(data stored in ACNUC7421 zone)

EMBL: CP001896

ID   CP001896; SV 1; circular; genomic DNA; STD; PRO; 3526903 BP.
XX
AC   CP001896; ACQQ01000000-ACQQ01000066;
XX
PR   Project:PRJNA32547;
XX
DT   18-FEB-2010 (Rel. 103, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Allochromatium vinosum DSM 180 chromosome, complete genome.
XX
KW   .
XX
OS   Allochromatium vinosum DSM 180
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales; Chromatiaceae;
OC   Allochromatium.
XX
RN   [1]
RP   1-3526903
RX   DOI; 10.4056/sigs.2335270.
RX   PUBMED; 22675582.
RA   Weissgerber T., Zigann R., Bruce D., Chang Y.J., Detter J.C., Han C.,
RA   Hauser L., Jeffries C.D., Land M., Munk A.C., Tapia R., Dahl C.;
RT   "Complete genome sequence of Allochromatium vinosum DSM 180(T)";
RL   Stand Genomic Sci 5(3):311-330(2011).
XX
RN   [2]
RP   1-3526903
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Munk A.C., Detter J.C., Han C., Tapia R., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Ivanova N., Zigann R., Dahl C., Woyke T.;
RT   ;
RL   Submitted (01-FEB-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; a2adad0e480e2eddb7f0d7026d0b4b32.
DR   BioSample; SAMN02598487.
DR   CABRI; DSM 180.
DR   EnsemblGenomes-Gn; Alvin_R0001.
DR   EnsemblGenomes-Gn; Alvin_R0002.
DR   EnsemblGenomes-Gn; Alvin_R0003.
DR   EnsemblGenomes-Gn; Alvin_R0004.
DR   EnsemblGenomes-Gn; Alvin_R0005.
DR   EnsemblGenomes-Gn; Alvin_R0006.
DR   EnsemblGenomes-Gn; Alvin_R0007.
DR   EnsemblGenomes-Gn; Alvin_R0008.
DR   EnsemblGenomes-Gn; Alvin_R0009.
DR   EnsemblGenomes-Gn; Alvin_R0010.
DR   EnsemblGenomes-Gn; Alvin_R0011.
DR   EnsemblGenomes-Gn; Alvin_R0012.
DR   EnsemblGenomes-Gn; Alvin_R0013.
DR   EnsemblGenomes-Gn; Alvin_R0014.
DR   EnsemblGenomes-Gn; Alvin_R0015.
DR   EnsemblGenomes-Gn; Alvin_R0016.
DR   EnsemblGenomes-Gn; Alvin_R0017.
DR   EnsemblGenomes-Gn; Alvin_R0018.
DR   EnsemblGenomes-Gn; Alvin_R0019.
DR   EnsemblGenomes-Gn; Alvin_R0020.
DR   EnsemblGenomes-Gn; Alvin_R0021.
DR   EnsemblGenomes-Gn; Alvin_R0022.
DR   EnsemblGenomes-Gn; Alvin_R0023.
DR   EnsemblGenomes-Gn; Alvin_R0024.
DR   EnsemblGenomes-Gn; Alvin_R0025.
DR   EnsemblGenomes-Gn; Alvin_R0026.
DR   EnsemblGenomes-Gn; Alvin_R0027.
DR   EnsemblGenomes-Gn; Alvin_R0028.
DR   EnsemblGenomes-Gn; Alvin_R0029.
DR   EnsemblGenomes-Gn; Alvin_R0030.
DR   EnsemblGenomes-Gn; Alvin_R0031.
DR   EnsemblGenomes-Gn; Alvin_R0032.
DR   EnsemblGenomes-Gn; Alvin_R0033.
DR   EnsemblGenomes-Gn; Alvin_R0034.
DR   EnsemblGenomes-Gn; Alvin_R0035.
DR   EnsemblGenomes-Gn; Alvin_R0036.
DR   EnsemblGenomes-Gn; Alvin_R0037.
DR   EnsemblGenomes-Gn; Alvin_R0038.
DR   EnsemblGenomes-Gn; Alvin_R0039.
DR   EnsemblGenomes-Gn; Alvin_R0040.
DR   EnsemblGenomes-Gn; Alvin_R0041.
DR   EnsemblGenomes-Gn; Alvin_R0042.
DR   EnsemblGenomes-Gn; Alvin_R0043.
DR   EnsemblGenomes-Gn; Alvin_R0044.
DR   EnsemblGenomes-Gn; Alvin_R0045.
DR   EnsemblGenomes-Gn; Alvin_R0046.
DR   EnsemblGenomes-Gn; Alvin_R0047.
DR   EnsemblGenomes-Gn; Alvin_R0048.
DR   EnsemblGenomes-Gn; Alvin_R0049.
DR   EnsemblGenomes-Gn; Alvin_R0050.
DR   EnsemblGenomes-Gn; Alvin_R0051.
DR   EnsemblGenomes-Gn; Alvin_R0052.
DR   EnsemblGenomes-Gn; Alvin_R0053.
DR   EnsemblGenomes-Gn; Alvin_R0054.
DR   EnsemblGenomes-Gn; Alvin_R0055.
DR   EnsemblGenomes-Gn; Alvin_R0056.
DR   EnsemblGenomes-Gn; Alvin_R0057.
DR   EnsemblGenomes-Gn; Alvin_R0058.
DR   EnsemblGenomes-Gn; Alvin_R0059.
DR   EnsemblGenomes-Gn; Alvin_R0060.
DR   EnsemblGenomes-Gn; Alvin_R0061.
DR   EnsemblGenomes-Gn; Alvin_R0062.
DR   EnsemblGenomes-Gn; Alvin_R0063.
DR   EnsemblGenomes-Gn; Alvin_R0064.
DR   EnsemblGenomes-Gn; EBG00001451954.
DR   EnsemblGenomes-Gn; EBG00001451955.
DR   EnsemblGenomes-Gn; EBG00001451956.
DR   EnsemblGenomes-Gn; EBG00001451957.
DR   EnsemblGenomes-Gn; EBG00001451958.
DR   EnsemblGenomes-Gn; EBG00001451959.
DR   EnsemblGenomes-Gn; EBG00001451960.
DR   EnsemblGenomes-Gn; EBG00001451961.
DR   EnsemblGenomes-Gn; EBG00001451962.
DR   EnsemblGenomes-Gn; EBG00001451963.
DR   EnsemblGenomes-Gn; EBG00001451964.
DR   EnsemblGenomes-Gn; EBG00001451965.
DR   EnsemblGenomes-Gn; EBG00001451966.
DR   EnsemblGenomes-Gn; EBG00001451967.
DR   EnsemblGenomes-Gn; EBG00001451968.
DR   EnsemblGenomes-Gn; EBG00001451969.
DR   EnsemblGenomes-Gn; EBG00001451970.
DR   EnsemblGenomes-Gn; EBG00001451971.
DR   EnsemblGenomes-Gn; EBG00001451972.
DR   EnsemblGenomes-Gn; EBG00001451973.
DR   EnsemblGenomes-Gn; EBG00001451974.
DR   EnsemblGenomes-Gn; EBG00001451975.
DR   EnsemblGenomes-Gn; EBG00001451976.
DR   EnsemblGenomes-Gn; EBG00001451977.
DR   EnsemblGenomes-Gn; EBG00001451978.
DR   EnsemblGenomes-Gn; EBG00001451979.
DR   EnsemblGenomes-Gn; EBG00001451980.
DR   EnsemblGenomes-Gn; EBG00001451981.
DR   EnsemblGenomes-Gn; EBG00001451982.
DR   EnsemblGenomes-Gn; EBG00001451983.
DR   EnsemblGenomes-Gn; EBG00001451984.
DR   EnsemblGenomes-Gn; EBG00001451985.
DR   EnsemblGenomes-Gn; EBG00001451986.
DR   EnsemblGenomes-Gn; EBG00001451987.
DR   EnsemblGenomes-Gn; EBG00001451988.
DR   EnsemblGenomes-Gn; EBG00001451989.
DR   EnsemblGenomes-Gn; EBG00001451990.
DR   EnsemblGenomes-Gn; EBG00001451991.
DR   EnsemblGenomes-Gn; EBG00001451992.
DR   EnsemblGenomes-Gn; EBG00001451993.
DR   EnsemblGenomes-Gn; EBG00001451994.
DR   EnsemblGenomes-Gn; EBG00001451995.
DR   EnsemblGenomes-Gn; EBG00001451996.
DR   EnsemblGenomes-Gn; EBG00001451997.
DR   EnsemblGenomes-Gn; EBG00001451998.
DR   EnsemblGenomes-Gn; EBG00001451999.
DR   EnsemblGenomes-Gn; EBG00001452000.
DR   EnsemblGenomes-Gn; EBG00001452001.
DR   EnsemblGenomes-Gn; EBG00001452002.
DR   EnsemblGenomes-Gn; EBG00001452003.
DR   EnsemblGenomes-Gn; EBG00001452004.
DR   EnsemblGenomes-Gn; EBG00001452005.
DR   EnsemblGenomes-Gn; EBG00001452006.
DR   EnsemblGenomes-Gn; EBG00001452007.
DR   EnsemblGenomes-Gn; EBG00001452008.
DR   EnsemblGenomes-Gn; EBG00001452009.
DR   EnsemblGenomes-Gn; EBG00001452010.
DR   EnsemblGenomes-Gn; EBG00001452011.
DR   EnsemblGenomes-Gn; EBG00001452012.
DR   EnsemblGenomes-Gn; EBG00001452013.
DR   EnsemblGenomes-Gn; EBG00001452014.
DR   EnsemblGenomes-Gn; EBG00001452015.
DR   EnsemblGenomes-Gn; EBG00001452016.
DR   EnsemblGenomes-Gn; EBG00001452017.
DR   EnsemblGenomes-Gn; EBG00001452018.
DR   EnsemblGenomes-Gn; EBG00001452019.
DR   EnsemblGenomes-Gn; EBG00001452020.
DR   EnsemblGenomes-Gn; EBG00001452021.
DR   EnsemblGenomes-Gn; EBG00001452022.
DR   EnsemblGenomes-Gn; EBG00001452023.
DR   EnsemblGenomes-Gn; EBG00001452024.
DR   EnsemblGenomes-Gn; EBG00001452025.
DR   EnsemblGenomes-Gn; EBG00001452026.
DR   EnsemblGenomes-Gn; EBG00001452027.
DR   EnsemblGenomes-Gn; EBG00001452028.
DR   EnsemblGenomes-Gn; EBG00001452029.
DR   EnsemblGenomes-Tr; Alvin_R0001-1.
DR   EnsemblGenomes-Tr; Alvin_R0002-1.
DR   EnsemblGenomes-Tr; Alvin_R0003-1.
DR   EnsemblGenomes-Tr; Alvin_R0004-1.
DR   EnsemblGenomes-Tr; Alvin_R0005-1.
DR   EnsemblGenomes-Tr; Alvin_R0006-1.
DR   EnsemblGenomes-Tr; Alvin_R0007-1.
DR   EnsemblGenomes-Tr; Alvin_R0008-1.
DR   EnsemblGenomes-Tr; Alvin_R0009-1.
DR   EnsemblGenomes-Tr; Alvin_R0010-1.
DR   EnsemblGenomes-Tr; Alvin_R0011-1.
DR   EnsemblGenomes-Tr; Alvin_R0012-1.
DR   EnsemblGenomes-Tr; Alvin_R0013-1.
DR   EnsemblGenomes-Tr; Alvin_R0014-1.
DR   EnsemblGenomes-Tr; Alvin_R0015-1.
DR   EnsemblGenomes-Tr; Alvin_R0016-1.
DR   EnsemblGenomes-Tr; Alvin_R0017-1.
DR   EnsemblGenomes-Tr; Alvin_R0018-1.
DR   EnsemblGenomes-Tr; Alvin_R0019-1.
DR   EnsemblGenomes-Tr; Alvin_R0020-1.
DR   EnsemblGenomes-Tr; Alvin_R0021-1.
DR   EnsemblGenomes-Tr; Alvin_R0022-1.
DR   EnsemblGenomes-Tr; Alvin_R0023-1.
DR   EnsemblGenomes-Tr; Alvin_R0024-1.
DR   EnsemblGenomes-Tr; Alvin_R0025-1.
DR   EnsemblGenomes-Tr; Alvin_R0026-1.
DR   EnsemblGenomes-Tr; Alvin_R0027-1.
DR   EnsemblGenomes-Tr; Alvin_R0028-1.
DR   EnsemblGenomes-Tr; Alvin_R0029-1.
DR   EnsemblGenomes-Tr; Alvin_R0030-1.
DR   EnsemblGenomes-Tr; Alvin_R0031-1.
DR   EnsemblGenomes-Tr; Alvin_R0032-1.
DR   EnsemblGenomes-Tr; Alvin_R0033-1.
DR   EnsemblGenomes-Tr; Alvin_R0034-1.
DR   EnsemblGenomes-Tr; Alvin_R0035-1.
DR   EnsemblGenomes-Tr; Alvin_R0036-1.
DR   EnsemblGenomes-Tr; Alvin_R0037-1.
DR   EnsemblGenomes-Tr; Alvin_R0038-1.
DR   EnsemblGenomes-Tr; Alvin_R0039-1.
DR   EnsemblGenomes-Tr; Alvin_R0040-1.
DR   EnsemblGenomes-Tr; Alvin_R0041-1.
DR   EnsemblGenomes-Tr; Alvin_R0042-1.
DR   EnsemblGenomes-Tr; Alvin_R0043-1.
DR   EnsemblGenomes-Tr; Alvin_R0044-1.
DR   EnsemblGenomes-Tr; Alvin_R0045-1.
DR   EnsemblGenomes-Tr; Alvin_R0046-1.
DR   EnsemblGenomes-Tr; Alvin_R0047-1.
DR   EnsemblGenomes-Tr; Alvin_R0048-1.
DR   EnsemblGenomes-Tr; Alvin_R0049-1.
DR   EnsemblGenomes-Tr; Alvin_R0050-1.
DR   EnsemblGenomes-Tr; Alvin_R0051-1.
DR   EnsemblGenomes-Tr; Alvin_R0052-1.
DR   EnsemblGenomes-Tr; Alvin_R0053-1.
DR   EnsemblGenomes-Tr; Alvin_R0054-1.
DR   EnsemblGenomes-Tr; Alvin_R0055-1.
DR   EnsemblGenomes-Tr; Alvin_R0056-1.
DR   EnsemblGenomes-Tr; Alvin_R0057-1.
DR   EnsemblGenomes-Tr; Alvin_R0058-1.
DR   EnsemblGenomes-Tr; Alvin_R0059-1.
DR   EnsemblGenomes-Tr; Alvin_R0060-1.
DR   EnsemblGenomes-Tr; Alvin_R0061-1.
DR   EnsemblGenomes-Tr; Alvin_R0062-1.
DR   EnsemblGenomes-Tr; Alvin_R0063-1.
DR   EnsemblGenomes-Tr; Alvin_R0064-1.
DR   EnsemblGenomes-Tr; EBT00001605751.
DR   EnsemblGenomes-Tr; EBT00001605752.
DR   EnsemblGenomes-Tr; EBT00001605753.
DR   EnsemblGenomes-Tr; EBT00001605754.
DR   EnsemblGenomes-Tr; EBT00001605755.
DR   EnsemblGenomes-Tr; EBT00001605756.
DR   EnsemblGenomes-Tr; EBT00001605757.
DR   EnsemblGenomes-Tr; EBT00001605758.
DR   EnsemblGenomes-Tr; EBT00001605759.
DR   EnsemblGenomes-Tr; EBT00001605760.
DR   EnsemblGenomes-Tr; EBT00001605761.
DR   EnsemblGenomes-Tr; EBT00001605762.
DR   EnsemblGenomes-Tr; EBT00001605763.
DR   EnsemblGenomes-Tr; EBT00001605764.
DR   EnsemblGenomes-Tr; EBT00001605765.
DR   EnsemblGenomes-Tr; EBT00001605766.
DR   EnsemblGenomes-Tr; EBT00001605767.
DR   EnsemblGenomes-Tr; EBT00001605768.
DR   EnsemblGenomes-Tr; EBT00001605769.
DR   EnsemblGenomes-Tr; EBT00001605770.
DR   EnsemblGenomes-Tr; EBT00001605771.
DR   EnsemblGenomes-Tr; EBT00001605772.
DR   EnsemblGenomes-Tr; EBT00001605773.
DR   EnsemblGenomes-Tr; EBT00001605774.
DR   EnsemblGenomes-Tr; EBT00001605775.
DR   EnsemblGenomes-Tr; EBT00001605776.
DR   EnsemblGenomes-Tr; EBT00001605777.
DR   EnsemblGenomes-Tr; EBT00001605778.
DR   EnsemblGenomes-Tr; EBT00001605779.
DR   EnsemblGenomes-Tr; EBT00001605780.
DR   EnsemblGenomes-Tr; EBT00001605781.
DR   EnsemblGenomes-Tr; EBT00001605782.
DR   EnsemblGenomes-Tr; EBT00001605783.
DR   EnsemblGenomes-Tr; EBT00001605784.
DR   EnsemblGenomes-Tr; EBT00001605785.
DR   EnsemblGenomes-Tr; EBT00001605786.
DR   EnsemblGenomes-Tr; EBT00001605787.
DR   EnsemblGenomes-Tr; EBT00001605788.
DR   EnsemblGenomes-Tr; EBT00001605789.
DR   EnsemblGenomes-Tr; EBT00001605790.
DR   EnsemblGenomes-Tr; EBT00001605791.
DR   EnsemblGenomes-Tr; EBT00001605792.
DR   EnsemblGenomes-Tr; EBT00001605793.
DR   EnsemblGenomes-Tr; EBT00001605794.
DR   EnsemblGenomes-Tr; EBT00001605795.
DR   EnsemblGenomes-Tr; EBT00001605796.
DR   EnsemblGenomes-Tr; EBT00001605797.
DR   EnsemblGenomes-Tr; EBT00001605798.
DR   EnsemblGenomes-Tr; EBT00001605799.
DR   EnsemblGenomes-Tr; EBT00001605800.
DR   EnsemblGenomes-Tr; EBT00001605801.
DR   EnsemblGenomes-Tr; EBT00001605802.
DR   EnsemblGenomes-Tr; EBT00001605803.
DR   EnsemblGenomes-Tr; EBT00001605804.
DR   EnsemblGenomes-Tr; EBT00001605805.
DR   EnsemblGenomes-Tr; EBT00001605806.
DR   EnsemblGenomes-Tr; EBT00001605807.
DR   EnsemblGenomes-Tr; EBT00001605808.
DR   EnsemblGenomes-Tr; EBT00001605809.
DR   EnsemblGenomes-Tr; EBT00001605810.
DR   EnsemblGenomes-Tr; EBT00001605811.
DR   EnsemblGenomes-Tr; EBT00001605812.
DR   EnsemblGenomes-Tr; EBT00001605813.
DR   EnsemblGenomes-Tr; EBT00001605814.
DR   EnsemblGenomes-Tr; EBT00001605815.
DR   EnsemblGenomes-Tr; EBT00001605816.
DR   EnsemblGenomes-Tr; EBT00001605817.
DR   EnsemblGenomes-Tr; EBT00001605818.
DR   EnsemblGenomes-Tr; EBT00001605819.
DR   EnsemblGenomes-Tr; EBT00001605820.
DR   EnsemblGenomes-Tr; EBT00001605821.
DR   EnsemblGenomes-Tr; EBT00001605822.
DR   EnsemblGenomes-Tr; EBT00001605823.
DR   EnsemblGenomes-Tr; EBT00001605824.
DR   EnsemblGenomes-Tr; EBT00001605825.
DR   EnsemblGenomes-Tr; EBT00001605826.
DR   EuropePMC; PMC2916503; 20543059.
DR   EuropePMC; PMC3001079; 20716518.
DR   EuropePMC; PMC3746430; 23991253.
DR   EuropePMC; PMC4830845; 27148201.
DR   EuropePMC; PMC6292899; 30546119.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02033; HEARO.
DR   SILVA-LSU; CP001896.
DR   SILVA-SSU; CP001896.
