FT                   /gene="cad"
FT                   /locus_tag="BpOF4_08095"
FT   CDS_pept        40859..42310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cad"
FT                   /locus_tag="BpOF4_08095"
FT                   /product="lysine decarboxylase"
FT                   /note="COG1982 Arginine/lysine/ornithine decarboxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08095"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49677"
FT                   /db_xref="GOA:D3FQY1"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY1"
FT                   /protein_id="ADC49677.1"
FT   gene            42307..42948
FT                   /gene="tmk"
FT                   /locus_tag="BpOF4_08100"
FT   CDS_pept        42307..42948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BpOF4_08100"
FT                   /product="thymidylate kinase"
FT                   /note="COG0125 Thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08100"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49678"
FT                   /db_xref="GOA:D3FQY2"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY2"
FT                   /protein_id="ADC49678.1"
FT   gene            42983..43312
FT                   /locus_tag="BpOF4_08105"
FT   CDS_pept        42983..43312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08105"
FT                   /product="hypothetical protein"
FT                   /note="COG3870 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08105"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49679"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY3"
FT                   /protein_id="ADC49679.1"
FT                   QFEQF"
FT   gene            43328..44317
FT                   /gene="holB"
FT                   /locus_tag="BpOF4_08110"
FT   CDS_pept        43328..44317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BpOF4_08110"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /note="COG0470 ATPase involved in DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08110"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49680"
FT                   /db_xref="GOA:D3FQY4"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY4"
FT                   /protein_id="ADC49680.1"
FT   gene            44322..45152
FT                   /locus_tag="BpOF4_08115"
FT   CDS_pept        44322..45152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08115"
FT                   /product="signal peptidase-like protein, no function
FT                   established"
FT                   /note="COG1774 Uncharacterized homolog of PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49681"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY5"
FT                   /protein_id="ADC49681.1"
FT   gene            45168..45518
FT                   /gene="yabA"
FT                   /locus_tag="BpOF4_08120"
FT   CDS_pept        45168..45518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabA"
FT                   /locus_tag="BpOF4_08120"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /note="COG4467 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08120"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49682"
FT                   /db_xref="GOA:D3FQY6"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY6"
FT                   /protein_id="ADC49682.1"
FT                   DCLFCLSFLHQK"
FT   gene            45628..46368
FT                   /locus_tag="BpOF4_08125"
FT   CDS_pept        45628..46368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08125"
FT                   /product="hypothetical protein"
FT                   /note="COG4123 Predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49683"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY7"
FT                   /protein_id="ADC49683.1"
FT   gene            46365..46634
FT                   /locus_tag="BpOF4_08130"
FT   CDS_pept        46365..46634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08130"
FT                   /product="hypothetical protein"
FT                   /note="COG2827 Predicted endonuclease containing a URI
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08130"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49684"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY8"
FT                   /protein_id="ADC49684.1"
FT   gene            46618..47481
FT                   /locus_tag="BpOF4_08135"
FT   CDS_pept        46618..47481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08135"
FT                   /product="hypothetical protein"
FT                   /note="COG0313 Predicted methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08135"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49685"
FT                   /db_xref="GOA:D3FQY9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQY9"
FT                   /protein_id="ADC49685.1"
FT                   YQAYHT"
FT   gene            complement(47530..47820)
FT                   /gene="abrB"
FT                   /locus_tag="BpOF4_08140"
FT   CDS_pept        complement(47530..47820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BpOF4_08140"
FT                   /product="transcriptional pleiotropic regulator of
FT                   transition state genes, spoVT abrB"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08140"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49686"
FT                   /db_xref="GOA:D3FQZ0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR040678"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ0"
FT                   /protein_id="ADC49686.1"
FT   gene            48024..48986
FT                   /locus_tag="BpOF4_08145"
FT   CDS_pept        48024..48986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49687"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ1"
FT                   /protein_id="ADC49687.1"
FT   gene            48999..50831
FT                   /locus_tag="BpOF4_08150"
FT   CDS_pept        48999..50831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08150"
FT                   /product="hypothetical protein"
FT                   /note="COG1854 LuxS protein involved in autoinducer AI2
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49688"
FT                   /db_xref="GOA:D3FQZ2"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ2"
FT                   /protein_id="ADC49688.1"
FT   gene            51209..53209
FT                   /gene="metS"
FT                   /locus_tag="BpOF4_08155"
FT   CDS_pept        51209..53209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BpOF4_08155"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="COG0143 Methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49689"
FT                   /db_xref="GOA:D3FQZ3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ3"
FT                   /protein_id="ADC49689.1"
FT   gene            53295..54065
FT                   /locus_tag="BpOF4_08160"
FT   CDS_pept        53295..54065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08160"
FT                   /product="Metal-dependent DNA hydrolase of TatD family"
FT                   /note="COG0084 Mg-dependent DNase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49690"
FT                   /db_xref="GOA:D3FQZ4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ4"
FT                   /protein_id="ADC49690.1"
FT   gene            54294..55559
FT                   /locus_tag="BpOF4_08165"
FT   CDS_pept        54294..55559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08165"
FT                   /product="hypothetical protein"
FT                   /note="COG3583 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08165"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49691"
FT                   /db_xref="GOA:D3FQZ5"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ5"
FT                   /protein_id="ADC49691.1"
FT   gene            55676..56236
FT                   /locus_tag="BpOF4_08170"
FT   CDS_pept        55676..56236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08170"
FT                   /product="hypothetical protein"
FT                   /note="COG1658 Small primase-like proteins (Toprim domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08170"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49692"
FT                   /db_xref="GOA:D3FQZ6"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ6"
FT                   /protein_id="ADC49692.1"
FT   gene            56229..57137
FT                   /gene="ksgA"
FT                   /locus_tag="BpOF4_08175"
FT   CDS_pept        56229..57137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BpOF4_08175"
FT                   /product="dimethyladenosine transferase"
FT                   /note="COG0030 Dimethyladenosine transferase (rRNA
FT                   methylation)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49693"
FT                   /db_xref="GOA:D3FQZ7"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ7"
FT                   /protein_id="ADC49693.1"
FT   gene            57187..58062
FT                   /locus_tag="BpOF4_08180"
FT   CDS_pept        57187..58062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08180"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49694"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ8"
FT                   /protein_id="ADC49694.1"
FT                   TKQEYQPEEG"
FT   gene            58269..58532
FT                   /locus_tag="BpOF4_08185"
FT   CDS_pept        58269..58532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08185"
FT                   /product="hypothetical protein"
FT                   /note="COG4466 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49695"
FT                   /db_xref="GOA:D3FQZ9"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQZ9"
FT                   /protein_id="ADC49695.1"
FT   gene            58705..58890
FT                   /gene="ssp"
FT                   /locus_tag="BpOF4_08190"
FT   CDS_pept        58705..58890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssp"
FT                   /locus_tag="BpOF4_08190"
FT                   /product="small acid-soluble spore protein (minor
FT                   alpha/beta-type SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08190"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49696"
FT                   /db_xref="GOA:D3FR00"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR00"
FT                   /protein_id="ADC49696.1"
FT                   AVEIAERQLAEQEGSK"
FT   gene            58890..58988
FT                   /locus_tag="BpOF4_08195"
FT   CDS_pept        58890..58988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08195"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49697"
FT                   /db_xref="GOA:D3FR01"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR01"
FT                   /protein_id="ADC49697.1"
FT                   /translation="MEMKAGASASAFYTSIMGPISSIKMSLLWYVG"
FT   gene            59036..59893
FT                   /gene="ipk"
FT                   /locus_tag="BpOF4_08200"
FT   CDS_pept        59036..59893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipk"
FT                   /locus_tag="BpOF4_08200"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /note="COG1947 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   2-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08200"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49698"
FT                   /db_xref="GOA:D3FR02"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR02"
FT                   /protein_id="ADC49698.1"
FT                   LIRS"
FT   gene            59961..60812
FT                   /gene="purR"
FT                   /locus_tag="BpOF4_08205"
FT   CDS_pept        59961..60812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BpOF4_08205"
FT                   /product="pur operon repressor"
FT                   /note="COG0503 Adenine/guanine phosphoribosyltransferases
FT                   and related PRPP-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08205"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49699"
FT                   /db_xref="GOA:D3FR03"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR03"
FT                   /protein_id="ADC49699.1"
FT                   LS"
FT   gene            60809..61183
FT                   /gene="yabJ"
FT                   /locus_tag="BpOF4_08210"
FT   CDS_pept        60809..61183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabJ"
FT                   /locus_tag="BpOF4_08210"
FT                   /product="translation initiation inhibitor"
FT                   /note="COG0251 Putative translation initiation inhibitor,
FT                   yjgF family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08210"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49700"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR04"
FT                   /protein_id="ADC49700.1"
FT   gene            61360..61653
FT                   /gene="spoVG"
FT                   /locus_tag="BpOF4_08215"
FT   CDS_pept        61360..61653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BpOF4_08215"
FT                   /product="regulatory protein SpoVG"
FT                   /note="COG2088 Uncharacterized protein, involved in the
FT                   regulation of septum location"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08215"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49701"
FT                   /db_xref="GOA:D3FR05"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR05"
FT                   /protein_id="ADC49701.1"
FT   gene            61896..63254
FT                   /gene="glmU"
FT                   /locus_tag="BpOF4_08220"
FT   CDS_pept        61896..63254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="BpOF4_08220"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="COG1207 N-acetylglucosamine-1-phosphate
FT                   uridyltransferase (contains nucleotidyltransferase and
FT                   I-patch acetyltransferase domains)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08220"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49702"
FT                   /db_xref="GOA:D3FR06"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR06"
FT                   /protein_id="ADC49702.1"
FT   gene            63325..64275
FT                   /gene="prs"
FT                   /locus_tag="BpOF4_08225"
FT   CDS_pept        63325..64275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="BpOF4_08225"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /note="COG0462 Phosphoribosylpyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08225"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49703"
FT                   /db_xref="GOA:D3FR07"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR07"
FT                   /protein_id="ADC49703.1"
FT   gene            64413..65048
FT                   /gene="ctc"
FT                   /locus_tag="BpOF4_08230"
FT   CDS_pept        64413..65048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctc"
FT                   /locus_tag="BpOF4_08230"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /note="COG1825 Ribosomal protein L25 (general stress
FT                   protein Ctc)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08230"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49704"
FT                   /db_xref="GOA:D3FR08"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR08"
FT                   /protein_id="ADC49704.1"
FT   gene            65138..65695
FT                   /gene="spoVC"
FT                   /locus_tag="BpOF4_08235"
FT   CDS_pept        65138..65695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BpOF4_08235"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /note="COG0193 Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08235"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49705"
FT                   /db_xref="GOA:D3FR09"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR09"
FT                   /protein_id="ADC49705.1"
FT   gene            65789..66016
FT                   /locus_tag="BpOF4_08240"
FT   CDS_pept        65789..66016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08240"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49706"
FT                   /db_xref="GOA:D3FR10"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR10"
FT                   /protein_id="ADC49706.1"
FT   gene            66317..69859
FT                   /gene="mfd"
FT                   /locus_tag="BpOF4_08245"
FT   CDS_pept        66317..69859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BpOF4_08245"
FT                   /product="transcription-repair coupling factor (TRCF)"
FT                   /note="COG1197 Transcription-repair coupling factor
FT                   (superfamily II helicase)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08245"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49707"
FT                   /db_xref="GOA:D3FR11"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR11"
FT                   /protein_id="ADC49707.1"
FT                   SIPKSRKQTTSNTV"
FT   gene            70037..70576
FT                   /gene="spoVT"
FT                   /locus_tag="BpOF4_08250"
FT   CDS_pept        70037..70576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BpOF4_08250"
FT                   /product="stage V sporulation protein T, transcriptional
FT                   regulator"
FT                   /note="COG2002 Regulators of stationary/sporulation gene
FT                   expression"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08250"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49708"
FT                   /db_xref="GOA:D3FR12"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR12"
FT                   /protein_id="ADC49708.1"
FT                   KLAETAASFLARQMEH"
FT   gene            70757..72352
FT                   /gene="pstA2"
FT                   /locus_tag="BpOF4_08255"
FT   CDS_pept        70757..72352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA2"
FT                   /locus_tag="BpOF4_08255"
FT                   /product="polysaccharide export protein"
FT                   /note="COG2244 Membrane protein involved in the export of
FT                   O-antigen and teichoic acid"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08255"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49709"
FT                   /db_xref="GOA:D3FR13"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR13"
FT                   /protein_id="ADC49709.1"
FT                   VPKLNKLRLKVRRR"
FT   gene            72365..73822
FT                   /locus_tag="BpOF4_08260"
FT   CDS_pept        72365..73822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08260"
FT                   /product="MazG family protein, putative tetrapyrrole
FT                   methylase"
FT                   /note="COG3956 Protein containing tetrapyrrole
FT                   methyltransferase domain and MazG-like (predicted
FT                   pyrophosphatase) domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08260"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49710"
FT                   /db_xref="GOA:D3FR14"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR14"
FT                   /protein_id="ADC49710.1"
FT   gene            73836..74108
FT                   /gene="yabO"
FT                   /locus_tag="BpOF4_08265"
FT   CDS_pept        73836..74108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabO"
FT                   /locus_tag="BpOF4_08265"
FT                   /product="S4 domain RNA binding heat shock protein, YabO"
FT                   /note="COG1188 Ribosome-associated heat shock protein
FT                   implicated in the recycling of the 50S subunit (S4
FT                   paralog)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08265"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49711"
FT                   /db_xref="GOA:D3FR15"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR15"
FT                   /protein_id="ADC49711.1"
FT   gene            74201..74512
FT                   /gene="yabP"
FT                   /locus_tag="BpOF4_08270"
FT   CDS_pept        74201..74512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BpOF4_08270"
FT                   /product="sporulation protein YabP"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08270"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49712"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR16"
FT                   /protein_id="ADC49712.1"
FT   gene            74509..75090
FT                   /locus_tag="BpOF4_08275"
FT   CDS_pept        74509..75090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08275"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49713"
FT                   /db_xref="GOA:D3FR17"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR17"
FT                   /protein_id="ADC49713.1"
FT   gene            75104..75484
FT                   /gene="divIC"
FT                   /locus_tag="BpOF4_08280"
FT   CDS_pept        75104..75484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC"
FT                   /locus_tag="BpOF4_08280"
FT                   /product="cell-division initiation protein (septum
FT                   formation) DivIC"
FT                   /note="COG2919 Septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08280"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49714"
FT                   /db_xref="GOA:D3FR18"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR039076"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR18"
FT                   /protein_id="ADC49714.1"
FT   gene            75557..76036
FT                   /locus_tag="BpOF4_08285"
FT   CDS_pept        75557..76036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08285"
FT                   /product="hypothetical protein"
FT                   /note="COG1098 Predicted RNA binding protein (contains
FT                   ribosomal protein S1 domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08285"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49715"
FT                   /db_xref="GOA:D3FR19"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR19"
FT                   /protein_id="ADC49715.1"
FT   gene            76224..76300
FT                   /locus_tag="BpOF4_t19825"
FT   tRNA            76224..76300
FT                   /locus_tag="BpOF4_t19825"
FT                   /product="tRNA-Met"
FT   gene            76604..79096
FT                   /gene="spoIIE"
FT                   /locus_tag="BpOF4_08290"
FT   CDS_pept        76604..79096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BpOF4_08290"
FT                   /product="stage II sporulation protein E"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08290"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49716"
FT                   /db_xref="GOA:D3FR20"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR20"
FT                   /protein_id="ADC49716.1"
FT                   KWAAIPLYKSPKLLRKRA"
FT   gene            79204..79944
FT                   /locus_tag="BpOF4_08295"
FT   CDS_pept        79204..79944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08295"
FT                   /product="hypothetical protein"
FT                   /note="COG2304 Uncharacterized protein containing a von
FT                   Willebrand factor type A (vWA) domain; yabS"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08295"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49717"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR21"
FT                   /protein_id="ADC49717.1"
FT   gene            79907..80917
FT                   /gene="yabT"
FT                   /locus_tag="BpOF4_08300"
FT   CDS_pept        79907..80917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabT"
FT                   /locus_tag="BpOF4_08300"
FT                   /product="serine/threonine protein kinase"
FT                   /note="COG0515 Serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08300"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49718"
FT                   /db_xref="GOA:D3FR22"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR22"
FT                   /protein_id="ADC49718.1"
FT   gene            81017..81766
FT                   /locus_tag="BpOF4_08305"
FT   CDS_pept        81017..81766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08305"
FT                   /product="hypothetical protein"
FT                   /note="COG2966 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08305"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49719"
FT                   /db_xref="GOA:D3FR23"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR23"
FT                   /protein_id="ADC49719.1"
FT   gene            81779..82228
FT                   /locus_tag="BpOF4_08310"
FT   CDS_pept        81779..82228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08310"
FT                   /product="hypothetical protein"
FT                   /note="COG3610 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08310"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49720"
FT                   /db_xref="GOA:D3FR24"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR24"
FT                   /protein_id="ADC49720.1"
FT   gene            82209..83606
FT                   /gene="tilS/mesJ"
FT                   /locus_tag="BpOF4_08315"
FT   CDS_pept        82209..83606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS/mesJ"
FT                   /locus_tag="BpOF4_08315"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="COG0037 Predicted ATPase of the PP-loop superfamily
FT                   implicated in cell cycle control"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08315"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49721"
FT                   /db_xref="GOA:D3FR25"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR25"
FT                   /protein_id="ADC49721.1"
FT                   FVPCISI"
FT   gene            83671..84210
FT                   /gene="hprT"
FT                   /locus_tag="BpOF4_08320"
FT   CDS_pept        83671..84210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprT"
FT                   /locus_tag="BpOF4_08320"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /note="COG0634 Hypoxanthine-guanine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08320"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49722"
FT                   /db_xref="GOA:D3FR26"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR26"
FT                   /protein_id="ADC49722.1"
FT                   RNLPYIGVLKPEIYES"
FT   gene            84280..86319
FT                   /locus_tag="BpOF4_08325"
FT   CDS_pept        84280..86319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08325"
FT                   /product="cell-division protein (ATP-dependent Zn
FT                   metallopeptidase)"
FT                   /note="COG0465 ATP-dependent Zn proteases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08325"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49723"
FT                   /db_xref="GOA:P94304"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:P94304"
FT                   /protein_id="ADC49723.1"
FT   gene            86459..87244
FT                   /gene="coaX"
FT                   /locus_tag="BpOF4_08330"
FT   CDS_pept        86459..87244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BpOF4_08330"
FT                   /product="pantothenate kinase"
FT                   /note="COG1521 Putative transcriptional regulator, homolog
FT                   of Bvg accessory factor"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49724"
FT                   /db_xref="GOA:D3FR28"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR28"
FT                   /protein_id="ADC49724.1"
FT   gene            87261..88139
FT                   /gene="hslO"
FT                   /locus_tag="BpOF4_08335"
FT   CDS_pept        87261..88139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BpOF4_08335"
FT                   /product="disulfide bond chaperone of the HSP33 family"
FT                   /note="COG1281 Disulfide bond chaperones of the HSP33
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49725"
FT                   /db_xref="GOA:D3FR29"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR29"
FT                   /protein_id="ADC49725.1"
FT                   AELEKLLTETK"
FT   gene            88241..89164
FT                   /gene="cysK"
FT                   /locus_tag="BpOF4_08340"
FT   CDS_pept        88241..89164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="BpOF4_08340"
FT                   /product="cysteine synthase A"
FT                   /note="COG0031 Cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08340"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49726"
FT                   /db_xref="GOA:D3FR30"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR30"
FT                   /protein_id="ADC49726.1"
FT   gene            89304..90770
FT                   /gene="pabB"
FT                   /locus_tag="BpOF4_08345"
FT   CDS_pept        89304..90770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BpOF4_08345"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /note="COG0147 Anthranilate/para-aminobenzoate synthases
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08345"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49727"
FT                   /db_xref="GOA:D3FR31"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010118"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR31"
FT                   /protein_id="ADC49727.1"
FT   gene            90793..91377
FT                   /gene="pabA"
FT                   /locus_tag="BpOF4_08350"
FT   CDS_pept        90793..91377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BpOF4_08350"
FT                   /product="para-aminobenzoate/anthranilate synthase
FT                   glutamine amidotransferase component II"
FT                   /note="COG0512 Anthranilate/para-aminobenzoate synthases
FT                   component II"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08350"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49728"
FT                   /db_xref="GOA:D3FR32"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR32"
FT                   /protein_id="ADC49728.1"
FT   gene            91374..92231
FT                   /gene="pabC"
FT                   /locus_tag="BpOF4_08355"
FT   CDS_pept        91374..92231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BpOF4_08355"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /note="COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08355"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49729"
FT                   /db_xref="GOA:D3FR33"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR33"
FT                   /protein_id="ADC49729.1"
FT                   KSEL"
FT   gene            92244..93026
FT                   /gene="folP"
FT                   /locus_tag="BpOF4_08360"
FT   CDS_pept        92244..93026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BpOF4_08360"
FT                   /product="dihydropteroate synthase (dihydropteroate
FT                   pyrophosphorylase)"
FT                   /note="COG0294 Dihydropteroate synthase and related
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08360"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49730"
FT                   /db_xref="GOA:D3FR34"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR34"
FT                   /protein_id="ADC49730.1"
FT   gene            93029..93397
FT                   /gene="folB"
FT                   /locus_tag="BpOF4_08365"
FT   CDS_pept        93029..93397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BpOF4_08365"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="COG1539 Dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08365"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49731"
FT                   /db_xref="GOA:D3FR35"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR35"
FT                   /protein_id="ADC49731.1"
FT                   PGHYKSVAVEITRGKNEA"
FT   gene            93387..93914
FT                   /gene="folK"
FT                   /locus_tag="BpOF4_08370"
FT   CDS_pept        93387..93914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BpOF4_08370"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="COG0801
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08370"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49732"
FT                   /db_xref="GOA:D3FR36"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR36"
FT                   /protein_id="ADC49732.1"
FT                   RVGAEGSEHFES"
FT   gene            93866..94069
FT                   /locus_tag="BpOF4_08375"
FT   CDS_pept        93866..94069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08375"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08375"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49733"
FT                   /db_xref="GOA:D3FR37"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR37"
FT                   /protein_id="ADC49733.1"
FT   gene            94097..95098
FT                   /locus_tag="BpOF4_08380"
FT   CDS_pept        94097..95098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08380"
FT                   /product="nitrogen regulation transcriptional regulator"
FT                   /note="COG0042 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08380"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49734"
FT                   /db_xref="GOA:D3FR38"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR38"
FT                   /protein_id="ADC49734.1"
FT   gene            95340..96839
FT                   /gene="lysS"
FT                   /locus_tag="BpOF4_08385"
FT   CDS_pept        95340..96839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BpOF4_08385"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="COG1190 Lysyl-tRNA synthetase (class II)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08385"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49735"
FT                   /db_xref="GOA:D3FR39"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR39"
FT                   /protein_id="ADC49735.1"
FT   gene            97241..98801
FT                   /locus_tag="BpOF4_r19937"
FT   rRNA            97241..98801
FT                   /locus_tag="BpOF4_r19937"
FT                   /product="16S ribosomal RNA"
FT   gene            99160..102100
FT                   /locus_tag="BpOF4_r19951"
FT   rRNA            99160..102100
FT                   /locus_tag="BpOF4_r19951"
FT                   /product="23S ribosomal RNA"
FT   gene            102180..102295
FT                   /locus_tag="BpOF4_r19921"
FT   rRNA            102180..102295
FT                   /locus_tag="BpOF4_r19921"
FT                   /product="5S ribosomal RNA"
FT   repeat_region   102346..102512
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_2F"
FT   gene            102809..103279
FT                   /gene="ctsR"
FT                   /locus_tag="BpOF4_08390"
FT   CDS_pept        102809..103279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctsR"
FT                   /locus_tag="BpOF4_08390"
FT                   /product="transcriptional regulator CtsR"
FT                   /note="COG4463 Transcriptional repressor of class III
FT                   stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08390"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49736"
FT                   /db_xref="GOA:D3FR40"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR40"
FT                   /protein_id="ADC49736.1"
FT   gene            103382..103915
FT                   /locus_tag="BpOF4_08395"
FT   CDS_pept        103382..103915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08395"
FT                   /product="hypothetical protein"
FT                   /note="COG3880 Uncharacterized protein with conserved CXXC
FT                   pairs; mcsA"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08395"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49737"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR41"
FT                   /protein_id="ADC49737.1"
FT                   IRALEEQKKNQGEG"
FT   gene            103920..104996
FT                   /gene="mcsB"
FT                   /locus_tag="BpOF4_08400"
FT   CDS_pept        103920..104996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcsB"
FT                   /locus_tag="BpOF4_08400"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="COG3869 Arginine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08400"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49738"
FT                   /db_xref="GOA:D3FR42"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR42"
FT                   /protein_id="ADC49738.1"
FT                   RRATLIRERLKLENDTNE"
FT   gene            105014..107455
FT                   /gene="clpC"
FT                   /locus_tag="BpOF4_08405"
FT   CDS_pept        105014..107455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpC"
FT                   /locus_tag="BpOF4_08405"
FT                   /product="class III stress response-related ATPase"
FT                   /note="COG0542 ATPases with chaperone activity, ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08405"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49739"
FT                   /db_xref="GOA:D3FR43"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR43"
FT                   /protein_id="ADC49739.1"
FT                   V"
FT   gene            107605..108981
FT                   /gene="radA"
FT                   /locus_tag="BpOF4_08410"
FT   CDS_pept        107605..108981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BpOF4_08410"
FT                   /product="DNA repair protein RadA"
FT                   /note="COG1066 Predicted ATP-dependent serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08410"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49740"
FT                   /db_xref="GOA:D3FR44"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR44"
FT                   /protein_id="ADC49740.1"
FT                   "
FT   gene            108987..110060
FT                   /gene="disA"
FT                   /locus_tag="BpOF4_08415"
FT   CDS_pept        108987..110060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="disA"
FT                   /locus_tag="BpOF4_08415"
FT                   /product="DNA integrity scanning protein DisA"
FT                   /note="COG1623 Predicted nucleic-acid-binding protein
FT                   (contains the HHH domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08415"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49741"
FT                   /db_xref="GOA:D3FR45"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR45"
FT                   /protein_id="ADC49741.1"
FT                   KDGLQRIQEQLFVDRHI"
FT   gene            110207..111295
FT                   /gene="yacL"
FT                   /locus_tag="BpOF4_08420"
FT   CDS_pept        110207..111295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacL"
FT                   /locus_tag="BpOF4_08420"
FT                   /product="protein with PilT ATPase and Pin domains"
FT                   /note="COG4956 Integral membrane protein (PIN domain
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08420"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49742"
FT                   /db_xref="GOA:D3FR46"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR46"
FT                   /protein_id="ADC49742.1"
FT   gene            111523..112227
FT                   /gene="ispD"
FT                   /locus_tag="BpOF4_08425"
FT   CDS_pept        111523..112227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BpOF4_08425"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="COG1211 4-diphosphocytidyl-2-methyl-D-erithritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08425"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49743"
FT                   /db_xref="GOA:D3FR47"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR47"
FT                   /protein_id="ADC49743.1"
FT                   FAEAILAHKERV"
FT   gene            112229..112708
FT                   /gene="ispF"
FT                   /locus_tag="BpOF4_08430"
FT   CDS_pept        112229..112708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BpOF4_08430"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="COG0245 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49744"
FT                   /db_xref="GOA:D3FR48"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR48"
FT                   /protein_id="ADC49744.1"
FT   gene            112802..114256
FT                   /gene="gltX"
FT                   /locus_tag="BpOF4_08435"
FT   CDS_pept        112802..114256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BpOF4_08435"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="COG0008 Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08435"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49745"
FT                   /db_xref="GOA:D3FR49"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR49"
FT                   /protein_id="ADC49745.1"
FT   gene            114559..115209
FT                   /gene="cysE"
FT                   /locus_tag="BpOF4_08440"
FT   CDS_pept        114559..115209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BpOF4_08440"
FT                   /product="serine O-acetyltransferase"
FT                   /note="COG1045 Serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08440"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49746"
FT                   /db_xref="GOA:D3FR50"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR50"
FT                   /protein_id="ADC49746.1"
FT   gene            115264..116661
FT                   /gene="cysS"
FT                   /locus_tag="BpOF4_08445"
FT   CDS_pept        115264..116661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BpOF4_08445"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /note="COG0215 Cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08445"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49747"
FT                   /db_xref="GOA:D3FR51"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR51"
FT                   /protein_id="ADC49747.1"
FT                   GVRWKRG"
FT   gene            116663..117070
FT                   /gene="rnhIII"
FT                   /locus_tag="BpOF4_08450"
FT   CDS_pept        116663..117070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhIII"
FT                   /locus_tag="BpOF4_08450"
FT                   /product="RNAse III"
FT                   /note="COG1939 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08450"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49748"
FT                   /db_xref="GOA:D3FR52"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR008226"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR52"
FT                   /protein_id="ADC49748.1"
FT   gene            117104..117853
FT                   /gene="trmH"
FT                   /locus_tag="BpOF4_08455"
FT   CDS_pept        117104..117853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmH"
FT                   /locus_tag="BpOF4_08455"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /note="COG0566 rRNA methylases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49749"
FT                   /db_xref="GOA:D3FR53"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR53"
FT                   /protein_id="ADC49749.1"
FT   gene            117855..118367
FT                   /locus_tag="BpOF4_08460"
FT   CDS_pept        117855..118367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08460"
FT                   /product="putative RNAse with PIN and NYM domains"
FT                   /note="COG3688 Predicted RNA-binding protein containing a
FT                   PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08460"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49750"
FT                   /db_xref="InterPro:IPR010298"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR54"
FT                   /protein_id="ADC49750.1"
FT                   RWRRGGR"
FT   gene            118450..119097
FT                   /gene="sig70"
FT                   /locus_tag="BpOF4_08465"
FT   CDS_pept        118450..119097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig70"
FT                   /locus_tag="BpOF4_08465"
FT                   /product="RNA polymerase factor sigma-70"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08465"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49751"
FT                   /db_xref="GOA:D3FR55"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014218"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR016371"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR55"
FT                   /protein_id="ADC49751.1"
FT   gene            119261..119410
FT                   /gene="rpmG"
FT                   /locus_tag="BpOF4_08470"
FT   CDS_pept        119261..119410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="BpOF4_08470"
FT                   /product="Ribosomal protein L33"
FT                   /note="COG0267 Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08470"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49752"
FT                   /db_xref="GOA:D3FR56"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR56"
FT                   /protein_id="ADC49752.1"
FT                   RETK"
FT   gene            119683..119877
FT                   /gene="secE"
FT                   /locus_tag="BpOF4_08475"
FT   CDS_pept        119683..119877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BpOF4_08475"
FT                   /product="preprotein translocase subunit, secE"
FT                   /note="COG0690 Preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08475"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49753"
FT                   /db_xref="GOA:D3FR57"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR57"
FT                   /protein_id="ADC49753.1"
FT   gene            119953..120486
FT                   /gene="nusG"
FT                   /locus_tag="BpOF4_08480"
FT   CDS_pept        119953..120486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BpOF4_08480"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="COG0250 Transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08480"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49754"
FT                   /db_xref="GOA:D3FR58"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR58"
FT                   /protein_id="ADC49754.1"
FT                   ETPVELEFDQVEKI"
FT   gene            120646..121071
FT                   /gene="rplK"
FT                   /locus_tag="BpOF4_08485"
FT   CDS_pept        120646..121071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BpOF4_08485"
FT                   /product="50S ribosomal protein L11"
FT                   /note="COG0080 Ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08485"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49755"
FT                   /db_xref="GOA:D3FR59"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR59"
FT                   /protein_id="ADC49755.1"
FT   gene            121195..121890
FT                   /gene="rplA"
FT                   /locus_tag="BpOF4_08490"
FT   CDS_pept        121195..121890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BpOF4_08490"
FT                   /product="50S ribosomal protein L1"
FT                   /note="COG0081 Ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49756"
FT                   /db_xref="GOA:D3FR60"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR60"
FT                   /protein_id="ADC49756.1"
FT                   RVNASSIAK"
FT   gene            122121..122618
FT                   /gene="rplJ"
FT                   /locus_tag="BpOF4_08495"
FT   CDS_pept        122121..122618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BpOF4_08495"
FT                   /product="50S ribosomal protein L10"
FT                   /note="COG0244 Ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08495"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49757"
FT                   /db_xref="GOA:D3FR61"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR61"
FT                   /protein_id="ADC49757.1"
FT                   GA"
FT   gene            122684..123046
FT                   /locus_tag="BpOF4_08500"
FT   CDS_pept        122684..123046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08500"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /note="COG0222 Ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08500"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49758"
FT                   /db_xref="GOA:D3FR62"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR62"
FT                   /protein_id="ADC49758.1"
FT                   EMKAKLEDAGASVEVK"
FT   gene            123168..123773
FT                   /gene="ybxB"
FT                   /locus_tag="BpOF4_08505"
FT   CDS_pept        123168..123773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxB"
FT                   /locus_tag="BpOF4_08505"
FT                   /product="ribosomal RNA methyltransferase"
FT                   /note="COG2813 16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08505"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49759"
FT                   /db_xref="GOA:D3FR63"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR63"
FT                   /protein_id="ADC49759.1"
FT   gene            124126..127668
FT                   /gene="rpoB"
FT                   /locus_tag="BpOF4_08510"
FT   CDS_pept        124126..127668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BpOF4_08510"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /note="COG0085 DNA-directed RNA polymerase, beta
FT                   subunit/140 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08510"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49760"
FT                   /db_xref="GOA:D3FR64"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR64"
FT                   /protein_id="ADC49760.1"
FT                   EKLNLNLESSESNV"
FT   gene            127820..131440
FT                   /gene="rpoC"
FT                   /locus_tag="BpOF4_08515"
FT   CDS_pept        127820..131440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BpOF4_08515"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /note="COG0086 DNA-directed RNA polymerase, beta'
FT                   subunit/160 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08515"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49761"
FT                   /db_xref="GOA:D3FR65"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR65"
FT                   /protein_id="ADC49761.1"
FT   gene            131529..131777
FT                   /gene="ybxF"
FT                   /locus_tag="BpOF4_08520"
FT   CDS_pept        131529..131777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybxF"
FT                   /locus_tag="BpOF4_08520"
FT                   /product="ribosomal protein L7AE family protein"
FT                   /note="COG1358 Ribosomal protein HS6-type (S12/L30/L7a)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08520"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49762"
FT                   /db_xref="GOA:D3FR66"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR023460"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR66"
FT                   /protein_id="ADC49762.1"
FT   gene            131888..132307
FT                   /gene="rpsL"
FT                   /locus_tag="BpOF4_08525"
FT   CDS_pept        131888..132307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="BpOF4_08525"
FT                   /product="30S ribosomal protein S12"
FT                   /note="COG0048 Ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08525"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49763"
FT                   /db_xref="GOA:D3FR67"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR67"
FT                   /protein_id="ADC49763.1"
FT   gene            132349..132819
FT                   /gene="rpsG"
FT                   /locus_tag="BpOF4_08530"
FT   CDS_pept        132349..132819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BpOF4_08530"
FT                   /product="30S ribosomal protein S7"
FT                   /note="COG0049 Ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08530"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49764"
FT                   /db_xref="GOA:D3FR68"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR68"
FT                   /protein_id="ADC49764.1"
FT   gene            132871..134949
FT                   /gene="fusA"
FT                   /locus_tag="BpOF4_08535"
FT   CDS_pept        132871..134949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BpOF4_08535"
FT                   /product="elongation factor G"
FT                   /note="COG0480 Translation elongation factors (GTPases)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08535"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49765"
FT                   /db_xref="GOA:D3FR69"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR69"
FT                   /protein_id="ADC49765.1"
FT   gene            135077..136267
FT                   /gene="tufA"
FT                   /locus_tag="BpOF4_08540"
FT   CDS_pept        135077..136267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufA"
FT                   /locus_tag="BpOF4_08540"
FT                   /product="elongation factor Tu"
FT                   /note="COG0050 GTPases - translation elongation factors"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08540"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49766"
FT                   /db_xref="GOA:D3FR70"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR70"
FT                   /protein_id="ADC49766.1"
FT   gene            136568..136876
FT                   /gene="rpsJ"
FT                   /locus_tag="BpOF4_08545"
FT   CDS_pept        136568..136876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BpOF4_08545"
FT                   /product="30S ribosomal protein S10"
FT                   /note="COG0051 Ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08545"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49767"
FT                   /db_xref="GOA:D3FR71"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR71"
FT                   /protein_id="ADC49767.1"
FT   gene            136970..137596
FT                   /gene="rplC"
FT                   /locus_tag="BpOF4_08550"
FT   CDS_pept        136970..137596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BpOF4_08550"
FT                   /product="50S ribosomal protein L3"
FT                   /note="COG0087 Ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08550"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49768"
FT                   /db_xref="GOA:D3FR72"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR72"
FT                   /protein_id="ADC49768.1"
FT   gene            137622..138245
FT                   /gene="rplD"
FT                   /locus_tag="BpOF4_08555"
FT   CDS_pept        137622..138245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BpOF4_08555"
FT                   /product="50S ribosomal protein L4"
FT                   /note="COG0088 Ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08555"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49769"
FT                   /db_xref="GOA:D3FR73"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR73"
FT                   /protein_id="ADC49769.1"
FT   gene            138245..138535
FT                   /gene="rplW"
FT                   /locus_tag="BpOF4_08560"
FT   CDS_pept        138245..138535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BpOF4_08560"
FT                   /product="50S ribosomal protein L23"
FT                   /note="COG0089 Ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08560"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49770"
FT                   /db_xref="GOA:D3FR74"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR74"
FT                   /protein_id="ADC49770.1"
FT   gene            138563..139393
FT                   /gene="rplB"
FT                   /locus_tag="BpOF4_08565"
FT   CDS_pept        138563..139393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BpOF4_08565"
FT                   /product="50S ribosomal protein L2"
FT                   /note="COG0090 Ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08565"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49771"
FT                   /db_xref="GOA:D3FR75"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR75"
FT                   /protein_id="ADC49771.1"
FT   gene            139454..139732
FT                   /gene="rpsS"
FT                   /locus_tag="BpOF4_08570"
FT   CDS_pept        139454..139732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="BpOF4_08570"
FT                   /product="30S ribosomal protein S19"
FT                   /note="COG0185 Ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08570"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49772"
FT                   /db_xref="GOA:D3FR76"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR76"
FT                   /protein_id="ADC49772.1"
FT   gene            139759..140100
FT                   /gene="rplV"
FT                   /locus_tag="BpOF4_08575"
FT   CDS_pept        139759..140100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BpOF4_08575"
FT                   /product="50S ribosomal protein L22"
FT                   /note="COG0091 Ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08575"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49773"
FT                   /db_xref="GOA:D3FR77"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR77"
FT                   /protein_id="ADC49773.1"
FT                   LVVTEKKEG"
FT   gene            140104..140763
FT                   /gene="rpsC"
FT                   /locus_tag="BpOF4_08580"
FT   CDS_pept        140104..140763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BpOF4_08580"
FT                   /product="30S ribosomal protein S3"
FT                   /note="COG0092 Ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08580"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49774"
FT                   /db_xref="GOA:D3FR78"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR78"
FT                   /protein_id="ADC49774.1"
FT   gene            140766..141200
FT                   /gene="rplP"
FT                   /locus_tag="BpOF4_08585"
FT   CDS_pept        140766..141200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BpOF4_08585"
FT                   /product="50S ribosomal protein L16"
FT                   /note="COG0197 Ribosomal protein L16/L10E"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08585"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49775"
FT                   /db_xref="GOA:D3FR79"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR79"
FT                   /protein_id="ADC49775.1"
FT   gene            141190..141393
FT                   /gene="rpmC"
FT                   /locus_tag="BpOF4_08590"
FT   CDS_pept        141190..141393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BpOF4_08590"
FT                   /product="50S ribosomal protein L29"
FT                   /note="COG0255 Ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08590"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49776"
FT                   /db_xref="GOA:D3FR80"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR80"
FT                   /protein_id="ADC49776.1"
FT   gene            141410..141670
FT                   /gene="rpsQ"
FT                   /locus_tag="BpOF4_08595"
FT   CDS_pept        141410..141670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BpOF4_08595"
FT                   /product="30S ribosomal protein S17"
FT                   /note="COG0186 Ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08595"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49777"
FT                   /db_xref="GOA:D3FR81"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR81"
FT                   /protein_id="ADC49777.1"
FT   gene            141704..142072
FT                   /gene="rplN"
FT                   /locus_tag="BpOF4_08600"
FT   CDS_pept        141704..142072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BpOF4_08600"
FT                   /product="50S ribosomal protein L14"
FT                   /note="COG0093 Ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08600"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49778"
FT                   /db_xref="GOA:D3FR82"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR82"
FT                   /protein_id="ADC49778.1"
FT                   ELRDNQFMKIVSLAPEVL"
FT   gene            142111..142431
FT                   /gene="rplX"
FT                   /locus_tag="BpOF4_08605"
FT   CDS_pept        142111..142431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BpOF4_08605"
FT                   /product="50S ribosomal protein L24"
FT                   /note="COG0198 Ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08605"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49779"
FT                   /db_xref="GOA:D3FR83"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR83"
FT                   /protein_id="ADC49779.1"
FT                   DK"
FT   gene            142458..142997
FT                   /gene="rplE"
FT                   /locus_tag="BpOF4_08610"
FT   CDS_pept        142458..142997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BpOF4_08610"
FT                   /product="50S ribosomal protein L5"
FT                   /note="COG0094 Ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08610"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49780"
FT                   /db_xref="GOA:D3FR84"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR84"
FT                   /protein_id="ADC49780.1"
FT                   EEARELLTQMGMPFQK"
FT   gene            143029..143214
FT                   /gene="rpsN"
FT                   /locus_tag="BpOF4_08615"
FT   CDS_pept        143029..143214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BpOF4_08615"
FT                   /product="30S ribosomal protein S14"
FT                   /note="COG0199 Ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08615"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49781"
FT                   /db_xref="GOA:D3FR85"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR85"
FT                   /protein_id="ADC49781.1"
FT                   ELAHKGQIPGVKKASW"
FT   gene            143244..143642
FT                   /gene="rpsH"
FT                   /locus_tag="BpOF4_08620"
FT   CDS_pept        143244..143642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BpOF4_08620"
FT                   /product="30S ribosomal protein S8"
FT                   /note="COG0096 Ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08620"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49782"
FT                   /db_xref="GOA:D3FR86"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR86"
FT                   /protein_id="ADC49782.1"
FT   gene            143676..144212
FT                   /gene="rplF"
FT                   /locus_tag="BpOF4_08625"
FT   CDS_pept        143676..144212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BpOF4_08625"
FT                   /product="50S ribosomal protein L6"
FT                   /note="COG0097 Ribosomal protein L6P/L9E"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08625"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49783"
FT                   /db_xref="GOA:D3FR87"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR87"
FT                   /protein_id="ADC49783.1"
FT                   YEGEYVRRKEGKTGK"
FT   gene            144239..144601
FT                   /gene="rplR"
FT                   /locus_tag="BpOF4_08630"
FT   CDS_pept        144239..144601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BpOF4_08630"
FT                   /product="50S ribosomal protein L18"
FT                   /note="COG0256 Ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08630"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49784"
FT                   /db_xref="GOA:D3FR88"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR88"
FT                   /protein_id="ADC49784.1"
FT                   RVQTLADAAREAGLQF"
FT   gene            144623..145123
FT                   /gene="rpsE"
FT                   /locus_tag="BpOF4_08635"
FT   CDS_pept        144623..145123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BpOF4_08635"
FT                   /product="30S ribosomal protein S5"
FT                   /note="COG0098 Ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08635"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49785"
FT                   /db_xref="GOA:D3FR89"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR89"
FT                   /protein_id="ADC49785.1"
FT                   LLG"
FT   gene            145137..145325
FT                   /gene="rpmD"
FT                   /locus_tag="BpOF4_08640"
FT   CDS_pept        145137..145325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BpOF4_08640"
FT                   /product="50S ribosomal protein L30"
FT                   /note="COG1841 Ribosomal protein L30/L7E"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08640"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49786"
FT                   /db_xref="GOA:D3FR90"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR90"
FT                   /protein_id="ADC49786.1"
FT                   GMVNKVSHLLTVKEIEA"
FT   gene            145357..145797
FT                   /gene="rplO"
FT                   /locus_tag="BpOF4_08645"
FT   CDS_pept        145357..145797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BpOF4_08645"
FT                   /product="50S ribosomal protein L15"
FT                   /note="COG0200 Ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08645"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49787"
FT                   /db_xref="GOA:D3FR91"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR91"
FT                   /protein_id="ADC49787.1"
FT   gene            145797..147089
FT                   /gene="secY"
FT                   /locus_tag="BpOF4_08650"
FT   CDS_pept        145797..147089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BpOF4_08650"
FT                   /product="preprotein translocase subunit SecY"
FT                   /note="COG0201 Preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08650"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49788"
FT                   /db_xref="GOA:D3FR92"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR92"
FT                   /protein_id="ADC49788.1"
FT   gene            147165..147818
FT                   /gene="adk"
FT                   /locus_tag="BpOF4_08655"
FT   CDS_pept        147165..147818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BpOF4_08655"
FT                   /product="adenylate kinase"
FT                   /note="COG0563 Adenylate kinase and related kinases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08655"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49789"
FT                   /db_xref="GOA:D3FR93"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR93"
FT                   /protein_id="ADC49789.1"
FT   gene            147815..148561
FT                   /gene="map"
FT                   /locus_tag="BpOF4_08660"
FT   CDS_pept        147815..148561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="BpOF4_08660"
FT                   /product="methionine aminopeptidase"
FT                   /note="COG0024 Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08660"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49790"
FT                   /db_xref="GOA:D3FR94"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR94"
FT                   /protein_id="ADC49790.1"
FT   gene            148580..148903
FT                   /locus_tag="BpOF4_08665"
FT   CDS_pept        148580..148903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08665"
FT                   /product="hypothetical protein"
FT                   /note="COG2163 Ribosomal protein L14E/L6E/L27E"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08665"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49791"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041985"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR95"
FT                   /protein_id="ADC49791.1"
FT                   EGE"
FT   gene            148908..149126
FT                   /gene="infA"
FT                   /locus_tag="BpOF4_08670"
FT   CDS_pept        148908..149126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BpOF4_08670"
FT                   /product="translation initiation factor IF-1"
FT                   /note="COG0361 Translation initiation factor 1 (IF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08670"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49792"
FT                   /db_xref="GOA:D3FR96"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR96"
FT                   /protein_id="ADC49792.1"
FT   gene            149227..149340
FT                   /gene="rpmJ"
FT                   /locus_tag="BpOF4_08675"
FT   CDS_pept        149227..149340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BpOF4_08675"
FT                   /product="50S ribosomal protein L36"
FT                   /note="COG0257 Ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08675"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49793"
FT                   /db_xref="GOA:D3FR97"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR97"
FT                   /protein_id="ADC49793.1"
FT   gene            149363..149728
FT                   /gene="rpsM"
FT                   /locus_tag="BpOF4_08680"
FT   CDS_pept        149363..149728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BpOF4_08680"
FT                   /product="30S ribosomal protein S13"
FT                   /note="COG0099 Ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08680"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49794"
FT                   /db_xref="GOA:D3FR98"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR98"
FT                   /protein_id="ADC49794.1"
FT                   NARTRKGPRRTVANKKK"
FT   gene            149749..150141
FT                   /gene="rpsK"
FT                   /locus_tag="BpOF4_08685"
FT   CDS_pept        149749..150141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BpOF4_08685"
FT                   /product="30S ribosomal protein S11"
FT                   /note="COG0100 Ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08685"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49795"
FT                   /db_xref="GOA:D3FR99"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D3FR99"
FT                   /protein_id="ADC49795.1"
FT   gene            150309..151253
FT                   /gene="rpoA"
FT                   /locus_tag="BpOF4_08690"
FT   CDS_pept        150309..151253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BpOF4_08690"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /note="COG0202 DNA-directed RNA polymerase, alpha
FT                   subunit/40 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08690"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49796"
FT                   /db_xref="GOA:D3FRN6"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRN6"
FT                   /protein_id="ADC49796.1"
FT   gene            151346..151708
FT                   /gene="rplQ"
FT                   /locus_tag="BpOF4_08695"
FT   CDS_pept        151346..151708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BpOF4_08695"
FT                   /product="50S ribosomal protein L17"
FT                   /note="COG0203 Ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08695"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49797"
FT                   /db_xref="GOA:D3FRN7"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRN7"
FT                   /protein_id="ADC49797.1"
FT                   GPRRGDGAPMAIIELV"
FT   gene            151894..152730
FT                   /locus_tag="BpOF4_08700"
FT   CDS_pept        151894..152730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08700"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08700"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49798"
FT                   /db_xref="GOA:D3FRN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030947"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRN8"
FT                   /protein_id="ADC49798.1"
FT   gene            152706..153578
FT                   /locus_tag="BpOF4_08705"
FT   CDS_pept        152706..153578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08705"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1122 ABC-type cobalt transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08705"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49799"
FT                   /db_xref="GOA:D3FRN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030946"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRN9"
FT                   /protein_id="ADC49799.1"
FT                   DLLHEKGEG"
FT   gene            153581..154381
FT                   /locus_tag="BpOF4_08710"
FT   CDS_pept        153581..154381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08710"
FT                   /product="ABC transporter for cobalt permease protein"
FT                   /note="COG0619 ABC-type cobalt transport system, permease
FT                   component CbiQ and related transporters"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08710"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49800"
FT                   /db_xref="GOA:D3FRP0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR024919"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3FRP0"
FT                   /protein_id="ADC49800.1"
FT   gene            154392..155135
FT                   /gene="truA"
FT                   /locus_tag="BpOF4_08715"
FT   CDS_pept        154392..155135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BpOF4_08715"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /note="COG0101 Pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08715"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49801"
FT                   /db_xref="GOA:D3FRP1"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP1"
FT                   /protein_id="ADC49801.1"
FT   gene            155336..155773
FT                   /gene="rplM"
FT                   /locus_tag="BpOF4_08720"
FT   CDS_pept        155336..155773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BpOF4_08720"
FT                   /product="50S ribosomal protein L13"
FT                   /note="COG0102 Ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08720"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49802"
FT                   /db_xref="GOA:D3FRP2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP2"
FT                   /protein_id="ADC49802.1"
FT   gene            155794..156186
FT                   /gene="rpsI"
FT                   /locus_tag="BpOF4_08725"
FT   CDS_pept        155794..156186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BpOF4_08725"
FT                   /product="30S ribosomal protein S9"
FT                   /note="COG0103 Ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08725"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49803"
FT                   /db_xref="GOA:D3FRP3"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP3"
FT                   /protein_id="ADC49803.1"
FT   gene            156315..156641
FT                   /locus_tag="BpOF4_08730"
FT   CDS_pept        156315..156641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08730"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49804"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP4"
FT                   /protein_id="ADC49804.1"
FT                   VPGD"
FT   gene            156787..157095
FT                   /locus_tag="BpOF4_08735"
FT   CDS_pept        156787..157095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08735"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49805"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP5"
FT                   /protein_id="ADC49805.1"
FT   gene            157341..158120
FT                   /locus_tag="BpOF4_08740"
FT   CDS_pept        157341..158120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08740"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49806"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP6"
FT                   /protein_id="ADC49806.1"
FT   gene            complement(158123..158641)
FT                   /locus_tag="BpOF4_08745"
FT   CDS_pept        complement(158123..158641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08745"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49807"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP7"
FT                   /protein_id="ADC49807.1"
FT                   QPAPPLLWI"
FT   gene            complement(158669..159133)
FT                   /locus_tag="BpOF4_08750"
FT   CDS_pept        complement(158669..159133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08750"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49808"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP8"
FT                   /protein_id="ADC49808.1"
FT   gene            159300..159737
FT                   /locus_tag="BpOF4_08755"
FT   CDS_pept        159300..159737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08755"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49809"
FT                   /db_xref="InterPro:IPR019667"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRP9"
FT                   /protein_id="ADC49809.1"
FT   gene            159800..160513
FT                   /gene="cwlD"
FT                   /locus_tag="BpOF4_08760"
FT   CDS_pept        159800..160513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BpOF4_08760"
FT                   /product="germination-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /note="COG0860 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08760"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49810"
FT                   /db_xref="GOA:D3FRQ0"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR014234"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ0"
FT                   /protein_id="ADC49810.1"
FT                   QGIMRYYTNEEEPVS"
FT   gene            160599..161654
FT                   /gene="minD"
FT                   /locus_tag="BpOF4_08765"
FT   CDS_pept        160599..161654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="BpOF4_08765"
FT                   /product="putative MinD"
FT                   /note="COG0489 ATPases involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08765"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49811"
FT                   /db_xref="GOA:D3FRQ1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ1"
FT                   /protein_id="ADC49811.1"
FT                   IAEKIIVKIEK"
FT   gene            complement(161682..162341)
FT                   /gene="gerD"
FT                   /locus_tag="BpOF4_08770"
FT   CDS_pept        complement(161682..162341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BpOF4_08770"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08770"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49812"
FT                   /db_xref="InterPro:IPR041262"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ2"
FT                   /protein_id="ADC49812.1"
FT   gene            162487..163092
FT                   /gene="kbaA"
FT                   /locus_tag="BpOF4_08775"
FT   CDS_pept        162487..163092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kbaA"
FT                   /locus_tag="BpOF4_08775"
FT                   /product="activation of the KinB signaling pathway of
FT                   sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08775"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49813"
FT                   /db_xref="GOA:D3FRQ3"
FT                   /db_xref="InterPro:IPR024164"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ3"
FT                   /protein_id="ADC49813.1"
FT   gene            complement(163114..163875)
FT                   /gene="pdaB"
FT                   /locus_tag="BpOF4_08780"
FT   CDS_pept        complement(163114..163875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaB"
FT                   /locus_tag="BpOF4_08780"
FT                   /product="polysaccharide deacetylase pdaB involved in
FT                   sporulation"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08780"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49814"
FT                   /db_xref="GOA:D3FRQ4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014132"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ4"
FT                   /protein_id="ADC49814.1"
FT   gene            164049..164276
FT                   /locus_tag="BpOF4_08785"
FT   CDS_pept        164049..164276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08785"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49815"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ5"
FT                   /protein_id="ADC49815.1"
FT   gene            164650..166210
FT                   /locus_tag="BpOF4_r19939"
FT   rRNA            164650..166210
FT                   /locus_tag="BpOF4_r19939"
FT                   /product="16S ribosomal RNA"
FT   gene            166444..169384
FT                   /locus_tag="BpOF4_r19953"
FT   rRNA            166444..169384
FT                   /locus_tag="BpOF4_r19953"
FT                   /product="23S ribosomal RNA"
FT   gene            169567..169682
FT                   /locus_tag="BpOF4_r19923"
FT   rRNA            169567..169682
FT                   /locus_tag="BpOF4_r19923"
FT                   /product="5S ribosomal RNA"
FT   gene            169695..169769
FT                   /locus_tag="BpOF4_t19827"
FT   tRNA            169695..169769
FT                   /locus_tag="BpOF4_t19827"
FT                   /product="tRNA-Asn"
FT   gene            169777..169852
FT                   /locus_tag="BpOF4_t19829"
FT   tRNA            169777..169852
FT                   /locus_tag="BpOF4_t19829"
FT                   /product="tRNA-Thr"
FT   gene            complement(170088..170276)
FT                   /locus_tag="BpOF4_08790"
FT   CDS_pept        complement(170088..170276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08790"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49816"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ6"
FT                   /protein_id="ADC49816.1"
FT                   RTVTGLTAEELKSRSTR"
FT   gene            170466..170540
FT                   /locus_tag="BpOF4_t19831"
FT   tRNA            170466..170540
FT                   /locus_tag="BpOF4_t19831"
FT                   /product="tRNA-Glu"
FT   gene            170587..170662
FT                   /locus_tag="BpOF4_t19833"
FT   tRNA            170587..170662
FT                   /locus_tag="BpOF4_t19833"
FT                   /product="tRNA-Val"
FT   gene            170666..170738
FT                   /locus_tag="BpOF4_t19835"
FT   tRNA            170666..170738
FT                   /locus_tag="BpOF4_t19835"
FT                   /product="tRNA-Thr"
FT   gene            170755..170839
FT                   /locus_tag="BpOF4_t19837"
FT   tRNA            170755..170839
FT                   /locus_tag="BpOF4_t19837"
FT                   /product="tRNA-Tyr"
FT   gene            170847..170921
FT                   /locus_tag="BpOF4_t19839"
FT   tRNA            170847..170921
FT                   /locus_tag="BpOF4_t19839"
FT                   /product="tRNA-Gln"
FT   gene            170928..171000
FT                   /locus_tag="BpOF4_t19841"
FT   tRNA            170928..171000
FT                   /locus_tag="BpOF4_t19841"
FT                   /product="tRNA-Lys"
FT   gene            171036..171110
FT                   /locus_tag="BpOF4_t19843"
FT   tRNA            171036..171110
FT                   /locus_tag="BpOF4_t19843"
FT                   /product="tRNA-Gly"
FT   gene            171118..171193
FT                   /locus_tag="BpOF4_t19845"
FT   tRNA            171118..171193
FT                   /locus_tag="BpOF4_t19845"
FT                   /product="tRNA-Ala"
FT   gene            complement(171244..171417)
FT                   /locus_tag="BpOF4_08795"
FT   CDS_pept        complement(171244..171417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08795"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49817"
FT                   /db_xref="GOA:D3FRQ7"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ7"
FT                   /protein_id="ADC49817.1"
FT                   LLNEYDLLLKEE"
FT   gene            171623..172186
FT                   /gene="sigW"
FT                   /locus_tag="BpOF4_08800"
FT   CDS_pept        171623..172186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigW"
FT                   /locus_tag="BpOF4_08800"
FT                   /product="RNA polymerase sigma factor SigW"
FT                   /note="COG1595 DNA-directed RNA polymerase specialized
FT                   sigma subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08800"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49818"
FT                   /db_xref="GOA:D3FRQ8"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ8"
FT                   /protein_id="ADC49818.1"
FT   gene            172203..172850
FT                   /gene="rsiW"
FT                   /locus_tag="BpOF4_08805"
FT   CDS_pept        172203..172850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsiW"
FT                   /locus_tag="BpOF4_08805"
FT                   /product="anti-sigma factor"
FT                   /note="COG5662 Predicted transmembrane transcriptional
FT                   regulator (anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08805"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49819"
FT                   /db_xref="GOA:D3FRQ9"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRQ9"
FT                   /protein_id="ADC49819.1"
FT   gene            173160..173984
FT                   /locus_tag="BpOF4_08810"
FT   CDS_pept        173160..173984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08810"
FT                   /product="hypothetical protein"
FT                   /note="COG1624 Uncharacterized conserved protein; ybbP"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08810"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49820"
FT                   /db_xref="GOA:D3FRR0"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR0"
FT                   /protein_id="ADC49820.1"
FT   gene            173977..175221
FT                   /locus_tag="BpOF4_08815"
FT   CDS_pept        173977..175221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08815"
FT                   /product="hypothetical protein"
FT                   /note="COG4856 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08815"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49821"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR1"
FT                   /protein_id="ADC49821.1"
FT                   KTNVEVIVSDQSESE"
FT   gene            175248..176597
FT                   /gene="glmM"
FT                   /locus_tag="BpOF4_08820"
FT   CDS_pept        175248..176597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BpOF4_08820"
FT                   /product="phosphoglucosamine mutase"
FT                   /note="COG1109 Phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08820"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49822"
FT                   /db_xref="GOA:D3FRR2"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR2"
FT                   /protein_id="ADC49822.1"
FT   gene            177042..178844
FT                   /gene="glmS"
FT                   /locus_tag="BpOF4_08825"
FT   CDS_pept        177042..178844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BpOF4_08825"
FT                   /product="glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /note="COG0449 Glucosamine 6-phosphate synthetase, contains
FT                   amidotransferase and phosphosugar isomerase domains"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08825"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49823"
FT                   /db_xref="GOA:D3FRR3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR3"
FT                   /protein_id="ADC49823.1"
FT   gene            complement(178995..181178)
FT                   /gene="katG"
FT                   /locus_tag="BpOF4_08830"
FT   CDS_pept        complement(178995..181178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="BpOF4_08830"
FT                   /product="catalase (peroxidase)"