DR   StrainInfo; 156452; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4084488
CC   Source DNA and bacteria available from Christiane Dahl
CC   (ChDahl@uni-bonn.de)
CC   Contacts: Christiane Dahl (ChDahl@uni-bonn.de)
CC      Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Allochromatium vinosum DSM 180
CC   Culture Collection ID :: DSM 180, ATCC 17899
CC   GOLD Stamp ID         :: Gi02104
CC   Isolation Site        :: Ditch water
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 25C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water
CC   Energy Source         :: Phototroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3526903
FT                   /organism="Allochromatium vinosum DSM 180"
FT                   /strain="DSM 180"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:572477"
FT                   /type_material="type strain of Allochromatium vinosum"
FT   gene            232..1593
FT                   /locus_tag="Alvin_0001"
FT   CDS_pept        232..1593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: aeh:Mlg_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60973"
FT                   /db_xref="GOA:D3RUS4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUS4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADC60973.1"
FT                   /translation="MSGNAVALWEHCINQLKAELTSAEFNTWILPLQARVDGPLLRLLA
FT                   PNRFVLDWTRKHYADRLLELCARHSQGEVSEIHFEVGEFARESGPAKGKGARAGSKASV
FT                   IDSDLATRRAAANLNADFNFDTFVEGKSNQLARAASIQIARNPGGTYNPLFIYGGVGLG
FT                   KTHLMHAVGNVILASNPSARVVYLHSERFVAEMIKALQHNRIEDFKKTYRSVNALLIDD
FT                   VQFFAGKERSQEEFFHTFNALLESGQQIVLSSDRFPKEVTGLEERLRSRFGWGLTVAID
FT                   PPDLETSVAILHCKATQLGVELPEDVAFFVGRRIRSNIRELEGALRRLVANAHFTGKPI
FT                   TLEFAKQALRDVLVAQDRQVSLENIQRTVADYYKLRTSDLLSAKRSRSLARPRQLAMAL
FT                   AKELTKHSLPEIGQAFGGRDHTTVLHATRKIKSLRESDATIEEDYRNLLRMLTL"
FT   gene            1692..2792
FT                   /locus_tag="Alvin_0002"
FT   CDS_pept        1692..2792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: psp:PSPPH_0002 DNA polymerase III subunit
FT                   beta; TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60974"
FT                   /db_xref="GOA:D3RUS5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUS5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADC60974.1"
FT                   /translation="MEFVANREIVLPALNKVIGVVERRQTLPILGNLLVVARAGRVTLT
FT                   GTDLEVEVKTSFEAEIQQEGETTIPARKLVDICRNLSEGAEIRLRVKDERCVVTSGRGR
FT                   FTLGLLPAADFPTMDLEEGGFDFQIQESQLKRLLDKTAFAMAQQDVRYYLNGLLLELHA
FT                   TVLIAVATDGHRLAKFVTPLDLTLDTERQVIVPNKTVMELKRQLGSSDDPISIRLSERS
FT                   LRVVVGAMTMTSKLVDGRYPEYERVIPGHSGRTATVEKDALKRALSRTSILSNEKYRGV
FT                   RLSFDPGTLKLLAHNPEQEEAEEEIELEYDGEPISIGFNVAYLMDVLGVIDETAVIIHF
FT                   QDANGSSIWRGVGGESETFVVMPMRL"
FT   gene            2936..4012
FT                   /locus_tag="Alvin_0003"
FT   CDS_pept        2936..4012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: pmy:Pmen_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60975"
FT                   /db_xref="GOA:D3RUS6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUS6"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADC60975.1"
FT                   /translation="MDPEPGLRSLRIESLRNIRRLDLAPDTRTLLLTGANGAGKTSVLE
FT                   AIYLLARGRTFRGTKAGPLTTQGEFYTRVEGRYQPSDRDVVRLRYVKEGATAVRDIHPP
FT                   LWAETGGADWRSPLQVKLVGENAQILLDGDPSLRRRFLDWNVFHVEHRFAQVQKDFTRV
FT                   LMQRNAAIRSGGSQLGLWDRRFIALAESVDRQRAAFHAEWRTCFLDLCGDYPFLHGTDL
FT                   RYRRGWPDGRELGETLVALADQELARGYTLAGPSRADFRIDPGEGRRGFSRGQTKIVVA
FT                   LLQLAAERVHRAHGREPVIWLLDDLEAELDRTLAERLWSAFGATGNQVIATRVATDGDP
FT                   GIFGNTESLTMFHVEHPG"
FT   gene            complement(4062..4523)
FT                   /locus_tag="Alvin_0004"
FT   CDS_pept        complement(4062..4523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGAP011715-PA; K09680 type II pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60976"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC60976.1"
FT                   /translation="MPFTTLSSGALWGLLLMLLTFGTVQADSTAEVERILSDIRQDQPL
FT                   PRLDYLHPVAPINPGCAAFEGRYGAVAIQVETHPDSPRVASLLLQIPGPDQTRALLPAV
FT                   SRALGPPHSQDRRQSVYGWDWPDYRTASLHYVHGDSSAPGLTIVSLFYR"
FT   sig_peptide     complement(4443..4523)
FT                   /locus_tag="Alvin_0004"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 27"
FT   gene            complement(4570..5571)
FT                   /locus_tag="Alvin_0005"
FT   CDS_pept        complement(4570..5571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rru:Rru_A2527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60977"
FT                   /db_xref="GOA:D3RUS8"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC60977.1"
FT                   /translation="MKPPPPQIRWEIDIPLATNPRLLKTLALVAGLAALIPSLFMSVIL
FT                   AAQGEWDGIPALAGLFALVGVGLFVSFVLIALIVFGNRLRTRYTLDAQGIHQETIDRTS
FT                   RLVNRLTVLGGAASGQPGPTGAGLTARARESERLDWRGGFSLQVQPRAHRLIFRNAWRP
FT                   LMEVYCTPENFVQIEALARHFMSQHHTSERTPARSPLPSYLGHSMLILLAAFILFTVHD
FT                   EFDLDLFAPILVMAFALATLWLIPLFGYVVLLVNAGILASLVMASLEERVSYIRPSERY
FT                   RHYEVFSDADWALLGFGLLALGYLSWLAWRAARGRLLSLLMRDQDDQTGPGG"
FT   sig_peptide     complement(5431..5571)
FT                   /locus_tag="Alvin_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.506 at
FT                   residue 47"
FT   gene            complement(5647..6762)
FT                   /locus_tag="Alvin_0006"
FT   CDS_pept        complement(5647..6762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0006"
FT                   /product="Protein of unknown function DUF2006"
FT                   /note="PFAM: Protein of unknown function DUF2006; KEGG:
FT                   eba:ebA6804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60978"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUS9"
FT                   /inference="protein motif:PFAM:PF09410"
FT                   /protein_id="ADC60978.1"
FT                   /translation="MHRRTCLLALAGLPLTRIVAATAPATDSAGAETDPAIAFDAVLPG
FT                   RVLRFPDDEGAHPGFRTEWWYVTGWLKGADDDPLGFQITFFRVRTGIGEDNPSAFAPRQ
FT                   LLLAHAAIADPRLGRLRHDQRAARVGFERAGYATDRTHVWLDDWSFEQSDQHYATRVNA
FT                   EDFAYDLRLAFTGAPMLNGDHGFSRKAPDPRHASYYYSRPHLQVEGQLTLDGRRHAVSG
FT                   RAWMDHEWSSAYSPEGADGWDWVGLNLDDGGALMAFRMRRPDGTALWAGATRRFPDGRT
FT                   RSLAPEQVEWLPLRRWRSPRTGIEYPVEWSLRIGGRRYDLRPLMDDQELDSRRSTNTLY
FT                   WEGAIHILEAGREIGRGYLEMTGYGDRIQVG"
FT   sig_peptide     complement(6700..6762)
FT                   /locus_tag="Alvin_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.452 at
FT                   residue 21"
FT   gene            complement(6762..9275)
FT                   /locus_tag="Alvin_0007"
FT   CDS_pept        complement(6762..9275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0007"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   eba:ebA6805 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60979"
FT                   /db_xref="GOA:D3RUT0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT0"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADC60979.1"
FT                   /translation="MRLAPVFFGSLTRRRAATLLSFAAIALGVALGMAVQAVNQAALTE
FT                   FGRGLRTLAGAADLQVVGPRGGFDEALYTQLAARPEVAQASPVLEVWTERIGSTDTLRL
FT                   LGLDLFVIGAVTPALWPRPAEIEGQSGHEARFAALAEDSLFLSAAAQTALAVKPGDRLS
FT                   VYAGSQPLELRVAGDIPGAAEDRRLAVMDIAAVQKHFARIGRLTRIDLRLVEGLDVQAA
FT                   RAVLEPRLPAGVWLEVPQAAEGQASNLSRAYRVNLTLLAAMALVTGAFLVFSAQALSVV
FT                   RRHTELAFLRAIGVGRRQLLAWLLAEGAIVGLLGAVVGVMLGHGLAFGLLRLLGGDLGA
FT                   GFFAGLSPTLRIDPWATGVYVLLGVGAGVAGAWLPAREAARIAPAQALKATDDSVLSQR
FT                   RGYPRLGLILMAAGLPLCALPPIQGLPIGGYLAIFGLLAGSILWLPMLASGLARVVPLR
FT                   GPVPVRLAAARLRAAPGMSAVAATGVLASVALVVAMAIMVNSLRGSVDVWLGQILPADL
FT                   YLRAGRAQSGGVLNEALQARLADVPGVARIEFTRHESLRLASGQPPVALLARPVSPDGR
FT                   ELPLVGSAHAVAEGETAIWISEALHDLQGWRPGDRVRLPLAGSEVPVQVAGIWRDYARQ
FT                   TGSLMLDLADYRRLSGDHSAQDAAIWLAPGVDTLSVAEALKAAGGSGALEVTVPGEIRA
FT                   ISLRIFDRAFAVTYVLEAAAVIIGLAGVAASFAALAAARRREFGLLRHLGLTRGQIGVL
FT                   LALEGSLAAGVGILGGLTVGGAIAWILIEVVNRQSFHWSMDLSVPWLSLLVFAGTLATL
FT                   ASLAAVLAGRQAMREDAVLAVREDW"
FT   sig_peptide     complement(9162..9275)
FT                   /locus_tag="Alvin_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.700) with cleavage site probability 0.577 at
FT                   residue 38"
FT   gene            complement(9272..9925)
FT                   /locus_tag="Alvin_0008"
FT   CDS_pept        complement(9272..9925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0008"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eba:ebA6806 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60980"
FT                   /db_xref="GOA:D3RUT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC60980.1"
FT                   /translation="MLEICDLYRQFNGRPVLQGISMRLKPGEYVAITGESGVGKSTLLN
FT                   VIAGLDRPDRGRLVLDGEDYAALDEDALTRLRRDKLGFVFQAFHILPHLTLRQNVALPL
FT                   WLKGQGGRRADRQAEHLLDAVGLGDRAESWPRELSGGEMQRVAIARALAHKPRLILADE
FT                   PTGNLDPTNAARVLRLLGERIRSAGAMGILVTHSPEAARSADRVLQLTPEGLHE"
FT   gene            10275..10745
FT                   /locus_tag="Alvin_0009"
FT   CDS_pept        10275..10745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0009"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: asa:ASA_0008
FT                   16 kDa heat shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60981"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT2"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ADC60981.1"
FT                   /translation="MSTLDFSPLFRSMIGFDRLANALETAYRTEPGGYPPYNVELLDEN
FT                   RYRITLAVAGFTEAELGIEAKENLLTVTGQRQANESEGNFLYRGIANRAFERRFQLADY
FT                   VKVQEARLENGLLHIDLVREVPEAMKPRRIEIRAAGASPAIEHASTERPKAA"
FT   gene            10860..11210
FT                   /locus_tag="Alvin_0010"
FT   CDS_pept        10860..11210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0010"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: tgr:Tgr7_0587 propeptide PepSY amd peptidase
FT                   M4"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60982"
FT                   /db_xref="GOA:D3RUT3"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT3"
FT                   /inference="protein motif:COG:COG3212"
FT                   /protein_id="ADC60982.1"
FT                   /translation="MVNHLVNEALVITMTPVAHLSCLLLISALTFNVSVLADHLDHDSV
FT                   KRLRDDGRILSMSEVMRRAARIRPGQLLEAELDRDDGRYVYEILILDATGRVHELELDA
FT                   ASGVLIESSYDD"
FT   gene            11227..11886
FT                   /locus_tag="Alvin_0011"
FT   CDS_pept        11227..11886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0011"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; transcriptional regulator domain protein; KEGG:
FT                   sbm:Shew185_0239 two component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60983"
FT                   /db_xref="GOA:D3RUT4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC60983.1"
FT                   /translation="MRLLLVEDDPAQIAALLPALNAAGFAVDQAQDGAIGERLGETEPY
FT                   DVIVLDLGLPKRPGLEVLRHWRARGLSLPVLILTARDAWPERVDGLKAGADDYLGKPFH
FT                   VEELIARLNALTRRAAGNLRPALAVGGLSLDADRQQVICPDGEVRELTGTEFRLLRYLM
FT                   LNPGRILSKAQLLEHVYELEAERGDNLIEVYIRRLREKIGRDRIQTLRGQGYLLKR"
FT   gene            11883..13235
FT                   /locus_tag="Alvin_0012"
FT   CDS_pept        11883..13235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0012"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mmb:Mmol_1757 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60984"
FT                   /db_xref="GOA:D3RUT5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC60984.1"
FT                   /translation="MTSLEGRLHLGLALSLALLIGSAWWLGHAALHHTANAFVLSRLEH
FT                   DAEGLLGALRFDAPGIPRLESPRLTPVYEQPYSGHYFVIVPATGEPLRSRSLWDTDLES
FT                   PALQPGETRHWTLQGPNEQYLVAWAEGYRFGDRDLVVVMAEDIRPLSAELRHFERLFAI
FT                   MAVAGLLLSLLIQRLIVRRAFAGLRPIYRDIEQLEHGRIVTLSEDVPREMQPLVRKLNR
FT                   LLVLLGQRLERSRTAAGNLSHALKGPLVLLRQYLSDPKLHLTPETRAGLLDQVEHLRRI
FT                   AERQLKRARLAGAGGVGEFFEPAAELPVLKRLLERIHAGRALRIDLECVIDAPLALDRE
FT                   DMLELLGNLLDNACKWARERVRARLHVEAGTLVLLVEDDGPGCSEDAIADITERGVRLD
FT                   EEVGGHGLGLAIVKEIVAGYQGVLGFERAGELGGLRVDVRLPLQDQGLDGR"
FT   gene            13278..14522
FT                   /locus_tag="Alvin_0013"
FT   CDS_pept        13278..14522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0013"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   tbd:Tbd_1748 putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60985"
FT                   /db_xref="GOA:D3RUT6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT6"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ADC60985.1"
FT                   /translation="MDSHSPLTSKTGHRRRARLILFCLLLTSATASAGTLGEAIDSALD
FT                   LEGQRARVGALRDEGEATRRQAESLVAGDPGLRVKHLSDQAIANEGAYEWEAMVELPLW
FT                   MPGQRTARQAVAAALGEQAETLAGLLRWEMAGRVREAVWNARLTQGRADQAAQALANAR
FT                   ALATTVDKRLAAGDLARVDALVAHQAVLDREAEHQSARMEAEEALARYRHLTGQTTLPD
FT                   DSDEAVPPDLSDQLPPDHPLMREADSAVGVARRQRDQARSERTGHPVLSLGTTVTRDAR
FT                   GADQNTALQLELSIPFGLASQSAPSIAAAERVYTEQASERQSLLRQAEAELIAAHLGRR
FT                   GAAESLAIAERRQEAAREAFALVRRAFELGEADLTTRLRAEDSAREANVALELRRLEQG
FT                   RARARLNQALGVIPQ"
FT   sig_peptide     13278..13379
FT                   /locus_tag="Alvin_0013"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.982 at
FT                   residue 34"
FT   gene            14522..15637
FT                   /locus_tag="Alvin_0014"
FT   CDS_pept        14522..15637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0014"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: tgr:Tgr7_3245 efflux transporter, RND
FT                   family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60986"
FT                   /db_xref="GOA:D3RUT7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT7"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADC60986.1"
FT                   /translation="MPTTRFKRAWPGLALLFLLAPLGGRAGDTIPMSAEQQQAFKIQWT
FT                   APQAATEQHSRRYPAAVVVPNPQLRVVAAPWSGVLERLRVAEGEVVSAGQILAELRSPA
FT                   LIEAQSAYLESLIRLELAERERNRDRTLQREGLIAERRSVESESKYREQATLVDHKRQL
FT                   LELAGLSAEDIATLTRTRRLTSVLPVRAPIGGVVLEQLVSTGQSVDGATALYRLGDLDP
FT                   LWLEIHVPADQVAGLQIGARVWPTAQPDLAGRLITIGQWVDERDQGVVVRAEIHDPSGQ
FT                   LRPGQFVEVQLATATATEAAGWRLPAAALVRQGAEVYVFVARPGGFEALPVTLIAREEQ
FT                   DAVVSAAALSTEDRVAITGVVALKAAWLGGE"
FT   sig_peptide     14522..14602
FT                   /locus_tag="Alvin_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.960 at
FT                   residue 27"
FT   gene            15637..18783
FT                   /locus_tag="Alvin_0015"
FT   CDS_pept        15637..18783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0015"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: tgr:Tgr7_3246 heavy
FT                   metal efflux pump, CzcA family"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60987"
FT                   /db_xref="GOA:D3RUT8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT8"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ADC60987.1"
FT                   /translation="MLARLIQFALTQRLLMLLVVALLIGGGWRAVQLTPIDAFPDVSTT
FT                   QVKIIVKAPGMTPEEVAARITSLIEVEMLGLPRQTMLRSIAKYALTDITIDFAEGTDIV
FT                   WARQQVAERLNSVWGNLPEGIEGGIAPMTTPLGEMFMFSIEGGSLSLAERRDLLDWTIR
FT                   PALRSVPGVADVNALGGFVTTFEVVPDNARLAARSLSLEQLRAAIAANNRNDGAGRLDE
FT                   GEEVLLVRSAGAIQTLDDLGAIVVGGDTRQPVRVADIAEVRLSALTRYGAVTRNGQGET
FT                   VQALVLALRGANARALVDGIQAKLDELAPSLPEGVRLDVFYNRGVLVERAVQTVSKALI
FT                   EATILVIVLLVLFLGDARAALTVALILPLAALATFILMQQFGLSANLMSLGGLAIAIGM
FT                   LVDAAVVVVENVVTQLAQSGSGRRLPRLHLIYRATREVAVPVSSGILIIIIVFLPLLTL
FT                   QGLEGKLFVPVALTIVFALASALLLSLTVIPVLASYLLKAGHGEHEPWLPRMLGRLYAP
FT                   VLTTALRHSRWVIAAAILLLVVAGYVYTLIGKAFMPTLDEGNLIVQLEKLPSITLAESI
FT                   AIDQRVQRAILEEVPEVESIVARAGSDELGLDPMGLNQTDSFLVLKPMEEWRVPDKEAL
FT                   VESIRRVLERFPGVEYAFTQPIEMRVSEMLTGVRGDLAVKIFGPDPARLDQLAESVVGV
FT                   LQGLDGAQDVYTPRNAGAQYLNLVVDRLETGRLGIDADTLAGTLRAQVEGVTVGTVYLE
FT                   GKRRPVVIRGPEDLRQSPVRFASLRVAPPEGGSVPLTNLARLERIEGPVALTRERGNNL
FT                   SVAIANVGGRDLVGFVEEARRAVSAQVELPPGYWLEWGGEFENQQRAAARLALVVPIAL
FT                   GLIFLVLFSTFGSVSQALLVLSNVPFALIGGVFALALTGEYLSVPASVGFIALLGIAVL
FT                   NGVVMLTYFNQLRALGRPMDVVVVEGAQRRLRPVLMTANIAAFGLVPLLFATGPGSEIQ
FT                   RPLAIVVIGGLLSATLLTLILLPILYRRFGDRQRVKRASAPPAVEQGATATQPGDIDHV
FT                   "
FT   gene            18776..19081
FT                   /locus_tag="Alvin_0016"
FT   CDS_pept        18776..19081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_3247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60988"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR021634"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUT9"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_3247"
FT                   /protein_id="ADC60988.1"
FT                   /translation="MSDTVLYLVIPPRAEDLLTEWLLEREDVPGFTSLPVSGHGSSESS
FT                   MSLAEQVAGRSRRVLFMLHLPLSVAEALLAALAEEFRGGDLHYWLVPSLKAGRLNA"
FT   gene            19142..19543
FT                   /locus_tag="Alvin_0017"
FT   CDS_pept        19142..19543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ERM1; ERD4-related membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60989"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC60989.1"
FT                   /translation="MRLKTHSIMAGPLALALLLMSTTPEAASPSASLSVDRSSSSRFTV
FT                   GFVQVDPDAAASTLTVRGTVRPRISARGAIPGQVHITVLDAEGRTLAETDASLMRRNRQ
FT                   AQAAHFHAQLAIDPPPGSRVRVEHRLDRP"
FT   sig_peptide     19142..19222
FT                   /locus_tag="Alvin_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.873 at
FT                   residue 27"
FT   gene            19540..20841
FT                   /locus_tag="Alvin_0018"
FT   CDS_pept        19540..20841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0018"
FT                   /product="Di-heme cytochrome c peroxidase"
FT                   /note="PFAM: Di-haem cytochrome c peroxidase; KEGG:
FT                   mca:MCA1769 cytochrome c peroxidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60990"
FT                   /db_xref="GOA:D3RUU1"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU1"
FT                   /inference="protein motif:PFAM:PF03150"
FT                   /protein_id="ADC60990.1"
FT                   /translation="MSRSGWEAILKPDDVLVNMIDEDGMQTTKRTKPIHSLTLAGLLAA
FT                   APIAQADADLVALGKALFFDATLSEPPGQSCASCHAPIAGWTSPDSALNAAGGVHEGAV
FT                   AGRFGNRRPLMAAYASFSPPLHLDGEEDHFVGGNFWDGRATGWLLGHPTAEQAQGPFLN
FT                   PVEQNLTDDAELVRRVCAGPSGGALRAWFGESACANPTDGFNAIAQALLAFESSPEMNA
FT                   FSSKYDYHLKDPQRYPLTEQEQLGLMLFERKDKGNCAACHPHTPGSNGEPPLFTDFTYD
FT                   NLGVGRNPDNPWYRQNERNPEGAAWRDPGLGGFLKTVPRFADRTGENLGKFKVPSLRNA
FT                   DLRPSEGFAKSYMHNGAHKSLEEVVHFYNTRDTKPVCERIDAPEPGQNCWPEPEIAANV
FT                   NTDELGNLGLSAEEEAAIVAFMRTLNDGWSPPKD"
FT   gene            complement(20860..21777)
FT                   /locus_tag="Alvin_0019"
FT   CDS_pept        complement(20860..21777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0019"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   pen:PSEEN4794 cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60991"
FT                   /db_xref="GOA:D3RUU2"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU2"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADC60991.1"
FT                   /translation="MSIESRTPTTSAETAQLLRLATWASVSTAGLLILVKVVAWGMTGS
FT                   ITVLASLMDSAMDAMASLLTLLAVRWSLRPPDAEHRFGHGKAQALAALGQSAFIAGSAL
FT                   FLGLQAVDRFLHPRPLTEIGVGLGVIAFAILVTLALLALQRHVIRRTGSPAIRADALHY
FT                   ATDLATNSVTLVALGLAGFGWSWIDPILGLAIGLYILWSAARIGRDAVEMLMDRELPDE
FT                   ARWRILELARAIPEVCGAHGLRTHQSGQSLIIQLHLELDDVLPLRQAHQIALAVEARIR
FT                   ERYPDSDILIHQDPVSLGREATDS"
FT   gene            complement(21780..22358)
FT                   /locus_tag="Alvin_0020"
FT   CDS_pept        complement(21780..22358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0020"
FT                   /product="Diheme cytochrome c"
FT                   /note="PFAM: Dihaem cytochrome c; KEGG: sbm:Shew185_0241
FT                   diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60992"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU3"
FT                   /inference="protein motif:PFAM:PF09626"
FT                   /protein_id="ADC60992.1"
FT                   /translation="MSHRPFIARSALMGLLLVATGTALAATDDETRDWRRWLRMFPNIA
FT                   PATQPAYLQECGSCHLAYPPGVLPAASWSRILAPESLADHYGDDASLPDALVAELRGYL
FT                   MANAADGSARVRERAFAVPGAARSDTGLPRITETPYFIRKHRRIPARLVTDNPEVSRFS
FT                   QCNRCHIGADRGVFDERQIEIPGLGRWKD"
FT   sig_peptide     complement(22281..22358)
FT                   /locus_tag="Alvin_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(22398..23024)
FT                   /locus_tag="Alvin_0021"
FT   CDS_pept        complement(22398..23024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0021"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: tgr:Tgr7_0586
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60993"
FT                   /db_xref="GOA:D3RUU4"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU4"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ADC60993.1"
FT                   /translation="MPNDYPTDTTTLPNHSEPKTSERIRVWDPLVRVFHWSLVAGFATA
FT                   FIVEDDLLGVHVWAGYLVLALVAVRLVWGLIGTRHARFSDFVRSPGAVLAYLRDVVSLR
FT                   APRYLGHNPAGGAMILLLLISVAATGISGLALYGAEEFAGPLADVMRGLPAFWGDALEE
FT                   AHEVFAYFTLGLILIHVAGVLVSSLLHHENLIGSMISGYKRQERE"
FT   gene            23238..23594
FT                   /locus_tag="Alvin_0022"
FT   CDS_pept        23238..23594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0022"
FT                   /product="Domain of unknown function DUF1924"
FT                   /note="PFAM: Domain of unknown function DUF1924; KEGG:
FT                   shm:Shewmr7_3778 cytochrome c-type protein Shp"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60994"
FT                   /db_xref="GOA:D3RUU5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU5"
FT                   /inference="protein motif:PFAM:PF09086"
FT                   /protein_id="ADC60994.1"
FT                   /translation="MKRHLATVLLSASTLILPATLWAADPAAGAAGWTKEYPQADGSAP
FT                   RSCVTCHGRDLTQPGRQANTGKVIEPMAPSVNPQRLTDPAKIEKWLTRNCRWTLGRECT
FT                   ADEKADFIAYIKTQ"
FT   sig_peptide     23238..23309
FT                   /locus_tag="Alvin_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            23611..24159
FT                   /locus_tag="Alvin_0023"
FT   CDS_pept        23611..24159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0023"
FT                   /product="Diheme cytochrome c"
FT                   /note="PFAM: Dihaem cytochrome c; KEGG: shm:Shewmr7_3779
FT                   diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60995"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU6"
FT                   /inference="protein motif:PFAM:PF09626"
FT                   /protein_id="ADC60995.1"
FT                   /translation="MNPFPLKSVLTLLLTGTLAMGSAHIAFADDDDDDWFESPQTLAPP
FT                   VNATYNQECGSCHMAYPPGLLPPQAWAQIMTPDALTDHYGDDAGLSEERRTEISAFLQA
FT                   GASRVTLRMAPSGAVSGLPRITDSIAFKHEHDEIPARLVTGNPEVGRFSQCNACHRKAA
FT                   EGSYDERWIDIPGHGPWKD"
FT   sig_peptide     23611..23697
FT                   /locus_tag="Alvin_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            24201..24512
FT                   /locus_tag="Alvin_0024"
FT   CDS_pept        24201..24512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0024"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: pde:Pden_1661 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60996"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU7"
FT                   /inference="protein motif:COG:COG3212"
FT                   /protein_id="ADC60996.1"
FT                   /translation="MRYAILMGLLSLFSLQVNADTRDDHERAREARLRGEIRPIAEILH
FT                   HIGEQVPGEVIGIELERETRAGRPVWIYEIKILTPDGRRLEVEVDARNGRIQELEDDD"
FT   sig_peptide     24201..24260
FT                   /locus_tag="Alvin_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            24512..25189
FT                   /locus_tag="Alvin_0025"
FT   CDS_pept        24512..25189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0025"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; transcriptional regulator domain protein; KEGG:
FT                   mno:Mnod_6194 two component transcriptional regulator,
FT                   winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60997"
FT                   /db_xref="GOA:D3RUU8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC60997.1"
FT                   /translation="MRLLLVEDDDQVAETVTAGLTAAGFLVERARDGREAWFMGDTEPY
FT                   AAAILDLGLPGLDGLSVLRQWRAAGQRLPVLILSARGDWTERVEGIEAGADDYLPKPFR
FT                   FEELLARVRALIRRAAGQPAPVLVHGSFRLDTRRQTLSRDGLPIHLSPQEYRLVSYLMQ
FT                   QAGRVVSQQELTEQLYAQDFERDSNAVEVLVGRVRRKLGAELIQTRRGFGYLIEADDAS
FT                   HAP"
FT   gene            25215..26594
FT                   /locus_tag="Alvin_0026"
FT   CDS_pept        25215..26594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0026"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mno:Mnod_6193 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60998"
FT                   /db_xref="GOA:D3RUU9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUU9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC60998.1"
FT                   /translation="MRRRSLRARLWLSALISITLALLIAWLGLANLFERHVERHIGVEL
FT                   EVRLNQLAAAVEIAPDGSIRLTQEPQSPAFAQPLSGHYWQIDRPGQPGVRRSRSLWDEV
FT                   LILPDDDLAPGLIHAHRLPGPAGQSLLVRERRIRVSADPEPVELRLILAQDRAELLVAR
FT                   ANFTADMRPYLGLIAFLLTLATLIQIQTGLAPLEALRREVGAIRVGRASRLVAQGADEV
FT                   QPLVAELNALLEARERSVERARAWTADLAHGLKTPLSVLATDAERLRRAGHPDLAEDLD
FT                   QLALTMRRRVERELIRARVRSGHPPHAARAEVVENLARLLHTLERTPAGERIDWHITAT
FT                   ERITVALMADDLLELLGNLLENAAKWARERVEIQVSMSLEAAGQVEIRIADDGPGVPPE
FT                   HWPRLGERGLRLDERQVGTGLGLAIVRDVVEAYGGMLGFDHAGLGGLLVWVRLPEAHSL
FT                   D"
FT   sig_peptide     25215..25307
FT                   /locus_tag="Alvin_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.833) with cleavage site probability 0.721 at
FT                   residue 31"
FT   gene            26717..28162
FT                   /locus_tag="Alvin_0027"
FT   CDS_pept        26717..28162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0027"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: aeh:Mlg_0654 TrkH family
FT                   potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADC60999"
FT                   /db_xref="GOA:D3RUV0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV0"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADC60999.1"
FT                   /translation="MHWRAIIRLFGLLLMLYSLSFLPSLAVALVYQDGQWSVFLESLAA
FT                   TLSAGLLLWLPNSHRESELSVRDGFLIVALFWALLGVFGALPFILGLHLSLTDAVFESI
FT                   SGFTTTGATVIAGLDRLPPSILYHRQQIQWLGGMGVIVLAVAVLPLLGVGGMQLYRAEA
FT                   SGVAKHEKPTPRIGETARVLWSLYFGLTAACALAFWLAGMTLFDAVGHAFATVATGGFS
FT                   THDASLGHYDSPLIEAIAIVFMLAGAVNFAIHFVAWRDLDVRAYLNDPETRVFGLTILG
FT                   GSLFIAASLYWAQAYADVGSSLRHGTFQVVSIMTSTGFGTATFGDWPLHIPLVLVILSF
FT                   TGGCGGSTAGGLKVLRVMLLVKLGVRQLFQFAHPRAVLEVKIGRRVIKEDVLLSVWGFY
FT                   VLYIATCLLLTVAMMAAGLDLESAFGAVFTTVNLCGPGLGEVAVTFATVDPVVKWLGVF
FT                   GMLAGRLEIFTLLILFMPAFWRQ"
FT   sig_peptide     26717..26797
FT                   /locus_tag="Alvin_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.582 at
FT                   residue 27"
FT   gene            complement(28180..28821)
FT                   /locus_tag="Alvin_0028"
FT   CDS_pept        complement(28180..28821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0028"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="TIGRFAM: sulfur relay protein, TusE/DsrC/DsvC
FT                   family; PFAM: DsrC family protein; KEGG: aeh:Mlg_0997 DsrC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61000"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV1"
FT                   /inference="protein motif:TFAM:TIGR03342"
FT                   /protein_id="ADC61000.1"
FT                   /translation="MIEITVFMKVTNEPLKRTPVTLWLDTEDSQTAPVLTDRDGVARFD
FT                   LPPTSGKVLVSGVERYHGRLDGRIPIELWSITQSEHSSLGMPGEFPSGSNAYAGMTTQT
FT                   IAVGGREVLTDSEGYLVDPADWSEDFARALARHEGLTLTERHWEVIRFLREHFARRGTQ
FT                   ATVRDMIAHFRRLWGAEAGGNRGLHRLFPRGGPQKQGNRLAGLLRTKGEH"
FT   gene            28960..29127
FT                   /locus_tag="Alvin_0029"
FT   CDS_pept        28960..29127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbt:BBta_7517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61001"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61001.1"
FT                   /translation="MRERIHPPNRHGIRDGRLAHIHVQRATAARHDPGGPDGWRSVRRL
FT                   ISDLPADAGV"
FT   gene            29130..29771
FT                   /locus_tag="Alvin_0030"
FT   CDS_pept        29130..29771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0030"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   eba:ebA2713 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61002"
FT                   /db_xref="GOA:D3RUV3"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV3"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ADC61002.1"
FT                   /translation="MDLSVLSDLALDRLMYGISLGAVAMMAAAGVLEAGRKCFDLFGMV
FT                   VVALAAALGGGSLRDVLLDRPVFWVADQTYLIAALIAAMLTFFLARIFALPARLFLIPD
FT                   AAGLALFTISGTKAALAWGAPWLVASFMGVITGVVGGILRDVLCNEEPLVFQGTLYATA
FT                   AWAGALVFLGLMTVEIDPGQAAVAGGALIFLLRVAAIRWDIALPRFTSRL"
FT   gene            29907..34022
FT                   /locus_tag="Alvin_0031"
FT   CDS_pept        29907..34022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0031"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: hau:Haur_4372 XRE family transcriptional
FT                   regulator; TIGRFAM: DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   Hedgehog/intein hint domain protein; ATP-binding region
FT                   ATPase domain protein; helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61003"
FT                   /db_xref="GOA:D3RUV4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV4"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADC61003.1"
FT                   /translation="MTYDSTNIKVLRGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNS
FT                   IDEALAGYCSTVSVTLHADGSVSVVDDGRGIPVDIHAEENRSAAEVILTVLHAGGKFDD
FT                   NSYKVSGGLHGVGVSVVNALSERLYLRIRRGGHLHEQEYRLGEPVYPLRVIGDTEETGT
FT                   EIRFYPSGEIFSNLDFHYDILAKRLRELSFLNSGVRIALSDEASGRHDVFEYEGGIRAF
FT                   VENLNQNKEPIHPTVVYFSTERQDIGVELAIQWNNSYQETIFCYTNTIPQRDGGTHLAG
FT                   LRAALTRTLNGYIEREGLDKNQKIRPIGDDAREGLTAVLSVKVPDPKFSSQTKDKLVSS
FT                   EVKAVVESLVVEHLGTFLEEQPNEAKVIAGKMLEAARAREAARKAREMTRRKGVLDIAG
FT                   LPGKLADCQEKDPAKSELYLVEGDSAGGSAKQGRDRAFQAILPLKGKILNVEKARFDKM
FT                   LASAEVGTLITALGCGIGREEYNPDNLRYHRVIIMSVDAEEHVFVRDPGGHVRMTRIGD
FT                   FIDAALPEASGDDYCKRADADLGEVLCFGMEDRLTRFRPIKAVIRHPLHEPLYEVKSAY
FT                   GRSVRVTASHSVFVYEDQQIRLKRGDELCAGDRIVAPRSLSFPVTAPERLDVLSVLHAI
FT                   PEAAAQIWVRGVAVEACHKARVLAQYADDAELVSPRVELPVAVGAEVAALRRASGQTVR
FT                   SICEKIGIRQPVTIHAWENGQSRPRLDRWVAYLEAVGADVDRIMDQVKVVPGRLEQTWS
FT                   TQYRGAPANQVRPYVRLSDLDGEAVSGFGTRTDLELTPKHYADRGMARFINVNADLLWL
FT                   LGFYLAEGSCSERGGIRFAIGARNQAILPELRRVLEQTFGLQAQVYTSQDRVTELRLTN
FT                   RVAVLAWRHLFGFTNTNAIDKAIPDLVFSVDEPLRLAFIRGYLQGDGTLAAGRLGFATS
FT                   SRDLASGLSYLLSSFGVVASLSHYEPDGVVREIRGQPCVTRHPHWILTVSAREDLARLR
FT                   AVWADLPGAEALEARLQSTAPSVNRRFEALDGDLIALPIESITPVEASNGQVYDFSVED
FT                   DENFIAGLGGLCCHNTDADVDGAHIRTLLLTFFYRQMPELVERGHIYIAQPPLYKLKKG
FT                   KQEDYLLDETALNGAMLQSALDGAELHVNAEAPALANTALEALAKDYQVTVNIVRRLAS
FT                   RYDATFLDELVRTPPVDAALLSDGERLADWCRIMEARLNAAESVSLRYVLRLSEPTEGQ
FT                   SRGLELIRLIHGIPETRIIPLDFFNTTDYARLREFGLKLDGLIQPGAFVRRGEKIKEIG
FT                   DLGEAIRWLLAEAQRGYSIQRYKGLGEMNPEQLWETTMNPEMRRLLKVTIEDAVAADQI
FT                   FTTLMGDQVEPRREFIERNALNVGNLDI"
FT   gene            complement(34094..35560)
FT                   /locus_tag="Alvin_0032"
FT   CDS_pept        complement(34094..35560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0032"
FT                   /product="glutamate synthase, NADH/NADPH, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, NADH/NADPH, small
FT                   subunit; PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: hha:Hhal_1616 glutamate synthases,
FT                   NADH/NADPH, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61004"
FT                   /db_xref="GOA:D3RUV5"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV5"
FT                   /inference="protein motif:TFAM:TIGR01317"
FT                   /protein_id="ADC61004.1"
FT                   /translation="MGKPTGFMEYARRDRRYAPAGDRVVHYDEFVIPLSEPELSQQGAR
FT                   CMDCGIPFCHQGCPVNNIIPDWNDLVYRGDWQAAIEVLHSTNNFPEFTGRICPAPCEAS
FT                   CTLNIDDSPVTIKTIECAIVDRAWDEGWIKPQVPERRTGKRVAVVGSGPAGLACAQQLA
FT                   RAGHQVAIYEKADRIGGLLRYGIPDFKLNKKLIDRRMAQMRTEGVEFHTNAHVGVDIPV
FT                   SALRAEYDALVLAGGAEQPRDLPVPGRELQGIHFAMDFLRRNSQRVQGSYVPDEEFINA
FT                   QGKHVLVIGGGDTGSDCIGTSNRHGAASVTQVEILDRPPEKENKALTWPNWPNRMRTSS
FT                   SQEEGCTRMWNFATKGFVGDDQGRVKAVKYCLVRWEKDAEGRWRMEEVPGSEGELKADL
FT                   VLLAMGFVHPVREGMLEQLEHEAGLKLDGRGNVQGTTEGSDAYKTTVDGVFCAGDMRRG
FT                   QSLVVWAIREGRQCARAVDEWLMGRSDLPR"
FT   gene            complement(35553..40208)
FT                   /locus_tag="Alvin_0033"
FT   CDS_pept        complement(35553..40208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0033"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamate synthase; ferredoxin-dependent
FT                   glutamate synthase; glutamine amidotransferase class-II;
FT                   glutamate synthase alpha subunit domain protein; KEGG:
FT                   hha:Hhal_1617 glutamate synthase (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61005"
FT                   /db_xref="GOA:D3RUV6"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV6"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADC61005.1"
FT                   /translation="MSLRALPPAQGLYDPTLERDACGVGFVCHIKNHKSHAIVRQGLEI
FT                   LERLHHRGAVGADPKAGDGAGILVQIPDAFFRAVLDFELPAVGDYGVGLVFLPRDAEAR
FT                   ARMIETVERHLTEGGQRVLGWRDVPVDNSDLGPSVLPSEPMVRQVFVARGENCPDQDSF
FT                   ERRLFVIRKRMDNEIRAAGFDKTAYYVVSMSSRTLNYKGMLLADQVGKYYLDLSDERFV
FT                   SALALVHQRFSTNTFPTWDLAQPFRMICHNGEINTLRGNVNWMAARRHTMRSEILGEDL
FT                   DSIWPLIPEGQSDSACFDNALELLVMGGYSLAHAMMILIPEAWAGNKQMDAQRRAFYEY
FT                   HAALMEPWDGPAAVAFTDGRQIGATLDRNGLRPARYLVTNDDMVIMASEMGVLDIAEER
FT                   IVKKWRLQPGKMFLIDLEQGRIIDDAELKADLAAAKPYREWLAKTQIHLDELPTNVAPM
FT                   APDADTLLDAQQAFGYTQEDIKFLLTPMMLTGQEAVGSMGADNPPSVLSSRAKHLSTYF
FT                   KQNFAQVTNPPIDPIREELVMSLVSLIGPRPNLLGINEAGKHWRLEVSQPILTNQDLER
FT                   VRHIEDNSGGAFRTKNLHMVYAAGEGAAGMERALERLCLEAEAAVLAGYNILILSDRNT
FT                   NRDNIAIPALLATSAVHHHLIRRGLRTSSGLVVETGAALEVHHFATLAGYGAEAINPYL
FT                   AFDTIQSLLPSLAEKLTFEEAQYRYIKAVGKGLLKVMSKMGISTFQSYCGAQIFDAVGL
FT                   SNAFLERYFTGTHSRIEGVGLPEVAAEAVRWHSQAYGNEQIYSRHLDVGGDYAYRVRGE
FT                   DHIWTPETISKLQHATRANDAKTFAEFSRLVDEQNEHLLTLRGLMEFKFAETPIPLEEV
FT                   EPASEIVKRFATGAMSFGSISYEAHSTLAKAMNAIGGKSNTGEGGEEPERFNPLPDGSR
FT                   NPERSAIKQVASGRFGVTTEYLVNADDIQIKIAQGAKPGEGGQLPGHKVNAQIARVRHS
FT                   TPGVGLISPPPHHDIYSIEDLAQLIHDLKNVNPKARISVKLVSEVGVGTVAAGVSKAHA
FT                   DHVTISGYDGGTGASPLTSIKHAGSPWEIGLAETQQTLVLNRLRGRITVQVDGGLRTGR
FT                   DVVIGALLGADEFGFATAPLIVEGCLMMRKCHLNTCPVGVATQDPELRKKFTGKPEHVI
FT                   NYFFFVAEEVRQLMAKLGFRTIEEMIGQSDRLEMRRAIEHWKAHGLDYSRLLARPQVPA
FT                   EVAIRHAELQDHGLDKALDHTLIRQAAPALERGEPVRIETPIRNFNRTFGALLSGRVAE
FT                   RYGHAGLPDDTIHIKAKGTAGQSLGAWLARGVTLELEGEGNDYVGKGLSGGRIIIYPPA
FT                   ESAIGRAEDNIIVGNTVLYGAITGECFFRGVAGERFCVRNSGATAVVEGVGDHGCEYMT
FT                   GGITVVLGPTGRNFAAGMSGGVAYVLDEAGDFADRCNLAMVELEPIAEEDAALEAFDHQ
FT                   GGDLETHGRVDITHDMTRHDARRLKLLIERHLEYTDSAVARRILDDWASYLPKFVKVMP
FT                   VDYRRALQEMQANQSRPPRTNKPLKGIVEHG"
FT   gene            complement(40569..40907)
FT                   /locus_tag="Alvin_0034"
FT   CDS_pept        complement(40569..40907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mfa:Mfla_0272 DNA-directed RNA polymerase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61006"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61006.1"
FT                   /translation="MSDSNSRDLTQQDIDDSRRDGLSLATALVILAEDAWDGVRMEYDH
FT                   VIAQHGQMHEGWTLASQHVFLDGERRYDRLDIVLSSGEKLSYFFDITNFYGRHTIPDDD
FT                   DSEAGILD"
FT   gene            41063..42067
FT                   /locus_tag="Alvin_0035"
FT   CDS_pept        41063..42067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0035"
FT                   /product="putative transcriptional factor"
FT                   /note="KEGG: azo:azo2640 putative transcriptional factor"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61007"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV8"
FT                   /inference="similar to AA sequence:KEGG:azo2640"
FT                   /protein_id="ADC61007.1"
FT                   /translation="MSAAHLSRIERLKQLEACLPIEGRAERCPDVGCLLDRIGGIYGGA
FT                   SESATRRALQRDLKELVCDGRIAIVNPNGKPLRYRRLMDDPDDDPAVWDWLWQQVLTQA
FT                   GATLTRRQLDRVWRHLLTTTDGPRLDESRLRILPDTLRLQPVELHDGVLRAVIQALIQR
FT                   RVLRVHYLKPTGERRESDLHPQALMQRGPIPYLFALKDDEAEPIRLYALHRMTRAELLP
FT                   EVEARVADGFDLDAAIADGRADFGAGETIALELRVRGYLAELLRVCPLAPGQRIEDEPP
FT                   DSDFEQRVSAQVPSTGQLLRWLLGAGDNLEVVAPPDLRRIVAAQTRKAAALYG"
FT   gene            42060..42755
FT                   /locus_tag="Alvin_0036"
FT   CDS_pept        42060..42755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0036"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: mca:MCA0002
FT                   glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61008"
FT                   /db_xref="GOA:D3RUV9"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUV9"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ADC61008.1"
FT                   /translation="MDNDRKRSDGDSVKQAVHSPDAADWPVIEARLSHGCAALGLAPTP
FT                   EQQARLVALLGLLTRWNQAYNLTAVRDPLEMVAKHLLDSLAIAPFLFGETVLDVGTGAG
FT                   LPGLPLAILVPERRFWLLDSNNKKVRFVRQAVLELGLTNVEPVQSRIETYRPGRKFSTI
FT                   VSRAVAAESVLPVLTADLCDRPGRLLLMKGRADEAADETAWAALKPIVHRLTIPFLDAP
FT                   RHLIELRSD"
FT   gene            42763..43557
FT                   /locus_tag="Alvin_0037"
FT   CDS_pept        42763..43557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0037"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   aeh:Mlg_2878 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61009"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW0"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADC61009.1"
FT                   /translation="MVNIIAIANQKGGVGKTTTAVNLAAALAFMRRRVLLIDLDPQGNA
FT                   TMGCGVDKHQVEHTTCDLLLTEVPIADCLQRVTEPAPGFDLLPSNADLTAAEIGLLDSP
FT                   DREQRLSKVLATAVGAYEMVIIDCPPSLNMLTLNALVAAHGVLIPIQCEYYALEGLSSL
FT                   LDTIEQVRESRNAGLRIEGILRTMHDPRNNLANQVSTQLVTHFKDQVYRTIIPRNVRVA
FT                   EAPSHGQSALVYDPQSRGALAYLALASEVLRRQEKRRQAEAA"
FT   gene            43583..44557
FT                   /locus_tag="Alvin_0038"
FT   CDS_pept        43583..44557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0038"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: aeh:Mlg_2877 ParB-like partition proteins;
FT                   TIGRFAM: parB-like partition protein; PFAM: ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61010"
FT                   /db_xref="GOA:D3RUW1"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW1"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ADC61010.1"
FT                   /translation="MDTSEQKNTPRKKGLGRGLDALLGAARPPASRLDPVSDGTPTTLS
FT                   GGGVGPNPGLSPVETVRRLPLEYIQRGRYQPRRDFDPEALRELADSIRAQGVIQPIVVR
FT                   PLAEPGATGARYEIIAGERRWRASQQAGLAEIPVVVREVDERTALAIALIENIQRADLN
FT                   PLEEAGALERLITEFDLTHQDVAEAVGKSRATVSNLLRLLELNADVKELVAQSQLEMGH
FT                   ARALLGLKGDIQSQTAHQVVAAGLSVRETERLVRRVQQADEPSRATPKPSSADDPNIRQ
FT                   LQNDLTDRLGAHVWIQHGQRGSGKLVIAYNTLDELDGILSRIQ"
FT   gene            44673..45050
FT                   /locus_tag="Alvin_0039"
FT   CDS_pept        44673..45050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0039"
FT                   /product="ATP synthase I chain"
FT                   /note="PFAM: ATP synthase I chain; KEGG: pap:PSPA7_6363
FT                   F0F1 ATP synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61011"
FT                   /db_xref="GOA:D3RUW2"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW2"
FT                   /inference="protein motif:PFAM:PF03899"
FT                   /protein_id="ADC61011.1"
FT                   /translation="MQQPNALQARQILKIQSIFGLILTIIALPFGSPVAISVLIGAGTC
FT                   WLANALLVVWVFRAYRAQAPERLVLRFYSAEVAKIALILALFGVAFAIYDELNIPALLG
FT                   AYFLVQVIPTLIAAQTGSRTQ"
FT   gene            45064..45933
FT                   /locus_tag="Alvin_0040"
FT   CDS_pept        45064..45933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0040"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   tbd:Tbd_2803 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61012"
FT                   /db_xref="GOA:D3RUW3"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW3"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ADC61012.1"
FT                   /translation="MASSETLTSQEYIQHHLTNLTLGWHPEHGLGFAHNSAEAAEMGFW
FT                   AINVDTMFFSILLGSLFLWFFKGVAERVSAGVPGTAQNFVEWIVDFVEENVRGSFSHKN
FT                   DMVAPLALTIFSWVFLMNLMDLVPVDLIPHLFAQLFAVFGADPHHVYLKVVPTTDPNAT
FT                   FGMALTVFLLVLYYSIKMKGIGGFLGELTLQPFGKWGLPANLILEGISLISKPISLALR
FT                   LFGNMYAGEMIFILIALLYGGGMVLAGTAGVLQFVWAVFHILIITLQAFIFMVLTIVYL
FT                   DMAHQEHH"
FT   gene            46031..46282
FT                   /locus_tag="Alvin_0041"
FT   CDS_pept        46031..46282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0041"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   tau:Tola_3138 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61013"
FT                   /db_xref="GOA:D3RUW4"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW4"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ADC61013.1"
FT                   /translation="MELEVAQAFAMAIKFIGAGLMLGLGAVGAGVGIGVLGGRFLEGAA
FT                   RQPELIPMLRTQFFIVMGLVDALPVIAIAMGLYLMFAA"
FT   gene            46364..46834
FT                   /locus_tag="Alvin_0042"
FT   CDS_pept        46364..46834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0042"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   mca:MCA0008 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61014"
FT                   /db_xref="GOA:D3RUW5"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW5"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ADC61014.1"
FT                   /translation="MNINLTLFAQMITFAVFVGFCMKYIWPPIVKALAERKAKIAEGLA
FT                   AAERGHQEKALGEQRALELMKEAKTNAAEIVGQAQKRATDIVEEAKSDARSEGERLLAA
FT                   AKAEVERETNRAREELREKVATLAIAAAEKILQKEIDVAAHRSIVDDFAKQL"
FT   gene            46844..47383
FT                   /locus_tag="Alvin_0043"
FT   CDS_pept        46844..47383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0043"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: tgr:Tgr7_3308 H(+)-transporting two-sector ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61015"
FT                   /db_xref="GOA:D3RUW6"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW6"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ADC61015.1"
FT                   /translation="MAGELTTIARPYAEAAFAHAKESGRIDAWADALTLLATVTSDPHM
FT                   AAQIGNPTVPRERIRDLLLEICGDALAAGPANLVRLLADNARLAAIPEIARLFEERRVA
FT                   DQGVRHVLVRSAFEVEDAQRSALADALAKRLGAQVDLSFEIDTALLGGLEIRAGDFVID
FT                   HSVRGKIKQLAHALQF"
FT   gene            47397..48938
FT                   /locus_tag="Alvin_0044"
FT   CDS_pept        47397..48938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0044"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: noc:Noc_3076 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61016"
FT                   /db_xref="GOA:D3RUW7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW7"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ADC61016.1"
FT                   /translation="MQLNPSEISDLIKQKIEKFELQTEARTEGTVVSVTDGIVRIHGLS
FT                   DAQYYEMLEFPGNTYGLALNLERDSVGAVVLGDYTHLSEGDWVRCTGRVLEVPVGAGLL
FT                   GRVVDALGNPIDGKGPIEAEGTSPIEKVAPGVIERKSVDQPVQTGLKAIDAMVPVGRGQ
FT                   RELIIGDRQTGKTAVAIDAIINQKDTGVKCIYVAVGQKNSSIAAIVRKLEEHGAMDHTI
FT                   IVAAPAADSAAMQFLAPYAGCTMGEYFRDKGEDALIVYDDLTKQAWAYRQVSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNADYVEKMTDGKVKGQTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGIRLALAQ
FT                   YRELAAFSQFASDLDEATRKQLQRGERVTELMKQFQYSPMSVGQMAISLFAANEGYLDD
FT                   VDVKKVVDFERALQSYVKSARAELLAKIDSTGDFNDEIAQAMHAAIKDFKANNTW"
FT   gene            49075..49938
FT                   /locus_tag="Alvin_0045"
FT   CDS_pept        49075..49938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0045"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit; KEGG:
FT                   pag:PLES_59511 F0F1 ATP synthase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61017"
FT                   /db_xref="GOA:D3RUW8"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW8"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ADC61017.1"
FT                   /translation="MAGAKEIRTKIASIKSTQKITKAMQMVAASKMRKAQDRMAASRPY
FT                   AEKMLQVISHLANATPEYRHSFMAMERPRKRVGYIVVSSDRGLCGGLNSNLFRRLIAEI
FT                   KEQRAAGIEPVFCTIGSKALGFFKRFGGEVKAQATHLGDKPHVEDLVGTVKVMLDAFEA
FT                   GEIDAIYVVGNEFVNTMTQRPVIRQLVPLVPGEREAMPYHWDYIYEPDAKTVLDALLTR
FT                   YIESLVYQAVVENSACEQAARMVAMKAASDNAGNLIGELQLVYNKARQAAITQEISEIV
FT                   SGAAAV"
FT   gene            50041..51423
FT                   /locus_tag="Alvin_0046"
FT   CDS_pept        50041..51423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0046"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="7.1.2.2"
FT                   /note="KEGG: tgr:Tgr7_3305 F0F1 ATP synthase subunit beta;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61018"
FT                   /db_xref="GOA:D3RUW9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUW9"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ADC61018.1"
FT                   /translation="MSSGNVVEIIGAVVDVQFPRGEMPKVYDALKIESTGLTLEVQQQL
FT                   GDGVVRTIAMGSTDGLQRGVDVTATGAPIQVPVGQATLGRIMDVLGNPIDEQGEVKSEA
FT                   RWSIHRQAPKLEDQAASTEILETGIKVIDLIMPIAKGGKVGLFGGAGVGKTVTLMELIR
FT                   NIAVEHSGFSVFAGVGERTREGNDFYHEMKDGGVLDKVALVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEGRDVLMFIDNIYRYTLAGTEVSALLGRMPSAVGYQPTLASEMGALQERI
FT                   TSTRTGSITSFQAVYVPADDLTDPSPATTFAHLDATLVLSRQIAELGIYPAVDPLDSTS
FT                   RILDPNVVGTEHYETARAVQGTLQRYKELKDIIAILGMDELSEEDKLTVNRARKIQRFL
FT                   SQPFFVAEVFTGAPGKFVSVKDTIKDFKAIVNGEYDHLPEQAFYMVGGIEEAVEKAKKM
FT                   AN"
FT   gene            51439..51864
FT                   /locus_tag="Alvin_0047"
FT   CDS_pept        51439..51864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0047"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   ATPase, F1 complex, delta/epsilon subunit-like; KEGG:
FT                   noc:Noc_3073 H+-transporting two-sector ATPase,
FT                   delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61019"
FT                   /db_xref="GOA:D3RUX0"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX0"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ADC61019.1"