FT                   /note="COG0376 Catalase (peroxidase I)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08830"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49824"
FT                   /db_xref="GOA:D3FRR4"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR4"
FT                   /protein_id="ADC49824.1"
FT   gene            181497..182696
FT                   /gene="yngD"
FT                   /locus_tag="BpOF4_08835"
FT   CDS_pept        181497..182696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yngD"
FT                   /locus_tag="BpOF4_08835"
FT                   /product="putative DHH family phosphohydrolase involved in
FT                   recombination YngD"
FT                   /note="COG2404 Predicted phosphohydrolase (DHH
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08835"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49825"
FT                   /db_xref="GOA:D3FRR5"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR5"
FT                   /protein_id="ADC49825.1"
FT                   "
FT   gene            182767..183264
FT                   /gene="ykuD"
FT                   /locus_tag="BpOF4_08840"
FT   CDS_pept        182767..183264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ykuD"
FT                   /locus_tag="BpOF4_08840"
FT                   /product="murein binding protein"
FT                   /note="COG1376 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08840"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49826"
FT                   /db_xref="GOA:D3FRR6"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR6"
FT                   /protein_id="ADC49826.1"
FT                   RP"
FT   gene            183403..184572
FT                   /locus_tag="BpOF4_08845"
FT   CDS_pept        183403..184572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08845"
FT                   /product="PAS:GGDEF domain protein"
FT                   /note="COG2199 FOG: GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08845"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49827"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR7"
FT                   /protein_id="ADC49827.1"
FT   gene            184698..185813
FT                   /locus_tag="BpOF4_08850"
FT   CDS_pept        184698..185813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08850"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="COG0665 Glycine/D-amino acid oxidases (deaminating)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08850"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49828"
FT                   /db_xref="GOA:D3FRR8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRR8"
FT                   /protein_id="ADC49828.1"
FT   gene            185960..186373
FT                   /locus_tag="BpOF4_08855"
FT   CDS_pept        185960..186373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08855"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08855"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49829"
FT                   /db_xref="GOA:D3FQ92"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQ92"
FT                   /protein_id="ADC49829.1"
FT   gene            186412..187290
FT                   /locus_tag="BpOF4_08860"
FT   CDS_pept        186412..187290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08860"
FT                   /product="transposase"
FT                   /note="COG2801 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08860"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49830"
FT                   /db_xref="GOA:D3FQ91"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3FQ91"
FT                   /protein_id="ADC49830.1"
FT                   VQYRDHLIKAA"
FT   misc_feature    complement(187331..188192)
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|154686353|ref|YP_001421514.1| YojH"
FT   gene            188316..188936
FT                   /gene="ppiB"
FT                   /locus_tag="BpOF4_08875"
FT   CDS_pept        188316..188936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppiB"
FT                   /locus_tag="BpOF4_08875"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /note="COG0652 Peptidyl-prolyl cis-trans isomerase
FT                   (rotamase) - cyclophilin family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08875"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49831"
FT                   /db_xref="GOA:D3FRS1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS1"
FT                   /protein_id="ADC49831.1"
FT   gene            complement(188990..189493)
FT                   /gene="ftnA"
FT                   /locus_tag="BpOF4_08880"
FT   CDS_pept        complement(188990..189493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftnA"
FT                   /locus_tag="BpOF4_08880"
FT                   /product="ferritin"
FT                   /note="COG1528 Ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08880"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49832"
FT                   /db_xref="GOA:D3FRS2"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS2"
FT                   /protein_id="ADC49832.1"
FT                   TPGE"
FT   gene            189703..191007
FT                   /locus_tag="BpOF4_08885"
FT   CDS_pept        189703..191007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08885"
FT                   /product="putative purine permease YbbY"
FT                   /note="COG2233 Xanthine/uracil permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08885"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49833"
FT                   /db_xref="GOA:D3FRS3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS3"
FT                   /protein_id="ADC49833.1"
FT   gene            191101..191307
FT                   /gene="ahpC"
FT                   /locus_tag="BpOF4_08890"
FT   CDS_pept        191101..191307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BpOF4_08890"
FT                   /product="peroxiredoxin"
FT                   /note="COG0450 Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08890"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49834"
FT                   /db_xref="GOA:D3FRS4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS4"
FT                   /protein_id="ADC49834.1"
FT   gene            191392..191727
FT                   /gene="ahpC"
FT                   /locus_tag="BpOF4_08895"
FT   CDS_pept        191392..191727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BpOF4_08895"
FT                   /product="peroxiredoxin"
FT                   /note="COG0450 Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08895"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49835"
FT                   /db_xref="GOA:D3FRS5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS5"
FT                   /protein_id="ADC49835.1"
FT                   QGLIGEV"
FT   repeat_region   complement(191777..191954)
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_3R"
FT   gene            192088..192420
FT                   /gene="yetG"
FT                   /locus_tag="BpOF4_08900"
FT   CDS_pept        192088..192420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yetG"
FT                   /locus_tag="BpOF4_08900"
FT                   /product="putative antibiotic synthesis monooxygenase"
FT                   /note="COG2329 Uncharacterized enzyme involved in
FT                   biosynthesis of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08900"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49836"
FT                   /db_xref="GOA:D3FRS6"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS6"
FT                   /protein_id="ADC49836.1"
FT                   REPVSK"
FT   gene            complement(192478..193509)
FT                   /gene="fhuG"
FT                   /locus_tag="BpOF4_08905"
FT   CDS_pept        complement(192478..193509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuG"
FT                   /locus_tag="BpOF4_08905"
FT                   /product="Ferric siderophore ABC transport, permease
FT                   protein"
FT                   /note="COG0609 ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08905"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49837"
FT                   /db_xref="GOA:D3FRS7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS7"
FT                   /protein_id="ADC49837.1"
FT                   VKA"
FT   gene            complement(193509..194546)
FT                   /gene="fhuB"
FT                   /locus_tag="BpOF4_08910"
FT   CDS_pept        complement(193509..194546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB"
FT                   /locus_tag="BpOF4_08910"
FT                   /product="Ferric siderophore ABC transport, permease
FT                   protein"
FT                   /note="COG0609 ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08910"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49838"
FT                   /db_xref="GOA:D3FRS8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS8"
FT                   /protein_id="ADC49838.1"
FT                   KGRSM"
FT   gene            194667..195428
FT                   /gene="fhuR"
FT                   /locus_tag="BpOF4_08915"
FT   CDS_pept        194667..195428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuR"
FT                   /locus_tag="BpOF4_08915"
FT                   /product="Ferric siderophore ABC transport, AraC type
FT                   regulator"
FT                   /note="COG2207 AraC-type DNA-binding domain-containing
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08915"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49839"
FT                   /db_xref="GOA:D3FRS9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRS9"
FT                   /protein_id="ADC49839.1"
FT   gene            195581..196576
FT                   /gene="fhuD"
FT                   /locus_tag="BpOF4_08920"
FT   CDS_pept        195581..196576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD"
FT                   /locus_tag="BpOF4_08920"
FT                   /product="Ferric siderophore ABC transport, binding
FT                   protein"
FT                   /note="COG0614 ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08920"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49840"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT0"
FT                   /protein_id="ADC49840.1"
FT   gene            196691..198502
FT                   /gene="asbA"
FT                   /locus_tag="BpOF4_08925"
FT   CDS_pept        196691..198502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asbA"
FT                   /locus_tag="BpOF4_08925"
FT                   /product="Petrobactin-like siderophore synthesis"
FT                   /note="COG4264 Siderophore synthetase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08925"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49841"
FT                   /db_xref="GOA:D3FRT1"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT1"
FT                   /protein_id="ADC49841.1"
FT   gene            198474..200237
FT                   /gene="asbB"
FT                   /locus_tag="BpOF4_08930"
FT   CDS_pept        198474..200237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asbB"
FT                   /locus_tag="BpOF4_08930"
FT                   /product="Petrobactin-like siderophore synthesis"
FT                   /note="COG4264 Siderophore synthetase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08930"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49842"
FT                   /db_xref="GOA:D3FRT2"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT2"
FT                   /protein_id="ADC49842.1"
FT                   QDTRRAEHVLC"
FT   gene            200224..201462
FT                   /gene="asbC"
FT                   /locus_tag="BpOF4_08935"
FT   CDS_pept        200224..201462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asbC"
FT                   /locus_tag="BpOF4_08935"
FT                   /product="Petrobactin-like siderophore synthesis"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08935"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49843"
FT                   /db_xref="GOA:D3FRT3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT3"
FT                   /protein_id="ADC49843.1"
FT                   GKVSRKKLGGVYA"
FT   gene            201459..201734
FT                   /gene="asbD"
FT                   /locus_tag="BpOF4_08940"
FT   CDS_pept        201459..201734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asbD"
FT                   /locus_tag="BpOF4_08940"
FT                   /product="Petrobactin-like siderophore synthesis"
FT                   /note="COG0236 Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08940"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49844"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT4"
FT                   /protein_id="ADC49844.1"
FT   gene            201731..202756
FT                   /gene="asbE"
FT                   /locus_tag="BpOF4_08945"
FT   CDS_pept        201731..202756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asbE"
FT                   /locus_tag="BpOF4_08945"
FT                   /product="Petrobactin-like siderophore synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08945"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49845"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT5"
FT                   /protein_id="ADC49845.1"
FT                   S"
FT   gene            202776..203603
FT                   /gene="asbF"
FT                   /locus_tag="BpOF4_08950"
FT   CDS_pept        202776..203603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asbF"
FT                   /locus_tag="BpOF4_08950"
FT                   /product="Petrobactin-like siderophore synthesis"
FT                   /note="COG1082 Sugar phosphate isomerases/epimerases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08950"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49846"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT6"
FT                   /protein_id="ADC49846.1"
FT   gene            complement(203654..204850)
FT                   /locus_tag="BpOF4_08955"
FT   CDS_pept        complement(203654..204850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08955"
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /note="COG1473 Metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08955"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49847"
FT                   /db_xref="GOA:D3FRT7"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT7"
FT                   /protein_id="ADC49847.1"
FT   gene            204999..205178
FT                   /locus_tag="BpOF4_08960"
FT   CDS_pept        204999..205178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08960"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49848"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT8"
FT                   /protein_id="ADC49848.1"
FT                   LQKRKAPIEEAKLG"
FT   gene            complement(205220..205852)
FT                   /locus_tag="BpOF4_08965"
FT   CDS_pept        complement(205220..205852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08965"
FT                   /product="CBS domain protein"
FT                   /note="COG0517 FOG: CBS domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08965"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49849"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRT9"
FT                   /protein_id="ADC49849.1"
FT   gene            205959..207344
FT                   /locus_tag="BpOF4_08970"
FT   CDS_pept        205959..207344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08970"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="COG1953 Cytosine/uracil/thiamine/allantoin
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08970"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49850"
FT                   /db_xref="GOA:D3FRU0"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU0"
FT                   /protein_id="ADC49850.1"
FT                   RVS"
FT   gene            207421..208122
FT                   /locus_tag="BpOF4_08975"
FT   CDS_pept        207421..208122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08975"
FT                   /product="hypothetical protein"
FT                   /note="COG2761 Predicted dithiol-disulfide isomerase
FT                   involved in polyketide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08975"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49851"
FT                   /db_xref="GOA:D3FRU1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU1"
FT                   /protein_id="ADC49851.1"
FT                   DNDCSDGSCNV"
FT   gene            208258..209145
FT                   /gene="yckB"
FT                   /locus_tag="BpOF4_08980"
FT   CDS_pept        208258..209145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckB"
FT                   /locus_tag="BpOF4_08980"
FT                   /product="putative ABC transporter (binding lipoprotein)"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08980"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49852"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU2"
FT                   /protein_id="ADC49852.1"
FT                   EPVDEAEVVGLDGE"
FT   gene            209218..209919
FT                   /gene="yckA"
FT                   /locus_tag="BpOF4_08985"
FT   CDS_pept        209218..209919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckA"
FT                   /locus_tag="BpOF4_08985"
FT                   /product="amino acid ABC transporter permease"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08985"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49853"
FT                   /db_xref="GOA:D3FRU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU3"
FT                   /protein_id="ADC49853.1"
FT                   EKRYNRYLSKR"
FT   gene            209933..210673
FT                   /gene="yckI"
FT                   /locus_tag="BpOF4_08990"
FT   CDS_pept        209933..210673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yckI"
FT                   /locus_tag="BpOF4_08990"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08990"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49854"
FT                   /db_xref="GOA:D3FRU4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU4"
FT                   /protein_id="ADC49854.1"
FT   gene            210998..212011
FT                   /locus_tag="BpOF4_08995"
FT   CDS_pept        210998..212011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_08995"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1135 ABC-type metal ion transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_08995"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49855"
FT                   /db_xref="GOA:D3FRU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU5"
FT                   /protein_id="ADC49855.1"
FT   gene            212001..212666
FT                   /locus_tag="BpOF4_09000"
FT   CDS_pept        212001..212666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09000"
FT                   /product="ABC transporter (permease)"
FT                   /note="COG2011 ABC-type metal ion transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09000"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49856"
FT                   /db_xref="GOA:D3FRU6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU6"
FT                   /protein_id="ADC49856.1"
FT   gene            212694..213524
FT                   /locus_tag="BpOF4_09005"
FT   CDS_pept        212694..213524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09005"
FT                   /product="putative ABC solute binding periplasmic
FT                   lipoprotein"
FT                   /note="COG1464 ABC-type metal ion transport system,
FT                   periplasmic component/surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49857"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU7"
FT                   /protein_id="ADC49857.1"
FT   gene            complement(213784..215388)
FT                   /locus_tag="BpOF4_09010"
FT   CDS_pept        complement(213784..215388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09010"
FT                   /product="oligopeptide ABC transporter
FT                   (oligopeptide-binding protein)"
FT                   /note="COG0747 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49858"
FT                   /db_xref="GOA:D3FRU8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU8"
FT                   /protein_id="ADC49858.1"
FT                   WQFPSTTLFLRDVELNR"
FT   gene            215946..216836
FT                   /locus_tag="BpOF4_09015"
FT   CDS_pept        215946..216836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09015"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="COG0388 Predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09015"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49859"
FT                   /db_xref="GOA:D3FRU9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRU9"
FT                   /protein_id="ADC49859.1"
FT                   DRRPETYDDMTALLP"
FT   gene            216927..218300
FT                   /locus_tag="BpOF4_09020"
FT   CDS_pept        216927..218300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09020"
FT                   /product="putative thioredoxin oxidoreductase (TDOR)"
FT                   /note="COG0493 NADPH-dependent glutamate synthase beta
FT                   chain and related oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09020"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49860"
FT                   /db_xref="GOA:D3FRV0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV0"
FT                   /protein_id="ADC49860.1"
FT   gene            218325..219611
FT                   /locus_tag="BpOF4_09025"
FT   CDS_pept        218325..219611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09025"
FT                   /product="dihydropyrimidine dehydrogenase"
FT                   /note="COG0167 Dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49861"
FT                   /db_xref="GOA:D3FRV1"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV1"
FT                   /protein_id="ADC49861.1"
FT   gene            219690..221108
FT                   /locus_tag="BpOF4_09030"
FT   CDS_pept        219690..221108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09030"
FT                   /product="phenylhydantoinase"
FT                   /note="COG0044 Dihydroorotase and related cyclic
FT                   amidohydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09030"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49862"
FT                   /db_xref="GOA:D3FRV2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV2"
FT                   /protein_id="ADC49862.1"
FT                   GQTLTANADEVISK"
FT   gene            221304..222773
FT                   /locus_tag="BpOF4_09035"
FT   CDS_pept        221304..222773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09035"
FT                   /product="NCS1 nucleoside transporter"
FT                   /note="COG1953 Cytosine/uracil/thiamine/allantoin
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49863"
FT                   /db_xref="GOA:D3FRV3"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV3"
FT                   /protein_id="ADC49863.1"
FT   gene            222788..223024
FT                   /locus_tag="BpOF4_09040"
FT   CDS_pept        222788..223024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09040"
FT                   /product="hypothetical protein"
FT                   /note="COG0539 Ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49864"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV4"
FT                   /protein_id="ADC49864.1"
FT   gene            223208..224815
FT                   /locus_tag="BpOF4_09045"
FT   CDS_pept        223208..224815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09045"
FT                   /product="transcriptional regulator, PucR family protein"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49865"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV5"
FT                   /protein_id="ADC49865.1"
FT                   LLAKDYLNVEEQLQKRTV"
FT   gene            224995..226458
FT                   /gene="iolA"
FT                   /locus_tag="BpOF4_09050"
FT   CDS_pept        224995..226458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iolA"
FT                   /locus_tag="BpOF4_09050"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49866"
FT                   /db_xref="GOA:D3FRV6"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR023510"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV6"
FT                   /protein_id="ADC49866.1"
FT   gene            226491..227846
FT                   /locus_tag="BpOF4_09055"
FT   CDS_pept        226491..227846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09055"
FT                   /product="aminotransferase"
FT                   /note="COG0161 Adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49867"
FT                   /db_xref="GOA:D3FRV7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV7"
FT                   /protein_id="ADC49867.1"
FT   gene            227995..229698
FT                   /gene="spoIIJ"
FT                   /locus_tag="BpOF4_09060"
FT   CDS_pept        227995..229698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIJ"
FT                   /locus_tag="BpOF4_09060"
FT                   /product="sporulation kinase"
FT                   /note="COG2202 FOG: PAS/PAC domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49868"
FT                   /db_xref="GOA:D3FRV8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV8"
FT                   /protein_id="ADC49868.1"
FT   gene            229740..230084
FT                   /gene="kinA"
FT                   /locus_tag="BpOF4_09065"
FT   CDS_pept        229740..230084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kinA"
FT                   /locus_tag="BpOF4_09065"
FT                   /product="sporulation kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09065"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49869"
FT                   /db_xref="GOA:D3FRV9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRV9"
FT                   /protein_id="ADC49869.1"
FT                   LIDIILPRYN"
FT   gene            230333..231457
FT                   /gene="subE"
FT                   /locus_tag="BpOF4_09070"
FT   CDS_pept        230333..231457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="subE"
FT                   /locus_tag="BpOF4_09070"
FT                   /product="extracellular alkaline serine protease subtilisin
FT                   E pre-cursor"
FT                   /note="COG1404 Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09070"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49870"
FT                   /db_xref="GOA:D3FRW0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW0"
FT                   /protein_id="ADC49870.1"
FT   gene            231658..231843
FT                   /locus_tag="BpOF4_09075"
FT   CDS_pept        231658..231843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09075"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49871"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW1"
FT                   /protein_id="ADC49871.1"
FT                   PHAGDLPHAGDLPHAG"
FT   gene            complement(231881..232753)
FT                   /locus_tag="BpOF4_09080"
FT   CDS_pept        complement(231881..232753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09080"
FT                   /product="hypothetical protein"
FT                   /note="COG1396 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49872"
FT                   /db_xref="GOA:D3FRW2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW2"
FT                   /protein_id="ADC49872.1"
FT                   EKQKKEAIG"
FT   gene            233053..233643
FT                   /locus_tag="BpOF4_09085"
FT   CDS_pept        233053..233643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09085"
FT                   /product="TetR family transcriptional regulator"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49873"
FT                   /db_xref="GOA:D3FRW3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW3"
FT                   /protein_id="ADC49873.1"
FT   gene            complement(233747..234055)
FT                   /locus_tag="BpOF4_09090"
FT   CDS_pept        complement(233747..234055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09090"
FT                   /product="hypothetical protein"
FT                   /note="COG1733 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09090"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49874"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW4"
FT                   /protein_id="ADC49874.1"
FT   gene            234219..234839
FT                   /gene="wrbA"
FT                   /locus_tag="BpOF4_09095"
FT   CDS_pept        234219..234839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="BpOF4_09095"
FT                   /product="flavoprotein WrbA"
FT                   /note="COG0655 Multimeric flavodoxin WrbA"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09095"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49875"
FT                   /db_xref="GOA:D3FRW5"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW5"
FT                   /protein_id="ADC49875.1"
FT   gene            234982..235398
FT                   /gene="uspA"
FT                   /locus_tag="BpOF4_09100"
FT   CDS_pept        234982..235398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uspA"
FT                   /locus_tag="BpOF4_09100"
FT                   /product="universal stress protein family"
FT                   /note="COG0589 Universal stress protein UspA and related
FT                   nucleotide-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09100"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49876"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW6"
FT                   /protein_id="ADC49876.1"
FT   gene            235555..235695
FT                   /locus_tag="BpOF4_09105"
FT   CDS_pept        235555..235695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09105"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49877"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW7"
FT                   /protein_id="ADC49877.1"
FT                   I"
FT   gene            235840..235938
FT                   /locus_tag="BpOF4_09110"
FT   CDS_pept        235840..235938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09110"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49878"
FT                   /db_xref="GOA:D3FRW8"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW8"
FT                   /protein_id="ADC49878.1"
FT                   /translation="MKLSNKALFIIIASVTALYGILYWVIGHFLTT"
FT   gene            complement(236065..237438)
FT                   /gene="mgtE2"
FT                   /locus_tag="BpOF4_09115"
FT   CDS_pept        complement(236065..237438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE2"
FT                   /locus_tag="BpOF4_09115"
FT                   /product="magnesium (Mg2+) transporter"
FT                   /note="COG2239 Mg/Co/Ni transporter MgtE (contains CBS
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49879"
FT                   /db_xref="GOA:D3FRW9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRW9"
FT                   /protein_id="ADC49879.1"
FT   gene            237694..238752
FT                   /gene="fetA"
FT                   /locus_tag="BpOF4_09120"
FT   CDS_pept        237694..238752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetA"
FT                   /locus_tag="BpOF4_09120"
FT                   /product="ABC iron (III) transport system ATP-binding
FT                   protein"
FT                   /note="COG3842 ABC-type spermidine/putrescine transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09120"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49880"
FT                   /db_xref="GOA:D3FRX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX0"
FT                   /protein_id="ADC49880.1"
FT                   DIKPELVALVEA"
FT   gene            238946..240043
FT                   /gene="fetB"
FT                   /locus_tag="BpOF4_09125"
FT   CDS_pept        238946..240043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetB"
FT                   /locus_tag="BpOF4_09125"
FT                   /product="ABC iron (III) transport system (iron
FT                   (III)-binding protein)"
FT                   /note="COG1840 ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49881"
FT                   /db_xref="GOA:D3FRX1"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX1"
FT                   /protein_id="ADC49881.1"
FT   gene            240082..241761
FT                   /gene="fetC"
FT                   /locus_tag="BpOF4_09130"
FT   CDS_pept        240082..241761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fetC"
FT                   /locus_tag="BpOF4_09130"
FT                   /product="ABC iron (III) transport system (permease)"
FT                   /note="COG1178 ABC-type Fe3+ transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09130"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49882"
FT                   /db_xref="GOA:D3FRX2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX2"
FT                   /protein_id="ADC49882.1"
FT   gene            241895..242212
FT                   /locus_tag="BpOF4_09135"
FT   CDS_pept        241895..242212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09135"
FT                   /product="hypothetical protein"
FT                   /note="COG4378 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09135"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49883"
FT                   /db_xref="InterPro:IPR016772"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX3"
FT                   /protein_id="ADC49883.1"
FT                   K"
FT   gene            242236..242799
FT                   /locus_tag="BpOF4_09140"
FT   CDS_pept        242236..242799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09140"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49884"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX4"
FT                   /protein_id="ADC49884.1"
FT   gene            243093..243989
FT                   /locus_tag="BpOF4_09145"
FT   CDS_pept        243093..243989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09145"
FT                   /product="periplasmic binding protein, metal (putatively
FT                   Mn2+) uptake ABC"
FT                   /note="COG0803 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49885"
FT                   /db_xref="GOA:D3FRX5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX5"
FT                   /protein_id="ADC49885.1"
FT                   VDMMKHNVNTFLEGLKK"
FT   gene            complement(244036..244776)
FT                   /locus_tag="BpOF4_09150"
FT   CDS_pept        complement(244036..244776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09150"
FT                   /product="hypothetical protein"
FT                   /note="COG0705 Uncharacterized membrane protein (homolog of
FT                   Drosophila rhomboid)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49886"
FT                   /db_xref="GOA:D3FRX6"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX6"
FT                   /protein_id="ADC49886.1"
FT   gene            244878..245237
FT                   /gene="acpS"
FT                   /locus_tag="BpOF4_09155"
FT   CDS_pept        244878..245237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BpOF4_09155"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="COG0736 Phosphopantetheinyl transferase (holo-ACP
FT                   synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49887"
FT                   /db_xref="GOA:D3FRX7"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX7"
FT                   /protein_id="ADC49887.1"
FT                   EKNAVAQVILERLSS"
FT   gene            245476..246486
FT                   /locus_tag="BpOF4_09160"
FT   CDS_pept        245476..246486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09160"
FT                   /product="putative lipoprotein"
FT                   /note="COG2834 Outer membrane lipoprotein-sorting protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49888"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX8"
FT                   /protein_id="ADC49888.1"
FT   gene            246694..246972
FT                   /gene="mazE"
FT                   /locus_tag="BpOF4_09165"
FT   CDS_pept        246694..246972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazE"
FT                   /locus_tag="BpOF4_09165"
FT                   /product="MazE-like protein of toxin/antitoxin system"
FT                   /note="COG0864 Predicted transcriptional regulators
FT                   containing the CopG/Arc/MetJ DNA-binding domain and a
FT                   metal-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09165"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49889"
FT                   /db_xref="GOA:D3FRX9"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRX9"
FT                   /protein_id="ADC49889.1"
FT   gene            246976..247326
FT                   /gene="mazF"
FT                   /locus_tag="BpOF4_09170"
FT   CDS_pept        246976..247326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mazF"
FT                   /locus_tag="BpOF4_09170"
FT                   /product="MazF-like protein of toxin/antitoxin system"
FT                   /note="COG2337 Growth inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09170"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49890"
FT                   /db_xref="GOA:D3FRY0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY0"
FT                   /protein_id="ADC49890.1"
FT                   DALFISLGLIDF"
FT   gene            247571..248389
FT                   /gene="rsbR"
FT                   /locus_tag="BpOF4_09175"
FT   CDS_pept        247571..248389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbR"
FT                   /locus_tag="BpOF4_09175"
FT                   /product="positive regulator of sigma-B activity"
FT                   /note="COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49891"
FT                   /db_xref="GOA:D3FRY1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY1"
FT                   /protein_id="ADC49891.1"
FT   gene            248406..248762
FT                   /gene="rsbS"
FT                   /locus_tag="BpOF4_09180"
FT   CDS_pept        248406..248762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbS"
FT                   /locus_tag="BpOF4_09180"
FT                   /product="negative regulator of sigma-B activity
FT                   (antagonist of RsbT)"
FT                   /note="COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09180"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49892"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY2"
FT                   /protein_id="ADC49892.1"
FT                   LEQGLDKLQQELEG"
FT   gene            248765..249178
FT                   /gene="rsbT"
FT                   /locus_tag="BpOF4_09185"
FT   CDS_pept        248765..249178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbT"
FT                   /locus_tag="BpOF4_09185"
FT                   /product="positive regulator of sigma-B activity"
FT                   /note="COG2172 Anti-sigma regulatory factor (Ser/Thr
FT                   protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49893"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY3"
FT                   /protein_id="ADC49893.1"
FT   gene            249191..250204
FT                   /gene="rsbU"
FT                   /locus_tag="BpOF4_09190"
FT   CDS_pept        249191..250204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="BpOF4_09190"
FT                   /product="indirect positive regulator of sigma-B activity
FT                   (serine phosphatase)"
FT                   /note="COG2208 Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09190"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49894"
FT                   /db_xref="GOA:D3FRY4"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY4"
FT                   /protein_id="ADC49894.1"
FT   gene            250266..250598
FT                   /gene="rsbV"
FT                   /locus_tag="BpOF4_09195"
FT   CDS_pept        250266..250598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /locus_tag="BpOF4_09195"
FT                   /product="positive regulator of sigma-B activity"
FT                   /note="COG1366 Anti-anti-sigma regulatory factor
FT                   (antagonist of anti-sigma factor)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09195"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49895"
FT                   /db_xref="GOA:D3FRY5"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY5"
FT                   /protein_id="ADC49895.1"
FT                   KGEEAK"
FT   gene            250595..251083
FT                   /gene="rsbW"
FT                   /locus_tag="BpOF4_09200"
FT   CDS_pept        250595..251083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /locus_tag="BpOF4_09200"
FT                   /product="serine-protein kinase RsbW"
FT                   /note="COG2172 Anti-sigma regulatory factor (Ser/Thr
FT                   protein kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09200"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49896"
FT                   /db_xref="GOA:D3FRY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY6"
FT                   /protein_id="ADC49896.1"
FT   gene            251043..251828
FT                   /gene="sigB"
FT                   /locus_tag="BpOF4_09205"
FT   CDS_pept        251043..251828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /locus_tag="BpOF4_09205"
FT                   /product="RNA polymerase sigma factor SigB"
FT                   /note="COG1191 DNA-directed RNA polymerase specialized
FT                   sigma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09205"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49897"
FT                   /db_xref="GOA:D3FRY7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY7"
FT                   /protein_id="ADC49897.1"
FT   gene            251830..252429
FT                   /gene="rsbX"
FT                   /locus_tag="BpOF4_09210"
FT   CDS_pept        251830..252429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbX"
FT                   /locus_tag="BpOF4_09210"
FT                   /product="indirect negative regulator of sigma-B activity"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09210"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49898"
FT                   /db_xref="GOA:D3FRY8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY8"
FT                   /protein_id="ADC49898.1"
FT   gene            252572..254752
FT                   /locus_tag="BpOF4_09215"
FT   CDS_pept        252572..254752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09215"
FT                   /product="Tex transcription access, protein (S1 RNA
FT                   binding)"
FT                   /note="COG2183 Transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09215"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49899"
FT                   /db_xref="GOA:D3FRY9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRY9"
FT                   /protein_id="ADC49899.1"
FT   gene            complement(254792..254920)
FT                   /locus_tag="BpOF4_09220"
FT   CDS_pept        complement(254792..254920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09220"
FT                   /product="hypothetical protein BpOF4"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09220"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49900"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRZ0"
FT                   /protein_id="ADC49900.1"
FT   gene            255014..255466
FT                   /locus_tag="BpOF4_09225"
FT   CDS_pept        255014..255466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09225"
FT                   /product="hypothetical protein"