FT                   /translation="MAMTVHVDIVSAEGAIHSGQAAMVYATAEMGEVGIAPRHTAFISR
FT                   LRPGDVRVENEQGEQEHFYVSGGMLEVQPHKVTVLADTAIRARDLDEAAALEAKRRAED
FT                   ALSGQKAEFEYAKAQAELAEAVAQLRAIEKLRKMKRG"
FT   gene            51957..53321
FT                   /locus_tag="Alvin_0048"
FT   CDS_pept        51957..53321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0048"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein; KEGG:
FT                   reu:Reut_A0229 UDP-N-acetylglucosamine pyrophosphorylase /
FT                   glucosamine-1-phosphate N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61020"
FT                   /db_xref="GOA:D3RUX1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX1"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ADC61020.1"
FT                   /translation="MKTGVVILAAGQGKRMRSRRPKVLHPLAGRPLLAHVLAAARALDP
FT                   ARIVVVHGHGGEQVRAALADEDCLWVEQAEQRGTGHAVIQAMPALTDMDRVLVLYGDVP
FT                   LITPETLERLVALAGSTPLAVLTAELDDPSGYGRILRDAEARVVRIVEDKDATSDERAI
FT                   REINTGFLVADHARLVSWLDRIDDDNAQGEYYLTDVIELAAREGVAIATTQPEDLHEVA
FT                   GVNDRVQLAELERIHQRRQAESLMRSGVTLADPARFDLRGRLDTEPDVFIDVNVVIEGE
FT                   VRLASGVRVGPNCVLKDCVIGPDTEIQANCVIESAEVGANARIGPFARLRPEARLADDT
FT                   HVGNFVEIKKTQVGRGSKVNHLTYLGDAEVGAGVNVGAGTITCNYDGVNKFKTRIGDGA
FT                   FIGSNTALVAPVTVGAGATIGAGSVVTREAPADQLTLTRARQTTIQGWKRPTKKT"
FT   gene            53416..55248
FT                   /locus_tag="Alvin_0049"
FT   CDS_pept        53416..55248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0049"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   hch:HCH_07068 glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61021"
FT                   /db_xref="GOA:D3RUX2"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX2"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADC61021.1"
FT                   /translation="MCGIVGAIAQRPVAAILLEGLRRLEYRGYDSAGLAVLDESGRLDR
FT                   RRELGKVARLAEAVAASPLPGTLGIAHTRWATHGEPATHNAHPHVSHDRCMLVHNGIIE
FT                   NHEELRREQLAAGYVFTSETDTEVVVHAIHAELDRGQSLIEAVRAATGRLRGAYALGVI
FT                   DAADPEHLVAAREGSPLVIGVGFGEHFIASDVFALLPVTNRFIFLEEGDLAELTRDQVR
FT                   IWDRAGQRVERPIKTSTVAAEATERGPYRHYMQKEIFEQPRAIADTLEGRLTGERVLPE
FT                   TFGNQASELFQGIRNVTIVACGTSFHAALVARYWMEAVAGLPCQVEVASEYRYRRHVVP
FT                   EHALFVTISQSGETADTLAALRQAKASGYAATLAICNVPESSLVRESDLVFLTHAGPEI
FT                   GVASTKAFTTQLVALLLLTIALGRFHRLDATTEARLVALLRALPGKIEDVLRLDETIAA
FT                   LAERFIDKQHALFLGRGEQYPIAMEGALKLKEISYIHAEAYAAGELKHGPLALIDEQMP
FT                   VVAVAPNNALLEKLKSNLEEVRARGGQLVVFADFQVPLEEGEGVTVVRLPETDDLIDPL
FT                   IFTIPLQLLAYHVAVLKGTDVDQPRNLAKSVTVE"
FT   gene            55531..57804
FT                   /locus_tag="Alvin_0050"
FT   CDS_pept        55531..57804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0050"
FT                   /product="protein of unknown function DUF1631"
FT                   /note="PFAM: protein of unknown function DUF1631; KEGG:
FT                   tbd:Tbd_2129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61022"
FT                   /db_xref="InterPro:IPR012434"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX3"
FT                   /inference="protein motif:PFAM:PF07793"
FT                   /protein_id="ADC61022.1"
FT                   /translation="MFKQPNSNVIPFGGREPRPSDAMQADTLAILHTCRERLIDTVRAV
FT                   FTRRLGRANDELLAMMDQAFEQEQRQLCFDAMSLLANRAPLLLQHFREAYVSLFDESIE
FT                   RLADQDRHTRVELPDELRLIDEEDFELDLAMTKLTTRASFNCAQPLVALDRRLAVLLNG
FT                   PRLTPEDNPLHPIGLYRALFQALTALDASRELAIFLMQAFERQTSAELPGIYNDINRYL
FT                   IESGILPKIPLTEPGMQTSEVRSSIPGAMSASVMPTAPMMPAASVISNEQSSPANDVFA
FT                   QLVAALQRLAGNPVQPATVAGSAVSPPGTLATPPRFGHEQLIQALGSLQRGPLAPGAVP
FT                   GLGMAPLDPRAGNVVAQLRATPMATGSPPVDAVTIDIVAMLFEAIFDDPELPAAIRAEI
FT                   AKLQIPVLKVALLDKGFFSDRKHPARRLLDVIAQAGVGHGEHENPRLLETIRAIVTAVI
FT                   TEFESDIGIFASQVERLEAFLAKEDARSYDKATGIVEELARHERQELALGRVAAEIQGR
FT                   ITRPGVPGLIVDFIERGWSQVLSEVFVSQGEANPQWTQALQLMDELIWSVEPKIHPADR
FT                   ERFIGRLPHLIQGLRSGLARLGLEEAWSEFFSVLIQRHVAALRGEGAMLNGAATSTSTP
FT                   PIAPVTDRAPAPSKSPSAGQGVSATADPHLDLVRALEPGAWIEFQTERGTRNTLRLSWV
FT                   SEFKGVYLFTNRQGENAMTLAAASLATHLRKGTARLLSQNPLTERAVARVMERMQPTTA
FT                   ESGA"
FT   gene            complement(57761..58795)
FT                   /locus_tag="Alvin_0051"
FT   CDS_pept        complement(57761..58795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0051"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   noc:Noc_2167 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61023"
FT                   /db_xref="GOA:D3RUX4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADC61023.1"
FT                   /translation="MTNTTQAAHLGPVLVTGATGQVGRRLVSALLETGHPVTILTRSPA
FT                   AARRLWPSDRVAVHAGDLTEAATLAGLGEGLKTVFHLASYAPRPDEPDLYNAPDHWRVT
FT                   AEGTANLVAALTGSTIERLVYVSTVKAMGDRAGALGRPAGADTPPEPDCLYGRAKLAAE
FT                   HSVLEFGRAHRTKVSVMRLPMVYGLDGAGNIVRMVEAVATGRFPPWPHQHNRRSAIHVE
FT                   DAIAAALLIARHPETGDRTYIATDGQPYSTRWIYEQIRLALGQSVPRWTLPLWILQGAA
FT                   LGGTLVERGLGQRMPLTRDSLAKLTQDAWYDSSAITALGFVPRQGLMDEIKRLTRRSSA
FT                   ASAP"
FT   gene            complement(58792..59691)
FT                   /locus_tag="Alvin_0052"
FT   CDS_pept        complement(58792..59691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0052"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   noc:Noc_2168 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61024"
FT                   /db_xref="GOA:D3RUX5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC61024.1"
FT                   /translation="MTESHSPVPAVSLILVNYNAGPLLTDAVGAALASSVPVEVIVSDN
FT                   GSRDDSLERLRRTHGRDERLRILENGANLGFAAANNRALPLARAERLLFLNPDCLVAPD
FT                   TLERLIAILDAHPEVGMIGCLVCDPDGTEQVACRRAIPDPWIALQRLLRLDRLNRSAAG
FT                   RRLDQRHQPLPTEPVEVEAISGSFMLTTRRALEQVGPLDAGYFLHCEDLDWFVRFQSAG
FT                   LKILFVPNVSVIHHKGACSTGDPLAVERHKHRGMVRFFRKHQMQRYSRLFGGFVIVGIW
FT                   VHFGLKAVVIRLGSRSRA"
FT   gene            complement(59861..60322)
FT                   /locus_tag="Alvin_0053"
FT   CDS_pept        complement(59861..60322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61025"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61025.1"
FT                   /translation="MSVSSVKPKSTRAILALSTVAAILVYTPVSQAFNFGNMMNPNRWF
FT                   GGDRDRYDDPYWGGPYAPGPYGGYGYPGVYGAPYGLPYGVPGFGVPPAGYGAVPAQTPV
FT                   PSTQPKVDPSEVEALKRRIEELESRQQGPSQPPNPEWPAAPAFRPMNQY"
FT   sig_peptide     complement(60224..60322)
FT                   /locus_tag="Alvin_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.982 at
FT                   residue 33"
FT   gene            complement(60419..61297)
FT                   /locus_tag="Alvin_0054"
FT   CDS_pept        complement(60419..61297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0054"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: tgr:Tgr7_1274
FT                   hydrogenase accessory protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61026"
FT                   /db_xref="GOA:D3RUX7"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX7"
FT                   /inference="protein motif:TFAM:TIGR00073"
FT                   /protein_id="ADC61026.1"
FT                   /translation="MCNTCGCNITPGNEHLVQGDGRHAQTTDGKAAVEVLQGLLSENDH
FT                   QAAHNREHLDHHGVLALNLMSSPGAGKTRLLEATIEALGPELRIAVIEGDLETENDAER
FT                   IRAKGVPAIQIATGSACHLDAHLVHQALHRLDLSQIDLLFIENVGNLVCPASFDLGQHR
FT                   NVILISVPEGDDKPAKYPVMFRAADLVLCSKSDLLPLMPEFDPERAERHLRALASTAPF
FT                   ESISARSHADLEPWLHWLRDELQAQRARLELGRTIRPNHQRDGEHRSGLTGMAAPGHHH
FT                   HHHHEPAHTHG"
FT   gene            61577..62257
FT                   /locus_tag="Alvin_0055"
FT   CDS_pept        61577..62257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0055"
FT                   /product="SOUL heme-binding protein"
FT                   /note="PFAM: SOUL heme-binding protein; KEGG: sfu:Sfum_2407
FT                   SOUL heme-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61027"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX8"
FT                   /inference="protein motif:PFAM:PF04832"
FT                   /protein_id="ADC61027.1"
FT                   /translation="MTTSKTWTARAWLGAVLLLSGAFAMATEEPRYQILKTTEDYELRD
FT                   YEPYRVAEVEVRGAFEEVGSQAFRILAGYIFGDNQGEAKIAMTAPVSQRPGEMSSGADP
FT                   GAGTRLEMTAPVTQRPAAAESDTYVISFAMPESFTLEALPRPNNPRIRLREEPAGRVAA
FT                   RRYSGSWSESRYRDEERRLLDALQRDGLQPHGVPIYARYNGPFSLPMLRRNEILVPLAG
FT                   SPDS"
FT   sig_peptide     61577..61657
FT                   /locus_tag="Alvin_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 27"
FT   gene            complement(62311..62748)
FT                   /locus_tag="Alvin_0056"
FT   CDS_pept        complement(62311..62748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0056"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: tgr:Tgr7_0209
FT                   D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61028"
FT                   /db_xref="GOA:D3RUX9"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUX9"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ADC61028.1"
FT                   /translation="MIGLLQRVSEARVVVSGETVGSIERGLLVLVGVQRGDDEARAERL
FT                   LERLLGYRVFPDAQDRMNLSLRDIDGGLLLVPQFTLAADTRKGTRASFTSAAPPDEGQR
FT                   LFDHLVERARKAHPRVATGRFGADMQVGLINDGPVTFWLET"
FT   gene            complement(62745..63707)
FT                   /locus_tag="Alvin_0057"
FT   CDS_pept        complement(62745..63707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0057"
FT                   /product="proline iminopeptidase"
FT                   /EC_number="3.4.11.5"
FT                   /note="KEGG: bch:Bcen2424_4115 proline iminopeptidase;
FT                   TIGRFAM: proline iminopeptidase; PFAM: alpha/beta hydrolase
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61029"
FT                   /db_xref="GOA:D3RUY0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUY0"
FT                   /inference="protein motif:TFAM:TIGR01249"
FT                   /protein_id="ADC61029.1"
FT                   /translation="MDTQATDFHPITEPFAVHELIVDNGHRLYVEECGRPDGVPAIFLH
FT                   GGPGAGCEPAHRGFFDPERYRAVLFDQRGCGRSTPHASLMANTTWDLVSDMELIRQQLG
FT                   IERWLVFGGSWGSTLALAYAETYPERVSALVVRGIFLCRAEEIRWFYQEGANWAFPDFW
FT                   EDFLAPIPEDEHADLLSAYHARLTGENEAVRLEAARAWSIWEGRTATLLANPNVQAHFA
FT                   DPHVALSLARIESHYFVNGAFLAPDQLLRDAHRLAEIPGVIVQGRYDLICPMRSAWELH
FT                   QAWPTAELQVVPDAGHSAFEPGIRRALVAATDRFARELA"
FT   gene            complement(63723..65615)
FT                   /locus_tag="Alvin_0058"
FT   CDS_pept        complement(63723..65615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0058"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: tgr:Tgr7_0487
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61030"
FT                   /db_xref="GOA:D3RUY1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUY1"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ADC61030.1"
FT                   /translation="MSAIPHDFVRKTAQLSEEVTRPFPNSRKVHVTGSRPDIRVPMREV
FT                   TLTPTQTNQEPEENPPILIYDTSGPYTDPEARIDLLAGLPDIRSGWIAEREDTEQLDGP
FT                   TSAFGRGRQNDPQLAHLRFEHLRTPRRAKSGRNVTQMHYARQGIITPEMEYVAIRENMR
FT                   LDELRADPRYAKLLRQHPGQSFGAAIPETITPEFVRDEIACGRAIIPANINHPELEPMI
FT                   IGRNFRVKINTNIGNSALTSSIEEEVEKMVWSARWGGDTLMDLSTGKHIHETREWILRN
FT                   APMPIGTVPIYQALEKVDGKPEELSWEIVRDTLIEQAEQGVDYFTIHAGVLLRYVPLTA
FT                   DRLTGIVSRGGSILAKWCLAHHQENFLYTHFEEICEIMKAYDVAFSLGDGLRPGSLADA
FT                   NDAAQFAELETLGELTQVAWKHDVQVMIEGPGHVPLQMVQENVTKELADCFEAPFYTLG
FT                   PIVTDIAPAYDHITSGMGAANIGWYGTAMLCYVTPKEHLGLPNKEDVREGIITYKIAAH
FT                   AADLAKGLPGAQIQDNALSKARFEFRWEDQFNLSLDPERAREYHDATLPHQSHKVAHFC
FT                   SMCGPHFCSMKITQDVRDYAANQRIENLDTAVAEGMREKAREFREDGAAIYKAV"
FT   misc_binding    complement(65792..65899)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 59.47"
FT   gene            66007..68091
FT                   /locus_tag="Alvin_0059"
FT   CDS_pept        66007..68091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0059"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="KEGG: smt:Smal_3705 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain protein; response
FT                   regulator receiver; GGDEF domain containing protein; SMART:
FT                   GGDEF domain containing protein; EAL domain protein;
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61031"
FT                   /db_xref="GOA:D3RUY2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUY2"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC61031.1"
FT                   /translation="MTRTGPSGHVYVLSTQTTLTESLCPLLESHGVQLVLFETVEALMQ
FT                   AILTLAPEVIVLDLGLIPDEPGLSGLCTRIAESTHRRPSLIGLAAGQERGEEALVRRLA
FT                   ARRAGLASYVSGPVSARRLASRILALCGFLESSRYHILLLVEHPDEGRRLALMLAAVGM
FT                   KTLVVSDPMKLLARLMVFKPNLLLMEMQFSQVSGIELAAIIRDDDQFHALPILFLTDET
FT                   DPVRQLWALRAGGDGFIPRPARRETLVSAIEQQLRLSRWFQDRFTLSNRRENARGFLPR
FT                   DVFMSHLEHLLRTWVPGSERQGLLLLDLDAGQTLLERLGHGGLERLLRELEQCLGRHLN
FT                   VNEAATRLDDFRYAILARRDGSAKLQALADQLHQHIQAFALQDSANTRSLTLSIGVASL
FT                   NPPPADLQSLLSRAELAVRSAGQAGGDRVHVWSPVTLESATVMTETVVRRLVKTALQQD
FT                   GLRLLFQPILPVDPYVEGCYEAQIRLHTLGGDELSPADFLAVAARAELMPKIDRWVLQR
FT                   TWRTMLERQEADQPPRLLVHQHITTLAASDWFDWLRAQQTRIAPLKTRTVLEFQIDEIR
FT                   RRRREAESIFGRLAEQGIAVCAATVTGNEDEALLLTQLGVKLAKLTIEAGRTADPARLG
FT                   NAIQALRAQGIAVIVPGIDGPDDLRRVWMCRPEFIQGHYLQLPSSDLNFDFQTLSHETR
FT                   "
FT   gene            68078..68683
FT                   /locus_tag="Alvin_0060"
FT   CDS_pept        68078..68683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5226 primosome assembly protein PriA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61032"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61032.1"
FT                   /translation="MKPDSLLMSTALHTGRLILTPSDPHLAPDVDLLIEGLSRPGFLSA
FT                   PLILENPQPGAGDRAFATGAGFLSLLTFAGCAVRIRDDVRAGRFSHIRIPPVSQHPRLM
FT                   VGRNTRPPRCVGCRAPLSGWRALVEHWATHPHAGVQCPACGETRPPWLWDWKQQGGFGR
FT                   AFVQIEEVFPGEAVPTPMFFEQLIRVSGIGWRHFYIQD"
FT   gene            complement(68838..69905)
FT                   /locus_tag="Alvin_0061"
FT   CDS_pept        complement(68838..69905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0061"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class III,
FT                   PhaC subunit"
FT                   /note="TIGRFAM: poly(R)-hydroxyalkanoic acid synthase,
FT                   class III, PhaC subunit; PFAM: alpha/beta hydrolase fold;
FT                   KEGG: tgr:Tgr7_1512 poly(R)-hydroxyalkanoic acid synthase,
FT                   class III, PhaC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61033"
FT                   /db_xref="GOA:P45370"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010125"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45370"
FT                   /inference="protein motif:TFAM:TIGR01836"
FT                   /protein_id="ADC61033.1"
FT                   /translation="MFPIDIRPDKLTQEMLDYSRKLGQGMENLLNAEAIDTGVSPKQAV
FT                   YSEDKLVLYRYDRPEGAPEAQPVPLLIVYALVNRPYMTDIQEDRSTIKGLLATGQDVYL
FT                   IDWGYPDQADRALTLDDYINGYIDRCVDYLREAHGVDKVNLLGICQGGAFSLMYSALHP
FT                   DKVRNLVTMVTPVDFKTPDNLLSAWVQNVDIDLAVDTMGNIPGELLNWTFLSLKPFSLT
FT                   GQKYVNMVDLLDDPDKVKNFLRMEKWIFDSPDQAGETFRQFIKDFYQNNGFLNGGVVLG
FT                   GQEVDLKDITCPVLNIFALQDHLVPPDASRALKGLTSSPDYTELAFPGGHIGIYVSGKA
FT                   QKEVTPAIGKWLNER"
FT   gene            complement(69963..71036)
FT                   /locus_tag="Alvin_0062"
FT   CDS_pept        complement(69963..71036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0062"
FT                   /product="poly(R)-hydroxyalkanoic acid synthase, class III,
FT                   PhaE subunit"
FT                   /note="TIGRFAM: poly(R)-hydroxyalkanoic acid synthase,
FT                   class III, PhaE subunit; PFAM: Poly(R)-hydroxyalkanoic acid
FT                   synthase class III PhaE subunit; KEGG: tgr:Tgr7_1513
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61034"
FT                   /db_xref="GOA:P45372"
FT                   /db_xref="InterPro:IPR010123"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45372"
FT                   /inference="protein motif:TFAM:TIGR01834"
FT                   /protein_id="ADC61034.1"
FT                   /translation="MSNTNFFNDDWLELQRKYWDNWTDMSRKAMGLDSASSSATTPWEA
FT                   AIDQWWKAMAPAAPDLSRSFMEKMMEQGKNFFRLADTFAKRADEGNAGNGLELWTKTLE
FT                   DMQKRFSGSLDDGGNTMQRLMSFWELPLDNWQRMMSSMSPMPGDMLRNMPHEQFKDSLD
FT                   RALSAPGLGYTREEQSQYQELMRSAMEYQAALQEYTNVYTKLGMKSVEHMGSYIQGVID
FT                   SGKTIDSARALYDNWVACCEGAYADEVATPEYARIHGRLVNAQMALKKRMSILVDENLG
FT                   ALNMPTRSELRTLQDRLQETRRENKALRHSLHSLERRVAALAGEEPATKPATALRSPAP
FT                   AAKAPARRRTTKTNPAD"
FT   gene            71187..72371
FT                   /locus_tag="Alvin_0063"
FT   CDS_pept        71187..72371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0063"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; KEGG:
FT                   mgm:Mmc1_1165 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61035"
FT                   /db_xref="GOA:P45369"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45369"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ADC61035.1"
FT                   /translation="MNENIVIVDAGRSAIGTFSGSLSSLSATEIGTAVLKGLLARTGLA
FT                   PEQIDEVILGQVLTAGVGQNPARQTTLKAGLPHSVPAMTINKVCGSGLKAVHLAMQAIA
FT                   CGDADIVIAGGQESMSQSSHVLPRSRDGQRMGDWSMKDTMIVDGLWDAFNNYHMGTTAE
FT                   NIAQKYGFTREQQDAFAAASQQKTEAAQKAGRFQDEIIPIEIPQRKGDPKVFDADEFPR
FT                   HGTTAESLGKLRPAFSRDGSVTAGNASGINDGAAMVVVMKESKAKELGLKPMARLVAFA
FT                   SAGVDPAIMGTGPIPASTKCLEKAGWTPADLDLIEANEAFAAQAMSVNQDMGWDLSKVN
FT                   VNGGAIAIGHPIGASGARVLVTLLYEMQKRDAKKGLATLCIGGGQGVALAVERM"
FT   gene            72518..72979
FT                   /locus_tag="Alvin_0064"
FT   CDS_pept        72518..72979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0064"
FT                   /product="polyhydroxyalkonate synthesis repressor, PhaR"
FT                   /note="TIGRFAM: polyhydroxyalkanoate synthesis repressor
FT                   PhaR; PFAM: PHA accumulation regulator DNA-binding protein;
FT                   PHB accumulation regulatory domain protein; KEGG:
FT                   tgr:Tgr7_1516 polyhydroxyalkonate synthesis repressor,
FT                   PhaR"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61036"
FT                   /db_xref="GOA:P45373"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45373"
FT                   /inference="protein motif:TFAM:TIGR01848"
FT                   /protein_id="ADC61036.1"
FT                   /translation="MNSERIIKKYPNRRLYDTEVSRYITLADVRDLVMSGQPFRVLDSA
FT                   NDSDITRSILLQIMLEEETGGQPLFSANMLAQIIRFYGGTLQGTFARYLESSLDLFAKQ
FT                   QQEVTKALTDNPFGTVTRLTQKNVEIWADLQDELMRAAGFPVAPRKKKE"
FT   gene            73076..73438
FT                   /locus_tag="Alvin_0065"
FT   CDS_pept        73076..73438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0065"
FT                   /product="phasin family protein"
FT                   /note="KEGG: mgm:Mmc1_1168 phasin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61037"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45374"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_1168"
FT                   /protein_id="ADC61037.1"
FT                   /translation="MNTTDSLKTVNEWTNKSVERMTSFGELNVRLFEKLAARQMDAVNL
FT                   YMDHSMRLMKLATESKGYNDLFKGQVDATKELSERVMAESKATMQFFGDARDEYRVWFE
FT                   KSLNDVSEDLRKSVAV"
FT   gene            73627..74367
FT                   /locus_tag="Alvin_0066"
FT   CDS_pept        73627..74367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0066"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /note="TIGRFAM: acetoacetyl-CoA reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tgr:Tgr7_1519 acetoacetyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61038"
FT                   /db_xref="GOA:P45375"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45375"
FT                   /inference="protein motif:TFAM:TIGR01829"
FT                   /protein_id="ADC61038.1"
FT                   /translation="MARIALVTGGIGGIGTSICTRLAKDGCTVVANCHPSEAAAAEEWK
FT                   QARAAEGFDIAVFTADVSSFDDSARMVREITEQVGPIDILVNCAGITRDKTFKKMEQAH
FT                   WEAVINVNLNSVFNVTRQVWDGMLERGFGRIINISSVNGQRGQFGQANYSAAKAGMHGF
FT                   TMALAQEGASKGVTVNTISPGYVETAMTLAMNDDVRNSIISGIPMRRMAQPDEIAAAIA
FT                   FLAGDESGYMTGANLPVNGGLFMH"
FT   gene            74517..75281
FT                   /locus_tag="Alvin_0067"
FT   CDS_pept        74517..75281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0067"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   pag:PLES_48241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61039"
FT                   /db_xref="GOA:P45371"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P45371"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ADC61039.1"
FT                   /translation="MNAVMTDVRDLIRYCDDVLDAARFADYAPNGLQVEGERPLQRLVS
FT                   GVTASAALIEAAIAEHADAILVHHGWFWKNENPCLIGIKGQRARTLLSAGVSLIAYHLP
FT                   LDAHPELGNNATLGRRLDFIDMEPTALANGLLWVGRLAQPMTPASFTEHVSQRLARPAL
FT                   RVGRETGSIERVAWCTGGCQGYIEQAASLGVDAFLSGELSEQTTHQARELGLCYLAAGH
FT                   HATERYGVQALGKHLAERFGLWHRFVEIDNPA"
FT   gene            75512..76081
FT                   /locus_tag="Alvin_0068"
FT   CDS_pept        75512..76081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0068"
FT                   /product="ubiquinol-cytochrome c reductase, iron-sulfur
FT                   subunit"
FT                   /EC_number="7.1.1.8"
FT                   /note="KEGG: tbd:Tbd_1833 ubiquinol-cytochrome c reductase,
FT                   iron-sulfur subunit; TIGRFAM: ubiquinol-cytochrome c
FT                   reductase, iron-sulfur subunit; PFAM:
FT                   Ubiquitinol-cytochrome C reductase, Fe-S subunit, TAT
FT                   signal; Rieske [2Fe-2S] iron-sulphur domain"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61040"
FT                   /db_xref="GOA:O31214"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31214"
FT                   /inference="protein motif:TFAM:TIGR01416"
FT                   /protein_id="ADC61040.1"
FT                   /translation="MRRRVLVAATSVVGAVGAGYALVPFVASMNPSARARAAGAPVEAD
FT                   ISKLEPGALLRVKWRGKPVWVVHRSPEMLAALSSNDPKLVDPTSEVPQQPDYCKNPTRS
FT                   IKPEYLVAIGICTHLGCSPTYRPEFGPDDLGSDWKGGFHCPCHGSRFDLAARVFKNVPA
FT                   PTNLVIPKHVYLNDTTILIGEDRGSA"
FT   sig_peptide     75512..75625
FT                   /locus_tag="Alvin_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.423 at
FT                   residue 38"
FT   gene            76081..77325
FT                   /locus_tag="Alvin_0069"
FT   CDS_pept        76081..77325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0069"
FT                   /product="Cytochrome b/b6 domain protein"
FT                   /note="PFAM: Cytochrome b/b6 domain; KEGG: tbd:Tbd_1832
FT                   cytochrome b subunit of cytochrome bc1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61041"
FT                   /db_xref="GOA:O31215"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31215"
FT                   /inference="protein motif:PFAM:PF00033"
FT                   /protein_id="ADC61041.1"
FT                   /translation="MSAEKTENLSWIDKRFPLSETWRNHLSEYYAPKNLNFWSFFGSLA
FT                   ILTLVIQIVTGVWLAMSYKPDAGLAFASVEYIMRDVDWGWLIRYMHSTGASMFFIVIYL
FT                   HMFRGLLWGSYRKPRELLWMIGVVIYLVMMATAFFGYLLPWGQMSYWGAQVIVNLFAAV
FT                   PVVGEDLSVWVRGDFVISDATLNRFFAFHFLLPFLLAGLVFLHIVALHHVGSNNPDGIE
FT                   IKEGPKGNRWSDKAPADGIPFHPYYTVKDLMGVVVFLAIFGYVMFFNPTMGGLFLEAPN
FT                   FQPANPMQTPAHIAPVWYFTPFYAMLRAVPPMYGSQFPGVVVMFAAILILFVLPWLDRS
FT                   PVKSMRYKGPIFKWATGIFVVSFVALAWLGIQPASDFYTLLSQIFTVLYFAYFLLMPIY
FT                   SSLDKTKPVPERVTS"
FT   gene            77322..78056
FT                   /locus_tag="Alvin_0070"