FT                   /note="COG3091 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09225"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49901"
FT                   /db_xref="GOA:D3FRZ1"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/TrEMBL:D3FRZ1"
FT                   /protein_id="ADC49901.1"
FT   gene            255619..255693
FT                   /locus_tag="BpOF4_t19847"
FT   tRNA            255619..255693
FT                   /locus_tag="BpOF4_t19847"
FT                   /product="tRNA-Asn"
FT   gene            255695..255785
FT                   /locus_tag="BpOF4_t19849"
FT   tRNA            255695..255785
FT                   /locus_tag="BpOF4_t19849"
FT                   /product="tRNA-Ser"
FT   gene            255805..255879
FT                   /locus_tag="BpOF4_t19851"
FT   tRNA            255805..255879
FT                   /locus_tag="BpOF4_t19851"
FT                   /product="tRNA-Glu"
FT   gene            255886..255961
FT                   /locus_tag="BpOF4_t19853"
FT   tRNA            255886..255961
FT                   /locus_tag="BpOF4_t19853"
FT                   /product="tRNA-Val"
FT   gene            255965..256041
FT                   /locus_tag="BpOF4_t19855"
FT   tRNA            255965..256041
FT                   /locus_tag="BpOF4_t19855"
FT                   /product="tRNA-Asp"
FT   gene            256064..256145
FT                   /locus_tag="BpOF4_t19857"
FT   tRNA            256064..256145
FT                   /locus_tag="BpOF4_t19857"
FT                   /product="tRNA-Leu"
FT   gene            256192..256278
FT                   /locus_tag="BpOF4_t19859"
FT   tRNA            256192..256278
FT                   /locus_tag="BpOF4_t19859"
FT                   /product="tRNA-Leu"
FT   gene            256283..256359
FT                   /locus_tag="BpOF4_t19861"
FT   tRNA            256283..256359
FT                   /locus_tag="BpOF4_t19861"
FT                   /product="tRNA-Arg"
FT   gene            256376..256452
FT                   /locus_tag="BpOF4_t19863"
FT   tRNA            256376..256452
FT                   /locus_tag="BpOF4_t19863"
FT                   /product="tRNA-Pro"
FT   misc_feature    256392..256622
FT                   /note="potential protein location (hypothetical protein
FT                   BpOF4_09230 [Bacillus pseudofirmus OF4]) that overlaps RNA
FT                   (tRNA-G); potential protein location (hypothetical protein
FT                   BpOF4_09230 [Bacillus pseudofirmus OF4]) that overlaps RNA
FT                   (tRNA-I); potential protein location (hypothetical protein
FT                   BpOF4_09230 [Bacillus pseudofirmus OF4]) that overlaps RNA
FT                   (tRNA-P)"
FT   gene            256471..256544
FT                   /locus_tag="BpOF4_t19865"
FT   tRNA            256471..256544
FT                   /locus_tag="BpOF4_t19865"
FT                   /product="tRNA-Gly"
FT   gene            256587..256663
FT                   /locus_tag="BpOF4_t19867"
FT   tRNA            256587..256663
FT                   /locus_tag="BpOF4_t19867"
FT                   /product="tRNA-Ile"
FT   gene            256853..258413
FT                   /locus_tag="BpOF4_r19941"
FT   rRNA            256853..258413
FT                   /locus_tag="BpOF4_r19941"
FT                   /product="16S ribosomal RNA"
FT   gene            258642..258718
FT                   /locus_tag="BpOF4_t19869"
FT   tRNA            258642..258718
FT                   /locus_tag="BpOF4_t19869"
FT                   /product="tRNA-Ile"
FT   gene            258735..258810
FT                   /locus_tag="BpOF4_t19871"
FT   tRNA            258735..258810
FT                   /locus_tag="BpOF4_t19871"
FT                   /product="tRNA-Ala"
FT   gene            259044..261984
FT                   /locus_tag="BpOF4_r19955"
FT   rRNA            259044..261984
FT                   /locus_tag="BpOF4_r19955"
FT                   /product="23S ribosomal RNA"
FT   gene            262173..262288
FT                   /locus_tag="BpOF4_r19925"
FT   rRNA            262173..262288
FT                   /locus_tag="BpOF4_r19925"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(262668..262850)
FT                   /locus_tag="BpOF4_09235"
FT   CDS_pept        complement(262668..262850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09235"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49902"
FT                   /db_xref="GOA:D3FSD4"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSD4"
FT                   /protein_id="ADC49902.1"
FT                   AVYKSICVIGMRYYI"
FT   repeat_region   262691..262848
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_4F"
FT   gene            263020..264174
FT                   /gene="metC"
FT                   /locus_tag="BpOF4_09240"
FT   CDS_pept        263020..264174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="BpOF4_09240"
FT                   /product="cystathionine gamma-synthase"
FT                   /note="COG0626 Cystathionine beta-lyases/cystathionine
FT                   gamma-synthases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09240"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49903"
FT                   /db_xref="GOA:D3FSD5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSD5"
FT                   /protein_id="ADC49903.1"
FT   gene            264280..264395
FT                   /locus_tag="BpOF4_r19927"
FT   rRNA            264280..264395
FT                   /locus_tag="BpOF4_r19927"
FT                   /product="5S ribosomal RNA"
FT   gene            264450..264523
FT                   /locus_tag="BpOF4_t19873"
FT   tRNA            264450..264523
FT                   /locus_tag="BpOF4_t19873"
FT                   /product="tRNA-Met"
FT   gene            264691..265677
FT                   /gene="thiL"
FT                   /locus_tag="BpOF4_09245"
FT   CDS_pept        264691..265677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="BpOF4_09245"
FT                   /product="thiamine monophosphate kinase"
FT                   /note="COG0611 Thiamine monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09245"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49904"
FT                   /db_xref="GOA:D3FSD6"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSD6"
FT                   /protein_id="ADC49904.1"
FT   gene            265687..266154
FT                   /locus_tag="BpOF4_09250"
FT   CDS_pept        265687..266154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09250"
FT                   /product="ATP/GTP hydrolase"
FT                   /note="COG0802 Predicted ATPase or kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09250"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49905"
FT                   /db_xref="GOA:D3FSD7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSD7"
FT                   /protein_id="ADC49905.1"
FT   gene            266139..266858
FT                   /locus_tag="BpOF4_09255"
FT   CDS_pept        266139..266858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09255"
FT                   /product="hypothetical protein"
FT                   /note="COG1214 Inactive homolog of metal-dependent
FT                   proteases, putative molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09255"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49906"
FT                   /db_xref="GOA:D3FSD8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSD8"
FT                   /protein_id="ADC49906.1"
FT                   EAKWQSEQQKKACESND"
FT   gene            266851..267315
FT                   /gene="rimI"
FT                   /locus_tag="BpOF4_09260"
FT   CDS_pept        266851..267315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="BpOF4_09260"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="COG0456 Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09260"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49907"
FT                   /db_xref="GOA:D3FSD9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSD9"
FT                   /protein_id="ADC49907.1"
FT   gene            267305..268321
FT                   /gene="qcp"
FT                   /locus_tag="BpOF4_09265"
FT   CDS_pept        267305..268321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qcp"
FT                   /locus_tag="BpOF4_09265"
FT                   /product="putative DNA-binding/iron metalloprotein/AP
FT                   endonuclease"
FT                   /note="COG0533 Metal-dependent proteases with possible
FT                   chaperone activity"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09265"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49908"
FT                   /db_xref="GOA:D3FSE0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE0"
FT                   /protein_id="ADC49908.1"
FT   gene            268533..270752
FT                   /locus_tag="BpOF4_09270"
FT   CDS_pept        268533..270752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09270"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49909"
FT                   /db_xref="GOA:D3FSE1"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE1"
FT                   /protein_id="ADC49909.1"
FT   gene            270755..271159
FT                   /locus_tag="BpOF4_09275"
FT   CDS_pept        270755..271159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09275"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49910"
FT                   /db_xref="GOA:D3FSE2"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE2"
FT                   /protein_id="ADC49910.1"
FT   repeat_region   complement(271336..271463)
FT                   /rpt_family="bpr2"
FT                   /note="P_bpr2_1R (partial)"
FT   gene            complement(271492..273435)
FT                   /locus_tag="BpOF4_09280"
FT   CDS_pept        complement(271492..273435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09280"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09280"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49911"
FT                   /db_xref="GOA:D3FSE3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE3"
FT                   /protein_id="ADC49911.1"
FT                   EQLMEEWEELQS"
FT   gene            273681..274316
FT                   /gene="rexA"
FT                   /locus_tag="BpOF4_09285"
FT   CDS_pept        273681..274316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rexA"
FT                   /locus_tag="BpOF4_09285"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /note="COG2344 AT-rich DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09285"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49912"
FT                   /db_xref="GOA:D3FSE4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE4"
FT                   /protein_id="ADC49912.1"
FT   gene            274348..274533
FT                   /gene="tatA"
FT                   /locus_tag="BpOF4_09290"
FT   CDS_pept        274348..274533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="BpOF4_09290"
FT                   /product="TatA secretion protein"
FT                   /note="COG1826 Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09290"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49913"
FT                   /db_xref="GOA:D3FSE5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE5"
FT                   /protein_id="ADC49913.1"
FT                   LADEEDDKKKNNKDQA"
FT   gene            274551..275321
FT                   /gene="tatC"
FT                   /locus_tag="BpOF4_09295"
FT   CDS_pept        274551..275321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="BpOF4_09295"
FT                   /product="TatC secretion protein"
FT                   /note="COG0805 Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09295"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49914"
FT                   /db_xref="GOA:D3FSE6"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE6"
FT                   /protein_id="ADC49914.1"
FT   gene            275466..275633
FT                   /locus_tag="BpOF4_09300"
FT   CDS_pept        275466..275633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09300"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49915"
FT                   /db_xref="InterPro:IPR025072"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE7"
FT                   /protein_id="ADC49915.1"
FT                   SLKQRQNQHI"
FT   gene            275777..277162
FT                   /gene="emrB"
FT                   /locus_tag="BpOF4_09305"
FT   CDS_pept        275777..277162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="emrB"
FT                   /locus_tag="BpOF4_09305"
FT                   /product="ErmB/QacA family multidrug efflux protein"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09305"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49916"
FT                   /db_xref="GOA:D3FSE8"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE8"
FT                   /protein_id="ADC49916.1"
FT                   KAS"
FT   gene            277385..278716
FT                   /gene="cbdA"
FT                   /locus_tag="BpOF4_09310"
FT   CDS_pept        277385..278716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbdA"
FT                   /locus_tag="BpOF4_09310"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="COG1271 Cytochrome bd-type quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09310"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49917"
FT                   /db_xref="GOA:D3FSE9"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSE9"
FT                   /protein_id="ADC49917.1"
FT   gene            278731..279744
FT                   /gene="cbdB"
FT                   /locus_tag="BpOF4_09315"
FT   CDS_pept        278731..279744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbdB"
FT                   /locus_tag="BpOF4_09315"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /note="COG1294 Cytochrome bd-type quinol oxidase, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09315"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49918"
FT                   /db_xref="GOA:D3FSF0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF0"
FT                   /protein_id="ADC49918.1"
FT   gene            279756..279860
FT                   /locus_tag="BpOF4_09320"
FT   CDS_pept        279756..279860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09320"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49919"
FT                   /db_xref="GOA:D3FSF1"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF1"
FT                   /protein_id="ADC49919.1"
FT   gene            280072..280584
FT                   /locus_tag="BpOF4_09325"
FT   CDS_pept        280072..280584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09325"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49920"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF2"
FT                   /protein_id="ADC49920.1"
FT                   EVDIYGL"
FT   gene            280682..281788
FT                   /gene="sdaR"
FT                   /locus_tag="BpOF4_09330"
FT   CDS_pept        280682..281788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaR"
FT                   /locus_tag="BpOF4_09330"
FT                   /product="sugar diacid transcriptional regulator, CdaR"
FT                   /note="COG3835 Sugar diacid utilization regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49921"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF3"
FT                   /protein_id="ADC49921.1"
FT   gene            281917..283185
FT                   /locus_tag="BpOF4_09335"
FT   CDS_pept        281917..283185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09335"
FT                   /product="anion permease family protein"
FT                   /note="COG2610 H+/gluconate symporter and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49922"
FT                   /db_xref="GOA:D3FSF4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF4"
FT                   /protein_id="ADC49922.1"
FT   gene            283257..284396
FT                   /gene="glxK"
FT                   /locus_tag="BpOF4_09340"
FT   CDS_pept        283257..284396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxK"
FT                   /locus_tag="BpOF4_09340"
FT                   /product="glycerate kinase"
FT                   /note="COG1929 Glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09340"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49923"
FT                   /db_xref="GOA:D3FSF5"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF5"
FT                   /protein_id="ADC49923.1"
FT   gene            complement(284436..284654)
FT                   /locus_tag="BpOF4_09345"
FT   CDS_pept        complement(284436..284654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09345"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49924"
FT                   /db_xref="GOA:D3FSF6"
FT                   /db_xref="InterPro:IPR025426"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF6"
FT                   /protein_id="ADC49924.1"
FT   gene            complement(284651..285373)
FT                   /gene="abiA"
FT                   /locus_tag="BpOF4_09350"
FT   CDS_pept        complement(284651..285373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abiA"
FT                   /locus_tag="BpOF4_09350"
FT                   /product="CAAX amino terminus protein Abi"
FT                   /note="COG1266 Predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09350"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49925"
FT                   /db_xref="GOA:D3FSF7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF7"
FT                   /protein_id="ADC49925.1"
FT                   VERLEEVQQTSLIIGGLL"
FT   gene            285668..285952
FT                   /gene="groES"
FT                   /locus_tag="BpOF4_09355"
FT   CDS_pept        285668..285952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BpOF4_09355"
FT                   /product="co-chaperonin GroES"
FT                   /note="COG0234 Co-chaperonin GroES (HSP10)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09355"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49926"
FT                   /db_xref="GOA:D3FSF8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF8"
FT                   /protein_id="ADC49926.1"
FT   gene            286039..287679
FT                   /gene="groEL"
FT                   /locus_tag="BpOF4_09360"
FT   CDS_pept        286039..287679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BpOF4_09360"
FT                   /product="chaperonin GroEL"
FT                   /note="COG0459 Chaperonin GroEL (HSP60 family)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09360"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49927"
FT                   /db_xref="GOA:D3FSF9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSF9"
FT                   /protein_id="ADC49927.1"
FT   repeat_region   complement(287678..287828)
FT                   /note="bcr3_1R"
FT   gene            288109..290034
FT                   /locus_tag="BpOF4_09365"
FT   CDS_pept        288109..290034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09365"
FT                   /product="Multidomain redox protein (NAD(FAD)-dependent
FT                   oxidoreductase, Rhodanese domain, SirA-like redox domain,
FT                   Peroxiredoxin)"
FT                   /note="COG0446 Uncharacterized NAD(FAD)-dependent
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09365"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49928"
FT                   /db_xref="GOA:D3FSG0"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG0"
FT                   /protein_id="ADC49928.1"
FT                   FWIKKK"
FT   gene            complement(290165..291004)
FT                   /locus_tag="BpOF4_09370"
FT   CDS_pept        complement(290165..291004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09370"
FT                   /product="LysR family transcription regulator"
FT                   /note="COG0583 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09370"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49929"
FT                   /db_xref="GOA:D3FSG1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG1"
FT                   /protein_id="ADC49929.1"
FT   gene            291198..291983
FT                   /locus_tag="BpOF4_09375"
FT   CDS_pept        291198..291983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09375"
FT                   /product="putative permease"
FT                   /note="COG0730 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09375"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49930"
FT                   /db_xref="GOA:D3FSG2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG2"
FT                   /protein_id="ADC49930.1"
FT   gene            complement(292053..293762)
FT                   /gene="ureC"
FT                   /locus_tag="BpOF4_09380"
FT   CDS_pept        complement(292053..293762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="BpOF4_09380"
FT                   /product="urease subunit alpha"
FT                   /note="COG0804 Urea amidohydrolase (urease) alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09380"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49931"
FT                   /db_xref="GOA:D3FSG3"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG3"
FT                   /protein_id="ADC49931.1"
FT   gene            complement(293759..294136)
FT                   /gene="ureB"
FT                   /locus_tag="BpOF4_09385"
FT   CDS_pept        complement(293759..294136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="BpOF4_09385"
FT                   /product="urease (beta subunit)"
FT                   /note="COG0832 Urea amidohydrolase (urease) beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09385"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49932"
FT                   /db_xref="GOA:D3FSG4"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG4"
FT                   /protein_id="ADC49932.1"
FT   gene            complement(294133..294450)
FT                   /gene="ureA"
FT                   /locus_tag="BpOF4_09390"
FT   CDS_pept        complement(294133..294450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="BpOF4_09390"
FT                   /product="urease subunit gamma"
FT                   /note="COG0831 Urea amidohydrolase (urease) gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09390"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49933"
FT                   /db_xref="GOA:D3FSG5"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG5"
FT                   /protein_id="ADC49933.1"
FT                   S"
FT   gene            complement(294635..295954)
FT                   /gene="citM"
FT                   /locus_tag="BpOF4_09395"
FT   CDS_pept        complement(294635..295954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citM"
FT                   /locus_tag="BpOF4_09395"
FT                   /product="magnesium citrate secondary transporter"
FT                   /note="COG2851 H+/citrate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09395"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49934"
FT                   /db_xref="GOA:D3FSG6"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR014738"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG6"
FT                   /protein_id="ADC49934.1"
FT   gene            complement(296152..296865)
FT                   /gene="citT"
FT                   /locus_tag="BpOF4_09400"
FT   CDS_pept        complement(296152..296865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citT"
FT                   /locus_tag="BpOF4_09400"
FT                   /product="two-component response regulator"
FT                   /note="COG4565 Response regulator of citrate/malate
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09400"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49935"
FT                   /db_xref="GOA:D3FSG7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG7"
FT                   /protein_id="ADC49935.1"
FT                   YGDVGRPERLYISNK"
FT   gene            complement(296879..298534)
FT                   /gene="citS"
FT                   /locus_tag="BpOF4_09405"
FT   CDS_pept        complement(296879..298534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citS"
FT                   /locus_tag="BpOF4_09405"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="COG3290 Signal transduction histidine kinase
FT                   regulating citrate/malate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09405"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49936"
FT                   /db_xref="GOA:D3FSG8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG8"
FT                   /protein_id="ADC49936.1"
FT   gene            298692..299093
FT                   /locus_tag="BpOF4_09410"
FT   CDS_pept        298692..299093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09410"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49937"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSG9"
FT                   /protein_id="ADC49937.1"
FT   gene            299205..300611
FT                   /locus_tag="BpOF4_09415"
FT   CDS_pept        299205..300611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09415"
FT                   /product="sodium/glutamate symporter"
FT                   /note="COG0786 Na+/glutamate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09415"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49938"
FT                   /db_xref="GOA:D3FSH0"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH0"
FT                   /protein_id="ADC49938.1"
FT                   LYFGKKKSTQ"
FT   gene            300712..300891
FT                   /locus_tag="BpOF4_09420"
FT   CDS_pept        300712..300891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09420"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49939"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH1"
FT                   /protein_id="ADC49939.1"
FT                   INMENVERFEIEEH"
FT   gene            301112..302299
FT                   /locus_tag="BpOF4_09425"
FT   CDS_pept        301112..302299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09425"
FT                   /product="Zinc carboxypeptidase"
FT                   /note="COG2866 Predicted carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09425"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49940"
FT                   /db_xref="GOA:D3FSH2"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH2"
FT                   /protein_id="ADC49940.1"
FT   gene            302632..302925
FT                   /gene="yukE"
FT                   /locus_tag="BpOF4_09430"
FT   CDS_pept        302632..302925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yukE"
FT                   /locus_tag="BpOF4_09430"
FT                   /product="ESAT-6 WSG100 superfamily Bsub YukE"
FT                   /note="COG4842 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49941"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH3"
FT                   /protein_id="ADC49941.1"
FT   gene            303081..303296
FT                   /gene="yukD"
FT                   /locus_tag="BpOF4_09435"
FT   CDS_pept        303081..303296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yukD"
FT                   /locus_tag="BpOF4_09435"
FT                   /product="ESAT-6 YukD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09435"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49942"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH4"
FT                   /protein_id="ADC49942.1"
FT   gene            303371..304684
FT                   /gene="yukC"
FT                   /locus_tag="BpOF4_09440"
FT   CDS_pept        303371..304684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yukC"
FT                   /locus_tag="BpOF4_09440"
FT                   /product="ESAT-6 EssB superfamily Bsub YukC"
FT                   /note="COG4499 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09440"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49943"
FT                   /db_xref="GOA:D3FSH5"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="InterPro:IPR042565"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH5"
FT                   /protein_id="ADC49943.1"
FT   gene            304698..309137
FT                   /gene="yukA"
FT                   /locus_tag="BpOF4_09445"
FT   CDS_pept        304698..309137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yukA"
FT                   /locus_tag="BpOF4_09445"
FT                   /product="ESAT-6 ftsK-spoIIIE domain Bs YukA Sau EssC"
FT                   /note="COG1674 DNA segregation ATPase FtsK/SpoIIIE and
FT                   related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09445"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49944"
FT                   /db_xref="GOA:D3FSH6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR022206"
FT                   /db_xref="InterPro:IPR023839"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH6"
FT                   /protein_id="ADC49944.1"
FT                   FGYLIQDGTATRMQIPKC"
FT   gene            309159..312053
FT                   /gene="yueB"
FT                   /locus_tag="BpOF4_09450"
FT   CDS_pept        309159..312053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yueB"
FT                   /locus_tag="BpOF4_09450"
FT                   /product="ESAT-6 SPP1 phage receptor Bsub YueB"
FT                   /note="COG1511 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09450"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49945"
FT                   /db_xref="GOA:D3FSH7"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH7"
FT                   /protein_id="ADC49945.1"
FT   gene            312031..312519
FT                   /locus_tag="BpOF4_09455"
FT   CDS_pept        312031..312519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49946"
FT                   /db_xref="GOA:D3FSH8"
FT                   /db_xref="InterPro:IPR018920"
FT                   /db_xref="InterPro:IPR020212"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH8"
FT                   /protein_id="ADC49946.1"
FT   gene            312586..312930
FT                   /locus_tag="BpOF4_09460"
FT   CDS_pept        312586..312930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09460"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49947"
FT                   /db_xref="InterPro:IPR031681"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSH9"
FT                   /protein_id="ADC49947.1"
FT                   VAAKAAMVAR"
FT   gene            312943..313218
FT                   /locus_tag="BpOF4_09465"
FT   CDS_pept        312943..313218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09465"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49948"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI0"
FT                   /protein_id="ADC49948.1"
FT   gene            313233..314750
FT                   /locus_tag="BpOF4_09470"
FT   CDS_pept        313233..314750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09470"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09470"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49949"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI1"
FT                   /protein_id="ADC49949.1"
FT   gene            314743..314991
FT                   /locus_tag="BpOF4_09475"
FT   CDS_pept        314743..314991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09475"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49950"
FT                   /db_xref="GOA:D3FSI2"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI2"
FT                   /protein_id="ADC49950.1"
FT   gene            314988..315269
FT                   /locus_tag="BpOF4_09480"
FT   CDS_pept        314988..315269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09480"
FT                   /product="hypothetical protein"
FT                   /note="COG4495 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09480"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49951"
FT                   /db_xref="InterPro:IPR025233"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI3"
FT                   /protein_id="ADC49951.1"
FT   gene            315291..315758
FT                   /locus_tag="BpOF4_09485"
FT   CDS_pept        315291..315758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09485"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49952"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI4"
FT                   /protein_id="ADC49952.1"
FT   gene            315778..315975
FT                   /locus_tag="BpOF4_09490"
FT   CDS_pept        315778..315975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09490"
FT                   /product="hypothetical protein"
FT                   /note="COG1116 ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49953"
FT                   /db_xref="GOA:D3FSI5"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI5"
FT                   /protein_id="ADC49953.1"
FT   gene            316017..316292
FT                   /locus_tag="BpOF4_09495"
FT   CDS_pept        316017..316292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09495"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49954"
FT                   /db_xref="GOA:D3FSI6"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI6"
FT                   /protein_id="ADC49954.1"
FT   gene            316392..317054
FT                   /locus_tag="BpOF4_09500"
FT   CDS_pept        316392..317054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09500"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49955"
FT                   /db_xref="GOA:D3FSI7"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI7"
FT                   /protein_id="ADC49955.1"
FT   gene            complement(317166..317321)
FT                   /locus_tag="BpOF4_09505"
FT   CDS_pept        complement(317166..317321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09505"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49956"
FT                   /db_xref="GOA:D3FSI8"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI8"
FT                   /protein_id="ADC49956.1"
FT                   VFPMFQ"
FT   gene            317588..317731
FT                   /locus_tag="BpOF4_09510"
FT   CDS_pept        317588..317731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09510"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49957"
FT                   /db_xref="GOA:D3FSI9"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSI9"
FT                   /protein_id="ADC49957.1"
FT                   RA"
FT   gene            317832..318737
FT                   /gene="rhdA"
FT                   /locus_tag="BpOF4_09515"
FT   CDS_pept        317832..318737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhdA"
FT                   /locus_tag="BpOF4_09515"
FT                   /product="thiosulfate sulfurtransferase, rhodanese domain
FT                   protein"
FT                   /note="COG2897 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09515"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49958"
FT                   /db_xref="GOA:D3FSJ0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ0"
FT                   /protein_id="ADC49958.1"
FT   repeat_region   complement(318861..319022)
FT                   /note="P_bpr2_2R (partial)"
FT   gene            319153..319599
FT                   /locus_tag="BpOF4_09520"
FT   CDS_pept        319153..319599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09520"
FT                   /product="Transcriptional regulator, MarR family protein"
FT                   /note="COG1846 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09520"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49959"
FT                   /db_xref="GOA:D3FSJ1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ1"
FT                   /protein_id="ADC49959.1"
FT   gene            319641..320144
FT                   /gene="amhM"
FT                   /locus_tag="BpOF4_09525"
FT   CDS_pept        319641..320144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhM"
FT                   /locus_tag="BpOF4_09525"
FT                   /product="KTN accessory protein for AmhT"
FT                   /note="COG0490 Putative regulatory, ligand-binding protein
FT                   related to C-terminal domains of K+ channels"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09525"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49960"
FT                   /db_xref="GOA:D3FSJ2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR026278"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3FSJ2"
FT                   /protein_id="ADC49960.1"
FT                   KENN"
FT   gene            320147..321319
FT                   /gene="amhT"
FT                   /locus_tag="BpOF4_09530"
FT   CDS_pept        320147..321319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhT"
FT                   /locus_tag="BpOF4_09530"
FT                   /product="potassium/proton antiporter, putative
FT                   ammonium/proton antiporter"
FT                   /note="COG0475 Kef-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09530"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49961"
FT                   /db_xref="GOA:D3FSJ3"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3FSJ3"
FT                   /protein_id="ADC49961.1"
FT   gene            321351..322088
FT                   /locus_tag="BpOF4_09535"
FT   CDS_pept        321351..322088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09535"
FT                   /product="RelA/SpoT domain-containing protein"
FT                   /note="COG2357 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09535"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49962"
FT                   /db_xref="GOA:D3FSJ4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ4"
FT                   /protein_id="ADC49962.1"
FT   gene            322231..322884
FT                   /locus_tag="BpOF4_09540"
FT   CDS_pept        322231..322884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09540"
FT                   /product="putative phosphorylase"
FT                   /note="COG0775 Nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09540"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49963"
FT                   /db_xref="GOA:D3FSJ5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ5"
FT                   /protein_id="ADC49963.1"
FT   gene            322884..323717
FT                   /locus_tag="BpOF4_09545"
FT   CDS_pept        322884..323717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09545"
FT                   /product="hypothetical protein BpOF4"
FT                   /note="COG2107 Predicted periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09545"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49964"
FT                   /db_xref="GOA:D3FSJ6"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ6"
FT                   /protein_id="ADC49964.1"
FT   gene            323853..324797
FT                   /locus_tag="BpOF4_09550"
FT   CDS_pept        323853..324797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09550"
FT                   /product="inosine-uridine nucleoside hydrolase"
FT                   /note="COG1957 Inosine-uridine nucleoside N-ribohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09550"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49965"
FT                   /db_xref="GOA:D3FSJ7"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ7"
FT                   /protein_id="ADC49965.1"
FT   gene            324925..326634
FT                   /locus_tag="BpOF4_09555"
FT   CDS_pept        324925..326634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09555"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09555"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49966"
FT                   /db_xref="GOA:D3FSJ8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ8"
FT                   /protein_id="ADC49966.1"
FT   gene            326745..327545
FT                   /locus_tag="BpOF4_09560"
FT   CDS_pept        326745..327545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09560"
FT                   /product="putative SAM dependent methyltransferase"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09560"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49967"
FT                   /db_xref="GOA:D3FSJ9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSJ9"
FT                   /protein_id="ADC49967.1"
FT   gene            327538..328200
FT                   /gene="yisX"
FT                   /locus_tag="BpOF4_09565"
FT   CDS_pept        327538..328200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yisX"
FT                   /locus_tag="BpOF4_09565"
FT                   /product="putative quinolone resistance protein"
FT                   /note="COG1357 Uncharacterized low-complexity proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09565"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49968"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK0"
FT                   /protein_id="ADC49968.1"
FT   gene            complement(328217..328708)
FT                   /locus_tag="BpOF4_09570"
FT   CDS_pept        complement(328217..328708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09570"
FT                   /product="hypothetical protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09570"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49969"
FT                   /db_xref="GOA:D3FSK1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK1"
FT                   /protein_id="ADC49969.1"
FT                   "
FT   gene            328862..329101
FT                   /locus_tag="BpOF4_09575"
FT   CDS_pept        328862..329101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09575"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49970"
FT                   /db_xref="GOA:D3FSK2"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK2"
FT                   /protein_id="ADC49970.1"
FT   gene            329362..330321
FT                   /locus_tag="BpOF4_09580"
FT   CDS_pept        329362..330321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09580"
FT                   /product="methanol dehydrogenase regulatory protein"
FT                   /note="COG0714 MoxR-like ATPases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09580"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49971"
FT                   /db_xref="GOA:D3FSK3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK3"
FT                   /protein_id="ADC49971.1"
FT   gene            330318..331487
FT                   /locus_tag="BpOF4_09585"
FT   CDS_pept        330318..331487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09585"
FT                   /product="hypothetical protein"
FT                   /note="COG1721 Uncharacterized conserved protein (some
FT                   members contain a von Willebrand factor type A (vWA)
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09585"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49972"
FT                   /db_xref="GOA:D3FSK4"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK4"
FT                   /protein_id="ADC49972.1"
FT   gene            331484..333682
FT                   /gene="yebA"
FT                   /locus_tag="BpOF4_09590"
FT   CDS_pept        331484..333682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yebA"
FT                   /locus_tag="BpOF4_09590"
FT                   /product="membrane-bound protease, transglutaminase
FT                   superfamily"
FT                   /note="COG1305 Transglutaminase-like enzymes, putative
FT                   cysteine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09590"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49973"
FT                   /db_xref="GOA:D3FSK5"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK5"
FT                   /protein_id="ADC49973.1"
FT   gene            333929..335470
FT                   /gene="guaA"
FT                   /locus_tag="BpOF4_09595"
FT   CDS_pept        333929..335470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BpOF4_09595"
FT                   /product="GMP synthase"
FT                   /note="COG0518 GMP synthase - Glutamine amidotransferase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09595"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49974"