FT   CDS_pept        77322..78056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0070"
FT                   /product="cytochrome c1"
FT                   /note="PFAM: cytochrome c1; KEGG: sfr:Sfri_3305 cytochrome
FT                   c1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61042"
FT                   /db_xref="GOA:O31216"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31216"
FT                   /inference="protein motif:PFAM:PF02167"
FT                   /protein_id="ADC61042.1"
FT                   /translation="MRKLILATFLLLAPTALLASGGGEHLESANIDLRDQASLQRGAKY
FT                   FMNYCTGCHSLQYMRYNRLAKDLGIDEIALRQNLLFGDAKPGDLITKAMTDDDALKWFG
FT                   VVPPDLTLVTRWRSPDWVYTYLKSFYLDDTRPYGVNNVLFPLVGMPHVLGDLQGRQEAV
FT                   MEPSHEPGGEPTIKGVKLVEEGGLSPQEYDTMVRDITNFLTYAGEPFQLERERIGRYVL
FT                   LFLGFLFILAYLLKKEYWKDVH"
FT   sig_peptide     77322..77381
FT                   /locus_tag="Alvin_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.881 at
FT                   residue 20"
FT   gene            78126..78734
FT                   /locus_tag="Alvin_0071"
FT   CDS_pept        78126..78734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0071"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   pag:PLES_48071 stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61043"
FT                   /db_xref="GOA:D3RUZ4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUZ4"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ADC61043.1"
FT                   /translation="MTLYSDPTCPYCHRVRMVLAEKGIAVDVVDVDAKALPDEVMDFNP
FT                   YGTVPTFVDRDLRLYESRIIMEYLDERFPHPPLLPVDPVSRANARLFMYRVDRDWYSLM
FT                   GRILHGEGGEVEQARKELRESLTATAPVFGAHAFFMSEEFSLVDCCVAPLLWRLPVLGV
FT                   ELPKQADPIRVYMKRIFTWEAFRRSLTEAEKEMIADIRR"
FT   gene            78731..79216
FT                   /locus_tag="Alvin_0072"
FT   CDS_pept        78731..79216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0072"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   maq:Maqu_2466 ClpXP protease specificity-enhancing factor"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61044"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUZ5"
FT                   /inference="protein motif:PFAM:PF04386"
FT                   /protein_id="ADC61044.1"
FT                   /translation="MNDTTDDRMTSSKPYLVRAIYEWILDNQMTPHLVVDADFPDTRVP
FT                   MEFVADGRIVLNIAPGAVRGLVIGNEWIEFGARFGGTAREVLVPTEAVVGIFTRENGQG
FT                   MVFPDPTYPEPTQAANAPAASGPRLTSLPNTQGSAGDKPSPDRPKGKKGAPTLKVVK"
FT   gene            complement(79271..79585)
FT                   /locus_tag="Alvin_0073"
FT   CDS_pept        complement(79271..79585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61045"
FT                   /db_xref="InterPro:IPR021732"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUZ6"
FT                   /inference="similar to AA sequence:KEGG:ebA6177"
FT                   /protein_id="ADC61045.1"
FT                   /translation="MSHLLTVCLLLLLGWFWLDSLRAREIAIGICQAACRQRELQFLDQ
FT                   AVALRRLGLSWRSEGVRLRRVYRFDFSEEGMGRRQGYIVMRGLHLEDLSFGLPEQVSDA
FT                   "
FT   gene            complement(79582..80052)
FT                   /locus_tag="Alvin_0074"
FT   CDS_pept        complement(79582..80052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0074"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61046"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61046.1"
FT                   /translation="MSTTAIGPFRIHSIALPSADRRLQSVIAGALAVAMLVGCNPVKQD
FT                   RMTDTLQNATNGYQNALRWGYFENAYSYLPPDRRDEAIPPEILEGLRLTGYDVIQPPVM
FT                   NAESETATQVVAIDYLYEDRQVVKQLKDRQLWRYDAEKKTWWLESGLPAFKR"
FT   gene            80242..81444
FT                   /locus_tag="Alvin_0075"
FT   CDS_pept        80242..81444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0075"
FT                   /product="TraB family protein"
FT                   /note="TIGRFAM: TraB family protein; PFAM: TraB determinant
FT                   protein; KEGG: noc:Noc_0536 pheromone shutdown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61047"
FT                   /db_xref="GOA:D3RUZ8"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUZ8"
FT                   /inference="protein motif:TFAM:TIGR00261"
FT                   /protein_id="ADC61047.1"
FT                   /translation="MADSMEPRRDLVIDGVELTVLGTAHVSRASADQVRKLIQSGDYDS
FT                   VAVELCRSRFNALMDPRTLAQMDLFSVIRQNRVYMVVANLVLAAYQQRLADQFGIEPGA
FT                   EQRTALRLAKDQGLNLLLVDREIGITLKRISANLGWWKRYGLFAGLLAAMVSSDEVTEE
FT                   EVERLKEGDVLETAFAEFAAERRDLYVPLIEERDRYMAARLRRELARVGARRALVVIGA
FT                   GHLKGVTEALETDRTDPAEVLGDLERVPPPSRWPAVFGWTLLILILAGFGYGFAVSPEL
FT                   GLDLLIGWALITGGLSALGTLLAAGHPLTILSAFLAAPLTTLNPAIGAGMITGAVELYL
FT                   RKPSVGEFSRLRSDVATWTGWWRNRVSRVLVVFVLSSLGAGIGTYVAGLHIAERLIRAG
FT                   G"
FT   gene            complement(81468..82400)
FT                   /locus_tag="Alvin_0076"
FT   CDS_pept        complement(81468..82400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo1290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61048"
FT                   /db_xref="UniProtKB/TrEMBL:D3RUZ9"
FT                   /inference="similar to AA sequence:KEGG:azo1290"
FT                   /protein_id="ADC61048.1"
FT                   /translation="MRGMYQSPLNGSKRKIDGVIRVYYDGYWIKYYEPPPDSFEVRRQL
FT                   IQVLTRRLFNHVEHGINIPGSRLKEARAAYEAETDTERKRVNGAMLAGALFNRAADIFH
FT                   SLVDLQTAGVEIAPDHALMRECGHCLIEALELGKMVRHRSGDEGIDELWGEPFKAFSMP
FT                   IEAFYSSRYLKIAMTMHDIDRITGAMKATFAGSRQILGLDSRLDELNVTAKRKCEILRT
FT                   DPEVFDVWPTYVVASDRVRNVEPIMPAVHDAVDVREAVEGSRLLRDGTDLISFIVRARV
FT                   PMPKSAREYVDRCQQFRRAYIEPYLSTSV"
FT   gene            82518..83318
FT                   /locus_tag="Alvin_0077"
FT   CDS_pept        82518..83318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0077"
FT                   /product="spermidine synthase"
FT                   /note="KEGG: reh:H16_A1603 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61049"
FT                   /db_xref="GOA:D3RV00"
FT                   /db_xref="UniProtKB/TrEMBL:D3RV00"
FT                   /inference="similar to AA sequence:KEGG:H16_A1603"
FT                   /protein_id="ADC61049.1"
FT                   /translation="MPFNIAGYSIMQSKDRFTAIILALLVWGFAGALFGALFAGLHQIL
FT                   LVLGLAGWLPLVIAAAAAAMTTTAFYSAMPIALVGCMAGVLASIGYLIVIGHDIDLVMI
FT                   ASLAGGAGMLAGGFYSWMVAGGSRPLAETLTGLFAGLLAGGLLSLVLGFVAEPVGVFVL
FT                   AAGVVALVGALFEISERWLVRLGIAWLPGVVSAPLVAGLVAAVVAGSVWILGSTTATVL
FT                   DTRTQQAIAEVLNDIPPGLLGGMLGGALSGMVLELFGFRLEDDI"
FT   sig_peptide     82518..82625
FT                   /locus_tag="Alvin_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.593 at
FT                   residue 36"
FT   gene            83461..83589
FT                   /locus_tag="Alvin_0078"
FT   CDS_pept        83461..83589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_2241 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61050"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61050.1"
FT                   /translation="MVQLLIGIAIGIVIGWNWSQPAWARGLQARFVKLVHVPEKHD"
FT   sig_peptide     83461..83535
FT                   /locus_tag="Alvin_0078"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.763 at
FT                   residue 25"
FT   gene            83706..86297
FT                   /locus_tag="Alvin_0079"
FT   CDS_pept        83706..86297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0079"
FT                   /product="2-methylisocitrate dehydratase, Fe/S-dependent"
FT                   /note="TIGRFAM: 2-methylisocitrate dehydratase,
FT                   Fe/S-dependent; PFAM: aconitate hydratase domain protein;
FT                   KEGG: bcj:BCAM2701 aconitate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61051"
FT                   /db_xref="GOA:D3RVC4"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR012708"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVC4"
FT                   /inference="protein motif:TFAM:TIGR02333"
FT                   /protein_id="ADC61051.1"
FT                   /translation="MNTTNRKPLPGTDLDYFDARAAIEAIAPGAYDRLPYTARVLAENL
FT                   VRRCDPAILSDSLRQIVECKRERDFPWFPARVVCHDILGQTALVDLAGLRDAIADQGGD
FT                   PAKVNPVVPVQLVVDHSLAVECGGYDPDAFAKNRAIEDRRNEDRFHFIEWTKLAFDNVD
FT                   VIPAGNGIMHQINLERMSPVIQARDGVAFPDTLVGTDSHTPHVDALGVIAVGVGGLEAE
FT                   NVMLGRASWMRLPEIIGVELTGKPQPGITATDVVLALTEFLRKEKVVGAYLEFHGEGAA
FT                   ALTIGDRASISNMCPEYGATAALFHIDAQTIDYLRLTGRDDAQVKLVETYAKQTGLWAE
FT                   TLKNAQYERTLKFDLSSVVRNLAGPSNPHARVATADLAAKGIAGQWDEVPGQMPDGAVI
FT                   IAAITSCTNTSNPRNVIAAGLLARNANRLGLTRKPWVKSSLAPGSKTVPLYLEEAGLLL
FT                   ELEQLGFGIVGFACTTCNGMSGALDPKIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQ
FT                   AFLASPPLVVAYAIAGTIRFDIEKDVLAVADGREIRLKDIWPSDEEIDAVVAASVKPEQ
FT                   FRQVYEPMFAVRAETGEKVSPLYDWRPQSTYIRRPPYWEGALAGERTLKGMRPLAVLPD
FT                   NITTDHLSPSNAILPNSAAGEYLARMGLPEEDFNSYATHRGDHLTAQRATFANPKLINE
FT                   MAVVDGQVKQGSLARVEPDGTVMRMWEAIETYMNRNQPLIVIAGADYGQGSSRDWAAKG
FT                   VRLAGVEVIVAEGFERIHRTNLIGMGVLPLEFKPGVNRKTLGIDGTETYDVIGERRPRA
FT                   DLTLVIQRKNGERVEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLESTKAA"
FT   gene            86364..87557
FT                   /locus_tag="Alvin_0080"
FT   CDS_pept        86364..87557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0080"
FT                   /product="AcnD-accessory protein PrpF"
FT                   /note="TIGRFAM: AcnD-accessory protein PrpF; PFAM: protein
FT                   of unknown function DUF453; KEGG: avn:Avin_23250 AcnD
FT                   accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61052"
FT                   /db_xref="GOA:D3RVC5"
FT                   /db_xref="InterPro:IPR007400"
FT                   /db_xref="InterPro:IPR012709"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVC5"
FT                   /inference="protein motif:TFAM:TIGR02334"
FT                   /protein_id="ADC61052.1"
FT                   /translation="MSHTPQIKIPATYMRGGTSKGVFFRLKDLPESCQTPGAARDALLL
FT                   RVIGSPDPYGKQIDGMGGATSSTSKTVILAKSSRPDHDVDYLFGQVSIDTAFVDWSGNC
FT                   GNLSAAVGSFAIASGLVDADRLPQNGLATVRIWQANIGKTIIAHVPITDGAVQETGDFE
FT                   LDGVTFPAAEVQLEFLDPADEGEGEGGGSMFPTGNLVDDLDVPGVGTLKATLINAGIPT
FT                   IFVNAEAIGYTGTELQEAINGDPKALAMFETIRAHGALRMGLIQDISEAATRQHTPKVA
FT                   FVAPPTDYVASSGKPVAASEIDLCVRALSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLA
FT                   AGGGERTAVRFGHPSGTLRVGAEAKQVDGNWTVTKAIMSRSARVIMEGWVRVPGDAF"
FT   gene            complement(87643..88098)
FT                   /locus_tag="Alvin_0081"
FT   CDS_pept        complement(87643..88098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0081"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: pmy:Pmen_0684 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61053"
FT                   /db_xref="GOA:D3RVC6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVC6"
FT                   /inference="similar to AA sequence:KEGG:Pmen_0684"
FT                   /protein_id="ADC61053.1"
FT                   /translation="MYLLSVNDLGVYLGLFASAFGAASLLPLQSEVLLVALLLDRNQAV
FT                   WALLTVASFGNVLGSMLNWLLGRSLERYRERRWFPATPTRLEQAQRFYVRTGYWSLLLS
FT                   WMPIIGDPLTLVAGVLREPLWRFVLLVALAKSGRYLVLAALTPGALS"
FT   gene            complement(88144..89484)
FT                   /locus_tag="Alvin_0082"
FT   CDS_pept        complement(88144..89484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0082"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /EC_number="1.8.4.12"
FT                   /note="KEGG: tcx:Tcr_0783 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: peptide methionine sulfoxide reductase;
FT                   methionine-R-sulfoxide reductase; PFAM: Methionine
FT                   sulfoxide reductase A; Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61054"
FT                   /db_xref="GOA:D3RVC7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVC7"
FT                   /inference="protein motif:TFAM:TIGR00401"
FT                   /protein_id="ADC61054.1"
FT                   /translation="MRQTHRWPLIALGLSALLHTGTDNQATAAQNPARDPSGVAPDPTA
FT                   DTIVLGMGCFWGAEKRMSELPGVIDVESGYANGEIEGTYEAILAHERARRRGADEKRNH
FT                   AEVVKVRFDPARVSLEQVLAKFWESHDPTQGDRQGNDVGSNYRSAIYTSSPEQAAVAER
FT                   TRARYQAALTQAGRGAITTEIAPLSAYFRAEEAHQDYLRKNPRGYCGLGGTGVAYPGTA
FT                   SGVDEAAESPSPDPLDGATLERARQLVMFEAEYCGACKQFKAEVLDHWQSPVPVARSLS
FT                   FSAPTGWTLDKPLFATPTLVLFEDGREVSRYTGYDGDATRFWSWLGGQILTPEQRRIAF
FT                   EQGTERAFTGSLLDEKRSGTFVDPITGAPLFRSETKFESGSGWPSFFDPVDGAITFHED
FT                   VSHGMRRVEVRSASSGIHLGHVFEDGPPPTRKRYCINSRVLSFVPDP"
FT   gene            complement(89596..89802)
FT                   /locus_tag="Alvin_0083"
FT   CDS_pept        complement(89596..89802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: har:HEAR1731 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61055"
FT                   /db_xref="InterPro:IPR025906"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVC8"
FT                   /inference="similar to AA sequence:KEGG:HEAR1731"
FT                   /protein_id="ADC61055.1"
FT                   /translation="MEIPTSTTGLATLATAMSRTKLEGAVDVAVFKKALDMQEESAAQL
FT                   LQSLSTPAAALPDGVGGRIDTTA"
FT   gene            90089..90412
FT                   /locus_tag="Alvin_0084"
FT   CDS_pept        90089..90412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccs:CCNA_00398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61056"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61056.1"
FT                   /translation="MDGTRPTMSAWPGVLYGLLLALAVAPAKAQLAQQAFQIVITRAGG
FT                   ACQNIETTRALGTGSNGDALVAVACAGGGRHVVSIHSDNSVSYMSSCQAFEAGTGLVCF
FT                   NAR"
FT   sig_peptide     90089..90178
FT                   /locus_tag="Alvin_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.706 at
FT                   residue 30"
FT   gene            90409..91716
FT                   /locus_tag="Alvin_0085"
FT   CDS_pept        90409..91716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0085"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: dac:Daci_5359 recombination factor protein
FT                   RarA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61057"
FT                   /db_xref="GOA:D3RVD0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD0"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADC61057.1"
FT                   /translation="MTDLFANTPVPPLAEALRPRVLDEVIGQSHLLGEGKPLRLAFQSG
FT                   QAHSMILWGPPGVGKTTLARLTAQAFAGEFIALSAVFAGVKDIRAAMEQAEHHRSRGRR
FT                   TILFVDEIHRFNKAQQDALLPYVESGLVTLIGATTENPSFEVNAALLSRAQVYVLQSLT
FT                   DAELRQLLMRARDQVLTHLQFDAAAVDTLIGYADGDARRCLNLLEQCHIAAGTAGVTCI
FT                   DAGFIENALTLNSRRFDQGGDGFYDQISALHKSVRGSNPDAALYWLTRMLDGGADPHYL
FT                   SRRIVRMAWEDIGLADPRALQIANEAAMAYERLGSPEGELALAQAVIYLAIAAKSNAGY
FT                   TAYKAARAFVKQDRSREVPRHLRNAPTRLMKDLGHGQTYRYPHDEPQGYAAGETYLPDG
FT                   MSDPHWYRPVQRGLEIRIAEKMARLKQLDEEAKNKA"
FT   gene            91788..92183
FT                   /locus_tag="Alvin_0086"
FT   CDS_pept        91788..92183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0086"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   dba:Dbac_2919 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61058"
FT                   /db_xref="GOA:D3RVD1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD1"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADC61058.1"
FT                   /translation="MPPFALHPQLRADCHVLGRLPATHLLLHRNGAAPWFILVPETDLA
FT                   NLLDLPAAHRDAVLADCTRVSDALGTLGYPKINVAWIGNLVPQLHIHVIGRRPGDACWP
FT                   RPVWGHLPAERDYAEHEITALRAAVLD"
FT   gene            complement(92252..92755)
FT                   /locus_tag="Alvin_0087"
FT   CDS_pept        complement(92252..92755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0087"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   tgr:Tgr7_1062 sec-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61059"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD2"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ADC61059.1"
FT                   /translation="MVDERPPLDIEGTSIRIDSLDAWNEHPIPDIKSVRKSEESTMLNP
FT                   CLCGSGRPFDDCCGPHLSARTIAPTAEALMRSRYSAFATGQADYLLATWHPTTRPATLT
FT                   LEPGLRWLGLKILSTEAGGATDQEGWVTFVARSKLQGRAQRLQERSRFVREHGRWFYLD
FT                   GELG"
FT   gene            complement(92833..92940)
FT                   /pseudo
FT                   /locus_tag="Alvin_0088"
FT                   /note="hypothetical protein"
FT   gene            93100..93987
FT                   /locus_tag="Alvin_0089"
FT   CDS_pept        93100..93987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0089"
FT                   /product="CHAP domain containing protein"
FT                   /note="PFAM: CHAP domain containing protein; KEGG:
FT                   D-alanyl-glycyl endopeptidase-like protein; cysteine
FT                   peptidase, Clan CA, family C51"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61060"
FT                   /db_xref="GOA:D3RVD3"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD3"
FT                   /inference="protein motif:PFAM:PF05257"
FT                   /protein_id="ADC61060.1"
FT                   /translation="MISAPDRSWRRRLIPILATILVAVVVFVWTLNLTDWLMRPPPAST
FT                   VEYLPHTDGAERLVPPPVSEALSLERFQAARRACDGPCVTDFGTPLGRANGVEARSNCA
FT                   SLCVRLESSFVDPDSGRIWIARSGEHPEPLEYSGLAYQCVEYARRWWIQTLGLTFGDVP
FT                   TAADILRLTEGRRLSDQAVIPLGRSLNGHARRAPERGDLVIYAADPNDPEWRAGHVAVV
FT                   VDTDLEQGWVALAEQNYDNRPWSDPEYHARRIRIVRIGERYSLLDVAQDRVDNPEGGSI
FT                   VGWVYPLPDSMLVR"
FT   gene            94032..94241
FT                   /pseudo
FT                   /locus_tag="Alvin_0090"
FT                   /note="hypothetical protein"
FT   gene            94442..95254
FT                   /locus_tag="Alvin_0091"
FT   CDS_pept        94442..95254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0091"
FT                   /product="Thiosulfate dehydrogenase"
FT                   /note="KEGG: rme:Rmet_5347 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61061"
FT                   /db_xref="GOA:D3RVD4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="PDB:4V2K"
FT                   /db_xref="PDB:4WQ7"
FT                   /db_xref="PDB:4WQ8"
FT                   /db_xref="PDB:4WQ9"
FT                   /db_xref="PDB:4WQA"
FT                   /db_xref="PDB:4WQB"
FT                   /db_xref="PDB:4WQC"
FT                   /db_xref="PDB:4WQD"
FT                   /db_xref="PDB:4WQE"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3RVD4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_5347"
FT                   /protein_id="ADC61061.1"
FT                   /translation="MRGDVRVHTASPIAAAWLLAVGLVAHAEEPPTVALTVPAAALLPD
FT                   GALGESIVRGRRYLSDTPAQLPDFVGNGLACRHCHPGRDGEVGTEANAAPFVGVVGRFP
FT                   QYSARHGRLITLEQRIGDCFERSLNGRALALDHPALIDMLAYMSWLSQGVPVGAVVAGH
FT                   GIPTLTLEREPDGVHGEALYQARCLACHGADGSGTLDADGRYLFPPLWGPRSFNTGAGM
FT                   NRQATAAGFIKHKMPLGADDSLSDEEAWDVAGFVLTHPRPLFQEPTGD"
FT   sig_peptide     94442..94525
FT                   /locus_tag="Alvin_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            95301..95933
FT                   /locus_tag="Alvin_0092"
FT   CDS_pept        95301..95933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gym:GYMC10_1055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61062"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61062.1"
FT                   /translation="MKISPSLRRRYALAVSLTGLAFPVAASDALLTGLERTITWNHPEN
FT                   IFAESVLDLEFDTAVKPDTLIIKRATQAGMDYRVVFEALSVASNLPVEFDGTCIDGDRS
FT                   VSGGGEVAGSCFVQAGTHDFDADGLPELIIALGDGRMRLEVNVFSYHPPARPADAIRPE
FT                   NWGLIGHFSGQSNAVIDGQSVALPFGSQGFEQKMVFVDGRFIESAPQ"
FT   sig_peptide     95301..95381
FT                   /locus_tag="Alvin_0092"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 27"
FT   gene            95996..96352
FT                   /locus_tag="Alvin_0093"
FT   CDS_pept        95996..96352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_0715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61063"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD6"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_0715"
FT                   /protein_id="ADC61063.1"
FT                   /translation="MSKMIAPVRWLLALSILMLGWTAGALAQTSQPVCAQEAREQAQRL
FT                   LDFHVGGDDRIFIEPDVVEKAPLRNPANPKQQFQVLEVRGMILKGQYRMRLIYYRLEDS
FT                   CVLMGQEILEHASL"
FT   sig_peptide     95996..96079
FT                   /locus_tag="Alvin_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 28"
FT   gene            96349..96687
FT                   /locus_tag="Alvin_0094"
FT   CDS_pept        96349..96687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0094"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   cyt:cce_2077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61064"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD7"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADC61064.1"
FT                   /translation="MKSAGRIVHNLFADLPTLTSGEFFEELVVFRDVRIERILSSDQPE
FT                   SVLYDQEQDEWVCLLQGEARLWIAGDEVELRAGDHLLIPAHTPHQVLDTSREPPCLWLA
FT                   VHIHPHER"
FT   gene            96684..96809
FT                   /locus_tag="Alvin_0095"
FT   CDS_pept        96684..96809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61065"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61065.1"
FT                   /translation="MTVTMLTGVPDERVGEPTRPGSTAPDQRASIGTQLRFSGPT"
FT   gene            complement(96761..97909)
FT                   /locus_tag="Alvin_0096"
FT   CDS_pept        complement(96761..97909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0096"
FT                   /product="2-methylcitrate synthase/citrate synthase II"
FT                   /EC_number="2.3.3.5"
FT                   /note="KEGG: tgr:Tgr7_1508 2-methylcitrate synthase;
FT                   TIGRFAM: 2-methylcitrate synthase/citrate synthase II;
FT                   PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61066"
FT                   /db_xref="GOA:D3RVD9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVD9"
FT                   /inference="protein motif:TFAM:TIGR01800"
FT                   /protein_id="ADC61066.1"
FT                   /translation="MTETHQPKPKKSVALSGTVAGNTAICTVGLTGNDLHYRGYDILDF
FT                   ADQAEFEEVAHLLIHERLPTRAELEAYKRKLKSMRGLPAAVKTALEQIPASSAHPMDVL
FT                   RIGCSLLGTLEPEKDDMSVVGAREIGDRLIASFGSMLLYWYHFAHHGRRIEVETDDDTI
FT                   GGHFLHLLHGEKPSEEWVRAMHTSLILYAEHEFNASTFTARVIAGTNSDMYSAISGAIG
FT                   ALRGPKHGGANEVACEIQERYATADEAEADIRERVARKEIIIGFGHPVYTISDPRNKVI
FT                   KAVAERLSNTNGDRRMFDVADRLESVMWELKKMFPNLDWFSAVSYAQMGVPTPLFTPIF
FT                   VISRTTGWVAHVIEQRQDGKIIRPSANYVGPENLSWVPIEAR"
FT   gene            complement(97940..98830)
FT                   /locus_tag="Alvin_0097"
FT   CDS_pept        complement(97940..98830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0097"
FT                   /product="methylisocitrate lyase"
FT                   /note="TIGRFAM: methylisocitrate lyase; PFAM: isocitrate
FT                   lyase and phosphorylmutase; KEGG: tgr:Tgr7_1509
FT                   2-methylisocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61067"
FT                   /db_xref="GOA:D3RVE0"
FT                   /db_xref="InterPro:IPR012695"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE0"
FT                   /inference="protein motif:TFAM:TIGR02317"
FT                   /protein_id="ADC61067.1"
FT                   /translation="MTQAMTPGAKLRLAVQEERPLQVVGAINAYHARMAERTGYRALYL
FT                   SGGGVAAGSYGIPDLGMTSLDNVLEDVSRITYITDLPLLVDADTGWGGAFNIARTVKQL
FT                   IRAGAAGCHIEDQVAAKRCGHRPGKAIVSQAEMVDRIKAAVDARTDDFVIMARTDALAV
FT                   EGLDAAIERAQACVEAGADMIFPEAMTELAQYERFTAAVQVPVLANITEFGATPLFTTT
FT                   ELGAVGVSLVLYPLSAFRAMNKAALNVYQALRRDGTQANVVDTMQTRMELYDYLDYHHF
FT                   EQKLDALFAQERSGE"
FT   gene            complement(98877..99668)
FT                   /locus_tag="Alvin_0098"