FT                   /db_xref="GOA:D3FSK6"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK6"
FT                   /protein_id="ADC49974.1"
FT   gene            335763..337064
FT                   /locus_tag="BpOF4_09600"
FT   CDS_pept        335763..337064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09600"
FT                   /product="hypothetical protein"
FT                   /note="COG2252 Permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09600"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49975"
FT                   /db_xref="GOA:D3FSK7"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK7"
FT                   /protein_id="ADC49975.1"
FT   gene            337666..339226
FT                   /locus_tag="BpOF4_r19943"
FT   rRNA            337666..339226
FT                   /locus_tag="BpOF4_r19943"
FT                   /product="16S ribosomal RNA"
FT   gene            339584..342524
FT                   /locus_tag="BpOF4_r19957"
FT   rRNA            339584..342524
FT                   /locus_tag="BpOF4_r19957"
FT                   /product="23S ribosomal RNA"
FT   gene            342585..342700
FT                   /locus_tag="BpOF4_r19929"
FT   rRNA            342585..342700
FT                   /locus_tag="BpOF4_r19929"
FT                   /product="5S ribosomal RNA"
FT   repeat_region   342760..342921
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_5F"
FT   gene            complement(343037..343363)
FT                   /locus_tag="BpOF4_09605"
FT   CDS_pept        complement(343037..343363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09605"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49976"
FT                   /db_xref="GOA:D3FSK8"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK8"
FT                   /protein_id="ADC49976.1"
FT                   GERS"
FT   gene            343625..343840
FT                   /locus_tag="BpOF4_09610"
FT   CDS_pept        343625..343840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09610"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49977"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSK9"
FT                   /protein_id="ADC49977.1"
FT   gene            343929..344945
FT                   /locus_tag="BpOF4_09615"
FT   CDS_pept        343929..344945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09615"
FT                   /product="putative threonine aldolase"
FT                   /note="COG2008 Threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09615"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49978"
FT                   /db_xref="GOA:D3FSL0"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR023603"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL0"
FT                   /protein_id="ADC49978.1"
FT   gene            344973..345617
FT                   /locus_tag="BpOF4_09620"
FT   CDS_pept        344973..345617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09620"
FT                   /product="hypothetical protein"
FT                   /note="COG2258 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09620"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49979"
FT                   /db_xref="GOA:D3FSL1"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL1"
FT                   /protein_id="ADC49979.1"
FT   gene            345726..346823
FT                   /gene="bcsA"
FT                   /locus_tag="BpOF4_09625"
FT   CDS_pept        345726..346823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcsA"
FT                   /locus_tag="BpOF4_09625"
FT                   /product="naringenin-chalcone synthase"
FT                   /note="COG3424 Predicted naringenin-chalcone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09625"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49980"
FT                   /db_xref="GOA:D3FSL2"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL2"
FT                   /protein_id="ADC49980.1"
FT   gene            346823..347383
FT                   /gene="ypbQ"
FT                   /locus_tag="BpOF4_09630"
FT   CDS_pept        346823..347383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ypbQ"
FT                   /locus_tag="BpOF4_09630"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="COG1755 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09630"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49981"
FT                   /db_xref="GOA:D3FSL3"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL3"
FT                   /protein_id="ADC49981.1"
FT   gene            347542..348066
FT                   /locus_tag="BpOF4_09635"
FT   CDS_pept        347542..348066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09635"
FT                   /product="hypothetical protein"
FT                   /note="COG4843 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09635"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49982"
FT                   /db_xref="GOA:D3FSL4"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="InterPro:IPR022930"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL4"
FT                   /protein_id="ADC49982.1"
FT                   FGGFWVKGIRR"
FT   gene            348090..348281
FT                   /locus_tag="BpOF4_09640"
FT   CDS_pept        348090..348281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09640"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49983"
FT                   /db_xref="InterPro:IPR025930"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL5"
FT                   /protein_id="ADC49983.1"
FT                   IPVRQKIVFEGKLVEGEQ"
FT   gene            348590..349075
FT                   /gene="purE"
FT                   /locus_tag="BpOF4_09645"
FT   CDS_pept        348590..349075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BpOF4_09645"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /note="COG0041 Phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09645"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49984"
FT                   /db_xref="GOA:D3FSL6"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL6"
FT                   /protein_id="ADC49984.1"
FT   gene            349072..350199
FT                   /gene="purK"
FT                   /locus_tag="BpOF4_09650"
FT   CDS_pept        349072..350199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BpOF4_09650"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /note="COG0026 Phosphoribosylaminoimidazole carboxylase
FT                   (NCAIR synthetase)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09650"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49985"
FT                   /db_xref="GOA:D3FSL7"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL7"
FT                   /protein_id="ADC49985.1"
FT   gene            350242..351543
FT                   /gene="purB"
FT                   /locus_tag="BpOF4_09655"
FT   CDS_pept        350242..351543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="BpOF4_09655"
FT                   /product="adenylosuccinate lyase"
FT                   /note="COG0015 Adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09655"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49986"
FT                   /db_xref="GOA:D3FSL8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL8"
FT                   /protein_id="ADC49986.1"
FT   gene            351617..352339
FT                   /gene="purC"
FT                   /locus_tag="BpOF4_09660"
FT   CDS_pept        351617..352339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BpOF4_09660"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="COG0152
FT                   Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09660"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49987"
FT                   /db_xref="GOA:D3FSL9"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSL9"
FT                   /protein_id="ADC49987.1"
FT                   QAGYQEILTRLGGPTCTK"
FT   gene            352327..352578
FT                   /gene="purS"
FT                   /locus_tag="BpOF4_09665"
FT   CDS_pept        352327..352578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="BpOF4_09665"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit PurS"
FT                   /note="COG1828 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, PurS component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09665"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49988"
FT                   /db_xref="GOA:D3FSM0"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM0"
FT                   /protein_id="ADC49988.1"
FT   gene            352575..353258
FT                   /gene="purQ"
FT                   /locus_tag="BpOF4_09670"
FT   CDS_pept        352575..353258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BpOF4_09670"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /note="COG0047 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09670"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49989"
FT                   /db_xref="GOA:D3FSM1"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM1"
FT                   /protein_id="ADC49989.1"
FT                   HVATT"
FT   gene            353242..355467
FT                   /gene="purL"
FT                   /locus_tag="BpOF4_09675"
FT   CDS_pept        353242..355467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BpOF4_09675"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /note="COG0046 Phosphoribosylformylglycinamidine (FGAM)
FT                   synthase, synthetase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09675"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49990"
FT                   /db_xref="GOA:D3FSM2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM2"
FT                   /protein_id="ADC49990.1"
FT   gene            355443..356855
FT                   /gene="purF"
FT                   /locus_tag="BpOF4_09680"
FT   CDS_pept        355443..356855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BpOF4_09680"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09680"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49991"
FT                   /db_xref="GOA:D3FSM3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM3"
FT                   /protein_id="ADC49991.1"
FT                   IYADTLHPHAKV"
FT   gene            356892..357926
FT                   /gene="purM"
FT                   /locus_tag="BpOF4_09685"
FT   CDS_pept        356892..357926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BpOF4_09685"
FT                   /product="phosphoribosylaminoimidazole synthetase"
FT                   /note="COG0150 Phosphoribosylaminoimidazole (AIR)
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09685"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49992"
FT                   /db_xref="GOA:D3FSM4"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM4"
FT                   /protein_id="ADC49992.1"
FT                   GGLD"
FT   gene            357926..358519
FT                   /gene="purN"
FT                   /locus_tag="BpOF4_09690"
FT   CDS_pept        357926..358519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BpOF4_09690"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="COG0299 Folate-dependent phosphoribosylglycinamide
FT                   formyltransferase PurN"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09690"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49993"
FT                   /db_xref="GOA:D3FSM5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM5"
FT                   /protein_id="ADC49993.1"
FT   gene            358516..360045
FT                   /gene="purH"
FT                   /locus_tag="BpOF4_09695"
FT   CDS_pept        358516..360045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BpOF4_09695"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="COG0138 AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09695"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49994"
FT                   /db_xref="GOA:D3FSM6"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM6"
FT                   /protein_id="ADC49994.1"
FT   gene            360061..361335
FT                   /gene="purD"
FT                   /locus_tag="BpOF4_09700"
FT   CDS_pept        360061..361335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BpOF4_09700"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /note="COG0151 Phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09700"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49995"
FT                   /db_xref="GOA:D3FSM7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM7"
FT                   /protein_id="ADC49995.1"
FT   gene            complement(361310..361420)
FT                   /locus_tag="BpOF4_09705"
FT   CDS_pept        complement(361310..361420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09705"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09705"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49996"
FT                   /db_xref="GOA:D3FSM8"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM8"
FT                   /protein_id="ADC49996.1"
FT   gene            complement(361521..361790)
FT                   /locus_tag="BpOF4_09710"
FT   CDS_pept        complement(361521..361790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09710"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49997"
FT                   /db_xref="GOA:D3FSM9"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSM9"
FT                   /protein_id="ADC49997.1"
FT   gene            361951..363690
FT                   /gene="yeaR"
FT                   /locus_tag="BpOF4_09715"
FT   CDS_pept        361951..363690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeaR"
FT                   /locus_tag="BpOF4_09715"
FT                   /product="adenine deaminase"
FT                   /note="COG1001 Adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09715"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49998"
FT                   /db_xref="GOA:D3FSN0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN0"
FT                   /protein_id="ADC49998.1"
FT                   IMR"
FT   gene            363743..364789
FT                   /locus_tag="BpOF4_09720"
FT   CDS_pept        363743..364789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09720"
FT                   /db_xref="EnsemblGenomes-Tr:ADC49999"
FT                   /db_xref="InterPro:IPR021416"
FT                   /db_xref="InterPro:IPR023158"
FT                   /db_xref="InterPro:IPR035328"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN1"
FT                   /protein_id="ADC49999.1"
FT                   MDESVTYN"
FT   gene            364808..365119
FT                   /locus_tag="BpOF4_09725"
FT   CDS_pept        364808..365119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09725"
FT                   /product="hypothetical protein"
FT                   /note="COG4496 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09725"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50000"
FT                   /db_xref="GOA:D3FSN2"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013368"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN2"
FT                   /protein_id="ADC50000.1"
FT   gene            365264..365911
FT                   /locus_tag="BpOF4_09730"
FT   CDS_pept        365264..365911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09730"
FT                   /product="hypothetical protein"
FT                   /note="COG1734 DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09730"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50001"
FT                   /db_xref="GOA:D3FSN3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR014240"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN3"
FT                   /protein_id="ADC50001.1"
FT   gene            366069..366725
FT                   /locus_tag="BpOF4_09735"
FT   CDS_pept        366069..366725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09735"
FT                   /product="hypothetical protein"
FT                   /note="COG4243 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09735"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50002"
FT                   /db_xref="GOA:D3FSN4"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN4"
FT                   /protein_id="ADC50002.1"
FT   gene            366997..368730
FT                   /gene="adeC"
FT                   /locus_tag="BpOF4_09740"
FT   CDS_pept        366997..368730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adeC"
FT                   /locus_tag="BpOF4_09740"
FT                   /product="adenine deaminase"
FT                   /note="COG1001 Adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09740"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50003"
FT                   /db_xref="GOA:D3FSN5"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN5"
FT                   /protein_id="ADC50003.1"
FT                   E"
FT   gene            complement(368801..368956)
FT                   /locus_tag="BpOF4_09745"
FT   CDS_pept        complement(368801..368956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09745"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50004"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN6"
FT                   /protein_id="ADC50004.1"
FT                   LKSPEQ"
FT   gene            complement(369031..370887)
FT                   /locus_tag="BpOF4_09750"
FT   CDS_pept        complement(369031..370887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09750"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG3604 Transcriptional regulator containing GAF,
FT                   AAA-type ATPase, and DNA binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09750"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50005"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN7"
FT                   /protein_id="ADC50005.1"
FT   gene            371196..372731
FT                   /locus_tag="BpOF4_09755"
FT   CDS_pept        371196..372731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09755"
FT                   /product="hypothetical protein"
FT                   /note="COG2978 Putative p-aminobenzoyl-glutamate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09755"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50006"
FT                   /db_xref="GOA:D3FSN8"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN8"
FT                   /protein_id="ADC50006.1"
FT   gene            372750..374045
FT                   /gene="amaB"
FT                   /locus_tag="BpOF4_09760"
FT   CDS_pept        372750..374045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaB"
FT                   /locus_tag="BpOF4_09760"
FT                   /product="allantoate amidohydrolase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09760"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50007"
FT                   /db_xref="GOA:D3FSN9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSN9"
FT                   /protein_id="ADC50007.1"
FT   gene            374289..374756
FT                   /locus_tag="BpOF4_09765"
FT   CDS_pept        374289..374756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09765"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09765"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50008"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP0"
FT                   /protein_id="ADC50008.1"
FT   gene            complement(374887..375996)
FT                   /gene="alr"
FT                   /locus_tag="BpOF4_09770"
FT   CDS_pept        complement(374887..375996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="BpOF4_09770"
FT                   /product="alanine racemase"
FT                   /note="COG0787 Alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09770"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50009"
FT                   /db_xref="GOA:D3FSP1"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="PDB:5YYC"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP1"
FT                   /protein_id="ADC50009.1"
FT   gene            complement(376095..377228)
FT                   /gene="ald"
FT                   /locus_tag="BpOF4_09775"
FT   CDS_pept        complement(376095..377228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="BpOF4_09775"
FT                   /product="L-alanine dehyrogenase (sporulation V protein N)"
FT                   /note="COG0686 Alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09775"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50010"
FT                   /db_xref="GOA:D3FSP2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP2"
FT                   /protein_id="ADC50010.1"
FT   gene            complement(377361..378593)
FT                   /locus_tag="BpOF4_09780"
FT   CDS_pept        complement(377361..378593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09780"
FT                   /product="putative transcriptional regulator"
FT                   /note="COG2508 Regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09780"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50011"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP3"
FT                   /protein_id="ADC50011.1"
FT                   LYLDMKVYLKR"
FT   gene            378773..380188
FT                   /locus_tag="BpOF4_09785"
FT   CDS_pept        378773..380188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09785"
FT                   /product="amino acid transporter"
FT                   /note="COG1115 Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09785"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50012"
FT                   /db_xref="GOA:D3FSP4"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP4"
FT                   /protein_id="ADC50012.1"
FT                   FYEAAKTTAKQAS"
FT   gene            380309..380845
FT                   /locus_tag="BpOF4_09790"
FT   CDS_pept        380309..380845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09790"
FT                   /product="hypothetical protein"
FT                   /note="COG0640 Predicted transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09790"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50013"
FT                   /db_xref="GOA:D3FSP5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP5"
FT                   /protein_id="ADC50013.1"
FT                   RRARRLATISIPEVE"
FT   gene            380848..381786
FT                   /locus_tag="BpOF4_09795"
FT   CDS_pept        380848..381786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09795"
FT                   /product="hypothetical protein"
FT                   /note="COG1073 Hydrolases of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09795"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50014"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP6"
FT                   /protein_id="ADC50014.1"
FT   gene            381779..381985
FT                   /locus_tag="BpOF4_09800"
FT   CDS_pept        381779..381985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09800"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50015"
FT                   /db_xref="GOA:D3FSP7"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP7"
FT                   /protein_id="ADC50015.1"
FT   gene            381966..382286
FT                   /locus_tag="BpOF4_09805"
FT   CDS_pept        381966..382286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09805"
FT                   /product="hypothetical protein"
FT                   /note="COG0393 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09805"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50016"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:D3FSP8"
FT                   /protein_id="ADC50016.1"
FT                   EK"
FT   gene            382303..383085
FT                   /gene="psd"
FT                   /locus_tag="BpOF4_09810"
FT   CDS_pept        382303..383085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BpOF4_09810"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /note="COG0688 Phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09810"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50017"
FT                   /db_xref="GOA:D3FTE4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTE4"
FT                   /protein_id="ADC50017.1"
FT   repeat_region   383173..383278
FT                   /rpt_family="bpr2"
FT                   /note="P_bpr2_3F (partial)"
FT   gene            complement(383272..383391)
FT                   /locus_tag="BpOF4_09815"
FT   CDS_pept        complement(383272..383391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09815"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50018"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTE5"
FT                   /protein_id="ADC50018.1"
FT   repeat_region   383318..383490
FT                   /rpt_family="bpr2"
FT                   /note="P_bpr2_4F (partial)"
FT   repeat_region   383527..383638
FT                   /rpt_family="bpr2"
FT                   /note="P_bpr2_5F (partial)"
FT   gene            complement(383987..384751)
FT                   /locus_tag="BpOF4_09820"
FT   CDS_pept        complement(383987..384751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09820"
FT                   /product="Transposase"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09820"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50019"
FT                   /db_xref="GOA:D3FTE6"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTE6"
FT                   /protein_id="ADC50019.1"
FT   gene            complement(384688..385266)
FT                   /locus_tag="BpOF4_09825"
FT   CDS_pept        complement(384688..385266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09825"
FT                   /product="Transposase"
FT                   /note="COG3547 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09825"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50020"
FT                   /db_xref="GOA:D3FTE7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTE7"
FT                   /protein_id="ADC50020.1"
FT   repeat_region   385365..385510
FT                   /rpt_family="bpr2"
FT                   /note="P_bpr2_6F (partial)"
FT   gene            386083..388254
FT                   /gene="nrdA"
FT                   /locus_tag="BpOF4_09830"
FT   CDS_pept        386083..388254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="BpOF4_09830"
FT                   /product="ribonucleotide-diphosphate reductase subunit
FT                   alpha"
FT                   /note="COG0209 Ribonucleotide reductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09830"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50021"
FT                   /db_xref="GOA:D3FTE8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTE8"
FT                   /protein_id="ADC50021.1"
FT   gene            388269..389303
FT                   /gene="nrdB"
FT                   /locus_tag="BpOF4_09835"
FT   CDS_pept        388269..389303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="BpOF4_09835"
FT                   /product="ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /note="COG0208 Ribonucleotide reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09835"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50022"
FT                   /db_xref="GOA:D3FTE9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTE9"
FT                   /protein_id="ADC50022.1"
FT                   FDEL"
FT   gene            389293..389898
FT                   /gene="acuA"
FT                   /locus_tag="BpOF4_09840"
FT   CDS_pept        389293..389898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acuA"
FT                   /locus_tag="BpOF4_09840"
FT                   /product="acetoin dehydrogenase AcuA"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09840"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50023"
FT                   /db_xref="GOA:D3FTF0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024699"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF0"
FT                   /protein_id="ADC50023.1"
FT   gene            389972..390943
FT                   /locus_tag="BpOF4_09845"
FT   CDS_pept        389972..390943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09845"
FT                   /product="sodium-dependent transporter"
FT                   /note="COG0385 Predicted Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09845"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50024"
FT                   /db_xref="GOA:D3FTF1"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF1"
FT                   /protein_id="ADC50024.1"
FT   gene            391158..391844
FT                   /gene="crtE"
FT                   /locus_tag="BpOF4_09850"
FT   CDS_pept        391158..391844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="crtE"
FT                   /locus_tag="BpOF4_09850"
FT                   /product="geranylgeranylglyceryl phosphate synthase-like
FT                   protein"
FT                   /note="COG1646 Predicted phosphate-binding enzymes,
FT                   TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09850"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50025"
FT                   /db_xref="GOA:D3FTF2"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF2"
FT                   /protein_id="ADC50025.1"
FT                   VKATKS"
FT   gene            391947..394175
FT                   /gene="pcrA"
FT                   /locus_tag="BpOF4_09855"
FT   CDS_pept        391947..394175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BpOF4_09855"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="COG0210 Superfamily I DNA and RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09855"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50026"
FT                   /db_xref="GOA:D3FTF3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF3"
FT                   /protein_id="ADC50026.1"
FT   gene            394191..396197
FT                   /gene="ligA"
FT                   /locus_tag="BpOF4_09860"
FT   CDS_pept        394191..396197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BpOF4_09860"
FT                   /product="NAD-dependent DNA ligase LigA"
FT                   /note="COG0272 NAD-dependent DNA ligase (contains BRCT
FT                   domain type II)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09860"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50027"
FT                   /db_xref="GOA:D3FTF4"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF4"
FT                   /protein_id="ADC50027.1"
FT   gene            396234..397415
FT                   /locus_tag="BpOF4_09865"
FT   CDS_pept        396234..397415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09865"
FT                   /product="hypothetical protein"
FT                   /note="COG4851 Protein involved in sex pheromone
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09865"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50028"
FT                   /db_xref="InterPro:IPR011426"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF5"
FT                   /protein_id="ADC50028.1"
FT   gene            397806..398927
FT                   /locus_tag="BpOF4_09870"
FT   CDS_pept        397806..398927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09870"
FT                   /product="sugar ABC transporter substrate-binding protein"
FT                   /note="COG1744 Uncharacterized ABC-type transport system,
FT                   periplasmic component/surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09870"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50029"
FT                   /db_xref="GOA:D3FTF6"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF6"
FT                   /protein_id="ADC50029.1"
FT   gene            399146..400675
FT                   /locus_tag="BpOF4_09875"
FT   CDS_pept        399146..400675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09875"
FT                   /product="sugar ABC transporter ATP-binding protein"
FT                   /note="COG3845 ABC-type uncharacterized transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09875"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50030"
FT                   /db_xref="GOA:D3FTF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF7"
FT                   /protein_id="ADC50030.1"
FT   gene            400675..401733
FT                   /locus_tag="BpOF4_09880"
FT   CDS_pept        400675..401733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09880"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /note="COG4603 ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09880"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50031"
FT                   /db_xref="GOA:D3FTF8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF8"
FT                   /protein_id="ADC50031.1"
FT                   RWVMNRVKKEDI"
FT   gene            401733..402698
FT                   /locus_tag="BpOF4_09885"
FT   CDS_pept        401733..402698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09885"
FT                   /product="sugar ABC transporter permease"
FT                   /note="COG1079 Uncharacterized ABC-type transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09885"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50032"
FT                   /db_xref="GOA:D3FTF9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTF9"
FT                   /protein_id="ADC50032.1"
FT   gene            403246..404754
FT                   /gene="putP2"
FT                   /locus_tag="BpOF4_09890"
FT   CDS_pept        403246..404754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP2"
FT                   /locus_tag="BpOF4_09890"
FT                   /product="sodium/proline symporter"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09890"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50033"
FT                   /db_xref="GOA:D3FTG0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG0"
FT                   /protein_id="ADC50033.1"
FT   gene            404943..405233
FT                   /gene="gatC"
FT                   /locus_tag="BpOF4_09895"
FT   CDS_pept        404943..405233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BpOF4_09895"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /note="COG0721 Asp-tRNAAsn/Glu-tRNAGln amidotransferase C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09895"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50034"
FT                   /db_xref="GOA:D3FTG1"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG1"
FT                   /protein_id="ADC50034.1"
FT   gene            405251..406708
FT                   /gene="gatA"
FT                   /locus_tag="BpOF4_09900"
FT   CDS_pept        405251..406708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BpOF4_09900"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   A"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09900"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50035"
FT                   /db_xref="GOA:D3FTG2"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG2"
FT                   /protein_id="ADC50035.1"
FT   gene            406724..408151
FT                   /gene="gatB"
FT                   /locus_tag="BpOF4_09905"
FT   CDS_pept        406724..408151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BpOF4_09905"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /note="COG0064 Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit (PET112 homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09905"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50036"
FT                   /db_xref="GOA:D3FTG3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG3"
FT                   /protein_id="ADC50036.1"
FT                   ANPQMVNKILLEEIKKR"
FT   gene            408487..409389
FT                   /locus_tag="BpOF4_09910"
FT   CDS_pept        408487..409389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09910"
FT                   /product="putative lipid kinase"
FT                   /note="COG1597 Sphingosine kinase and enzymes related to
FT                   eukaryotic diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09910"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50037"
FT                   /db_xref="GOA:D3FTG4"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG4"
FT                   /protein_id="ADC50037.1"
FT   gene            409447..409668
FT                   /locus_tag="BpOF4_09915"
FT   CDS_pept        409447..409668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09915"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50038"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG5"
FT                   /protein_id="ADC50038.1"
FT   gene            409665..411044
FT                   /gene="yefA"
FT                   /locus_tag="BpOF4_09920"
FT   CDS_pept        409665..411044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yefA"
FT                   /locus_tag="BpOF4_09920"
FT                   /product="RNA methyltransferase, TrmA family"
FT                   /note="COG2265 SAM-dependent methyltransferases related to
FT                   tRNA (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09920"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50039"
FT                   /db_xref="GOA:D3FTG6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG6"
FT                   /protein_id="ADC50039.1"
FT                   N"
FT   gene            complement(411041..411283)
FT                   /locus_tag="BpOF4_09925"
FT   CDS_pept        complement(411041..411283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09925"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09925"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50040"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG7"
FT                   /protein_id="ADC50040.1"
FT   gene            complement(411688..413436)
FT                   /locus_tag="BpOF4_09930"
FT   CDS_pept        complement(411688..413436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09930"
FT                   /product="hypothetical protein"
FT                   /note="COG0433 Predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09930"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50041"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG8"
FT                   /protein_id="ADC50041.1"
FT                   INKWVN"
FT   gene            complement(413449..414603)
FT                   /locus_tag="BpOF4_09935"
FT   CDS_pept        complement(413449..414603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09935"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50042"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTG9"
FT                   /protein_id="ADC50042.1"
FT   gene            415246..416229
FT                   /gene="yfjN"
FT                   /locus_tag="BpOF4_09940"
FT   CDS_pept        415246..416229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfjN"
FT                   /locus_tag="BpOF4_09940"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /note="COG0042 tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09940"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50043"
FT                   /db_xref="GOA:D3FTH0"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH0"
FT                   /protein_id="ADC50043.1"
FT   gene            416889..417218
FT                   /locus_tag="BpOF4_09945"
FT   CDS_pept        416889..417218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09945"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09945"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50044"
FT                   /db_xref="GOA:D3FTH1"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH1"
FT                   /protein_id="ADC50044.1"
FT                   KQKFV"
FT   gene            417228..417797
FT                   /locus_tag="BpOF4_09950"
FT   CDS_pept        417228..417797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09950"
FT                   /product="hypothetical protein"
FT                   /note="COG0588 Phosphoglycerate mutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09950"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50045"
FT                   /db_xref="GOA:D3FTH2"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH2"
FT                   /protein_id="ADC50045.1"
FT   gene            417894..418076
FT                   /locus_tag="BpOF4_09955"
FT   CDS_pept        417894..418076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09955"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09955"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50046"
FT                   /db_xref="GOA:D3FTH3"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH3"
FT                   /protein_id="ADC50046.1"
FT                   LFVEKREYKQVRENE"
FT   gene            418103..418660
FT                   /locus_tag="BpOF4_09960"
FT   CDS_pept        418103..418660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09960"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09960"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50047"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH4"
FT                   /protein_id="ADC50047.1"
FT   gene            418699..418917
FT                   /locus_tag="BpOF4_09965"
FT   CDS_pept        418699..418917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09965"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09965"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50048"
FT                   /db_xref="GOA:D3FTH5"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH5"
FT                   /protein_id="ADC50048.1"
FT   gene            complement(418957..420900)
FT                   /gene="bceP"
FT                   /locus_tag="BpOF4_09970"
FT   CDS_pept        complement(418957..420900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bceP"
FT                   /locus_tag="BpOF4_09970"
FT                   /product="2-component ABC transporter (permease)
FT                   peptide/macrolide/lipoprotein efflux family"
FT                   /note="COG0577 ABC-type antimicrobial peptide transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09970"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50049"
FT                   /db_xref="GOA:D3FTH6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH6"
FT                   /protein_id="ADC50049.1"
FT                   VLYYKKVIKMAL"
FT   gene            complement(420890..421651)
FT                   /gene="bceA"
FT                   /locus_tag="BpOF4_09975"
FT   CDS_pept        complement(420890..421651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bceA"
FT                   /locus_tag="BpOF4_09975"
FT                   /product="ABC transporter ATP-binding protein component"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09975"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50050"
FT                   /db_xref="GOA:D3FTH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH7"
FT                   /protein_id="ADC50050.1"
FT   gene            complement(421755..422762)
FT                   /gene="bceS"
FT                   /locus_tag="BpOF4_09980"
FT   CDS_pept        complement(421755..422762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bceS"
FT                   /locus_tag="BpOF4_09980"
FT                   /product="two-component sensor histidine kinase controlling
FT                   resistance to antibiotics versus cell wall (BceS)"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09980"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50051"
FT                   /db_xref="GOA:D3FTH8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH8"
FT                   /protein_id="ADC50051.1"
FT   gene            complement(422767..423447)
FT                   /gene="bceR"
FT                   /locus_tag="BpOF4_09985"
FT   CDS_pept        complement(422767..423447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bceR"
FT                   /locus_tag="BpOF4_09985"
FT                   /product="response regulator (BceR)"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09985"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50052"
FT                   /db_xref="GOA:D3FTH9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTH9"
FT                   /protein_id="ADC50052.1"
FT                   AIER"
FT   gene            423603..423995
FT                   /locus_tag="BpOF4_09990"
FT   CDS_pept        423603..423995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09990"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09990"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50053"
FT                   /db_xref="GOA:D3FTI0"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI0"
FT                   /protein_id="ADC50053.1"
FT   gene            complement(424105..424620)
FT                   /locus_tag="BpOF4_09995"
FT   CDS_pept        complement(424105..424620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_09995"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_09995"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50054"
FT                   /db_xref="GOA:D3FTI1"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI1"
FT                   /protein_id="ADC50054.1"
FT                   SDARSRIE"
FT   gene            424754..425362
FT                   /locus_tag="BpOF4_10000"
FT   CDS_pept        424754..425362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10000"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50055"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI2"
FT                   /protein_id="ADC50055.1"
FT   repeat_region   complement(425382..425566)
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_6R"
FT   gene            complement(425637..427313)
FT                   /gene="glnS"
FT                   /locus_tag="BpOF4_10005"
FT   CDS_pept        complement(425637..427313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="BpOF4_10005"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /note="COG0008 Glutamyl- and glutaminyl-tRNA synthetases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50056"
FT                   /db_xref="GOA:D3FTI3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI3"
FT                   /protein_id="ADC50056.1"
FT   gene            427582..428307
FT                   /locus_tag="BpOF4_10010"
FT   CDS_pept        427582..428307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50057"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI4"
FT                   /protein_id="ADC50057.1"
FT   gene            428450..429922
FT                   /locus_tag="BpOF4_10015"
FT   CDS_pept        428450..429922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10015"
FT                   /product="hypothetical protein"
FT                   /note="COG0397 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10015"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50058"
FT                   /db_xref="GOA:D3FTI5"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI5"
FT                   /protein_id="ADC50058.1"
FT   gene            complement(430244..430387)
FT                   /locus_tag="BpOF4_10020"
FT   CDS_pept        complement(430244..430387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10020"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50059"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI6"
FT                   /protein_id="ADC50059.1"
FT                   SH"
FT   gene            431521..432576
FT                   /gene="desA"
FT                   /locus_tag="BpOF4_10025"
FT   CDS_pept        431521..432576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="desA"
FT                   /locus_tag="BpOF4_10025"
FT                   /product="fatty acid desaturase"
FT                   /note="COG3239 Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50060"
FT                   /db_xref="GOA:D3FTI7"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI7"
FT                   /protein_id="ADC50060.1"
FT                   KKDSTKLSRAK"
FT   gene            432700..433830
FT                   /gene="desK"
FT                   /locus_tag="BpOF4_10030"
FT   CDS_pept        432700..433830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="desK"
FT                   /locus_tag="BpOF4_10030"
FT                   /product="two-component sensor histidine kinase"
FT                   /note="COG4585 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10030"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50061"
FT                   /db_xref="GOA:D3FTI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI8"
FT                   /protein_id="ADC50061.1"
FT   gene            433832..434431
FT                   /gene="desR"
FT                   /locus_tag="BpOF4_10035"
FT   CDS_pept        433832..434431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="desR"
FT                   /locus_tag="BpOF4_10035"
FT                   /product="two-component response regulator"
FT                   /note="COG2197 Response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50062"
FT                   /db_xref="GOA:D3FTI9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTI9"
FT                   /protein_id="ADC50062.1"
FT   gene            434611..435327
FT                   /locus_tag="BpOF4_10040"
FT   CDS_pept        434611..435327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50063"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ0"
FT                   /protein_id="ADC50063.1"
FT                   FEIIPCLPNGNGNGAG"
FT   gene            435400..435603
FT                   /locus_tag="BpOF4_10045"
FT   CDS_pept        435400..435603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10045"
FT                   /product="acyl-CoA ligase"
FT                   /note="COG0318 Acyl-CoA synthetases (AMP-forming)/AMP-acid
FT                   ligases II"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50064"
FT                   /db_xref="GOA:D3FTJ1"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ1"
FT                   /protein_id="ADC50064.1"
FT   gene            435784..437460
FT                   /locus_tag="BpOF4_10050"
FT   CDS_pept        435784..437460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10050"
FT                   /product="sulfatase"
FT                   /note="COG3119 Arylsulfatase A and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50065"
FT                   /db_xref="GOA:D3FTJ2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ2"
FT                   /protein_id="ADC50065.1"
FT   gene            437607..438092
FT                   /locus_tag="BpOF4_10055"
FT   CDS_pept        437607..438092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10055"
FT                   /product="hypothetical protein"
FT                   /note="COG4329 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50066"
FT                   /db_xref="GOA:D3FTJ3"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ3"
FT                   /protein_id="ADC50066.1"
FT   gene            438096..438920
FT                   /locus_tag="BpOF4_10060"
FT   CDS_pept        438096..438920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10060"
FT                   /product="putative membrane protein CtaG family, copper"
FT                   /note="COG3336 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50067"
FT                   /db_xref="GOA:D3FTJ4"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ4"
FT                   /protein_id="ADC50067.1"
FT   gene            438996..439697
FT                   /locus_tag="BpOF4_10065"
FT   CDS_pept        438996..439697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10065"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family protein"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10065"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50068"
FT                   /db_xref="GOA:D3FTJ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ5"
FT                   /protein_id="ADC50068.1"
FT                   VGYKFLEKEHE"
FT   gene            439690..441099
FT                   /locus_tag="BpOF4_10070"
FT   CDS_pept        439690..441099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10070"
FT                   /product="sensory transduction histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10070"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50069"
FT                   /db_xref="GOA:D3FTJ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ6"
FT                   /protein_id="ADC50069.1"
FT                   TLPQSNSKDIE"
FT   gene            441349..442464
FT                   /locus_tag="BpOF4_10075"
FT   CDS_pept        441349..442464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10075"
FT                   /product="transposase (15)"
FT                   /note="COG3385 FOG: Transposase and inactivated
FT                   derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10075"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50070"
FT                   /db_xref="GOA:D3FTJ7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025399"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ7"
FT                   /protein_id="ADC50070.1"
FT   gene            442672..444876
FT                   /locus_tag="BpOF4_10080"
FT   CDS_pept        442672..444876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10080"
FT                   /product="putative multi-drug/solvent efflux protein, MMPL
FT                   domain protein"
FT                   /note="COG2409 Predicted drug exporters of the RND
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50071"
FT                   /db_xref="GOA:D3FTJ8"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ8"
FT                   /protein_id="ADC50071.1"
FT   gene            444873..445274
FT                   /locus_tag="BpOF4_10085"
FT   CDS_pept        444873..445274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50072"
FT                   /db_xref="GOA:D3FTJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTJ9"
FT                   /protein_id="ADC50072.1"
FT   gene            complement(445344..446207)
FT                   /locus_tag="BpOF4_10090"
FT   CDS_pept        complement(445344..446207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10090"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50073"
FT                   /db_xref="GOA:D3FTK0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK0"
FT                   /protein_id="ADC50073.1"
FT                   PDCKDL"
FT   gene            complement(446225..446674)
FT                   /locus_tag="BpOF4_10095"
FT   CDS_pept        complement(446225..446674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10095"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50074"
FT                   /db_xref="GOA:D3FTK1"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK1"
FT                   /protein_id="ADC50074.1"
FT   gene            complement(446688..447056)
FT                   /locus_tag="BpOF4_10100"
FT   CDS_pept        complement(446688..447056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10100"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50075"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK2"
FT                   /protein_id="ADC50075.1"
FT                   VYINEKDATRLYGYIEND"
FT   gene            447362..448534
FT                   /gene="prgY"
FT                   /locus_tag="BpOF4_10105"
FT   CDS_pept        447362..448534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prgY"
FT                   /locus_tag="BpOF4_10105"
FT                   /product="TraB family pheromone shut-down protein"
FT                   /note="COG1916 Uncharacterized homolog of PrgY (pheromone
FT                   shutdown protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10105"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50076"
FT                   /db_xref="GOA:D3FTK3"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK3"
FT                   /protein_id="ADC50076.1"
FT   gene            448570..448776
FT                   /locus_tag="BpOF4_10110"
FT   CDS_pept        448570..448776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10110"
FT                   /product="hypothetical protein"
FT                   /note="COG1180 Pyruvate-formate lyase-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10110"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50077"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK4"
FT                   /protein_id="ADC50077.1"
FT   repeat_region   complement(448843..448972)
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_7R"
FT   gene            449247..449396
FT                   /locus_tag="BpOF4_10115"
FT   CDS_pept        449247..449396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50078"
FT                   /db_xref="GOA:D3FTK5"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK5"
FT                   /protein_id="ADC50078.1"
FT                   TNHN"
FT   gene            449459..451027
FT                   /gene="putP2"
FT                   /locus_tag="BpOF4_10120"
FT   CDS_pept        449459..451027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putP2"
FT                   /locus_tag="BpOF4_10120"
FT                   /product="osmoregulated sodium/proline symporter"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10120"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50079"
FT                   /db_xref="GOA:D3FTK6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK6"
FT                   /protein_id="ADC50079.1"
FT                   DLLKE"
FT   gene            451033..451518
FT                   /locus_tag="BpOF4_10125"
FT   CDS_pept        451033..451518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50080"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK7"
FT                   /protein_id="ADC50080.1"
FT   gene            complement(451696..452730)
FT                   /gene="dctP"
FT                   /locus_tag="BpOF4_10130"
FT   CDS_pept        complement(451696..452730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctP"
FT                   /locus_tag="BpOF4_10130"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="COG1638 TRAP-type C4-dicarboxylate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10130"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50081"
FT                   /db_xref="GOA:D3FTK8"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK8"
FT                   /protein_id="ADC50081.1"
FT                   ANVE"
FT   misc_feature    452951..454075
FT                   /note="potential frameshift: common BLAST hit:
FT                   gi|172058851|ref|YP_001815311.1| NADH:flavin
FT                   oxidoreductase/NADH oxidase"
FT   gene            454211..455305
FT                   /locus_tag="BpOF4_10145"
FT   CDS_pept        454211..455305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10145"
FT                   /product="hypothetical protein"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50082"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTK9"
FT                   /protein_id="ADC50082.1"
FT   repeat_region   455412..455814
FT                   /rpt_family="bpr2"
FT                   /note="bpr2_1F"
FT   gene            455976..456497
FT                   /locus_tag="BpOF4_10150"
FT   CDS_pept        455976..456497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50083"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL0"
FT                   /protein_id="ADC50083.1"
FT                   ISLERLNDLD"
FT   gene            456513..457442
FT                   /locus_tag="BpOF4_10155"
FT   CDS_pept        456513..457442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10155"
FT                   /product="lysophospholipase"
FT                   /note="COG2267 Lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50084"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL1"
FT                   /protein_id="ADC50084.1"
FT   gene            457613..458335
FT                   /gene="kipI"
FT                   /locus_tag="BpOF4_10160"
FT   CDS_pept        457613..458335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipI"
FT                   /locus_tag="BpOF4_10160"
FT                   /product="putative inhibitor of autophosphorylation of
FT                   KinA"
FT                   /note="COG2049 Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50085"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL2"
FT                   /protein_id="ADC50085.1"
FT                   QFKPITEAEYHKYKEKIT"
FT   gene            458332..459348
FT                   /gene="kipA"
FT                   /locus_tag="BpOF4_10165"
FT   CDS_pept        458332..459348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kipA"
FT                   /locus_tag="BpOF4_10165"
FT                   /product="putative hydrolase subunit antagonist of KipI"
FT                   /note="COG1984 Allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10165"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50086"
FT                   /db_xref="GOA:D3FTL3"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL3"
FT                   /protein_id="ADC50086.1"
FT   gene            complement(459345..460109)
FT                   /locus_tag="BpOF4_10170"
FT   CDS_pept        complement(459345..460109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10170"
FT                   /product="IclR family transcriptional regulator"
FT                   /note="COG1414 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10170"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50087"
FT                   /db_xref="GOA:D3FTL4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL4"
FT                   /protein_id="ADC50087.1"
FT   gene            460230..461453
FT                   /locus_tag="BpOF4_10175"
FT   CDS_pept        460230..461453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10175"
FT                   /product="putative NRAMP family Mn2+ or Fe2+ transporter"
FT                   /note="COG1914 Mn2+ and Fe2+ transporters of the NRAMP
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50088"
FT                   /db_xref="GOA:D3FTL5"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL5"
FT                   /protein_id="ADC50088.1"
FT                   TQMIPQLF"
FT   gene            461493..462251
FT                   /locus_tag="BpOF4_10180"
FT   CDS_pept        461493..462251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10180"
FT                   /product="LamB/YcsF family protein"
FT                   /note="COG1540 Uncharacterized proteins, homologs of lactam
FT                   utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10180"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50089"
FT                   /db_xref="GOA:D3FTL6"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL6"
FT                   /protein_id="ADC50089.1"
FT   gene            complement(462311..463180)
FT                   /locus_tag="BpOF4_10185"
FT   CDS_pept        complement(462311..463180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10185"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COG0456 Acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50090"
FT                   /db_xref="GOA:D3FTL7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL7"
FT                   /protein_id="ADC50090.1"
FT                   LTAYKLKQ"
FT   gene            463510..465075
FT                   /locus_tag="BpOF4_10190"
FT   CDS_pept        463510..465075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10190"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50091"
FT                   /db_xref="InterPro:IPR006829"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL8"
FT                   /protein_id="ADC50091.1"
FT                   GWFK"
FT   gene            465106..465438
FT                   /locus_tag="BpOF4_10195"
FT   CDS_pept        465106..465438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10195"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50092"
FT                   /db_xref="GOA:D3FTL9"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTL9"
FT                   /protein_id="ADC50092.1"
FT                   LLNLLV"
FT   gene            465562..466365
FT                   /locus_tag="BpOF4_10200"
FT   CDS_pept        465562..466365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10200"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50093"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM0"
FT                   /protein_id="ADC50093.1"
FT   gene            complement(466383..467366)
FT                   /locus_tag="BpOF4_10205"
FT   CDS_pept        complement(466383..467366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10205"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50094"
FT                   /db_xref="GOA:D3FTM1"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM1"
FT                   /protein_id="ADC50094.1"
FT   gene            467848..468792
FT                   /gene="ylaM"
FT                   /locus_tag="BpOF4_10210"
FT   CDS_pept        467848..468792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ylaM"
FT                   /locus_tag="BpOF4_10210"
FT                   /product="glutaminase"
FT                   /note="COG2066 Glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10210"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50095"
FT                   /db_xref="GOA:D3FTM2"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM2"
FT                   /protein_id="ADC50095.1"
FT   repeat_region   complement(468926..469313)
FT                   /rpt_family="bpr2"
FT                   /note="bpr2_2R"
FT   gene            469889..471256
FT                   /gene="sig54"
FT                   /locus_tag="BpOF4_10215"
FT   CDS_pept        469889..471256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sig54"
FT                   /locus_tag="BpOF4_10215"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family protein"
FT                   /note="COG3829 Transcriptional regulator containing PAS,
FT                   AAA-type ATPase, and DNA-binding domains"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10215"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50096"
FT                   /db_xref="GOA:D3FTM3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM3"
FT                   /protein_id="ADC50096.1"
FT   gene            471345..472736
FT                   /locus_tag="BpOF4_10220"
FT   CDS_pept        471345..472736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10220"
FT                   /product="nucleoside recognition domain-containing protein"
FT                   /note="COG3314 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10220"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50097"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30267"
FT                   /protein_id="ADC50097.1"
FT                   HVFFF"
FT   gene            472777..474114
FT                   /gene="gabT"
FT                   /locus_tag="BpOF4_10225"
FT   CDS_pept        472777..474114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BpOF4_10225"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10225"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50098"
FT                   /db_xref="GOA:P30268"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30268"
FT                   /protein_id="ADC50098.1"
FT   gene            474251..475087
FT                   /locus_tag="BpOF4_10230"
FT   CDS_pept        474251..475087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10230"
FT                   /product="chemotaxis sensory transducer"
FT                   /note="COG0840 Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10230"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50099"
FT                   /db_xref="GOA:D3FTM6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM6"
FT                   /protein_id="ADC50099.1"
FT   gene            475304..476569
FT                   /locus_tag="BpOF4_10235"
FT   CDS_pept        475304..476569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10235"
FT                   /product="N-carbamoyl-L-amino acid hydrolase"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10235"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50100"
FT                   /db_xref="GOA:D3FTM7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM7"
FT                   /protein_id="ADC50100.1"
FT   gene            476597..476833
FT                   /locus_tag="BpOF4_10240"
FT   CDS_pept        476597..476833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10240"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50101"
FT                   /db_xref="GOA:D3FTM8"
FT                   /db_xref="InterPro:IPR021741"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM8"
FT                   /protein_id="ADC50101.1"
FT   gene            476853..478370
FT                   /locus_tag="BpOF4_10245"
FT   CDS_pept        476853..478370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10245"
FT                   /product="Na+/proline symporter"
FT                   /note="COG0591 Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10245"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50102"
FT                   /db_xref="GOA:D3FTM9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTM9"
FT                   /protein_id="ADC50102.1"
FT   gene            478397..479554
FT                   /locus_tag="BpOF4_10250"
FT   CDS_pept        478397..479554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10250"
FT                   /product="peptidase, ArgE/DapE family protein"
FT                   /note="COG0624 Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10250"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50103"
FT                   /db_xref="GOA:D3FTN0"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN0"
FT                   /protein_id="ADC50103.1"
FT   gene            complement(479582..480925)
FT                   /locus_tag="BpOF4_10255"
FT   CDS_pept        complement(479582..480925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10255"
FT                   /product="putative sodium-dependent transporter"
FT                   /note="COG0733 Na+-dependent transporters of the SNF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10255"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50104"
FT                   /db_xref="GOA:D3FTN1"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN1"
FT                   /protein_id="ADC50104.1"
FT   gene            complement(480949..481800)
FT                   /gene="kynA"
FT                   /locus_tag="BpOF4_10260"
FT   CDS_pept        complement(480949..481800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynA"
FT                   /locus_tag="BpOF4_10260"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /note="COG3483 Tryptophan 2,3-dioxygenase (vermilion)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10260"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50105"
FT                   /db_xref="GOA:D3FTN2"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN2"
FT                   /protein_id="ADC50105.1"
FT                   EI"
FT   gene            complement(481820..482452)
FT                   /gene="kynB"
FT                   /locus_tag="BpOF4_10265"
FT   CDS_pept        complement(481820..482452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynB"
FT                   /locus_tag="BpOF4_10265"
FT                   /product="arylformamidase"
FT                   /note="COG1878 Predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10265"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50106"
FT                   /db_xref="GOA:D3FTN3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR017484"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN3"
FT                   /protein_id="ADC50106.1"
FT   gene            complement(482452..483729)
FT                   /gene="kynU"
FT                   /locus_tag="BpOF4_10270"
FT   CDS_pept        complement(482452..483729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynU"
FT                   /locus_tag="BpOF4_10270"
FT                   /product="kynureninase"
FT                   /note="COG3844 Kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10270"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50107"
FT                   /db_xref="GOA:D3FTN4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN4"
FT                   /protein_id="ADC50107.1"
FT   gene            483873..484481
FT                   /locus_tag="BpOF4_10275"
FT   CDS_pept        483873..484481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10275"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /note="COG1309 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10275"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50108"
FT                   /db_xref="GOA:D3FTN5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN5"
FT                   /protein_id="ADC50108.1"
FT   gene            484559..485749
FT                   /gene="yggT"
FT                   /locus_tag="BpOF4_10280"
FT   CDS_pept        484559..485749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yggT"
FT                   /locus_tag="BpOF4_10280"
FT                   /product="gamma-D-glutamyl-L-diamino acid endopeptidase I"
FT                   /note="COG1388 FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10280"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50109"
FT                   /db_xref="GOA:D3FTN6"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR034274"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN6"
FT                   /protein_id="ADC50109.1"
FT   gene            485877..487613
FT                   /locus_tag="BpOF4_10285"
FT   CDS_pept        485877..487613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10285"
FT                   /product="Multi-drug ABC transporter ATP-binding protein
FT                   and permease"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10285"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50110"
FT                   /db_xref="GOA:D3FTN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN7"
FT                   /protein_id="ADC50110.1"
FT                   HV"
FT   gene            487606..489417
FT                   /locus_tag="BpOF4_10290"
FT   CDS_pept        487606..489417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10290"
FT                   /product="Multi-drug ABC transporter ATP-binding protein
FT                   and permease"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10290"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50111"
FT                   /db_xref="GOA:D3FTN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN8"
FT                   /protein_id="ADC50111.1"
FT   gene            489618..490922
FT                   /gene="kinB"
FT                   /locus_tag="BpOF4_10295"
FT   CDS_pept        489618..490922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kinB"
FT                   /locus_tag="BpOF4_10295"
FT                   /product="sporulation kinase B"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10295"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50112"
FT                   /db_xref="GOA:D3FTN9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTN9"
FT                   /protein_id="ADC50112.1"
FT   gene            complement(490987..491346)
FT                   /locus_tag="BpOF4_10300"
FT   CDS_pept        complement(490987..491346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10300"
FT                   /product="hypothetical protein"
FT                   /note="COG3564 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10300"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50113"
FT                   /db_xref="InterPro:IPR008497"
FT                   /db_xref="UniProtKB/TrEMBL:D3FTP0"
FT                   /protein_id="ADC50113.1"
FT                   SRVFTNEERIELGLT"
FT   gene            complement(491368..492888)
FT                   /locus_tag="BpOF4_10305"
FT   CDS_pept        complement(491368..492888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10305"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10305"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50114"
FT                   /db_xref="GOA:D3FUE4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUE4"
FT                   /protein_id="ADC50114.1"
FT   gene            493044..493733
FT                   /locus_tag="BpOF4_10310"
FT   CDS_pept        493044..493733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10310"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="COG1187 16S rRNA uridine-516 pseudouridylate
FT                   synthase and related pseudouridylate synthases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10310"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50115"
FT                   /db_xref="GOA:D3FUE5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUE5"
FT                   /protein_id="ADC50115.1"
FT                   VLMKDLR"
FT   gene            494020..494853
FT                   /gene="glpF"
FT                   /locus_tag="BpOF4_10315"
FT   CDS_pept        494020..494853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="BpOF4_10315"
FT                   /product="GlpF MIP family glycerol uptake channel"
FT                   /note="COG0580 Glycerol uptake facilitator and related
FT                   permeases (Major Intrinsic Protein Family)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10315"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50116"
FT                   /db_xref="GOA:D3FUE6"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUE6"
FT                   /protein_id="ADC50116.1"
FT   gene            494875..496380
FT                   /gene="glpK"
FT                   /locus_tag="BpOF4_10320"
FT   CDS_pept        494875..496380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="BpOF4_10320"
FT                   /product="glycerol kinase"
FT                   /note="COG0554 Glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10320"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50117"
FT                   /db_xref="GOA:D3FUE7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUE7"
FT                   /protein_id="ADC50117.1"
FT   gene            496600..497160
FT                   /gene="glpP"
FT                   /locus_tag="BpOF4_10325"
FT   CDS_pept        496600..497160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpP"
FT                   /locus_tag="BpOF4_10325"
FT                   /product="glycerol uptake operon antiterminator regulatory
FT                   protein"
FT                   /note="COG1954 Glycerol-3-phosphate responsive
FT                   antiterminator (mRNA-binding)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10325"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50118"
FT                   /db_xref="GOA:D3FUE8"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUE8"
FT                   /protein_id="ADC50118.1"
FT   gene            complement(497173..498075)
FT                   /locus_tag="BpOF4_10330"
FT   CDS_pept        complement(497173..498075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10330"
FT                   /product="drug/metabolite transporter (DMT) superfamily
FT                   protein"
FT                   /note="COG0697 Permeases of the drug/metabolite transporter
FT                   (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50119"
FT                   /db_xref="GOA:D3FUE9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUE9"
FT                   /protein_id="ADC50119.1"
FT   gene            498357..499778
FT                   /locus_tag="BpOF4_10335"
FT   CDS_pept        498357..499778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10335"
FT                   /product="amino acid carrier protein"
FT                   /note="COG1115 Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50120"
FT                   /db_xref="GOA:D3FUF0"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF0"
FT                   /protein_id="ADC50120.1"
FT                   KNTECWDEQAERDRQ"
FT   gene            499887..501203
FT                   /locus_tag="BpOF4_10340"
FT   CDS_pept        499887..501203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10340"
FT                   /product="hypothetical protein"
FT                   /note="COG2244 Membrane protein involved in the export of
FT                   O-antigen and teichoic acid; pstA3"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10340"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50121"
FT                   /db_xref="GOA:D3FUF1"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF1"
FT                   /protein_id="ADC50121.1"
FT   gene            501460..502872
FT                   /gene="treP"
FT                   /locus_tag="BpOF4_10345"
FT   CDS_pept        501460..502872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treP"
FT                   /locus_tag="BpOF4_10345"
FT                   /product="Phosphotransferase system (PTS)
FT                   trehalose-specific enzyme II, BC component"
FT                   /note="COG1264 Phosphotransferase system IIB components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10345"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50122"
FT                   /db_xref="GOA:D3FUF2"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF2"
FT                   /protein_id="ADC50122.1"
FT                   TFLFAKIRKPNL"
FT   gene            503025..504704
FT                   /locus_tag="BpOF4_10350"
FT   CDS_pept        503025..504704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10350"
FT                   /product="alpha,alpha-phosphotrehalase"
FT                   /note="COG0366 Glycosidases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10350"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50123"
FT                   /db_xref="GOA:D3FUF3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF3"
FT                   /protein_id="ADC50123.1"
FT   gene            504729..505445
FT                   /locus_tag="BpOF4_10355"
FT   CDS_pept        504729..505445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10355"
FT                   /product="GntR family transcriptional repressor of
FT                   trehalose operon"
FT                   /note="COG2188 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10355"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50124"
FT                   /db_xref="GOA:D3FUF4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012770"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF4"
FT                   /protein_id="ADC50124.1"
FT                   HRPDKFRFVDFARRAK"
FT   repeat_region   505515..505698
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_8F"
FT   gene            505831..506313
FT                   /locus_tag="BpOF4_10360"
FT   CDS_pept        505831..506313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10360"
FT                   /product="bacillithiol peroxidase"
FT                   /note="COG0386 Glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10360"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50125"
FT                   /db_xref="GOA:D3FUF5"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF5"
FT                   /protein_id="ADC50125.1"
FT   gene            506432..507532
FT                   /gene="nos"
FT                   /locus_tag="BpOF4_10365"
FT   CDS_pept        506432..507532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nos"
FT                   /locus_tag="BpOF4_10365"
FT                   /product="Nitric oxide synthase, oxygenase domain protein"
FT                   /note="COG4362 Nitric oxide synthase, oxygenase domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10365"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50126"
FT                   /db_xref="GOA:D3FUF6"
FT                   /db_xref="InterPro:IPR004030"
FT                   /db_xref="InterPro:IPR017142"
FT                   /db_xref="InterPro:IPR036119"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF6"
FT                   /protein_id="ADC50126.1"
FT   gene            507719..509602
FT                   /locus_tag="BpOF4_10370"
FT   CDS_pept        507719..509602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10370"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG0488 ATPase components of ABC transporters with
FT                   duplicated ATPase domains"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10370"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50127"
FT                   /db_xref="GOA:D3FUF7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF7"
FT                   /protein_id="ADC50127.1"
FT   gene            509714..511054
FT                   /locus_tag="BpOF4_10375"
FT   CDS_pept        509714..511054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10375"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase"
FT                   /note="COG3706 Response regulator containing a CheY-like
FT                   receiver domain and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10375"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50128"
FT                   /db_xref="GOA:D3FUF8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF8"
FT                   /protein_id="ADC50128.1"
FT   gene            511192..511947
FT                   /locus_tag="BpOF4_10380"
FT   CDS_pept        511192..511947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10380"
FT                   /product="DeoR family transcriptional regulator"
FT                   /note="COG1349 Transcriptional regulators of sugar
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10380"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50129"
FT                   /db_xref="GOA:D3FUF9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUF9"
FT                   /protein_id="ADC50129.1"
FT   gene            511944..512858
FT                   /gene="fruK"
FT                   /locus_tag="BpOF4_10385"
FT   CDS_pept        511944..512858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="BpOF4_10385"
FT                   /product="fructose 1-phosphate kinase"
FT                   /note="COG1105 Fructose-1-phosphate kinase and related
FT                   fructose-6-phosphate kinase (PfkB)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10385"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50130"
FT                   /db_xref="GOA:D3FUG0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG0"
FT                   /protein_id="ADC50130.1"
FT   gene            512886..514742
FT                   /gene="fruA"
FT                   /locus_tag="BpOF4_10390"
FT   CDS_pept        512886..514742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="BpOF4_10390"
FT                   /product="PTS system, fructose-specific enzyme II, BC
FT                   component"
FT                   /note="COG1762 Phosphotransferase system
FT                   mannitol/fructose-specific IIA domain (Ntr-type)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10390"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50131"
FT                   /db_xref="GOA:D3FUG1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG1"
FT                   /protein_id="ADC50131.1"
FT   gene            514878..516320
FT                   /locus_tag="BpOF4_10395"
FT   CDS_pept        514878..516320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10395"
FT                   /product="Glutaminyl-tRNA synthase, glutamine-hydrolyzing,
FT                   subunit A"
FT                   /note="COG0154 Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit and related amidases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10395"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50132"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG2"
FT                   /protein_id="ADC50132.1"
FT   gene            516552..517115
FT                   /locus_tag="BpOF4_10400"
FT   CDS_pept        516552..517115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10400"
FT                   /product="putative thiamine transporter"
FT                   /note="COG3859 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10400"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50133"
FT                   /db_xref="GOA:D3FUG3"
FT                   /db_xref="InterPro:IPR012651"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG3"
FT                   /protein_id="ADC50133.1"
FT   gene            517228..518625
FT                   /gene="gdhA"
FT                   /locus_tag="BpOF4_10405"
FT   CDS_pept        517228..518625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="BpOF4_10405"