FT   CDS_pept        complement(98877..99668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0098"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: GntR domain protein; regulatory protein GntR
FT                   HTH; KEGG: tgr:Tgr7_1510 GntR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61068"
FT                   /db_xref="GOA:D3RVE1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE1"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ADC61068.1"
FT                   /translation="MTVDIFTMTLAALDLEDAPSLTIADRLFDQLRQAIVEGEIPAGSK
FT                   ISEPALAARYGVSRGSLREALQRLEAIKLIERRANVGARVVQLSSTELLEIYSVREGLE
FT                   AMAARLAAERMSDAGIAELKALLERHRQELAHEDWQRYFQQEGDLDFHFRIARGSGNRR
FT                   LIEILCNDLYHLTRLYRCQFGMKSHRTREALREHELIVEAIAARDGELAEWLMRRHIRA
FT                   SRQATEQQLALSTAGHPPSAINGPRVRRPRRPTTRPPATPN"
FT   gene            100138..100929
FT                   /locus_tag="Alvin_0099"
FT   CDS_pept        100138..100929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0099"
FT                   /product="initiator RepB protein"
FT                   /note="PFAM: initiator RepB protein; KEGG: abm:p3ABSDF0018
FT                   replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61069"
FT                   /db_xref="GOA:D3RVE2"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE2"
FT                   /inference="protein motif:PFAM:PF01051"
FT                   /protein_id="ADC61069.1"
FT                   /translation="MLSLSEQRLLLLTIARIDSRAILEPGICHTITASEIADSYSLPRD
FT                   QAYELLINVAERLYERSVVICDPDPDRPDVSQLRTRWVASIRYLPSRGSIELIFAPAIL
FT                   PFLSQLKRKFSSYRLEHVAPMTSIYAIRLYELLIQWRESGTRTVEIDWLRERFELGDKY
FT                   PNIRDLKARVLNPAIDQINAHSDLYVKWEQHKRGRVVHALTFTFGPKAGQTSEAEAKPQ
FT                   SPAKSAKPKLSRAYIEQHAQPGESWEEATERCRRKLEQESA"
FT   gene            100930..101388
FT                   /locus_tag="Alvin_0100"
FT   CDS_pept        100930..101388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0100"
FT                   /product="protein of unknown function DUF123"
FT                   /note="PFAM: protein of unknown function DUF123; KEGG:
FT                   sru:SRU_2389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61070"
FT                   /db_xref="InterPro:IPR002837"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE3"
FT                   /inference="protein motif:PFAM:PF01986"
FT                   /protein_id="ADC61070.1"
FT                   /translation="MSDDHGTYLVRLIPEQSGPVLIGRLGTLTLAGGELLYVGSALGPG
FT                   GLAARCRHHGRLAARPHWHLDYLRPHCRVAGCWVARGLERREHVWARALGTLPGASWPL
FT                   ARFGASDCDCPAHLIRLDRVPETAALSVLLGVSLVWRAAPDQFEEPEP"
FT   gene            101385..102377
FT                   /locus_tag="Alvin_0101"
FT   CDS_pept        101385..102377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61071"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61071.1"
FT                   /translation="MTETSMDIALWPADEVNAEAEPSPGFEDEGSPPDERVSTPVVAGE
FT                   SAGKLAERPEGCAPAIEIMAPLQPPRSVALYIDGDNQSPAIAHDLLASVRHDWGLEVSR
FT                   VVLAGNDHGHTVPRWLTALANEAVHEDRILALRVQRKPEAADLAVILELGANMEQHRQG
FT                   PDLVVVVSRDEWLIGAAEAVRARGCRVWVAYAENEAVAAHTQLPTLLLPAVNRAQAQAR
FT                   AATATPKTPVEGVTPTVPASSVTSTAAAPRVKPKEAAPPNQSTPSHKALLAQVRAQCKV
FT                   QPGGGYLATEVGQALYTLGLTDKAARNRFLKAVADLREVGAGGAKRLMF"
FT   gene            complement(102473..104355)
FT                   /pseudo
FT                   /locus_tag="Alvin_0102"
FT                   /note="hypothetical protein"
FT   gene            complement(104467..105753)
FT                   /locus_tag="Alvin_0103"
FT   CDS_pept        complement(104467..105753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0103"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: tgr:Tgr7_2421
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61072"
FT                   /db_xref="GOA:D3RVE5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE5"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADC61072.1"
FT                   /translation="MSRSHDLFAAAQRHIPGGVNSPVRAFRGVGGDPVFFESASGPHAI
FT                   DADGKCYIDYVGSWGPMILGHAHPEVLAAVRERLDKGLSFGAPTELETVMADKVCELVP
FT                   SMDMVRMVSSGTEATMSALRLARGYTGRDKIVKFEGCYHGHADSLLVKAGSGALTFGEP
FT                   SSPGVPAALAELTITLRYNDIDQVRETFAEIGSEIACIIVEPVAGNMNCIPPVPGFLEG
FT                   LREVCDQYGSVLIFDEVMTGFRVALGGAQAHFGIKPDLTALGKVIGGGMPVGAFGGKQE
FT                   IMSRLSPLGPVYQAGTLSGNPIAMAAGLKTLELISAPGFYDQLAAKVTTLMTGLKERAA
FT                   VAGIALTTNQAGGMFGIFFTDQQVTNYEQATACNQDQFKAFFHGMLERGVYLAPSAFEA
FT                   GFVSIMHTDEHIQATLDAAADTFAAIAAR"
FT   gene            complement(105755..106393)
FT                   /locus_tag="Alvin_0104"
FT   CDS_pept        complement(105755..106393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0104"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: tbd:Tbd_2556 thiamine monophosphate synthase;
FT                   TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61073"
FT                   /db_xref="GOA:D3RVE6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE6"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADC61073.1"
FT                   /translation="MSNTSLRGLYAITPDAPLTIATLVDQVDAAIDGGARVIQYRDKTY
FT                   ERDERRRRAAALLARCRAAGVPLIINDDLDLAVELGADGVHLGRDDPDPRAARERLSET
FT                   AIIGVSCYDQLALAEAAAANGASYVAFGSFFPSTTKPKAVRPDPGLLTEARRRVTLPLV
FT                   AIGGITPHNGGPLIAAGADMLAVVTGVFAQADITAAARAYTNLFPKETH"
FT   gene            complement(106426..107244)
FT                   /locus_tag="Alvin_0105"
FT   CDS_pept        complement(106426..107244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0105"
FT                   /product="Phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="PFAM: Phosphomethylpyrimidine kinase type-1; KEGG:
FT                   dar:Daro_3900 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61074"
FT                   /db_xref="GOA:D3RVE7"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE7"
FT                   /inference="protein motif:PRIAM:2.7.4.7"
FT                   /protein_id="ADC61074.1"
FT                   /translation="MTEAQRPDRPLVLCVGGHDPSGGAGILADAEVVQAARAFPLTVIT
FT                   ALTEQDTCGLAQIHPQPPEQIEAHCRRLLSDSPPSALKIGLIGGADIARMLARFIDTLA
FT                   TAERARVPVVLDTVLATGAGQSVADAALREAVREALIPRCTLVTPNLPEARALTGADAP
FT                   EDCAERLLAAGAPWVLITGTHDATEAVTNRLFGSNGERHAWDWPRLPGEYHGSGCTLAS
FT                   AIAARLAHGMTLIQAVESAQAYTWTALERALRTGRCQLTPNRLYSQASAD"
FT   gene            107383..107547
FT                   /locus_tag="Alvin_0106"
FT   CDS_pept        107383..107547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0106"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   ppw:PputW619_0158 rubredoxin-type Fe(Cys)4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61075"
FT                   /db_xref="GOA:D3RVE8"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE8"
FT                   /inference="protein motif:PFAM:PF00301"
FT                   /protein_id="ADC61075.1"
FT                   /translation="MNTYQCLVCGLIYDEAQGWPDDGIAPGTKWEDVPSDWKCPECGVG
FT                   KDDFEMVRL"
FT   gene            107643..108158
FT                   /locus_tag="Alvin_0107"
FT   CDS_pept        107643..108158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61076"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVE9"
FT                   /inference="similar to AA sequence:KEGG:MCA0630"
FT                   /protein_id="ADC61076.1"
FT                   /translation="MDAITSPTRVLETGFDHDLARLARRYCELIETRATKRGLWLARIA
FT                   ELLPRLHAGVSSLVAAEPPPGDRPEPVDLDARFELFSQLRHLLADCDPYWLEFDSVADG
FT                   MTAMTGSLADDLTDIYCELKQGLTLFELDPDRAVTAWALGYRQHWGQHLVDAERHLAML
FT                   QSQSRLDL"
FT   gene            108267..108632
FT                   /locus_tag="Alvin_0108"
FT   CDS_pept        108267..108632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0108"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   neu:NE1428 iron-sulfur cluster insertion protein ErpA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61077"
FT                   /db_xref="GOA:D3RVF0"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF0"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADC61077.1"
FT                   /translation="MSLAITEADLTLTGPAQAKMSDLFQQVDDSVQGVRVFATAGGCSG
FT                   VSFGMTFTDVINEDDGVLSFDGFKVVVDDGTLEYLRGVEIDFVDQGDGNATFIFNNLPQ
FT                   MGGGCGSCGSSSGGGCS"
FT   gene            108655..109677
FT                   /locus_tag="Alvin_0109"
FT   CDS_pept        108655..109677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0109"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: mei:Msip34_0060
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; SMART: Semialdehyde
FT                   dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61078"
FT                   /db_xref="GOA:D3RVF1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF1"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADC61078.1"
FT                   /translation="MIRVGIVGGTGYTGAELLRLLARHPQAAPAVITSRSESGLPVAEM
FT                   FPHLRGRLDLCFSEPDTGALAECDLVFFATPNGTAMQSVPELLERGTRVIDLAADFRLK
FT                   DPALWERWYGMPHQCPDLLAETVYGLPEVNRDAIRRARLIANPGCYPTAVTLGFLPLLE
FT                   RRAVDPSWLIADAKSGVSGAGRKAETSLLMAEVGESFKAYSVSGHRHLPEITQNLQTFA
FT                   GIEVGLTFVPHLVPMIRGIEATLYARLTDDGLDLAALYQSRYADEPFVDFMVSGSPDTR
FT                   SVRGSNDCRIAVARQGDIVIVQSVIDNLVKGAAGQAVQNMNLMFGFDETLGLEALAMLP
FT                   "
FT   gene            109960..110310
FT                   /locus_tag="Alvin_0110"
FT   CDS_pept        109960..110310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0110"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   dar:Daro_0653 iron-sulfur cluster insertion protein ErpA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61079"
FT                   /db_xref="GOA:D3RVF2"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF2"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADC61079.1"
FT                   /translation="MNAEADLEAPLVFTASAASKVAELIRDEGNPGLMLRVYIQGGGCS
FT                   GFQYGFTFDEDVQDGDTEVVTDGVKLLVDPMSLQYLMGAEIDYTEGLQGAQFVIRNPNA
FT                   TTTCGCGSSFSA"
FT   gene            complement(110379..110597)
FT                   /locus_tag="Alvin_0111"
FT   CDS_pept        complement(110379..110597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61080"
FT                   /db_xref="GOA:D3RVF3"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61080.1"
FT                   /translation="MMRDYKFKRTEWTPRRKRRFGLGTFLRILALLAVAGAGYAIFDYF
FT                   ANRPSQASQGANLPSHIIPLQLPPQPN"
FT   sig_peptide     complement(110490..110597)
FT                   /locus_tag="Alvin_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.567 at
FT                   residue 36"
FT   gene            110801..112003
FT                   /locus_tag="Alvin_0112"
FT   CDS_pept        110801..112003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0112"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="KEGG: tgr:Tgr7_2405 tyrosyl-tRNA synthetase;
FT                   TIGRFAM: tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib; RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61081"
FT                   /db_xref="GOA:D3RVF4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF4"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADC61081.1"
FT                   /translation="MESVERSLALIQRGTEEILLQDALRKKLEQGRPLRIKAGFDPTAP
FT                   DLHLGHTVLINKLRQFQELGHEILFLIGDFTGMIGDPTGKSVTRKPLSREQIEENAQTY
FT                   KDQVFRILDPDKTRILFNSHWLDDLGTAGLVQLAARQTVARMLERDDFSKRYKSGQPIA
FT                   IHEFLYPLIQGYDSVALRADVELGGTDQKFNLLMGRQLQEAYGQEAQVVITLPILEGLD
FT                   GVQKMSKSLGNYIGIADAPEEMFGKLMSISDDLMWRYFELLSFRELSEIEDWRRAVSEG
FT                   ANPRDIKFELGLELVTRFHGAEQARKAQEAFVARFQKGAMPDNMPFVELACSDDAGLPL
FT                   ANLLKEAGLVASTSEAIRMVRQGAVRIDGERVEDVQQVCAVGAEHIYQVGKHRFAKVRL
FT                   G"
FT   gene            112452..113967
FT                   /locus_tag="Alvin_R0001"
FT   rRNA            112452..113967
FT                   /locus_tag="Alvin_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            114051..114127
FT                   /locus_tag="Alvin_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            114051..114127
FT                   /locus_tag="Alvin_R0002"
FT                   /product="tRNA-Ile"
FT   gene            114185..114260
FT                   /locus_tag="Alvin_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            114185..114260
FT                   /locus_tag="Alvin_R0003"
FT                   /product="tRNA-Ala"
FT   gene            114517..117408
FT                   /locus_tag="Alvin_R0004"
FT   rRNA            114517..117408
FT                   /locus_tag="Alvin_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            117493..117607
FT                   /locus_tag="Alvin_R0005"
FT   rRNA            117493..117607
FT                   /locus_tag="Alvin_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            complement(117685..118212)
FT                   /locus_tag="Alvin_0113"
FT   CDS_pept        complement(117685..118212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0113"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG: sml:Smlt0972
FT                   putative transmembrane PAP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61082"
FT                   /db_xref="GOA:D3RVF5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF5"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADC61082.1"
FT                   /translation="MQAWLRHLNELEVSVCRLWSRSGQRRWIRYPFAFISRLGDGVFWY
FT                   SLMAALPLVYGLKGLQASLHMLATGGIALLLYKSLKGVTRRSRPCHHASDITALVPPLD
FT                   QYSFPSGHTLHAVVFSSVAIYYFPVLAWILVPFTALIALSRIILGLHYPSDVLMATLIG
FT                   LGLAYASLSAFI"
FT   gene            complement(118184..119413)
FT                   /locus_tag="Alvin_0114"
FT   CDS_pept        complement(118184..119413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0114"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tgr:Tgr7_2734 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61083"
FT                   /db_xref="GOA:D3RVF6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC61083.1"
FT                   /translation="MSSETRSTAQSTGDRLRIAIVTETYPPEINGVANTMRHLAEGMVA
FT                   RGHGVQLIRPRQPADPRHPEQSDRLDLHLVPGLPIPGYRGLRFGLPVYWRLRRLWHRRP
FT                   ADLVYIATQGPLGHAALSAAQALKIPTITGFHTHFQHYSRHYGLGALTRQIAETLRHFH
FT                   NRSDATLVPTAELRDSLAAEGFENLHVFGRGVDVDQFAPDRRSAELRRSWGCAEDDLVA
FT                   LYVGRIAAEKNLALALAGFRAIQRQCPNARFVLVGDGPERPHLQQEHPDLIFAGARVGD
FT                   ELAAHYASGDLFLFPSLTETFGNVVTEAMASGLPVIAFDYAAAHANVQPWVNGVTVPVD
FT                   AQESFIDICLECVGDRERLRRMGLEARKRALDIGWERVLGRVEEHLFAVIHRKRGQAES
FT                   CHASLATTSE"
FT   gene            complement(119417..120250)
FT                   /locus_tag="Alvin_0115"
FT   CDS_pept        complement(119417..120250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0115"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: tgr:Tgr7_2735
FT                   lyso-ornithine lipid acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61084"
FT                   /db_xref="GOA:D3RVF7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF7"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ADC61084.1"
FT                   /translation="MITRTLWRSWRVGEHLATGTLVGLYAVFQGRARRQPGWLPRAVRW
FT                   WHGRLVRALEVEVRIEGRLEAGCLLVGNHVSWLDIPILGAQGEIGFLAKSDVRRWPLIG
FT                   WLAGFAGTRFIERGAHQAESVIHRLLADLASERTVMIFPEGTTTDGRTLGRFHPRLFAI
FT                   AQHPEVRVQPVAIRYRRRDTLALDQSVPYIGDDSLIANLSRLVRHPGLIACIHFLPSMQ
FT                   ALEGESRRALAERARAAILETLDVSETAPVMTTRDVAVSVRDEDASPCWLEPGAV"
FT   gene            complement(120277..121038)
FT                   /locus_tag="Alvin_0116"
FT   CDS_pept        complement(120277..121038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0116"
FT                   /product="putative hemolysin"
FT                   /note="KEGG: tgr:Tgr7_2736 putative hemolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61085"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF8"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2736"
FT                   /protein_id="ADC61085.1"
FT                   /translation="MVASASASLAKRGERLYVEIATSESEVREAQALRYQVFGEEMGAR
FT                   LKGEPGYDHDTFDDHCQHLLVRDSRTGRVVGCTRLLTDASAARIGGFYSESEFELDAIK
FT                   RLDGRLLEVGRTCIAPEFRQGPAIAVLWSGLAGFVQLNGFDYLFGCASVPLGEDDIQAA
FT                   AIMNRLRRQALAPEDRRITPRAPLLTTQVDDDVLDAPLPPLLRAYVRLGAKACGEPCRD
FT                   PDFGVADVLMLLDIDAMSPAYSRHFLDRHGL"
FT   gene            complement(121142..121798)
FT                   /locus_tag="Alvin_0117"
FT   CDS_pept        complement(121142..121798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0117"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: tgr:Tgr7_2416 HAD-superfamily subfamily IB
FT                   hydrolase, TIGR01490"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61086"
FT                   /db_xref="GOA:D3RVF9"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVF9"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADC61086.1"
FT                   /translation="MPLAIFDLDNTLLDGDSDYLWGCYLARHGLVDSAEYARENERFYR
FT                   EYQDGTLDIQEFLRFSLRPLREHPRERLEALRARFLEEQIEPIMTPAARALVERHQSAG
FT                   DTLLIITATNAFVTAPIAERFGVPHLIATLPAERDGVYTGEVEGVPSFREGKVERLEHW
FT                   LAEQGLDLAGSCFYSDSHNDLPLLERVERPIAVNPDAQLRATAETRGWPILSLRA"
FT   gene            122003..122551
FT                   /locus_tag="Alvin_0118"
FT   CDS_pept        122003..122551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0118"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aeh:Mlg_0427
FT                   dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61087"
FT                   /db_xref="GOA:D3RVG0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG0"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADC61087.1"
FT                   /translation="MIDHDGFRPNVGIILSNRDRRLFWGRRVGQNAWQFPQGGINPDET
FT                   PEQAMFRELEEEVGLCEQQVTILGSTRGWLRYHLPKRYIRHRYCGPGPICIGQKQVWFM
FT                   LRVNCGEEAFCLDRTDKPEFDAWRWVRYWQPLYEVVYFKRHVYQQALEELAPTLYPEGV
FT                   PDRRHVYASPSRLLRQGYP"
FT   gene            122659..124920
FT                   /locus_tag="Alvin_0119"
FT   CDS_pept        122659..124920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0119"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="KEGG: tgr:Tgr7_2414 phosphoenolpyruvate-protein
FT                   phosphotransferase PtsP; TIGRFAM:
FT                   phosphoenolpyruvate-protein phosphotransferase; PFAM:
FT                   PEP-utilizing protein; PEP-utilising protein domain
FT                   protein; PEP-utilising protein mobile region; GAF domain
FT                   protein; SMART: GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61088"
FT                   /db_xref="GOA:D3RVG1"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG1"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADC61088.1"
FT                   /translation="MLESLRRIVQEVNNARDLEQALSIIVQRVKQAVGADVCSVYLNDY
FT                   DNHRHVLQATEGLRKDAVGRVRLELGRGLIGLVSERAEPINLDDAANHPRYECIIDTGE
FT                   ERYHGFLGAPIIQNRKVLGVLVLRQRRRRHFGEDEVTFVMTLASQLAGAITFARTSGEL
FT                   ARLQDDGIPQRFLPGLAASPGIGLGQAVVVYPPADLDAVPDRRPEDLEAEAEEFRRAVR
FT                   EVAEDLDRFASRTQVHLRVEDMALFDAWRLMLESDTLIDGTLSRIRAGNWAPGALRETI
FT                   AEHARVFDAMDDAYLRERATDVRDLGRCILMHLQNRASAPIQYPPCTILVGDEISAMQI
FT                   ADVPREKLAGVVSTSGSGSSHVGILARGMGVPAAMGVSDLPVGRVEGREMVVDGYRGRV
FT                   YVSPGPAVRSEYQRLADDDAALTSELQALSHLPAETTDGYVIPLYLNTGLVSESRPLGI
FT                   EESAGVGLYRTELPFIVRDSFPSEAAQMANYRHVLELFAPRPVTIRTLDIGGDKPLPYF
FT                   PMQEANPFLGWRGIRITLDHPEIFLSQVRAVLRASIGLDNLQLLLPMVSTVGEVDDALL
FT                   LIQRAHNELLEEGYQVRMPPVGVMIEVPAAVYQAEALARRVDFLSVGTNDLTQYLLAVD
FT                   RNNPHVAKLYNEYHPAVLRALLQILTGARLHGKEVSVCGEMAGDPLATFLLLGMGVHSL
FT                   SMGAGSLLRVKKVIRSISRARAREVLKVALQCEDAGSVRRLLLDALETVGLGGLVRPGR
FT                   "
FT   gene            complement(124917..126302)
FT                   /locus_tag="Alvin_0120"
FT   CDS_pept        complement(124917..126302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0120"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   tgr:Tgr7_0755 oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61089"
FT                   /db_xref="GOA:D3RVG2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG2"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADC61089.1"
FT                   /translation="MPELTAGLRAELARIAGSGALLTDPADCWPYGYDNSRRQALPQAV
FT                   VFARDEDQIAALVRLCAEAGLPLIARGLGTGTTGATVPDRGGVVLSFERMDQIKRIEPG
FT                   DRLAVVEPGVTNARLQQAIAAEGFFWPPDPTSAPTCTIGGNLAYNSAGPRAVKYGTPRE
FT                   NTLGLRAVSGTGEVFHTGVLTTKGVVGYDLTRLIIGSEGTLALVTEATLKLTPLPEAKR
FT                   TLRATYADIHSAALAVSAIMAQPVTPCALEIMDGSAIEMVSRYSELDLPDGAGALLMIE
FT                   VDGPAACIQEAQRAVGEAARVAGLLELRLAETADEVAALWKTRKALSPALRHIAPKKIN
FT                   EDVVVPVSHMGAFIDGLEQLARETGIRIVNFGHAGNGNIHVNLLIDPDDAEEVARAAHC
FT                   LDAVFALVLRLGGTLSGEHGVGLEKRDFVDRELDPVALRLMHAIKAQFDPAGILNPGKS
FT                   LPG"
FT   gene            complement(126295..126903)
FT                   /locus_tag="Alvin_0121"
FT   CDS_pept        complement(126295..126903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0121"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG: asa:ASA_0340
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61090"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG3"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ADC61090.1"
FT                   /translation="MNRTYPKLITLTSAMLAFALSAAGCAPLVVGGAAVAGASAIHDRR
FT                   PAQALLDDRQIEFAATQAIFQDRDLSRGARLVVTSYNRTVLITGQAESAELARRASNRI
FT                   SRLHKVARVIDEVRVGPRIGMSRQSEDAYIASRAKLELAGIGLPDFDPTRVKIVVEDGD
FT                   LYLLGLVTPREADLAAERVRYVPGVRKVVKLFEYWTPNA"
FT   sig_peptide     complement(126793..126903)
FT                   /locus_tag="Alvin_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.616 at
FT                   residue 37"
FT   gene            complement(126992..127369)
FT                   /locus_tag="Alvin_0122"
FT   CDS_pept        complement(126992..127369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0122"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   csa:Csal_2201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61091"
FT                   /db_xref="GOA:D3RVG4"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG4"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ADC61091.1"
FT                   /translation="MSTSPRSGRSRPDTRAIGEAKERLAESFLIAQGLRLVARNQRSRF
FT                   GEIDLVMRDEAILVFVEVRYRRSTRFGTPAATVDARKQQRLILAARHYLHRHPTQLACR
FT                   FDVVAISAEDDIQWIRQAFTL"
FT   gene            complement(127366..129228)
FT                   /locus_tag="Alvin_0123"
FT   CDS_pept        complement(127366..129228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0123"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: noc:Noc_0356
FT                   LppC putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61092"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG5"
FT                   /inference="protein motif:PFAM:PF04348"
FT                   /protein_id="ADC61092.1"
FT                   /translation="MPKNRLDRAVFFSRRRLGPLLVVSALSGCAVQPLQDPSSLLTSVP
FT                   AAELSRASTLEAQGRVDEAARLYLESATRAQPPAGAELRLKAAQAYLAGGRTGQARETL
FT                   AGLASAELIGGQLERSRLLESELDLAAGQPKAAIAKLKRLPALAKPLAIRRLGLLAAAQ
FT                   RLDNDPIASAESLAELDARLDGQARVTNQVSLVATLALTGEDDLLQLTRAGRGAMKGWA
FT                   EIAQLVRRHGADPRRLDDAYRQWRQRRTSHPALPELARAYTGNGSSGYANGQRVTVMLP
FT                   SGGRFAAAAKAVRDGIQAASRLDPGDRRPSLDFADSTNAGRVRTLHAAAITRGADAVIG
FT                   PLEKPAVDALIEARTAQVPTLALNESTEAERRALNLFQFALSPENEAAEAANKGFALGA
FT                   RRALVLHPNDAWGQRLANAFSAQWRAQGGTLAGQAGFDPSSSNYDTTLGRLMNGQRADL
FT                   LFLVATAEMARKIHPQIQTVATKPSIVISTSHVYSGRFDAAADKALVGLYFVDIPWMLD
FT                   LGGEGPLARRTVMGQTASASGPLARLYAMGLDAYRLTPHLTELAANPGAYFPGQTGGLA
FT                   IDPLGRITRQLALGRFTENGPRLANGVEPSSETRVEPTRTLGPE"
FT   gene            129276..130136
FT                   /locus_tag="Alvin_0124"
FT   CDS_pept        129276..130136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0124"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: tgr:Tgr7_0758
FT                   uroporphyrin-III C/tetrapyrrole (corrin/porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61093"