FT                   /product="glutamate dehydrogenase"
FT                   /note="COG0334 Glutamate dehydrogenase/leucine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10405"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50134"
FT                   /db_xref="GOA:D3FUG4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG4"
FT                   /protein_id="ADC50134.1"
FT                   YRHGKLF"
FT   gene            complement(518672..521083)
FT                   /locus_tag="BpOF4_10410"
FT   CDS_pept        complement(518672..521083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10410"
FT                   /product="minor extracellular serine protease"
FT                   /note="COG1404 Subtilisin-like serine proteases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10410"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50135"
FT                   /db_xref="GOA:D3FUG5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR010259"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034213"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG5"
FT                   /protein_id="ADC50135.1"
FT   gene            521538..522296
FT                   /locus_tag="BpOF4_10415"
FT   CDS_pept        521538..522296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10415"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50136"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG6"
FT                   /protein_id="ADC50136.1"
FT   gene            complement(522472..522708)
FT                   /locus_tag="BpOF4_10420"
FT   CDS_pept        complement(522472..522708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10420"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50137"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG7"
FT                   /protein_id="ADC50137.1"
FT   gene            complement(522723..524330)
FT                   /locus_tag="BpOF4_10425"
FT   CDS_pept        complement(522723..524330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10425"
FT                   /product="ABC-1 domain protein"
FT                   /note="COG0661 Predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10425"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50138"
FT                   /db_xref="GOA:D3FUG8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG8"
FT                   /protein_id="ADC50138.1"
FT                   SIPLVIGGISFYATSKRL"
FT   gene            524425..524667
FT                   /locus_tag="BpOF4_10430"
FT   CDS_pept        524425..524667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50139"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUG9"
FT                   /protein_id="ADC50139.1"
FT   gene            524687..524911
FT                   /gene="rbsK"
FT                   /locus_tag="BpOF4_10435"
FT   CDS_pept        524687..524911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="BpOF4_10435"
FT                   /product="ribokinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10435"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50140"
FT                   /db_xref="GOA:D3FUH0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH0"
FT                   /protein_id="ADC50140.1"
FT   gene            524936..525589
FT                   /gene="rbsK"
FT                   /locus_tag="BpOF4_10440"
FT   CDS_pept        524936..525589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="BpOF4_10440"
FT                   /product="ribokinase"
FT                   /note="COG0524 Sugar kinases, ribokinase family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10440"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50141"
FT                   /db_xref="GOA:D3FUH1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH1"
FT                   /protein_id="ADC50141.1"
FT   gene            complement(525629..526636)
FT                   /gene="mreBH"
FT                   /locus_tag="BpOF4_10445"
FT   CDS_pept        complement(525629..526636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreBH"
FT                   /locus_tag="BpOF4_10445"
FT                   /product="rod-share determining protein MreBH"
FT                   /note="COG1077 Actin-like ATPase involved in cell
FT                   morphogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10445"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50142"
FT                   /db_xref="GOA:D3FUH2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH2"
FT                   /protein_id="ADC50142.1"
FT   gene            complement(527091..529121)
FT                   /gene="ptsG"
FT                   /locus_tag="BpOF4_10450"
FT   CDS_pept        complement(527091..529121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsG"
FT                   /locus_tag="BpOF4_10450"
FT                   /product="PTS system, glucose-specific enzyme II, A
FT                   component"
FT                   /note="COG1263 Phosphotransferase system IIC components,
FT                   glucose/maltose/N-acetylglucosamine-specific"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10450"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50143"
FT                   /db_xref="GOA:D3FUH3"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH3"
FT                   /protein_id="ADC50143.1"
FT   gene            complement(529334..530164)
FT                   /gene="glcT"
FT                   /locus_tag="BpOF4_10455"
FT   CDS_pept        complement(529334..530164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcT"
FT                   /locus_tag="BpOF4_10455"
FT                   /product="transcription antiterminator GlcT"
FT                   /note="COG3711 Transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50144"
FT                   /db_xref="GOA:D3FUH4"
FT                   /db_xref="InterPro:IPR001550"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH4"
FT                   /protein_id="ADC50144.1"
FT   gene            530332..530733
FT                   /locus_tag="BpOF4_10460"
FT   CDS_pept        530332..530733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10460"
FT                   /product="hypothetical protein"
FT                   /note="COG3011 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10460"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50145"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH5"
FT                   /protein_id="ADC50145.1"
FT   gene            530899..532245
FT                   /locus_tag="BpOF4_10465"
FT   CDS_pept        530899..532245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10465"
FT                   /product="putative sodium-dependent transporter"
FT                   /note="COG0733 Na+-dependent transporters of the SNF
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10465"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50146"
FT                   /db_xref="GOA:D3FUH6"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH6"
FT                   /protein_id="ADC50146.1"
FT   gene            532398..532736
FT                   /locus_tag="BpOF4_10470"
FT   CDS_pept        532398..532736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10470"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50147"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH7"
FT                   /protein_id="ADC50147.1"
FT                   AEQSAQNE"
FT   gene            532778..533680
FT                   /locus_tag="BpOF4_10475"
FT   CDS_pept        532778..533680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10475"
FT                   /product="hypothetical protein"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10475"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50148"
FT                   /db_xref="GOA:D3FUH8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH8"
FT                   /protein_id="ADC50148.1"
FT   repeat_region   complement(533780..534183)
FT                   /rpt_family="bpr2"
FT                   /note="bpr2_3R"
FT   gene            complement(534206..535369)
FT                   /gene="iscS"
FT                   /locus_tag="BpOF4_10480"
FT   CDS_pept        complement(534206..535369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="BpOF4_10480"
FT                   /product="cysteine desulfurase"
FT                   /note="COG1104 Cysteine sulfinate desulfinase/cysteine
FT                   desulfurase and related enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10480"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50149"
FT                   /db_xref="GOA:D3FUH9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUH9"
FT                   /protein_id="ADC50149.1"
FT   gene            535462..537045
FT                   /gene="nadB"
FT                   /locus_tag="BpOF4_10485"
FT   CDS_pept        535462..537045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="BpOF4_10485"
FT                   /product="L-aspartate oxidase"
FT                   /note="COG0029 Aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10485"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50150"
FT                   /db_xref="GOA:D3FUI0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI0"
FT                   /protein_id="ADC50150.1"
FT                   PVKEKERVLK"
FT   gene            537003..537896
FT                   /gene="nadC"
FT                   /locus_tag="BpOF4_10490"
FT   CDS_pept        537003..537896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="BpOF4_10490"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /note="COG0157 Nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50151"
FT                   /db_xref="GOA:D3FUI1"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI1"
FT                   /protein_id="ADC50151.1"
FT                   LDISLDVSVKEGVSHA"
FT   gene            537898..538995
FT                   /gene="nadA"
FT                   /locus_tag="BpOF4_10495"
FT   CDS_pept        537898..538995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="BpOF4_10495"
FT                   /product="quinolinate synthetase"
FT                   /note="COG0379 Quinolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10495"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50152"
FT                   /db_xref="GOA:D3FUI2"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023515"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI2"
FT                   /protein_id="ADC50152.1"
FT   gene            539149..540507
FT                   /gene="norM"
FT                   /locus_tag="BpOF4_10500"
FT   CDS_pept        539149..540507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norM"
FT                   /locus_tag="BpOF4_10500"
FT                   /product="multidrug efflux protein Na+-coupled MatE type"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10500"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50153"
FT                   /db_xref="GOA:D3FUI3"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI3"
FT                   /protein_id="ADC50153.1"
FT   repeat_region   complement(540631..540731)
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_9R"
FT   gene            complement(540786..541037)
FT                   /locus_tag="BpOF4_10505"
FT   CDS_pept        complement(540786..541037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10505"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50154"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI4"
FT                   /protein_id="ADC50154.1"
FT   gene            complement(541097..541234)
FT                   /locus_tag="BpOF4_10510"
FT   CDS_pept        complement(541097..541234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10510"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50155"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI5"
FT                   /protein_id="ADC50155.1"
FT                   "
FT   gene            541338..541979
FT                   /locus_tag="BpOF4_10515"
FT   CDS_pept        541338..541979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10515"
FT                   /product="ribonuclease H-related protein"
FT                   /note="COG3341 Predicted double-stranded RNA/RNA-DNA hybrid
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10515"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50156"
FT                   /db_xref="GOA:D3FUI6"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017290"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI6"
FT                   /protein_id="ADC50156.1"
FT   gene            542031..543392
FT                   /gene="ywdH"
FT                   /locus_tag="BpOF4_10520"
FT   CDS_pept        542031..543392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ywdH"
FT                   /locus_tag="BpOF4_10520"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10520"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50157"
FT                   /db_xref="GOA:D3FUI7"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI7"
FT                   /protein_id="ADC50157.1"
FT   gene            543441..544817
FT                   /locus_tag="BpOF4_10525"
FT   CDS_pept        543441..544817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10525"
FT                   /product="lysine/ornithine N-monooxygenase"
FT                   /note="COG3486 Lysine/ornithine N-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10525"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50158"
FT                   /db_xref="GOA:D3FUI8"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI8"
FT                   /protein_id="ADC50158.1"
FT                   "
FT   gene            545105..546562
FT                   /gene="katB"
FT                   /locus_tag="BpOF4_10530"
FT   CDS_pept        545105..546562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katB"
FT                   /locus_tag="BpOF4_10530"
FT                   /product="catalase"
FT                   /note="COG0753 Catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10530"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50159"
FT                   /db_xref="GOA:D3FUI9"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUI9"
FT                   /protein_id="ADC50159.1"
FT   gene            complement(546587..547723)
FT                   /gene="gerXC"
FT                   /locus_tag="BpOF4_10535"
FT   CDS_pept        complement(546587..547723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerXC"
FT                   /locus_tag="BpOF4_10535"
FT                   /product="germination protein, Ger(x)C family"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10535"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50160"
FT                   /db_xref="GOA:D3FUJ0"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ0"
FT                   /protein_id="ADC50160.1"
FT   gene            complement(547720..549141)
FT                   /gene="gerXA"
FT                   /locus_tag="BpOF4_10540"
FT   CDS_pept        complement(547720..549141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerXA"
FT                   /locus_tag="BpOF4_10540"
FT                   /product="GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10540"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50161"
FT                   /db_xref="GOA:D3FUJ1"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ1"
FT                   /protein_id="ADC50161.1"
FT                   RAPELDANDKTRGQS"
FT   gene            complement(549138..550226)
FT                   /gene="gerXB"
FT                   /locus_tag="BpOF4_10545"
FT   CDS_pept        complement(549138..550226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerXB"
FT                   /locus_tag="BpOF4_10545"
FT                   /product="putative spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10545"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50162"
FT                   /db_xref="GOA:D3FUJ2"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ2"
FT                   /protein_id="ADC50162.1"
FT   gene            complement(550312..550863)
FT                   /locus_tag="BpOF4_10550"
FT   CDS_pept        complement(550312..550863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10550"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="COG1670 Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10550"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50163"
FT                   /db_xref="GOA:D3FUJ3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ3"
FT                   /protein_id="ADC50163.1"
FT   gene            551069..552688
FT                   /gene="ggtA"
FT                   /locus_tag="BpOF4_10555"
FT   CDS_pept        551069..552688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggtA"
FT                   /locus_tag="BpOF4_10555"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /note="COG0405 Gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10555"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50164"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ4"
FT                   /protein_id="ADC50164.1"
FT   gene            complement(552855..553304)
FT                   /locus_tag="BpOF4_10560"
FT   CDS_pept        complement(552855..553304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10560"
FT                   /product="transcriptional regulator Lrp/AsnC type"
FT                   /note="COG1522 Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10560"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50165"
FT                   /db_xref="GOA:D3FUJ5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013199"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ5"
FT                   /protein_id="ADC50165.1"
FT   gene            553529..554095
FT                   /gene="chrA"
FT                   /locus_tag="BpOF4_10565"
FT   CDS_pept        553529..554095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="BpOF4_10565"
FT                   /product="chromate transporter"
FT                   /note="COG2059 Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10565"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50166"
FT                   /db_xref="GOA:D3FUJ6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ6"
FT                   /protein_id="ADC50166.1"
FT   gene            554092..554634
FT                   /gene="chrB"
FT                   /locus_tag="BpOF4_10570"
FT   CDS_pept        554092..554634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrB"
FT                   /locus_tag="BpOF4_10570"
FT                   /product="chromate transporter"
FT                   /note="COG2059 Chromate transport protein ChrA"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10570"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50167"
FT                   /db_xref="GOA:D3FUJ7"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ7"
FT                   /protein_id="ADC50167.1"
FT                   IAGALLYGGLFLGHGGV"
FT   repeat_region   complement(554641..554967)
FT                   /rpt_family="bpr2"
FT                   /note="bpr2_4R"
FT   gene            555219..556991
FT                   /locus_tag="BpOF4_10575"
FT   CDS_pept        555219..556991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10575"
FT                   /product="oligoendopeptidase F"
FT                   /note="COG1164 Oligoendopeptidase F"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10575"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50168"
FT                   /db_xref="GOA:D3FUJ8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ8"
FT                   /protein_id="ADC50168.1"
FT                   VLADVDEFMRLTDK"
FT   gene            557167..558864
FT                   /locus_tag="BpOF4_10580"
FT   CDS_pept        557167..558864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10580"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="COG0840 Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10580"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50169"
FT                   /db_xref="GOA:D3FUJ9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUJ9"
FT                   /protein_id="ADC50169.1"
FT   repeat_region   558919..559098
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_10F"
FT   gene            complement(559171..560199)
FT                   /gene="cydB"
FT                   /locus_tag="BpOF4_10585"
FT   CDS_pept        complement(559171..560199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="BpOF4_10585"
FT                   /product="cytochrome d ubiquinol oxidase subunit II"
FT                   /note="COG1294 Cytochrome bd-type quinol oxidase, subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10585"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50170"
FT                   /db_xref="GOA:D3FUK0"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK0"
FT                   /protein_id="ADC50170.1"
FT                   EG"
FT   gene            complement(560231..561574)
FT                   /gene="cydA"
FT                   /locus_tag="BpOF4_10590"
FT   CDS_pept        complement(560231..561574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="BpOF4_10590"
FT                   /product="cytochrome d (bd-type) ubiquinol oxidase subunit
FT                   I"
FT                   /note="COG1271 Cytochrome bd-type quinol oxidase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10590"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50171"
FT                   /db_xref="GOA:D3FUK1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK1"
FT                   /protein_id="ADC50171.1"
FT   gene            complement(561742..561882)
FT                   /locus_tag="BpOF4_10595"
FT   CDS_pept        complement(561742..561882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10595"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50172"
FT                   /db_xref="InterPro:IPR025004"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK2"
FT                   /protein_id="ADC50172.1"
FT                   S"
FT   gene            562091..562516
FT                   /locus_tag="BpOF4_10600"
FT   CDS_pept        562091..562516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10600"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50173"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK3"
FT                   /protein_id="ADC50173.1"
FT   gene            562758..562904
FT                   /locus_tag="BpOF4_10605"
FT   CDS_pept        562758..562904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10605"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50174"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK4"
FT                   /protein_id="ADC50174.1"
FT                   AYN"
FT   gene            562975..563934
FT                   /gene="yqjP"
FT                   /locus_tag="BpOF4_10610"
FT   CDS_pept        562975..563934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqjP"
FT                   /locus_tag="BpOF4_10610"
FT                   /product="Zn-dependent hydrolase"
FT                   /note="COG0491 Zn-dependent hydrolases, including
FT                   glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10610"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50175"
FT                   /db_xref="GOA:D3FUK5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK5"
FT                   /protein_id="ADC50175.1"
FT   gene            564053..564409
FT                   /locus_tag="BpOF4_10615"
FT   CDS_pept        564053..564409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10615"
FT                   /product="hypothetical protein"
FT                   /note="COG0840 Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10615"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50176"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK6"
FT                   /protein_id="ADC50176.1"
FT                   KEAAEEVKQLKNKE"
FT   gene            complement(564931..566136)
FT                   /locus_tag="BpOF4_10620"
FT   CDS_pept        complement(564931..566136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10620"
FT                   /product="putative MFS major facilitator transporter"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10620"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50177"
FT                   /db_xref="GOA:D3FUK7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK7"
FT                   /protein_id="ADC50177.1"
FT                   SK"
FT   gene            566296..566676
FT                   /locus_tag="BpOF4_10625"
FT   CDS_pept        566296..566676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10625"
FT                   /product="hypothetical protein"
FT                   /note="COG1765 Predicted redox protein, regulator of
FT                   disulfide bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10625"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50178"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK8"
FT                   /protein_id="ADC50178.1"
FT   gene            566815..568185
FT                   /gene="norM2"
FT                   /locus_tag="BpOF4_10630"
FT   CDS_pept        566815..568185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="norM2"
FT                   /locus_tag="BpOF4_10630"
FT                   /product="MATE sodium coupled multidrug efflux transporter"
FT                   /note="COG0534 Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10630"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50179"
FT                   /db_xref="GOA:D3FUK9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUK9"
FT                   /protein_id="ADC50179.1"
FT   gene            568233..568847
FT                   /locus_tag="BpOF4_10635"
FT   CDS_pept        568233..568847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10635"
FT                   /product="hypothetical protein"
FT                   /note="COG2364 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10635"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50180"
FT                   /db_xref="GOA:D3FUL0"
FT                   /db_xref="InterPro:IPR038750"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL0"
FT                   /protein_id="ADC50180.1"
FT   gene            568979..570328
FT                   /locus_tag="BpOF4_10640"
FT   CDS_pept        568979..570328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10640"
FT                   /product="ISBma2, transposase"
FT                   /note="COG3666 Transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10640"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50181"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL1"
FT                   /protein_id="ADC50181.1"
FT   gene            complement(570464..571258)
FT                   /gene="proC"
FT                   /locus_tag="BpOF4_10645"
FT   CDS_pept        complement(570464..571258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="BpOF4_10645"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /note="COG0345 Pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10645"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50182"
FT                   /db_xref="GOA:D3FUL2"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL2"
FT                   /protein_id="ADC50182.1"
FT   gene            571385..572233
FT                   /locus_tag="BpOF4_10650"
FT   CDS_pept        571385..572233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10650"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50183"
FT                   /db_xref="InterPro:IPR025548"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL3"
FT                   /protein_id="ADC50183.1"
FT                   K"
FT   repeat_region   complement(572259..572426)
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_11R"
FT   gene            complement(572496..573608)
FT                   /locus_tag="BpOF4_10655"
FT   CDS_pept        complement(572496..573608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10655"
FT                   /product="hypothetical protein"
FT                   /note="COG0535 Predicted Fe-S oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10655"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50184"
FT                   /db_xref="GOA:D3FUL4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014866"
FT                   /db_xref="InterPro:IPR031004"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL4"
FT                   /protein_id="ADC50184.1"
FT   gene            573866..574054
FT                   /locus_tag="BpOF4_10660"
FT   CDS_pept        573866..574054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10660"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50185"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL5"
FT                   /protein_id="ADC50185.1"
FT                   LDDIEVKCKQFRNDWSE"
FT   gene            574067..574705
FT                   /locus_tag="BpOF4_10665"
FT   CDS_pept        574067..574705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10665"
FT                   /product="hypothetical protein"
FT                   /note="COG0406 Fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10665"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50186"
FT                   /db_xref="GOA:D3FUL6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR003094"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL6"
FT                   /protein_id="ADC50186.1"
FT   gene            574839..575012
FT                   /locus_tag="BpOF4_10670"
FT   CDS_pept        574839..575012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10670"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50187"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL7"
FT                   /protein_id="ADC50187.1"
FT                   FYFEEELEQLTT"
FT   gene            575174..575371
FT                   /gene="cspC2"
FT                   /locus_tag="BpOF4_10675"
FT   CDS_pept        575174..575371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC2"
FT                   /locus_tag="BpOF4_10675"
FT                   /product="cold shock protein"
FT                   /note="COG1278 Cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10675"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50188"
FT                   /db_xref="GOA:D3FUL8"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL8"
FT                   /protein_id="ADC50188.1"
FT   gene            575525..577069
FT                   /gene="fumA"
FT                   /locus_tag="BpOF4_10680"
FT   CDS_pept        575525..577069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="BpOF4_10680"
FT                   /product="fumarate hydratase class I (fumarase)"
FT                   /note="COG1951 Tartrate dehydratase alpha subunit/Fumarate
FT                   hydratase class I, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10680"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50189"
FT                   /db_xref="GOA:D3FUL9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR011167"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUL9"
FT                   /protein_id="ADC50189.1"
FT   repeat_region   577125..577304
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_12F"
FT   gene            complement(577245..577352)
FT                   /locus_tag="BpOF4_10685"
FT   CDS_pept        complement(577245..577352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10685"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10685"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50190"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM0"
FT                   /protein_id="ADC50190.1"
FT   gene            577454..578254
FT                   /locus_tag="BpOF4_10690"
FT   CDS_pept        577454..578254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10690"
FT                   /product="polysaccharide deacetylase for xylans/chitin"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10690"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50191"
FT                   /db_xref="GOA:D3FUM1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM1"
FT                   /protein_id="ADC50191.1"
FT   repeat_region   complement(578251..578526)
FT                   /rpt_family="bcr3"
FT                   /note="bcr3b_2R-1/II"
FT   gene            complement(578593..578955)
FT                   /locus_tag="BpOF4_10695"
FT   CDS_pept        complement(578593..578955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10695"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10695"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50192"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM2"
FT                   /protein_id="ADC50192.1"
FT                   TLETIASAIGQESLVS"
FT   gene            579091..580506
FT                   /locus_tag="BpOF4_10700"
FT   CDS_pept        579091..580506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10700"
FT                   /product="RNA methyltransferase"
FT                   /note="COG2265 SAM-dependent methyltransferases related to
FT                   tRNA (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10700"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50193"
FT                   /db_xref="GOA:D3FUM3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM3"
FT                   /protein_id="ADC50193.1"
FT                   TAQVESVTVLSKS"
FT   gene            580629..583031
FT                   /locus_tag="BpOF4_10705"
FT   CDS_pept        580629..583031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10705"
FT                   /product="penicillin acylase II"
FT                   /note="COG2366 Protein related to penicillin acylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10705"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50194"
FT                   /db_xref="GOA:D3FUM4"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="InterPro:IPR023343"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM4"
FT                   /protein_id="ADC50194.1"
FT   gene            complement(583079..583342)
FT                   /locus_tag="BpOF4_10710"
FT   CDS_pept        complement(583079..583342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10710"
FT                   /product="hypothetical protein"
FT                   /note="COG2314 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10710"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50195"
FT                   /db_xref="GOA:D3FUM5"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM5"
FT                   /protein_id="ADC50195.1"
FT   gene            583514..584416
FT                   /gene="ycsN"
FT                   /locus_tag="BpOF4_10715"
FT   CDS_pept        583514..584416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycsN"
FT                   /locus_tag="BpOF4_10715"
FT                   /product="YcsN predicted aldo-keto reductase"
FT                   /note="COG4989 Predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10715"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50196"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM6"
FT                   /protein_id="ADC50196.1"
FT   gene            complement(584494..585249)
FT                   /locus_tag="BpOF4_10720"
FT   CDS_pept        complement(584494..585249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10720"
FT                   /product="short chain dehydrogenase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10720"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50197"
FT                   /db_xref="GOA:D3FUM7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM7"
FT                   /protein_id="ADC50197.1"
FT   gene            585410..587056
FT                   /gene="rocB"
FT                   /locus_tag="BpOF4_10725"
FT   CDS_pept        585410..587056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocB"
FT                   /locus_tag="BpOF4_10725"
FT                   /product="arginine degradation protein"
FT                   /note="COG4187 Arginine degradation protein (predicted
FT                   deacylase)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10725"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50198"
FT                   /db_xref="GOA:D3FUM8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR012166"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM8"
FT                   /protein_id="ADC50198.1"
FT   repeat_region   complement(587091..587272)
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_13R"
FT   gene            complement(587115..587273)
FT                   /locus_tag="BpOF4_10730"
FT   CDS_pept        complement(587115..587273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10730"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50199"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUM9"
FT                   /protein_id="ADC50199.1"
FT                   ISSLTYA"
FT   gene            complement(587266..587499)
FT                   /locus_tag="BpOF4_10735"
FT   CDS_pept        complement(587266..587499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10735"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50200"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN0"
FT                   /protein_id="ADC50200.1"
FT   repeat_region   587301..587682
FT                   /rpt_family="bcr3"
FT                   /note="bcr3ab_3F-1/II/III"
FT   gene            complement(587524..587640)
FT                   /locus_tag="BpOF4_10740"
FT   CDS_pept        complement(587524..587640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10740"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50201"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN1"
FT                   /protein_id="ADC50201.1"
FT   gene            complement(587683..588405)
FT                   /gene="glnQ"
FT                   /locus_tag="BpOF4_10745"
FT   CDS_pept        complement(587683..588405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="BpOF4_10745"
FT                   /product="glutamine ABC transporter ATP-binding protein"
FT                   /note="COG1126 ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10745"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50202"
FT                   /db_xref="GOA:D3FUN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN2"
FT                   /protein_id="ADC50202.1"
FT                   IFDDPQHPRLKAFLSKVL"
FT   gene            complement(588405..589067)
FT                   /gene="glnP"
FT                   /locus_tag="BpOF4_10750"
FT   CDS_pept        complement(588405..589067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="BpOF4_10750"
FT                   /product="glutamine ABC transporter permease"
FT                   /note="COG0765 ABC-type amino acid transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10750"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50203"
FT                   /db_xref="GOA:D3FUN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN3"
FT                   /protein_id="ADC50203.1"
FT   gene            complement(589161..589964)
FT                   /gene="glnH"
FT                   /locus_tag="BpOF4_10755"
FT   CDS_pept        complement(589161..589964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="BpOF4_10755"
FT                   /product="glutamine ABC transporter substrate-binding
FT                   protein"
FT                   /note="COG0834 ABC-type amino acid transport/signal
FT                   transduction systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10755"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50204"
FT                   /db_xref="GOA:D3FUN4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN4"
FT                   /protein_id="ADC50204.1"
FT   gene            590275..590571
FT                   /locus_tag="BpOF4_10760"
FT   CDS_pept        590275..590571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10760"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50205"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN5"
FT                   /protein_id="ADC50205.1"
FT   repeat_region   590639..590749
FT                   /rpt_family="bpr2"
FT                   /note="P_bpr2_7F (partial)"
FT   gene            complement(590824..591213)
FT                   /gene="ectC"
FT                   /locus_tag="BpOF4_10765"
FT   CDS_pept        complement(590824..591213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ectC"
FT                   /locus_tag="BpOF4_10765"
FT                   /product="L-ectoine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10765"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50206"
FT                   /db_xref="GOA:D3FUN6"
FT                   /db_xref="InterPro:IPR010462"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN6"
FT                   /protein_id="ADC50206.1"
FT   gene            complement(591303..592586)
FT                   /gene="ectB"
FT                   /locus_tag="BpOF4_10770"
FT   CDS_pept        complement(591303..592586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ectB"
FT                   /locus_tag="BpOF4_10770"
FT                   /product="diaminobutyrate--2-oxoglutarate aminotransferase"
FT                   /note="COG0160 4-aminobutyrate aminotransferase and related
FT                   aminotransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10770"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50207"
FT                   /db_xref="GOA:D3FUN7"
FT                   /db_xref="InterPro:IPR004637"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR012773"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN7"
FT                   /protein_id="ADC50207.1"
FT   gene            complement(592685..593119)
FT                   /gene="ectA"
FT                   /locus_tag="BpOF4_10775"
FT   CDS_pept        complement(592685..593119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ectA"
FT                   /locus_tag="BpOF4_10775"
FT                   /product="diaminobutyric acid acetyltransferase"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10775"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50208"
FT                   /db_xref="GOA:D3FUN8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012772"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUN8"
FT                   /protein_id="ADC50208.1"
FT   gene            complement(593529..593693)
FT                   /locus_tag="BpOF4_10780"
FT   CDS_pept        complement(593529..593693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10780"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50209"
FT                   /db_xref="GOA:P35142"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35142"
FT                   /protein_id="ADC50209.1"
FT                   GKRQKKNQQ"
FT   gene            complement(593783..593905)
FT                   /locus_tag="BpOF4_10785"
FT   CDS_pept        complement(593783..593905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10785"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50210"
FT                   /db_xref="InterPro:IPR025437"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP0"
FT                   /protein_id="ADC50210.1"
FT   gene            complement(593969..594577)
FT                   /locus_tag="BpOF4_10790"
FT   CDS_pept        complement(593969..594577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10790"
FT                   /product="Ribosomal-protein-alanine acetyltransferase"
FT                   /note="COG1670 Acetyltransferases, including N-acetylases
FT                   of ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10790"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50211"
FT                   /db_xref="GOA:D3FUP1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP1"
FT                   /protein_id="ADC50211.1"
FT   gene            complement(594886..595791)
FT                   /locus_tag="BpOF4_10795"
FT   CDS_pept        complement(594886..595791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10795"
FT                   /product="cell-division inhibitor"
FT                   /note="COG1090 Predicted nucleoside-diphosphate sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10795"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50212"
FT                   /db_xref="GOA:D3FUP2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP2"
FT                   /protein_id="ADC50212.1"
FT   gene            595916..596737
FT                   /gene="recX"
FT                   /locus_tag="BpOF4_10800"
FT   CDS_pept        595916..596737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="BpOF4_10800"
FT                   /product="recombination regulator RecX"
FT                   /note="COG2137 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10800"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50213"
FT                   /db_xref="GOA:D3FUP3"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP3"
FT                   /protein_id="ADC50213.1"
FT   gene            596792..597103
FT                   /locus_tag="BpOF4_10805"
FT   CDS_pept        596792..597103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10805"
FT                   /product="hypothetical protein"
FT                   /note="COG0582 Integrase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10805"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50214"
FT                   /db_xref="InterPro:IPR014938"
FT                   /db_xref="InterPro:IPR036289"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP4"
FT                   /protein_id="ADC50214.1"
FT   gene            complement(597135..597284)
FT                   /locus_tag="BpOF4_10810"
FT   CDS_pept        complement(597135..597284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10810"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50215"
FT                   /db_xref="InterPro:IPR025413"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP5"
FT                   /protein_id="ADC50215.1"
FT                   RKRS"
FT   gene            complement(597311..597451)
FT                   /locus_tag="BpOF4_10815"
FT   CDS_pept        complement(597311..597451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10815"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50216"
FT                   /db_xref="GOA:D3FUP6"
FT                   /db_xref="InterPro:IPR012611"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP6"
FT                   /protein_id="ADC50216.1"
FT                   Q"
FT   gene            597592..597858
FT                   /locus_tag="BpOF4_10820"
FT   CDS_pept        597592..597858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10820"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50217"
FT                   /db_xref="InterPro:IPR026952"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP7"
FT                   /protein_id="ADC50217.1"
FT   gene            complement(597907..598890)
FT                   /locus_tag="BpOF4_10825"
FT   CDS_pept        complement(597907..598890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10825"
FT                   /product="hypothetical protein"
FT                   /note="COG1988 Predicted membrane-bound metal-dependent
FT                   hydrolases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10825"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50218"
FT                   /db_xref="GOA:D3FUP8"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP8"
FT                   /protein_id="ADC50218.1"
FT   gene            599044..599355
FT                   /locus_tag="BpOF4_10830"
FT   CDS_pept        599044..599355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10830"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50219"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUP9"
FT                   /protein_id="ADC50219.1"
FT   gene            599366..600454
FT                   /locus_tag="BpOF4_10835"
FT   CDS_pept        599366..600454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10835"
FT                   /product="A/G-specific DNA adenine glycosylase"
FT                   /note="COG1194 A/G-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10835"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50220"
FT                   /db_xref="GOA:D3FUQ0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ0"
FT                   /protein_id="ADC50220.1"
FT   gene            600503..601258
FT                   /locus_tag="BpOF4_10840"
FT   CDS_pept        600503..601258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10840"
FT                   /product="3-oxoacyl-(acyl-carrier protein) reductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10840"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50221"
FT                   /db_xref="GOA:D3FUQ1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ1"
FT                   /protein_id="ADC50221.1"
FT   repeat_region   601332..601494
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_14F"
FT   gene            complement(601553..601888)
FT                   /locus_tag="BpOF4_10845"
FT   CDS_pept        complement(601553..601888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10845"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10845"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50222"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ2"
FT                   /protein_id="ADC50222.1"
FT                   HLVNNDQ"
FT   gene            complement(601994..602956)
FT                   /locus_tag="BpOF4_10850"
FT   CDS_pept        complement(601994..602956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10850"
FT                   /product="putative Zn alcohol dehydrogenase/quinone
FT                   reductase"
FT                   /note="COG0604 NADPH:quinone reductase and related
FT                   Zn-dependent oxidoreductases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10850"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50223"
FT                   /db_xref="GOA:D3FUQ3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ3"
FT                   /protein_id="ADC50223.1"
FT   gene            complement(602969..604123)
FT                   /gene="aspB"
FT                   /locus_tag="BpOF4_10855"
FT   CDS_pept        complement(602969..604123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspB"
FT                   /locus_tag="BpOF4_10855"
FT                   /product="aspartate aminotransferase"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10855"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50224"
FT                   /db_xref="GOA:D3FUQ4"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ4"
FT                   /protein_id="ADC50224.1"
FT   gene            complement(604253..604474)
FT                   /locus_tag="BpOF4_10860"
FT   CDS_pept        complement(604253..604474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10860"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50225"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ5"
FT                   /protein_id="ADC50225.1"
FT   gene            604596..605345
FT                   /locus_tag="BpOF4_10865"
FT   CDS_pept        604596..605345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10865"
FT                   /product="enoyl-(acyl carrier protein) reductase"
FT                   /note="COG1028 Dehydrogenases with different specificities
FT                   (related to short-chain alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10865"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50226"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ6"
FT                   /protein_id="ADC50226.1"
FT   gene            605406..605636
FT                   /locus_tag="BpOF4_10870"
FT   CDS_pept        605406..605636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10870"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50227"
FT                   /db_xref="GOA:D3FUQ7"
FT                   /db_xref="InterPro:IPR006341"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ7"
FT                   /protein_id="ADC50227.1"
FT   gene            605946..606473
FT                   /locus_tag="BpOF4_10875"
FT   CDS_pept        605946..606473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10875"
FT                   /product="hypothetical protein"
FT                   /note="COG3557 Uncharacterized domain/protein associated
FT                   with RNAses G and E"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10875"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50228"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016882"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ8"
FT                   /protein_id="ADC50228.1"
FT                   VESWYERFLQYR"
FT   gene            606552..608297
FT                   /locus_tag="BpOF4_10880"
FT   CDS_pept        606552..608297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10880"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="COG1132 ABC-type multidrug transport system, ATPase
FT                   and permease components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10880"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50229"
FT                   /db_xref="GOA:D3FUQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUQ9"
FT                   /protein_id="ADC50229.1"
FT                   VQQLS"
FT   gene            complement(608349..609434)
FT                   /locus_tag="BpOF4_10885"
FT   CDS_pept        complement(608349..609434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10885"
FT                   /product="putative integral membrane protein"
FT                   /note="COG4129 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10885"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50230"
FT                   /db_xref="GOA:D3FUR0"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR0"
FT                   /protein_id="ADC50230.1"
FT   gene            complement(609851..611149)
FT                   /gene="gsaB"
FT                   /locus_tag="BpOF4_10890"
FT   CDS_pept        complement(609851..611149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsaB"
FT                   /locus_tag="BpOF4_10890"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /note="COG0001 Glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10890"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50231"
FT                   /db_xref="GOA:D3FUR1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR1"
FT                   /protein_id="ADC50231.1"
FT   gene            complement(611338..611493)
FT                   /locus_tag="BpOF4_10895"
FT   CDS_pept        complement(611338..611493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10895"
FT                   /product="hypothetical protein"
FT                   /note="akc4"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10895"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50232"
FT                   /db_xref="InterPro:IPR015064"
FT                   /db_xref="InterPro:IPR036916"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR2"
FT                   /protein_id="ADC50232.1"
FT                   STHPQE"
FT   gene            611700..612125
FT                   /locus_tag="BpOF4_10900"
FT   CDS_pept        611700..612125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10900"
FT                   /product="Ion transport protein"
FT                   /note="COG1226 Kef-type K+ transport systems, predicted
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10900"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50233"
FT                   /db_xref="GOA:D3FUR3"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR3"
FT                   /protein_id="ADC50233.1"
FT   gene            612191..612664
FT                   /locus_tag="BpOF4_10905"
FT   CDS_pept        612191..612664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10905"
FT                   /product="bacterioferritin comigratory protein
FT                   peroxiredoxin"
FT                   /note="COG1225 Peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10905"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50234"
FT                   /db_xref="GOA:D3FUR4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR4"
FT                   /protein_id="ADC50234.1"
FT   gene            612749..613702
FT                   /gene="serA"
FT                   /locus_tag="BpOF4_10910"
FT   CDS_pept        612749..613702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="BpOF4_10910"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="COG0111 Phosphoglycerate dehydrogenase and related
FT                   dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10910"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50235"
FT                   /db_xref="GOA:D3FUR5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR5"
FT                   /protein_id="ADC50235.1"
FT   gene            613721..614008
FT                   /gene="yaaQ"
FT                   /locus_tag="BpOF4_10915"
FT   CDS_pept        613721..614008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaQ"
FT                   /locus_tag="BpOF4_10915"
FT                   /product="protein from nitrogen regulatory protein P-II"
FT                   /note="COG3870 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10915"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50236"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR6"
FT                   /protein_id="ADC50236.1"
FT   gene            614127..614564
FT                   /gene="perR"
FT                   /locus_tag="BpOF4_10920"
FT   CDS_pept        614127..614564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="perR"
FT                   /locus_tag="BpOF4_10920"
FT                   /product="FUR family transcriptional regulator PerR"
FT                   /note="COG0735 Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10920"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50237"
FT                   /db_xref="GOA:D3FUR7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR7"
FT                   /protein_id="ADC50237.1"
FT   gene            complement(614633..614989)
FT                   /locus_tag="BpOF4_10925"
FT   CDS_pept        complement(614633..614989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10925"
FT                   /product="hypothetical protein"
FT                   /note="COG2804 Type II secretory pathway, ATPase PulE/Tfp
FT                   pilus assembly pathway, ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10925"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50238"
FT                   /db_xref="GOA:D3FUR8"
FT                   /db_xref="InterPro:IPR020912"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR8"
FT                   /protein_id="ADC50238.1"
FT                   KEFDESYNNKSKRS"
FT   gene            615183..616052
FT                   /locus_tag="BpOF4_10930"
FT   CDS_pept        615183..616052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10930"
FT                   /product="hypothetical protein"
FT                   /note="ygxA"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10930"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50239"
FT                   /db_xref="InterPro:IPR029348"
FT                   /db_xref="InterPro:IPR041143"
FT                   /db_xref="UniProtKB/TrEMBL:D3FUR9"
FT                   /protein_id="ADC50239.1"
FT                   HIRYRLNT"
FT   gene            616325..617885
FT                   /locus_tag="BpOF4_r19945"
FT   rRNA            616325..617885
FT                   /locus_tag="BpOF4_r19945"
FT                   /product="16S ribosomal RNA"
FT   gene            618120..621060
FT                   /locus_tag="BpOF4_r19959"
FT   rRNA            618120..621060
FT                   /locus_tag="BpOF4_r19959"
FT                   /product="23S ribosomal RNA"
FT   gene            621302..621417
FT                   /locus_tag="BpOF4_r19931"
FT   rRNA            621302..621417
FT                   /locus_tag="BpOF4_r19931"
FT                   /product="5S ribosomal RNA"
FT   gene            621426..621500
FT                   /locus_tag="BpOF4_t19875"
FT   tRNA            621426..621500
FT                   /locus_tag="BpOF4_t19875"
FT                   /product="tRNA-Asn"
FT   gene            621505..621598
FT                   /locus_tag="BpOF4_t19877"
FT   tRNA            621505..621598
FT                   /locus_tag="BpOF4_t19877"
FT                   /product="tRNA-Ser"
FT   gene            621625..621699
FT                   /locus_tag="BpOF4_t19879"
FT   tRNA            621625..621699
FT                   /locus_tag="BpOF4_t19879"
FT                   /product="tRNA-Glu"
FT   gene            621725..621800
FT                   /locus_tag="BpOF4_t19881"
FT   tRNA            621725..621800
FT                   /locus_tag="BpOF4_t19881"
FT                   /product="tRNA-Val"
FT   gene            621831..621907
FT                   /locus_tag="BpOF4_t19883"
FT   tRNA            621831..621907
FT                   /locus_tag="BpOF4_t19883"
FT                   /product="tRNA-Met"
FT   gene            621912..621988
FT                   /locus_tag="BpOF4_t19885"
FT   tRNA            621912..621988
FT                   /locus_tag="BpOF4_t19885"
FT                   /product="tRNA-Asp"
FT   gene            622001..622076
FT                   /locus_tag="BpOF4_t19887"
FT   tRNA            622001..622076
FT                   /locus_tag="BpOF4_t19887"
FT                   /product="tRNA-Phe"
FT   gene            622151..622235
FT                   /locus_tag="BpOF4_t19889"
FT   tRNA            622151..622235
FT                   /locus_tag="BpOF4_t19889"
FT                   /product="tRNA-Tyr"
FT   gene            622243..622316
FT                   /locus_tag="BpOF4_t19891"
FT   tRNA            622243..622316
FT                   /locus_tag="BpOF4_t19891"
FT                   /product="tRNA-Trp"
FT   gene            622330..622405
FT                   /locus_tag="BpOF4_t19893"
FT   tRNA            622330..622405
FT                   /locus_tag="BpOF4_t19893"
FT                   /product="tRNA-His"
FT   gene            622416..622490
FT                   /locus_tag="BpOF4_t19895"
FT   tRNA            622416..622490
FT                   /locus_tag="BpOF4_t19895"
FT                   /product="tRNA-Gln"
FT   gene            622497..622571
FT                   /locus_tag="BpOF4_t19897"
FT   tRNA            622497..622571
FT                   /locus_tag="BpOF4_t19897"
FT                   /product="tRNA-Gly"
FT   gene            622590..622663
FT                   /locus_tag="BpOF4_t19899"
FT   tRNA            622590..622663
FT                   /locus_tag="BpOF4_t19899"
FT                   /product="tRNA-Cys"
FT   gene            622680..622768
FT                   /locus_tag="BpOF4_t19901"
FT   tRNA            622680..622768
FT                   /locus_tag="BpOF4_t19901"
FT                   /product="tRNA-Leu"
FT   gene            622775..622851
FT                   /locus_tag="BpOF4_t19903"
FT   tRNA            622775..622851
FT                   /locus_tag="BpOF4_t19903"
FT                   /product="tRNA-Arg"
FT   gene            622878..622959
FT                   /locus_tag="BpOF4_t19905"
FT   tRNA            622878..622959
FT                   /locus_tag="BpOF4_t19905"
FT                   /product="tRNA-Leu"
FT   gene            623531..625201
FT                   /gene="ilvD"
FT                   /locus_tag="BpOF4_10935"
FT   CDS_pept        623531..625201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="BpOF4_10935"
FT                   /product="dihydroxyacid dehydratase phosphogluconate
FT                   dehydratase"
FT                   /note="COG0129 Dihydroxyacid dehydratase/phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10935"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50240"
FT                   /db_xref="GOA:D3FV39"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV39"
FT                   /protein_id="ADC50240.1"
FT   gene            625486..625860
FT                   /locus_tag="BpOF4_10940"
FT   CDS_pept        625486..625860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10940"
FT                   /product="hypothetical protein"
FT                   /note="COG0346 Lactoylglutathione lyase and related lyases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10940"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50241"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV40"
FT                   /protein_id="ADC50241.1"
FT   gene            625977..626804
FT                   /locus_tag="BpOF4_10945"
FT   CDS_pept        625977..626804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10945"
FT                   /product="putative DNA repair photolyase"
FT                   /note="COG1533 DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10945"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50242"
FT                   /db_xref="GOA:D3FV41"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV41"
FT                   /protein_id="ADC50242.1"
FT   gene            627135..627539
FT                   /locus_tag="BpOF4_10950"
FT   CDS_pept        627135..627539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10950"
FT                   /product="hypothetical protein"
FT                   /note="COG2149 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10950"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50243"
FT                   /db_xref="GOA:D3FV42"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV42"
FT                   /protein_id="ADC50243.1"
FT   gene            627584..627961
FT                   /locus_tag="BpOF4_10955"
FT   CDS_pept        627584..627961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10955"
FT                   /product="hypothetical protein"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10955"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50244"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV43"
FT                   /protein_id="ADC50244.1"
FT   gene            628005..628247
FT                   /locus_tag="BpOF4_10960"
FT   CDS_pept        628005..628247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10960"
FT                   /product="hypothetical protein"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10960"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50245"
FT                   /db_xref="GOA:D3FV44"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV44"
FT                   /protein_id="ADC50245.1"
FT   gene            628244..628624
FT                   /locus_tag="BpOF4_10965"
FT   CDS_pept        628244..628624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10965"
FT                   /product="polysaccharide deacetylase"
FT                   /note="COG0726 Predicted xylanase/chitin deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10965"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50246"
FT                   /db_xref="GOA:D3FV45"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV45"
FT                   /protein_id="ADC50246.1"
FT   gene            628636..629001
FT                   /locus_tag="BpOF4_10970"
FT   CDS_pept        628636..629001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10970"
FT                   /product="Rhodanese domain protein sulfurtransferase"
FT                   /note="COG0607 Rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10970"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50247"
FT                   /db_xref="GOA:D3FV46"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV46"
FT                   /protein_id="ADC50247.1"
FT                   GYSNITNVKGGMSAWRG"
FT   gene            complement(629042..630667)
FT                   /gene="kinE"
FT                   /locus_tag="BpOF4_10975"
FT   CDS_pept        complement(629042..630667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kinE"
FT                   /locus_tag="BpOF4_10975"
FT                   /product="PAS two-component sensor histidine kinase"
FT                   /note="COG0642 Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10975"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50248"
FT                   /db_xref="GOA:D3FV47"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV47"
FT                   /protein_id="ADC50248.1"
FT   gene            631067..633886
FT                   /locus_tag="BpOF4_10980"
FT   CDS_pept        631067..633886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10980"
FT                   /product="5' nucleotidase"
FT                   /note="COG0737 5'-nucleotidase/2',3'-cyclic
FT                   phosphodiesterase and related esterases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10980"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50249"
FT                   /db_xref="GOA:D3FV48"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV48"
FT                   /protein_id="ADC50249.1"
FT                   EAVKHPEFN"
FT   gene            634004..634612
FT                   /locus_tag="BpOF4_10985"
FT   CDS_pept        634004..634612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_10985"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10985"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50250"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV49"
FT                   /protein_id="ADC50250.1"
FT   gene            634736..636145
FT                   /gene="gabD"
FT                   /locus_tag="BpOF4_10990"
FT   CDS_pept        634736..636145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BpOF4_10990"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /note="COG1012 NAD-dependent aldehyde dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10990"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50251"
FT                   /db_xref="GOA:D3FV50"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV50"
FT                   /protein_id="ADC50251.1"
FT                   FLEVKYISLAF"
FT   gene            complement(636368..636808)
FT                   /gene="dpsA"
FT                   /locus_tag="BpOF4_10995"
FT   CDS_pept        complement(636368..636808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dpsA"
FT                   /locus_tag="BpOF4_10995"
FT                   /product="stress-and starvation-induced ferritin family DNA
FT                   binding protein, gene controlled by sigma-B"
FT                   /note="COG0783 DNA-binding ferritin-like protein (oxidative
FT                   damage protectant)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_10995"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50252"
FT                   /db_xref="GOA:D3FV51"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV51"
FT                   /protein_id="ADC50252.1"
FT   gene            complement(636912..637586)
FT                   /locus_tag="BpOF4_11000"
FT   CDS_pept        complement(636912..637586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11000"
FT                   /product="hypothetical protein"
FT                   /note="COG3382 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11000"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50253"
FT                   /db_xref="GOA:D3FV52"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV52"
FT                   /protein_id="ADC50253.1"
FT                   NL"
FT   gene            637661..638818
FT                   /locus_tag="BpOF4_11005"
FT   CDS_pept        637661..638818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11005"
FT                   /product="hypothetical protein"
FT                   /note="COG1600 Uncharacterized Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50254"
FT                   /db_xref="GOA:D3FV53"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV53"
FT                   /protein_id="ADC50254.1"
FT   gene            638888..639433
FT                   /gene="ogt"
FT                   /locus_tag="BpOF4_11010"
FT   CDS_pept        638888..639433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="BpOF4_11010"
FT                   /product="O6-methylguanine DNA alkyltransferase"
FT                   /note="COG0350 Methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50255"
FT                   /db_xref="GOA:D3FV54"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV54"
FT                   /protein_id="ADC50255.1"
FT                   LDKKEILLNLEGAIEKIS"
FT   gene            639561..640493
FT                   /locus_tag="BpOF4_11015"
FT   CDS_pept        639561..640493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11015"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50256"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV55"
FT                   /protein_id="ADC50256.1"
FT   gene            640641..641114
FT                   /locus_tag="BpOF4_11020"
FT   CDS_pept        640641..641114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11020"
FT                   /product="rRNA methylase"
FT                   /note="COG0219 Predicted rRNA methylase (SpoU class)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11020"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50257"
FT                   /db_xref="GOA:D3FV56"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV56"
FT                   /protein_id="ADC50257.1"
FT   gene            complement(641157..641246)
FT                   /locus_tag="BpOF4_11025"
FT   CDS_pept        complement(641157..641246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50258"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV57"
FT                   /protein_id="ADC50258.1"
FT                   /translation="MGTILILGVCVAFLAAIFTAGYEDNPHKN"
FT   gene            641420..641725
FT                   /locus_tag="BpOF4_11030"
FT   CDS_pept        641420..641725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11030"
FT                   /product="putative antibiotic synthesis monooxygenase"
FT                   /note="COG2329 Uncharacterized enzyme involved in
FT                   biosynthesis of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11030"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50259"
FT                   /db_xref="GOA:D3FV58"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV58"
FT                   /protein_id="ADC50259.1"
FT   gene            641842..642399
FT                   /gene="yufK"
FT                   /locus_tag="BpOF4_11035"
FT   CDS_pept        641842..642399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yufK"
FT                   /locus_tag="BpOF4_11035"
FT                   /product="YufK conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50260"
FT                   /db_xref="GOA:D3FV59"
FT                   /db_xref="InterPro:IPR035289"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV59"
FT                   /protein_id="ADC50260.1"
FT   gene            complement(642434..644290)
FT                   /gene="pbp4"
FT                   /locus_tag="BpOF4_11040"
FT   CDS_pept        complement(642434..644290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp4"
FT                   /locus_tag="BpOF4_11040"
FT                   /product="penicillin-binding protein 4"
FT                   /note="COG0744 Membrane carboxypeptidase
FT                   (penicillin-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50261"
FT                   /db_xref="GOA:D3FV60"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV60"
FT                   /protein_id="ADC50261.1"
FT   gene            644495..646390
FT                   /locus_tag="BpOF4_11045"
FT   CDS_pept        644495..646390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11045"
FT                   /product="serine protein kinase"
FT                   /note="COG2766 Putative Ser protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50262"
FT                   /db_xref="GOA:D3FV61"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV61"
FT                   /protein_id="ADC50262.1"
FT   gene            646700..647872
FT                   /locus_tag="BpOF4_11050"
FT   CDS_pept        646700..647872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11050"
FT                   /product="hypothetical protein"
FT                   /note="COG2718 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50263"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV62"
FT                   /protein_id="ADC50263.1"
FT   gene            647985..648968
FT                   /locus_tag="BpOF4_11055"
FT   CDS_pept        647985..648968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11055"
FT                   /product="D-threo-aldose 1-dehydrogenase"
FT                   /note="COG0667 Predicted oxidoreductases (related to
FT                   aryl-alcohol dehydrogenases)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50264"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV63"
FT                   /protein_id="ADC50264.1"
FT   gene            649134..650159
FT                   /gene="fdcP"
FT                   /locus_tag="BpOF4_11060"
FT   CDS_pept        649134..650159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdcP"
FT                   /locus_tag="BpOF4_11060"
FT                   /product="Ferric Dicitrate ABC binding protein"
FT                   /note="COG0614 ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50265"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV64"
FT                   /protein_id="ADC50265.1"
FT                   E"
FT   gene            650161..652143
FT                   /gene="fdcT"
FT                   /locus_tag="BpOF4_11065"
FT   CDS_pept        650161..652143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdcT"
FT                   /locus_tag="BpOF4_11065"
FT                   /product="Iron dicitrate ABC permease"
FT                   /note="COG0609 ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11065"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50266"
FT                   /db_xref="GOA:D3FV65"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV65"
FT                   /protein_id="ADC50266.1"
FT   gene            652170..653057
FT                   /gene="fdcA"
FT                   /locus_tag="BpOF4_11070"
FT   CDS_pept        652170..653057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdcA"
FT                   /locus_tag="BpOF4_11070"
FT                   /product="Iron dicitrate ABC ATPase"
FT                   /note="COG1120 ABC-type cobalamin/Fe3+-siderophores
FT                   transport systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11070"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50267"
FT                   /db_xref="GOA:D3FV66"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV66"
FT                   /protein_id="ADC50267.1"
FT                   REEVERIDPYKALS"
FT   gene            653032..653760
FT                   /gene="fchR"
FT                   /locus_tag="BpOF4_11075"
FT   CDS_pept        653032..653760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fchR"
FT                   /locus_tag="BpOF4_11075"
FT                   /product="Ferric Iron Reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11075"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50268"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV67"
FT                   /protein_id="ADC50268.1"
FT   gene            653875..654336
FT                   /gene="yqkA"
FT                   /locus_tag="BpOF4_11080"
FT   CDS_pept        653875..654336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqkA"
FT                   /locus_tag="BpOF4_11080"
FT                   /product="ribosomal-protein-alanine acetyltransferase-like
FT                   protein"
FT                   /note="COG0454 Histone acetyltransferase HPA2 and related
FT                   acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50269"
FT                   /db_xref="GOA:D3FV68"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV68"
FT                   /protein_id="ADC50269.1"
FT   repeat_region   complement(654355..654795)
FT                   /rpt_family="bpr2"
FT                   /note="bpr2_5R"
FT   gene            complement(654898..656079)
FT                   /locus_tag="BpOF4_11085"
FT   CDS_pept        complement(654898..656079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11085"
FT                   /product="hypothetical protein"
FT                   /note="COG2311 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50270"
FT                   /db_xref="GOA:D3FV69"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV69"
FT                   /protein_id="ADC50270.1"
FT   gene            656222..656974
FT                   /locus_tag="BpOF4_11090"
FT   CDS_pept        656222..656974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11090"
FT                   /product="NADPH-flavin oxidoreductase"
FT                   /note="COG0778 Nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11090"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50271"
FT                   /db_xref="GOA:D3FV70"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV70"
FT                   /protein_id="ADC50271.1"
FT   gene            657270..658448
FT                   /locus_tag="BpOF4_11095"
FT   CDS_pept        657270..658448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11095"
FT                   /product="transaminase"
FT                   /note="COG0436 Aspartate/tyrosine/aromatic
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11095"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50272"
FT                   /db_xref="GOA:D3FV71"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV71"
FT                   /protein_id="ADC50272.1"
FT   gene            658520..659416
FT                   /gene="katM"
FT                   /locus_tag="BpOF4_11100"
FT   CDS_pept        658520..659416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katM"
FT                   /locus_tag="BpOF4_11100"
FT                   /product="Mn catalase"
FT                   /note="COG3546 Mn-containing catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11100"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50273"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV72"
FT                   /protein_id="ADC50273.1"
FT                   KEDFDEIVKRLQRSAGI"
FT   gene            659533..660594
FT                   /locus_tag="BpOF4_11105"
FT   CDS_pept        659533..660594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11105"
FT                   /product="tartrate dehydrogenase"
FT                   /note="COG0473 Isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11105"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50274"
FT                   /db_xref="GOA:D3FV73"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV73"
FT                   /protein_id="ADC50274.1"
FT                   VSEEIISRIQQLT"
FT   gene            660609..661235
FT                   /locus_tag="BpOF4_11110"
FT   CDS_pept        660609..661235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11110"
FT                   /product="hypothetical protein"
FT                   /note="COG0179 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
FT                   (catechol pathway)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11110"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50275"
FT                   /db_xref="GOA:D3FV74"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV74"
FT                   /protein_id="ADC50275.1"
FT   repeat_region   661285..661466
FT                   /rpt_family="bpr1"
FT                   /note="bpr1_15F"
FT   gene            complement(661505..662143)
FT                   /locus_tag="BpOF4_11115"
FT   CDS_pept        complement(661505..662143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11115"
FT                   /product="hypothetical protein"
FT                   /note="COG0500 SAM-dependent methyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50276"
FT                   /db_xref="GOA:D3FV75"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV75"
FT                   /protein_id="ADC50276.1"
FT   gene            complement(662226..662369)
FT                   /locus_tag="BpOF4_11120"
FT   CDS_pept        complement(662226..662369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11120"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50277"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV76"
FT                   /protein_id="ADC50277.1"
FT                   PF"
FT   gene            complement(662516..663889)
FT                   /locus_tag="BpOF4_11125"
FT   CDS_pept        complement(662516..663889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11125"
FT                   /product="amino acid transporter"
FT                   /note="COG1115 Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50278"
FT                   /db_xref="GOA:D3FV77"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV77"
FT                   /protein_id="ADC50278.1"
FT   gene            664148..665422
FT                   /locus_tag="BpOF4_11130"
FT   CDS_pept        664148..665422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11130"
FT                   /product="gluconate cation symporter family"
FT                   /note="COG2610 H+/gluconate symporter and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11130"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50279"
FT                   /db_xref="GOA:D3FV78"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV78"
FT                   /protein_id="ADC50279.1"
FT   gene            665531..665704
FT                   /locus_tag="BpOF4_11135"
FT   CDS_pept        665531..665704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11135"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50280"
FT                   /db_xref="InterPro:IPR025435"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV79"
FT                   /protein_id="ADC50280.1"
FT                   KEADARASQQKK"
FT   gene            665831..666571
FT                   /gene="glpQ"
FT                   /locus_tag="BpOF4_11140"
FT   CDS_pept        665831..666571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="BpOF4_11140"
FT                   /product="glycerophosphodiester phosphodiesterase"
FT                   /note="COG0584 Glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11140"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50281"
FT                   /db_xref="GOA:D3FV80"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV80"
FT                   /protein_id="ADC50281.1"
FT   repeat_region   complement(666616..666792)
FT                   /rpt_family="bpr2"
FT                   /note="P_bpr2_8R (partial)"
FT   repeat_region   complement(666899..667351)
FT                   /rpt_family="bpr2"
FT                   /note="bpr2_6R"
FT   gene            667597..668640
FT                   /locus_tag="BpOF4_11145"
FT   CDS_pept        667597..668640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11145"
FT                   /product="putative transcriptional regulator, ArsR family
FT                   protein"
FT                   /note="COG0532 Translation initiation factor 2 (IF-2;
FT                   GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50282"
FT                   /db_xref="GOA:D3FV81"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV81"
FT                   /protein_id="ADC50282.1"
FT                   LERLLIK"
FT   gene            668730..669998
FT                   /locus_tag="BpOF4_11150"
FT   CDS_pept        668730..669998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11150"
FT                   /product="putative transporter of MFS"
FT                   /note="COG0477 Permeases of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50283"
FT                   /db_xref="GOA:D3FV82"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV82"
FT                   /protein_id="ADC50283.1"
FT   gene            670082..670582
FT                   /locus_tag="BpOF4_11155"
FT   CDS_pept        670082..670582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BpOF4_11155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50284"
FT                   /db_xref="GOA:D3FV83"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV83"
FT                   /protein_id="ADC50284.1"
FT                   QLQ"
FT   gene            complement(670624..673053)
FT                   /gene="glgP"
FT                   /locus_tag="BpOF4_11160"
FT   CDS_pept        complement(670624..673053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="BpOF4_11160"
FT                   /product="glycogen phosphorylase"
FT                   /note="COG0058 Glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BpOF4_11160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC50285"
FT                   /db_xref="GOA:D3FV84"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D3FV84"
FT                   /protein_id="ADC50285.1"