FT                   /db_xref="GOA:D3RVG6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG6"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADC61093.1"
FT                   /translation="MRQQAGVLYVVATPIGNLGDLSERARRVLAEVDAIAAEDTRETRR
FT                   LLAYCGISAELIAYHDHNESELTPRLLEALESGQNLALVSDAGTPLISDPGYTLVAAAR
FT                   ERGLTVVPIPGASAAICALSASGLPSDRFLFLGFPPRTQARRRAWIEAVAREPGTLVLY
FT                   ESAKRALDTLRDLQAVLGDGRRLVIARELTKQFETFLLGSAGTLIARLESDPEQRLGEM
FT                   VILVEGCPDSETDATHNESIRVLRLLGESMPLSQAAALAARLTGAKKNALYRLGLELGL
FT                   GSESR"
FT   gene            130249..130564
FT                   /gene="rnpB"
FT                   /locus_tag="Alvin_R0006"
FT   ncRNA           130249..130564
FT                   /gene="rnpB"
FT                   /locus_tag="Alvin_R0006"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 266.44"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            130891..131346
FT                   /locus_tag="Alvin_0125"
FT   CDS_pept        130891..131346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0125"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; transcriptional regulator,
FT                   AbrB family; PFAM: MraZ domain; KEGG: tgr:Tgr7_0760 MraZ
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61094"
FT                   /db_xref="GOA:D3RVG7"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG7"
FT                   /inference="protein motif:TFAM:TIGR00242"
FT                   /protein_id="ADC61094.1"
FT                   /translation="MFRGVTIVNLDSKGRLAIPSRYRERLEAMSGTRLVVTVDRDRCLL
FT                   LYPESEWDIIERKFAALPALDPTARALQRLYVGNAQEVDIDAQGRILLPVHLREFASLD
FT                   KRVAFVGLGVKFEIWDESAWCARTEAALNDLAIAELATESGFGSLTL"
FT   gene            131394..132413
FT                   /locus_tag="Alvin_0126"
FT   CDS_pept        131394..132413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0126"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: tgr:Tgr7_0761
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61095"
FT                   /db_xref="GOA:D3RVG8"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG8"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ADC61095.1"
FT                   /translation="MKLPRPFKRMDGQEATDVEQASPRGRHSEKQPLSHKPVLLEESVS
FT                   ALLVQSDGIYVDGTFGRGGHSRAILARLGAAGRLLGFDRDPEAVAVGRALAAQDPRFSI
FT                   HQGSFADIGRLLDEAGVDARLNGLLLDLGVSSPQLDTPERGFSFMAEGPLDMRMDPDSG
FT                   ESAAQWLARAEQGEIATVLHEFGEERFANRIARAIVETRTQTPIRTTAQLAELVARAVP
FT                   RREPGKHPATRTFQAVRIQVNGELEALRRCLDQVCDRLAVGGRLAVISFHSLEDRLVKR
FT                   FIRREAKGPELPKGVPARAVEVQGRLRPVGKSVRPSTAEEALNPRARSAILRVAERLP"
FT   gene            132410..132700
FT                   /locus_tag="Alvin_0127"
FT   CDS_pept        132410..132700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0127"
FT                   /product="cell division protein FtsL"
FT                   /note="TIGRFAM: cell division protein FtsL; PFAM: cell
FT                   division protein FtsL; KEGG: tgr:Tgr7_0762 cell division
FT                   protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61096"
FT                   /db_xref="GOA:D3RVG9"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVG9"
FT                   /inference="protein motif:TFAM:TIGR02209"
FT                   /protein_id="ADC61096.1"
FT                   /translation="MTRARVVTVAGFMLAVILTAVVVVHTKYLTRLHFAHLQDLRAQRD
FT                   AIDVEWNRLRLEEAALSTHGLVERKARRELGMFAPRAGDVLLIEERVHAQP"
FT   sig_peptide     132410..132484
FT                   /locus_tag="Alvin_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.916) with cleavage site probability 0.430 at
FT                   residue 25"
FT   gene            132687..134468
FT                   /locus_tag="Alvin_0128"
FT   CDS_pept        132687..134468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0128"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   tgr:Tgr7_0763 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61097"
FT                   /db_xref="GOA:D3RVH0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH0"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADC61097.1"
FT                   /translation="MPNPSRRARKPLPSLKPRRAPNPALRRRLLMSALSLAFVMLTAGV
FT                   FYRQVIQTEFLQREGEARYLRDAVIPARRGMITDRNGEPLAVSTPVETVWAEPRKLVEH
FT                   LDRIPAIAQALDMDAAFLRDRIESNRDKGFLYVKRRVTFDEAQAVRAAIAQYKIEGLDF
FT                   ESEYRRFYPGAEVFAHVIGFTNIEDRGQEGLELAYDRVLKAEPGLQRVIRDGRRRTVQQ
FT                   VEQISPAHQGRDLVLSLDRRLQYLAYRELKAAVTEHKAKGGSLVVLDVATGEVLAMVNQ
FT                   PSFNPNSDRSGGSERRRNRALTDVMEPGSTLKPFVVAAALERRVITPASRFSTAPYSIG
FT                   RNVVRDVHNYGTLDVTGIITKSSNVGSVKIAQKMSYEDLWSLYDRLGFGHPTGVGFPGE
FT                   SRGLLRHYSTWRPFEHATHSFGYGLSVTPLQLAQAYLVLAADGVKRPVTLFKRNSLMQT
FT                   ASAPEGVRLLSQETTRRLRAMMETVVSEQGTAKQAIIAGYRAAGKTGTAKKSAGKAGYA
FT                   SNRYQSVFAGFVPAGRPRFVMAVMIDEPGAGAYYGGVVAAPIFQKVMEGALRLFNVPPD
FT                   DPEPSMMLAQHLQGNVP"
FT   sig_peptide     132687..132818
FT                   /locus_tag="Alvin_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.667) with cleavage site probability 0.624 at
FT                   residue 44"
FT   gene            134527..135885
FT                   /locus_tag="Alvin_0129"
FT   CDS_pept        134527..135885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0129"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: tgr:Tgr7_0765
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D -alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61098"
FT                   /db_xref="GOA:D3RVH1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH1"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ADC61098.1"
FT                   /translation="MWTLAQAIARAGGVLHGSDVAFSSVGTDSRADCTGQLFVALRGER
FT                   FDGHEYVAAAQAAGAVAAMVDQPLPLDLPQWVVDDTRLGLGRLAAAWRDRFPGRVIAIT
FT                   GSNGKTTVKEMVAAILSQAGRVRATRGNLNNDIGMPLTLLSARDEDFLVLEMGANHHGE
FT                   IGYMTEIARPEVALITNAGRAHLEGFGSVEGVARAKGEIARGLPEDGVFVVSGDSPYLG
FT                   LWRELAEGRRMLTFALDGAADLTAGTESIGVEWGAAGFRTTFTARVADENWPLALSLAG
FT                   QHNVRNALAASAGALALGLDRAAIAAGLESLTPVKGRLYPRLCREIGVIDDSYNANPDS
FT                   IAAAIAVLAGLTGRRTLVLGDLGELGADAARLHAEIGEQAHAAGLDRLFTVGTLSAEAS
FT                   RAFGAGAEHFADQDALLNRLKADLKPGDRVLVKGSRLARMERIVEALCAEDTL"
FT   gene            135888..136970
FT                   /locus_tag="Alvin_0130"
FT   CDS_pept        135888..136970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0130"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="KEGG: maq:Maqu_2455
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   Glycosyl transferase, family 4, conserved region;
FT                   Phospho-N-acetylmuramoyl-pentapeptide transferase,
FT                   conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61099"
FT                   /db_xref="GOA:D3RVH2"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH2"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ADC61099.1"
FT                   /translation="MLLYLTDWLTEYYNGFSVFRYLTLRAILGVLTALTIALLVGRPMI
FT                   RRLRAYKIGQTVRDDGPQSHLSKSGTPTMGGALILVAVGIATLLWSDLENRYVWIVLLT
FT                   TMAFGLVGLVDDYKKLVKRDPRGLIARWKYFWQTVFGFAAAVALYVTANSPAETALLIP
FT                   YAKNLSIQLGPWFILLTYFVIVGSSNAVNLTDGLDGLAIMPTVLVAGALTIFVYAAGHA
FT                   QIANYLLIPYLPEVGELVIFCSALVGAGLGFLWFNAYPAQVFMGDVGALALGAALGVVA
FT                   VAARQELVLFIMGGVFVAETISVMLQVMSFKLTGKRIFRMAPLHHHFELQGWPEPRVIV
FT                   RFWIMTVVLVLIGLASLKIR"
FT   gene            136976..138352
FT                   /locus_tag="Alvin_0131"
FT   CDS_pept        136976..138352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0131"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: Mur ligase middle domain protein; FAD
FT                   dependent oxidoreductase; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: tgr:Tgr7_0767
FT                   UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61100"
FT                   /db_xref="GOA:D3RVH3"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH3"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ADC61100.1"
FT                   /translation="MTSPSTATERSRSPESKTLIVGLGKTGLSCARHLSARGVRVAVTD
FT                   SRERPPGLDVLQSELPEVAVFVGGFDPDVFAAATELVVSPGVPLAEPLIRQAIARGVPA
FT                   VGDIELFAREIHAPLCAITGSNGKSTVTTLVGLMARLAGQRVAVGGNLGEPVLDLLAPD
FT                   VERYVVELSSFQLETVPSLRADAAVVLNVSADHLDRYAGLDDYARTKARIYQGARIAVV
FT                   NRDDPIVAAMPRDPEREIGFTLGVPEGSDFGVRVLEGQSWICQGEEPILPTAAIRLPGR
FT                   HNLANALAALALAQASAIPMAGACEALRVFPGLPHRSEFVAERAGARWYDDSKGTNPGA
FT                   TIAALEGLIPEDGSGRVVLIAGGEGKGADFAPLRAAVERAARAVVLIGRDAPLIASALD
FT                   GTVPLIRATDMDAAVALAAEHIEPGDCVLLSPACASFDMFDNYEHRGRVFAEAVRRLPG
FT                   "
FT   gene            138349..139548
FT                   /locus_tag="Alvin_0132"
FT   CDS_pept        138349..139548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0132"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: pmy:Pmen_0921 cell division protein
FT                   FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61101"
FT                   /db_xref="GOA:D3RVH4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3RVH4"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ADC61101.1"
FT                   /translation="MTAAAPSKPLPRTPRVRQAYPLDYPLLLCALGLLAFGWVMVTSAS
FT                   MSIAEACCQNPFHYSIRHAIALGLALMLGLMAYSVPSHWWERHGVWLFLASALVLILVL
FT                   IPGIGRTVNGATRWIPLGPLNVQPSEFVKLFAILYVAGYLVRHADKVVNQLSGFIRPLI
FT                   LIGAAALLILMQPDFGTTAVMLATVMGMLFLGGASLLPFIVLLAIVGAGLVTLVIFSPY
FT                   RLERVVSFLNPWEDPFNSGYQLSQALIAFGRGEWFGVGLGNGIQKQYFLPEAHTDFLPS
FT                   VIGEELGLAGMLVLIAAFVFLSWRAMSIGVRAEALKRPFESYVAQGIGLWIGLQSFVNL
FT                   GVNVGILPTKGLTLPFMSYGSNSLMVGCMAVAILLRIDVMLRRVESEAKFKRGTPWSRA
FT                   "
FT   gene            139533..140624
FT                   /locus_tag="Alvin_0133"
FT   CDS_pept        139533..140624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0133"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: tgr:Tgr7_0769
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61102"
FT                   /db_xref="GOA:D3RVH5"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH5"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ADC61102.1"
FT                   /translation="MVARLAVMAGGTGGHVFPALAVAESLRGQGAEVFWIGTQAGMESR
FT                   LVPEHGFEMEWVSIEGVRGKGGLQWLKAPFRLASAFGQARAILRRRRPTVVLGMGGFVS
FT                   GPGGLAARALGIPLVIHEQNFVPGLTNQWLARVATQVFEAFPGSFPPARRAIVTGNPVR
FT                   RSILDLPAPAERLTGRSGPVRLLVVGGSLGAQALNETVPQALARLPVEQRPLVRHQAGE
FT                   RTLELARNAYRDADVEAEVVAFVRDMAEAYAWADLVVCRSGALTVSELAAAGVGSILVP
FT                   YPFAVDDHQVGNARYLSEAGAARLILQRDLTAAGLTDILSELFADRARLLAMAEAARRR
FT                   AQPEATDHIARACLELSARGTHP"
FT   sig_peptide     139533..139598
FT                   /locus_tag="Alvin_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.756) with cleavage site probability 0.609 at
FT                   residue 22"
FT   gene            140621..142048
FT                   /locus_tag="Alvin_0134"
FT   CDS_pept        140621..142048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0134"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: tgr:Tgr7_0770
FT                   UDP-N-acetylmuramate/alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61103"
FT                   /db_xref="GOA:D3RVH6"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH6"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ADC61103.1"
FT                   /translation="MSPHLQHTAANMGRVRRLHFIGIGGSGMSGIAELMANLGYEVAGS
FT                   DLRDSEVTHRLRDLGIEVFIGHRAEQVSEADAVVVSTAIDETNPEIQQARERRIPIVRR
FT                   AEMLAELMRFYYGVAVAGTHGKTTTTSLVASILAEGGLDPTFVIGGRLNSAGANARLGS
FT                   TKYLVAEADESDASFLYLQPMVSIVTNIDADHMRTYGNDFDRLRQTFMEFLHHLPFYGL
FT                   AVLCIDDPEVRALVPEVPRPVRTYGTRPEADLRASDIRQEGMRTSFLVHGAEFERPLAV
FT                   TLNLPGRHNVLNALAAISVALELGVEDEAIVRALAGFQGVGRRFVAREVVDPQGRRLLV
FT                   VDDYGHHPRELAATLAAAREGWPGRRLVLVFQPHRYSRTQEQFEDFVEVLSTPDALVLC
FT                   EVYPAGETPIPGADGRALSRAIRVRGELDPIFAQGLDAVPGLLANIIRDGDILLVSGAG
FT                   DIGGLAARLPGLVEQGF"
FT   gene            142255..143139
FT                   /locus_tag="Alvin_0135"
FT   CDS_pept        142255..143139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0135"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: tgr:Tgr7_0771
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61104"
FT                   /db_xref="GOA:D3RVH7"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH7"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ADC61104.1"
FT                   /translation="MTTLRGRWQFDEPLSRHTSWRVGGPARRLYQPADADDLVGFMRQL
FT                   DPDEPLLWLGLGSNLLVDDAGFPGTVILTQGTLDTLELRGERRLYAEVGVSSAKLARFA
FT                   ARHDLTGIEFLAGIPGTLGGALAMNAGAWGGETWSFVRRVWTLDRQGQIHEREASEYEP
FT                   AYREIRGPAGEWFLAAELELTPGDGAASLARIRELLDQRAATQPVGQPSCGSVFRNPPG
FT                   DHAARLIDSLGLKGTRIGGAEVSSIHANFIINRGGATATDIARLIEQIQETVERHTGIR
FT                   LMPEVRRIAGEQA"
FT   gene            143136..144062
FT                   /locus_tag="Alvin_0136"
FT   CDS_pept        143136..144062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0136"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: aeh:Mlg_2190 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61105"
FT                   /db_xref="GOA:D3RVH8"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVH8"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ADC61105.1"
FT                   /translation="MTTDMNRAPERFGKVALLMGGQAAEREISLKSGRAVHEALQRLGV
FT                   DVEPIDPDATLLERLRTGGYDRAFIILHGRGGEDGQIQGALETIGLPYTGSGVLGSALG
FT                   MDKYRCKLAWAGCGLPTADFVLLRDESDLTAAAELGFPLMIKPVHEGSSIGMARVESVE
FT                   GLERAWRAAAEFDSLVLAERWIQGMELTCAILGHEALPTIRLETPHAFYDYEAKYSADS
FT                   TRYHCPSGLDAEVEARLRALALEAFDVVGASGWGRVDMMLDGTGQPFLLEINTVPGMTD
FT                   HSLVPMAARVAGIDFDDLVWRILETSL"
FT   gene            144120..144866
FT                   /locus_tag="Alvin_0137"
FT   CDS_pept        144120..144866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0137"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: tgr:Tgr7_0773 cell division protein FtsQ"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61106"
FT                   /db_xref="GOA:D3RVH9"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3RVH9"
FT                   /inference="protein motif:PFAM:PF03799"
FT                   /protein_id="ADC61106.1"
FT                   /translation="MGTRLRALLGVLILLVLGGAGWLFLRWEPTLLPIRLIQIEGEVHH
FT                   HSSQQLQERLTERLHGGILTADLVDLKQTAEELPWVGQATLRRVWPDTLRVQVREYRPI
FT                   ARWSLDGLVTADGIVFRPQGGSIPSNLPLLEGDDKRAPEITARYQAWQAALERVGRGIQ
FT                   RLSVDPRGDWRLKLASGAELRLGTTMVEERLARYLASASQLEAAGRPLTVDLRYSNGFS
FT                   VKWAPNTDTGVRAHPDRVAARAGNRR"
FT   gene            144873..146108
FT                   /locus_tag="Alvin_0138"
FT   CDS_pept        144873..146108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0138"
FT                   /product="cell division protein FtsA"
FT                   /note="KEGG: tgr:Tgr7_0774 cell division protein FtsA;
FT                   TIGRFAM: cell division protein FtsA; PFAM: cell division
FT                   protein FtsA; SMART: cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61107"
FT                   /db_xref="GOA:D3RVI0"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI0"
FT                   /inference="protein motif:TFAM:TIGR01174"
FT                   /protein_id="ADC61107.1"
FT                   /translation="MSRRNDKSLLVGLDIGTSKIACLVGELKDDDQIEIIGIGTHPSRG
FT                   LKKGVVVDIESTVQSIQRAVEAAELMADCEIHSVHVGIAGSHIRSLNSHGITAIKEHEV
FT                   NQADVDRVIEAARAVAIPTDQKILHILPQEFIIDDQEGIREPIGMCGVRLEARVHMVTG
FT                   AASAAQNIVKCVRRCGLEVDDLVLAQLSSSYAVLGEDEKELGVCVVDIGGGTTDLAVFT
FT                   DGAIRHTAVIPIAGDQVTNDIAVALRTPTQHAEQIKIQHACALTQLAANGDNIEVPSIG
FT                   DRPPRRLSRQTLAEVVEPRYEELLTLLHNELRRSGFEDVIAGGVVLTGGSAKMRGLIEL
FT                   AEEVFHMPVRLGVPNRVLGLSEVVDNPAHSTGVGLLMYARQHRFSRRPEPSDTPGLKGM
FT                   LVRLRHWFQGNF"
FT   gene            146272..147438
FT                   /locus_tag="Alvin_0139"
FT   CDS_pept        146272..147438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0139"
FT                   /product="cell division protein FtsZ"
FT                   /note="KEGG: aeh:Mlg_2187 cell division protein FtsZ;
FT                   TIGRFAM: cell division protein FtsZ; PFAM: Tubulin/FtsZ
FT                   GTPase; Tubulin/FtsZ, 2-layer sandwich domain; SMART:
FT                   Tubulin/FtsZ, 2-layer sandwich domain"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61108"
FT                   /db_xref="GOA:D3RVI1"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI1"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ADC61108.1"
FT                   /translation="MFELMDTHSQNAVIKVIGVGGGGSNAVNHMVASTIEGVDFICANT
FT                   DAQALRHSNVKTILQLGAGITKGLGAGADPDVGRHAALEDRDRIQEALEGADMVFITAG
FT                   MGGGTGTGAAPIVAQVAKELGILTVAVVTKPFPFEGTRRRRIAEEGITELAQHVDSLIT
FT                   IPNEKLLAVLGKDMSLLDAFKAANDVLLNATQGIAELITCRGLINVDFADVKTVMSNMG
FT                   VAMMGTGSARGENRAREAAEAAIKSPLLEDIDLAGAKGILVNITAGMTLTIGEFDEVGN
FT                   TVRDFADDDATVVVGTVVDPELEDELRVTVVATGLGDRRVKVKRTAGEPAMRLITGDSD
FT                   SSAPDYREMDRRPAIYRKGGATPAASDKSEDNDLDYLDIPAFLRRQAD"
FT   gene            147673..148584
FT                   /locus_tag="Alvin_0140"
FT   CDS_pept        147673..148584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0140"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="TIGRFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; PFAM: UDP-3-0-acyl N-acetylglucosamine
FT                   deacetylase; KEGG: tgr:Tgr7_0776 UDP-3-0-acyl
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61109"
FT                   /db_xref="GOA:D3RVI2"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI2"
FT                   /inference="protein motif:TFAM:TIGR00325"
FT                   /protein_id="ADC61109.1"
FT                   /translation="MLKQRTLKNAIRATGVGLHTGEKVELTLRPAAPDTGIVFRRIDLD
FT                   QPVTIAATPFNVGDTRLSTTLVNGDVRVSTIEHLLSAFAGLGIDNAYVDLAAAEVPIMD
FT                   GSAAPFVFLLQSAGIEEQSKAKRFIRIKRPVEVRDGDKFARFTPYDGFKVNFSIEFDHP
FT                   AFQARSNQAEIDFSTASFVRELSRARTFGFLRDIEALRQQNLALGGSLDNAVVVDEYRI
FT                   LNEEGLRYEDEFVRHKILDAIGDLYLLGHTLIGAFEGHKSGHALNNLLLRALVAEEAAW
FT                   EEVVFEDSAAAPICYAQPVPAL"
FT   gene            complement(148585..149043)
FT                   /locus_tag="Alvin_0141"
FT   CDS_pept        complement(148585..149043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0141"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   tgr:Tgr7_0777 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61110"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI3"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADC61110.1"
FT                   /translation="MRLRFRHIRDHLSHHGFARERLEQDRREQTLVAEIRALLPGKLGA
FT                   HCLDLRIADGRLTLFLDSTAWLTRARFLAGEILTSLKSYHVDAVGFQVRLPERESPRRD
FT                   VASRRAQLSETATRHLLEAADHQRDPCLSEALRRLARHGPRATPEGLD"
FT   gene            149194..150096
FT                   /locus_tag="Alvin_0142"
FT   CDS_pept        149194..150096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0142"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: pag:PLES_47831 putative
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61111"
FT                   /db_xref="GOA:D3RVI4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI4"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADC61111.1"
FT                   /translation="MPHIARKKTQRGQTLVMLSAVSSFALAGVGFGFWIGDRAGAPGRT
FT                   SIAMETVPVNPSVTDSGEIGAIAARLGEMQAELLRINALGERLVQVSGLDPDEFDFVNA
FT                   PPRGGPETAMARDYTIKELADELSTLVVLVQDRERKLDRLADRVLEQQPRAAGAQLGGW
FT                   PVRSGYISSPYGVRVHPVRNTRQFHEGVDFATKRGSPILAVADGLVVFSGRRNGYGNLV
FT                   DIRHRDGLVTRYAHNTANLVREGDLIRQGQQIATVGSTGTATGPHVHFEVIRNGRAVDP
FT                   MPYLRSQPAQRLARADVLR"
FT   sig_peptide     149194..149277
FT                   /locus_tag="Alvin_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.933 at
FT                   residue 28"
FT   gene            150213..153038
FT                   /locus_tag="Alvin_0143"
FT   CDS_pept        150213..153038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0143"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SEC-C motif domain protein; SecA
FT                   preprotein cross-linking region; SecA Wing and Scaffold;
FT                   KEGG: tgr:Tgr7_0779 preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61112"
FT                   /db_xref="GOA:D3RVI5"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI5"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADC61112.1"
FT                   /translation="MFNPFKKLFGSRNERLVKSLMKTVARINALEPELAQLSDQALAAK
FT                   TVEFRERLAGGTTLDDLLPEAFGVVREAGKRVLGMRHFDVQLVGGMVLNSGKIAEMRTG
FT                   EGKTLVATLAAYLNALPGQGVHVVTVNDYLARRDAAWMGRLYHFLGLSVGVINSSGGLG
FT                   PDMASYLFDPEFELEAGQGHRHLRPCTRRETYGADITYGTNNEYGFDYLRDNMAFTPEQ
FT                   RVQRDPFYAIVDEVDSILIDEARTPLIISGPSEGSTDLYKQIDTLIPRLTRQAPITNEE
FT                   GQPDFGPGDFSVDEKVRQVYLSEEGHEKVEQMLVEIGLLEEGDGLYDPGNIVLMHHVYA
FT                   ALRAHTLFQKNVEYIVRDGQVIIVDEFTGRTMPGRRWSEGLHQAVEAKEGVPIQPENQT
FT                   MASITFQNLFRLYPKLSGMTGTADTEAFEFQQIYGLEVVVIPTNQPMVRDDRGDLVYLT
FT                   PQEKYEAIIADVQDCVQRGQPVLVGTASIETSELVSGLLKKAGIAHEVLNAKQHEREAG
FT                   IIAQAGRPGAVTIATNMAGRGTDIVLGGNLEAELEEAGPNADHAALRAAWKARHEQVIQ
FT                   AGGLHVVGTERHESRRIDNQLRGRSGRQGDPGSSRFYLSLEDNLMRIFASDRVGKMMQR
FT                   LGMQKGEAIEHPWVTKAIENAQRKVEGRNFDIRKQLLEYDDVANDQRKVIYRQRRDLMD
FT                   ALDVSETVEAMRADVLKGLIDIYIPPDSLEEQWNIAGLSEALVEHFGGDWPIQSWLDQD
FT                   HDLHEETLRRRIQDALAQRYQERENLIGTANMRQVERAVMLQTLDSHWKDHLAAMDYLR
FT                   QGIHLRGYAQKNPKQEYKREAFLMFSAMLAGIKQDVVTTLAKLEIQAGVEADFAARRTP
FT                   EPAPKGFEFKHDVFEGFGEGDEESSESTGGRSRAEEDHHPYVRDGRKVGRNEPCPCGSG
FT                   KKYKQCCGKVD"
FT   gene            153054..154271
FT                   /locus_tag="Alvin_0144"
FT   CDS_pept        153054..154271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0144"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: tgr:Tgr7_0780 arginine biosynthesis
FT                   bifunctional protein ArgJ; TIGRFAM: arginine biosynthesis
FT                   bifunctional protein ArgJ; PFAM: arginine biosynthesis
FT                   protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61113"
FT                   /db_xref="GOA:D3RVI6"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI6"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADC61113.1"
FT                   /translation="MSENKTELSFLPVPGVRLATIGAGIRYQGRDDLLALELAPGATTA
FT                   AVFTRNAFCAAPVMLARHHLSQTAPRYLLVNSGNANAGTGARGLDDTRACCAALAEAAG
FT                   CRPEEVLPFSTGVIGEPLPVARFEAAMPALLERFEAAAWPDAARAIMTTDTVPKLCSRT
FT                   FEIDGRQATITGIAKGAGMICPDMATMLAFIATDAAVAPEVLQGCLKAAADRSFNAISI
FT                   DGDTSTNDACVLAATGALGNAPIVDETSTDYAALQAAVESVCVELATAIVRDGEGATKL
FT                   VTVRVEQARDRDEARRVAYTIAHSPLVKTALFASDPNWGRILAAVGRAGVENLVIEDVD
FT                   IWLGEVRIVEAGGRAADYTEQAGAAVMAESEILIRVALGRGTVDAEVLTCDFSYDYVRI
FT                   NAEYRS"
FT   gene            154325..155272
FT                   /locus_tag="Alvin_0145"
FT   CDS_pept        154325..155272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0145"
FT                   /product="mutator MutT protein"
FT                   /note="TIGRFAM: mutator MutT protein; PFAM: thiamine
FT                   monophosphate synthase; NUDIX hydrolase; KEGG: noc:Noc_0306
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61114"
FT                   /db_xref="GOA:D3RVI7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI7"
FT                   /inference="protein motif:TFAM:TIGR00586"
FT                   /protein_id="ADC61114.1"
FT                   /translation="MPEIIHVMAGAIADASGRILVGKRPDHVHQGGLWEFPGGKLEPGE
FT                   SPEAGLARELAEELGIQVRASRPLIRVHHDYGDRHILLDVHRVDDYAGVPHGREGQPLD
FT                   WLAPEEMDPAAFPAADRPIITSLRLPPLMLITGEEPDRPDAFLARLGRALETGARLVQL
FT                   RAHQLSANDYVHLAQAACDLCDRTGAKLLLNRDPAEVASVPRHGLHLNSQVLMTLRERP
FT                   GRSSELVGASCHDPVQLARAVDLGLDYALLSPVKPTASHPETSPLGWNTFAAWVDLVPL
FT                   PVYALGGLTTDDLDDAFQHGAQGIAAIRGLWPAR"
FT   gene            155426..155920
FT                   /locus_tag="Alvin_0146"
FT   CDS_pept        155426..155920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0146"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: mca:MCA2408
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61115"
FT                   /db_xref="GOA:D3RVI8"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI8"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ADC61115.1"
FT                   /translation="MKITALTLCLLAFGSMATQAAELNAPAPGCRVQTLTGQSSVDPAA
FT                   FPGKVVYLDFWASWCIPCAKSFPVLDQWQSELGGRGFEVIAINLDEERQEALDFLQQHP
FT                   VRFTIGADPAGKCPRLYAVRGMPTSYLIDRQGRIREVHEGFKTSDAAGLRARIESLLSE
FT                   R"
FT   sig_peptide     155426..155488
FT                   /locus_tag="Alvin_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            155929..156150
FT                   /locus_tag="Alvin_0147"
FT   CDS_pept        155929..156150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0147"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mca:MCA2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61116"
FT                   /db_xref="InterPro:IPR025362"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61116.1"
FT                   /translation="MNARRLSRSLMLLTPLLAGCATQVAPWERGHLARPEMALEPYPLE
FT                   ASFRQHVFFSKESVSGGYGVGGGGCGCN"
FT   sig_peptide     155929..156003
FT                   /locus_tag="Alvin_0147"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.637 at
FT                   residue 25"
FT   gene            156332..157504
FT                   /locus_tag="Alvin_0148"
FT   CDS_pept        156332..157504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_1224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61117"
FT                   /db_xref="InterPro:IPR021953"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ0"
FT                   /inference="similar to AA sequence:KEGG:Noc_1224"
FT                   /protein_id="ADC61117.1"
FT                   /translation="MERQWDVGYFHYEEGGERMRVESLKQSLVLPLGDALDLTLNAVRD
FT                   TISGASPIYNVPEIRCQDGRVFTAPVISVSGASGNAEPSGTRPERPPLNTGDCRLGSAR
FT                   QVMLEDTFQDVRSAGDFKLNYYRGDTSLGLGAGVSREQDYDSRFLSLDLRREINDKLTT
FT                   LAFGYSLASDTFSPLNKPDFSGDKDAHQILLGLTQVLGRNDLLQINLTLGYDQGYLTDP
FT                   YKNVYLLSTNAAIDESRPDSRRQWNLLARYNHYFTAFKAALHLDYRYSRSDWGIDAHTL
FT                   EAAWIQPLGQGWHLIPRLRYYTQSEADFYQSYFETLPASGDYSSDYRLAGFGALGGGLK
FT                   LTRQVTSQARLDLGVEFYDRQSAYGLQEHADSAFADYGFTVYSLNLHLEF"
FT   gene            157505..158425
FT                   /locus_tag="Alvin_0149"
FT   CDS_pept        157505..158425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0149"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: mca:MCA2411
FT                   thiamine biosynthesis lipoprotein ApbE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61118"
FT                   /db_xref="GOA:D3RVJ1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ1"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADC61118.1"
FT                   /translation="MPACHLVFKAMGSPCELHLHGPDAAETRRVAESVIADVQRLERRY
FT                   SRYRDDSLTSAINRVAAVSGRCEVDAETAALLDYADTCYRESDGLFDITSGVLRRAWRF
FT                   ENACAPEPEAIAALLDRVGWDRVVWKRPFLSFGRPGMEIDFGGIGKEYAADRAAALCLD
FT                   AGIRNGLINLGGDVRVIGPLPDGDPWRIGIRDPERPETLLGGVLMTGGALATSGDYARF
FT                   LRIAGRRYGHILDPRTGWPVLGLVSVSVIAASCLVAGSLSTIAMLRGRAGIEWLRSLDI
FT                   PHLWIDAEGGRGGSGVFADLLKTPG"
FT   gene            complement(158450..158653)
FT                   /locus_tag="Alvin_0150"
FT   CDS_pept        complement(158450..158653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0150"
FT                   /product="protein of unknown function DUF329"
FT                   /note="PFAM: protein of unknown function DUF329; KEGG:
FT                   rso:RSc2830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61119"
FT                   /db_xref="GOA:D3RVJ2"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ2"
FT                   /inference="protein motif:PFAM:PF03884"
FT                   /protein_id="ADC61119.1"
FT                   /translation="MVKTVECPHCGRPVPWTPDSRWRPFCSERCRLIDLGDWLEERHRL
FT                   PADDSETPGEDAPDSTQAPVRH"
FT   gene            complement(158658..159416)
FT                   /locus_tag="Alvin_0151"
FT   CDS_pept        complement(158658..159416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0151"
FT                   /product="protein of unknown function DUF1342"
FT                   /note="PFAM: protein of unknown function DUF1342; KEGG:
FT                   tgr:Tgr7_0783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61120"
FT                   /db_xref="GOA:D3RVJ3"
FT                   /db_xref="InterPro:IPR009777"
FT                   /db_xref="InterPro:IPR027462"
FT                   /db_xref="InterPro:IPR036268"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ3"
FT                   /inference="protein motif:PFAM:PF07072"
FT                   /protein_id="ADC61120.1"
FT                   /translation="MITFEHPLNERVRTFLRLEHLFRQLEFFIQQEDPRSSRCAIWALL
FT                   DIVAVTTRADVRNEILKELDRLTGNLNRLATQRGIDTEALNEVLDDLRRVTEGVQQLNG
FT                   PIGHRAREDEFLKAIAQRSSIPGGTCSFDLPHFHYWLIQPTEQRQTRFNDWLQDLNPAI
FT                   EAIRLALSLMRSSSASRQVTAEGGFYQEALDAVAPAQMLRVTLEAEAAIFPEISGHKNR
FT                   FSIRFMKPELQGRATPHAEDIQFRLTCCVF"
FT   gene            complement(159690..161663)
FT                   /locus_tag="Alvin_0152"
FT   CDS_pept        complement(159690..161663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   ote:Oter_4023 Rossmann fold nucleotide-binding protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61121"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ4"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADC61121.1"
FT                   /translation="MYATPETGDGWITRLIARDDEGFVVSARFAVTPRFRALIGGRERD
FT                   LVFAARSRLARMGINILPLGELELDSDHGDLRLRILAAIASYGIGEHLERIVVPGLRVG
FT                   RLVFCPEDNRLDSAAIHRLIQDNALQVPAGFSLDGRGYLILRPQQRLYRFQKPLTPEDV
FT                   TAIATHADGKDLLNRLQTRVEVEHIELPPRDGLVTACSMFLHRHYVVLRNLDEALGVHL
FT                   QATVLDPVSTRGTNVYLEFVNRTEQLIINPSVAASVHEAIRVDPKPRYWHGRAHPEPGA
FT                   NDDEATGCQSLLAIFDRLEAGPVRDRYSHRMAAIVRDPAKLLAGEEPERLWTQPQTPRD
FT                   PRGGTDLSAGLVAEGLDLTARLECGTQILADLPDGARATLLLGYFPNLIEHTQICEAAL
FT                   RGRVGRIVFRRASFEHGPFLSSRDHGRLADYEGLGLQVFWCNEARGHVVRHVFRGLRGY
FT                   FTTPDTVDRFRSCLIFAVYGSTKPLAESAVAQIERLLTNLRALFGSDIGILTGGGPGAM
FT                   QQVTDVAHRLGLLVGSSFIETVDQTPNESAEFYQTFQARSRQARQRWFEIASFHLFLVG
FT                   GVGTLEEIGLTLTDMKLGVIETGPVVFFDSSGGEFYWEGLRRQLEEMKRQGRVPSWLTD
FT                   QILMTTDPDAVPRFYKQALRLG"
FT   gene            161860..162609
FT                   /locus_tag="Alvin_0153"
FT   CDS_pept        161860..162609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0153"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   sbp:Sbal223_2041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61122"
FT                   /db_xref="GOA:D3RVJ5"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ5"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ADC61122.1"
FT                   /translation="MAGHSKWANIKHRKAAQDKQRGKVWTKLIREVTVAAREGGGDPGA
FT                   NPRLRLAMDKAFGANMPRDTVERAIKRGAGGTEGENYEEIRYEGYGPGGVAIMVDCMSD
FT                   NRNRTASEVRHAFTKRGGNLGTDGSVSYLFTKQGIISFQPGTSEDAVMEAALEAGAEDV
FT                   VVNDDGSLDVVTTPEDFAAVKEALTKAGFDTEVAEIGFNAATQVELDAETAEKLLKLVE
FT                   MLEDLDDVQDVYHNADISDEIMAALDV"
FT   gene            162616..163152
FT                   /locus_tag="Alvin_0154"
FT   CDS_pept        162616..163152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0154"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: tgr:Tgr7_2236 crossover junction
FT                   endodeoxyribonuclease; TIGRFAM: crossover junction
FT                   endodeoxyribonuclease RuvC; PFAM: Crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61123"
FT                   /db_xref="GOA:D3RVJ6"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ6"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ADC61123.1"
FT                   /translation="MTGTRPPRHRILGIDPGSRNTGFGVIDTDGHHSVRVASGCIRVGE
FT                   HPWPDRLGLIFDQVAAIVAEYQPHEMAVEQLIFARDPTAALKIGQARGAVLCAGLKGGA
FT                   IVHEYSPKSVKLAVVGSGGADKSQVQHMVRVLLALPETPGEDEADALAIALCHAHSMGI
FT                   PARKRAAASWRDWRP"
FT   gene            163156..163791
FT                   /locus_tag="Alvin_0155"
FT   CDS_pept        163156..163791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0155"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   DNA recombination protein RuvA domain I; RuvA domain
FT                   protein; KEGG: tgr:Tgr7_2235 DNA recombination protein,
FT                   RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61124"
FT                   /db_xref="GOA:D3RVJ7"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ7"
FT                   /inference="protein motif:TFAM:TIGR00084"
FT                   /protein_id="ADC61124.1"
FT                   /translation="MIGRLQGRILAKHPPQLLLDVNGVGYELEAPMSTFYGLPAVGETA
FT                   TLLTHLAVREDAWTLYGFIRERDRALFRALIKVTGVGARMALAILSGMDAARFAQCVEQ
FT                   EDATALTRLPGIGKKTAERLIIEMRDRLGGVMIAPGAALPSAAGQPASGTTTADVVAED
FT                   QALADAVSALVALGYKPPDANRMARAVDDGAKTAEEIIRAALRSVNPV"
FT   gene            163891..165195
FT                   /locus_tag="Alvin_0156"
FT   CDS_pept        163891..165195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0156"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: pth:PTH_2004 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF domain
FT                   containing protein; PAS fold-4 domain protein; SMART: GGDEF
FT                   domain containing protein; PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61125"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC61125.1"
FT                   /translation="MDAIGDLVWLQDARGLCLDANPAFERLAQTERSRLLGRRLEDVLD
FT                   PGVAGNLWQPDWPALQGGRACTHETWLTIEDVPRLCEITHIPQRDSAGTLVQIQSLGRD
FT                   ITQRHQRIEQSLRDSQRQLADVIDFLPDALLAIDRDKRVIIWNKAVAKLTGIPPEAMLG
FT                   RGDYAYTVPFYGERRPQLMDLVFQSDTDLERRYAHVTREGDTLTAEGFCNALHDGHGAW
FT                   ILARVAPLRDAAGQVVGAMEIIRDITDSKRLEEDLRQLTRLDPLTQLFNRRYFFTLAEQ
FT                   EYQRFLRYHHPMALCMIDIDHFKSVNDRYGHLVGDTVLCIVAQTLHDNLRQVDILARYG
FT                   GEEFVILLPETDLQTACASTERLRVAVAERRIETPSGPVSVTLSLGVVAIADGPAMTLE
FT                   RLLDAADQMLYRAKQAGRNRVEIWDLGRSMESDGD"
FT   gene            165338..166420
FT                   /locus_tag="Alvin_0157"
FT   CDS_pept        165338..166420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0157"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   noc:Noc_0844 glycolate oxidase FAD binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61126"
FT                   /db_xref="GOA:D3RVJ9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVJ9"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ADC61126.1"
FT                   /translation="MSTDLTQELQERVRAALADATPLRLLGNDTKSFIGRAGGGEPLGL
FT                   SGHTGLISYQPTELVVTARCGTTLAELKAALAEQGQMLPFEPPHFAGPDGQGATLGGTI
FT                   ACGLSGPARPYWGAARDLVLGARVLTGRGEVLRFGGEVMKNVAGYDVSRLMVGALGTLG
FT                   ILLDVSLKVLPIPAATRTRALSCNEGEALERMTRWGARPWPLSATCFDGERLWVRLSGT
FT                   AQGVAEAAEQIGGEPVADDEAEVFWQRLREQEFAFFSQGESPLWRLSLPQGAPAVRLEG
FT                   AQWIEWSGSQRWLRSEASESTIRAEAERLGGQATCFRGGDRTGEVFHPLPEPLMQLHRR
FT                   VKSAFDPHGLLNPGRLYANL"
FT   gene            166438..167664
FT                   /locus_tag="Alvin_0158"
FT   CDS_pept        166438..167664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0158"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: mca:MCA1499
FT                   glycolate oxidase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61127"
FT                   /db_xref="GOA:D3RVK0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK0"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADC61127.1"
FT                   /translation="MQTEILPEFLRTPEGREADAILRACVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYQIKLVLEGQTPTRVTQTHLDRCLTCRACETTCPSGVRYARLVDIGRHIVEA
FT                   RVDRLWSQRWLRRLLVAVVPYPRRLAPLVRLGRLLRPLLPATLRAKVPQYQPAGHWPKP
FT                   AGRRRMLALAGCVQSVAMPRTNAAAARLLACLGIDLVEVAEAGCCGAVAYHLDDREAGL
FT                   AAMRRNIDAWWPEIESGAEAILVNASGCGAMVKEYGDLLAHDPNYAERAARIAALARDP
FT                   VEVLGAEDLAALGTPGAGRRVAFHAPCSLQHGQQLKRVVEPILERLGFVVTAVPDAHLC
FT                   CGSAGTYSITQPELSTRLRDNKVAALESDAPGIIATANIGCQLHLAGGARMPVVHWLEL
FT                   LDEAAASRT"
FT   gene            complement(167704..168051)
FT                   /locus_tag="Alvin_0159"
FT   CDS_pept        complement(167704..168051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gem:GM21_0437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61128"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61128.1"
FT                   /translation="MHTSLPAIARPTLLAAALPLLALTWQPAMGASECKGLAQDACMTH
FT                   ENCRWMDGYTRKDGIQVSSHCRLSKPRQKDAAEIQAKAETVTAEAKPETVKAEPKPETA
FT                   TPDTPAETASN"
FT   sig_peptide     complement(167959..168051)
FT                   /locus_tag="Alvin_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.851 at
FT                   residue 31"
FT   gene            complement(168335..168946)
FT                   /locus_tag="Alvin_0160"
FT   CDS_pept        complement(168335..168946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0160"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="TIGRFAM: dephospho-CoA kinase; KEGG: eba:ebA4105
FT                   dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61129"
FT                   /db_xref="GOA:D3RVK2"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK2"
FT                   /inference="protein motif:TFAM:TIGR00152"
FT                   /protein_id="ADC61129.1"
FT                   /translation="MSAVGLVVALTGGIGSGKTTVADRLAELGAGVIDTDEISRALTAH
FT                   DGAALEPITAAFGPDIRLADGTLDRARLRRIVFSDPTARARLESILHPLIEAAMLERLA
FT                   ALETDYAVLVIPLLFETGQDRHADRVLVVDVPEAVQIARVMQRSGLSESEVRRIIDSQI
FT                   PRRERNTRADDLIDNSGTCVDLEPRLQELHAIYTRIAARR"
FT   gene            complement(168943..169833)
FT                   /locus_tag="Alvin_0161"
FT   CDS_pept        complement(168943..169833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0161"
FT                   /product="Prepilin peptidase"
FT                   /EC_number="3.4.23.43"
FT                   /note="PFAM: peptidase A24A domain protein; peptidase A24A
FT                   prepilin type IV; KEGG: tgr:Tgr7_0785 type IV pilus
FT                   prepilin peptidase PilD"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61130"
FT                   /db_xref="GOA:D3RVK3"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK3"
FT                   /inference="protein motif:PRIAM:3.4.23.43"
FT                   /protein_id="ADC61130.1"
FT                   /translation="MSTPAWLELLQTNLWLLYTSAVLLGLIFGSFLNVVILRLPRMMEA
FT                   GWRRDCAELLSPDGTAPETDEPPLSLSKPASTCPSCGHRLRVHENIPILSYVWLRGRCS
FT                   KCKTRISLRYPLVEALTALLTLIVVIQFGPTWQAAAALLLTWSLIALAVIDLDTQLLPD
FT                   SLTLPVLWLGLFLSLFGLFTDSQSAIIGAVAGYLSLWTVFQLFRLATGKEGMGYGDFKL
FT                   LALFGAWLGWPALPQIILLSALVGALVGVGLILSGRHESGKPLPFGPYLAAAGWISLIW
FT                   GEAINGAYLRLSGLA"
FT   gene            complement(169860..171110)
FT                   /locus_tag="Alvin_0162"
FT   CDS_pept        complement(169860..171110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0162"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   mca:MCA2095 type IV pilin biogenesis protein PilC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61131"
FT                   /db_xref="GOA:D3RVK4"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK4"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADC61131.1"
FT                   /translation="MALVTTTKAKPKPKTEEAKVFTWEGTDRRGARVKGESRAANTNAV
FT                   RADLRRQGVNPTRVKAKPKPLFGGGRKKITGQDLSIFTRQLATMMSAGVPLVQAFDIVG
FT                   RGHENPAMQDIILAIKQDIESGTAMSIAMAKHPLHFDDLVCSLVAAGEQAGVLDVLLDK
FT                   IATYKEKTESIKGKIKKALFYPAAVIVVAVIVTVVILLFVIPQFKELFSSFGADLPAFT
FT                   LMVIGLSDLIREWWWAFFGGLGALVYTIAYVFKRSRAFREIVDRASLKIPIIGAILNKA
FT                   AIARFARTLSTMFAAGVPLVEALQSVSGATGNVVYQDAVMKMREEVATGQSLQLAMRQR
FT                   NLFPHMVIQMTAIGEESGALDDMLGKVADFYEEQVDNAVDSLSSLLEPMIMVVIGGLVG
FT                   SLVVAMYLPIFKLAAVV"
FT   gene            complement(171133..172848)
FT                   /locus_tag="Alvin_0163"
FT   CDS_pept        complement(171133..172848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0163"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="KEGG: mca:MCA2096 type IV pilus assembly protein
FT                   PilB; TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II protein E domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61132"
FT                   /db_xref="GOA:D3RVK5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK5"
FT                   /inference="protein motif:TFAM:TIGR02538"
FT                   /protein_id="ADC61132.1"
FT                   /translation="MSKDQAMLKPSGLAWRLVKDQLISESQMQAAYQEARSKGRTFVQH
FT                   LVEEKILDSRRIAIVAAQEFGVPLLDLESFDVSNLPPNLVDERLISKHRALPLLRRGNR
FT                   LFLALSDPTSDQALEEIRFHTGLATDPILVEDSKLGAAIQKTIQAQDTSTISEFADADL
FT                   EKLEIEGGEEDDTENLDATIDEAPVVRYVNKILVDAITAGASDIHFEPFEKFFRIRFRQ
FT                   DGLLREVANPPLNIANRLTSRLKVMSRMNIAERRVPQDGRIKLKLSRNRDIDFRVNTLP
FT                   TIYGEKIVLRILDSSSAQVGIDALGFEPEQRNNFLKAIKKPYGMILVTGPTGSGKTVSL
FT                   YTALNILNDPEINISTVEDPVEIQVPGINQVNLNPKSGLTFAAALRAFLRQDPDIIMVG
FT                   EIRDLETAEIAVKAAQTGHLVLSTLHTNDAPQTLTRLANMGVPPFNIASSVLLIMAQRL
FT                   ARRLCMHCREKVNLPRAALLDEGFTEQEIDAGLTIYGPVGCDKCNKGYRGRVGIFQVMP
FT                   ISEETSRLILEGGNAMQLAEQARREGIADLRASGLRKVKAGVTSLEEVNRVTTD"
FT   gene            complement(172875..173708)
FT                   /locus_tag="Alvin_0164"
FT   CDS_pept        complement(172875..173708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0164"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   afr:AFE_0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61133"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK6"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ADC61133.1"
FT                   /translation="MSSSFRVGVFVDAENVRYNGGYQMRYDILRRFAAREGGVLQRLNT
FT                   YMAYDAERAREDYEYKKKAHAYQQMVRDFGWKITAKTVRRYTDDNGNVTTKANADLDMA
FT                   VDAMLQANRLDQVLLVTGDGDFLQVVEALQNTGCRVELIGFKNVSRLLQQRVDAFYSGF
FT                   VIPDLLPVHYEPRNEWGKPGSCVRGVCTKWFPDKGYGFLRVMNQISPNLWITDPREPDS
FT                   PYISVFCHANEVADEVTEDLLMNRETVLEFYVNESEQKDNGLVANNVRLAFSVNR"
FT   gene            complement(173927..175873)
FT                   /locus_tag="Alvin_0165"
FT   CDS_pept        complement(173927..175873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0165"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: tgr:Tgr7_1019 acetate--CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61134"
FT                   /db_xref="GOA:D3RVK7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK7"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ADC61134.1"
FT                   /translation="MSEEKVYPVPAAIAAKAHINAEQYAAMYQRSIDDPAGFWAEQAEQ
FT                   FVTWSRKWDSVMDYSYQADDLHINWFQGGKLNVSYNCLDRHLATRGDQVAIIWEGDDPN
FT                   VDRKITYRELHEEVCRLANVLKSRGVQKGDRVCIYLPMIPEAAVAMLACTRIGAVHSIV
FT                   FGGFSPDSLRDRVLDSECKLVITSDESVRGGRHVPLKKNADIAMRECPNVDTVLVVRRT
FT                   GGNVDWVEGRDVWYHEAVAAAATECAPEEMDAEDPLFILYTSGSTGKPKGALHTTGGYL
FT                   VYAAMTHKYTFDYQDGEIYWCTADVGWVTGHTYIVYGPLANGATSVMFEGIPNYPDMSR
FT                   FWDVVDKHNVSIFYTAPTAIRSLMRAGEEPVKKTSRQSLRILGSVGEPINPEAWEWYHN
FT                   VVGDGRCPIVDTWWQTETGGHLITPLPGATALKPGSATRPFFGVVPALVDPSTGVRIEG
FT                   AAEGALVICQPWPGQMRTVYGDHQRYVDTYFKQYPGYYFTGDGARRDADGYYWITGRID
FT                   DVLNVSGHRLGTAEIESALVLHPHVAEAAVVGYPHDLKGQGIYAYVTPMAGVEPTDELK
FT                   KELVSLVRGEIGPIAIVDIIQWAPGLPKTRSGKIMRRILRKIAANEIDSLGDTSTLADP
FT                   TVVEDLIENRAVK"
FT   gene            complement(176028..176705)
FT                   /locus_tag="Alvin_0166"
FT   CDS_pept        complement(176028..176705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0166"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: mgm:Mmc1_1044 exonuclease, RNase
FT                   T and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61135"
FT                   /db_xref="GOA:D3RVK8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK8"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ADC61135.1"
FT                   /translation="MPILTDWGRRWRHRRAPPGPLRDYLAQPLPSPRADYREVEYLAID
FT                   LETTGLDQRQDLILSVGYVVLHGPEIDLSTARHHLVRIDRSIPEASAVIHQITDDQAAT
FT                   GRELEDVLGEVLAALTGRVMIAHHAGIEQGFLSQACQRCWGRGLPLRLVDTQTLAHRTL
FT                   ERRQIPFKASDLRLHALTSRYNLPRHGAHNALSDALSAAELFLAQAAYRDDGRRLRLSE
FT                   FLC"
FT   gene            complement(176725..178590)
FT                   /locus_tag="Alvin_0167"
FT   CDS_pept        complement(176725..178590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0167"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: protein of unknown function DUF294
FT                   nucleotidyltransferase putative; CBS domain containing
FT                   protein; Domain of unknown function DUF294, putative
FT                   nucleotidyltransferase substrate-binding; SMART: CBS domain
FT                   containing protein; cyclic nucleotide-binding; KEGG:
FT                   cps:CPS_4954 CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61136"
FT                   /db_xref="GOA:D3RVK9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVK9"
FT                   /inference="protein motif:PFAM:PF03445"
FT                   /protein_id="ADC61136.1"
FT                   /translation="MDVELIEIQEFLASHPPFDQLPEETLARLPRRLSVRYFRRGTPFP
FT                   PEAADSPCLYILRRGAVELRNTRGELVGKLAEGDLCEQHCRISEDEPRFQGNTAEDTLV
FT                   YALPCADLTELRAAHPAFAEHFEQSTSRRLRKALDVVTESPSSGTGLMTVQVRDMVQRA
FT                   PIATRPETSIRDAARIMSEHHVSSLLIMDGEHLAGMITDRDLRNRCVAAGLATDQPVRA
FT                   IMTEKLTTVDMDTLGFQALIAMTRLNVHHLPVVENGRVVGLISSTDFTRFQSANSIYLV
FT                   GDIHRADSIETLAQIGAKIAELQVHLILGGATATQVGQAISAITDAITLRLIELAEADL
FT                   GAPPVPYAWLLGGSQARREQSAHSDQDNALLISDEAKPEDDAYFAALARFVNDGLHACG
FT                   CVYCPGDVMASNPKWRQTLRIWNKYFSNWILKPEPMALMLSNVFFDMRSLRDPNGLCEE
FT                   LHERIIEKSRANRIFIAYMAANALKNRPPLGFFRNIVLIQGGDHDHTLDIKHRGLIPII
FT                   DLARVYALSAGIMENNTNERLQTAAERGALSRDGAANLIDALELIATLRMRHQAQQLRN
FT                   GEKPDNFLAPDALSPLERGHLKEAFVLINTMQESLGQRYQTGRFA"
FT   gene            178753..179334
FT                   /locus_tag="Alvin_0168"
FT   CDS_pept        178753..179334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0168"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pae:PA0649 anthranilate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61137"
FT                   /db_xref="GOA:D3RVL0"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL0"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ADC61137.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFGELGAEVKVVRNDELTVEEAVALAPE
FT                   RVVISPGPCTPHEAGISVALIERLAGAVPILGVCLGHQSIGQAFGGRIVKAPEVMHGKT
FT                   SPVYHSDQGVFNTLPNPFGATRYHSLVIEPETLPDCLEVTAWTQNPDGTRECIMGVRHR
FT                   TLPIQGVQFHPESILTEQGHRLLQNFLEDR"
FT   gene            179336..180358
FT                   /locus_tag="Alvin_0169"
FT   CDS_pept        179336..180358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0169"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="KEGG: tgr:Tgr7_2799 anthranilate
FT                   phosphoribosyltransferase; TIGRFAM: anthranilate
FT                   phosphoribosyltransferase; PFAM: glycosyl transferase
FT                   family 3; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61138"
FT                   /db_xref="GOA:D3RVL1"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL1"
FT                   /inference="protein motif:TFAM:TIGR01245"
FT                   /protein_id="ADC61138.1"
FT                   /translation="MELKDAITRCIERRDLSGDEMSAVMRRIMTGGATPAQIAGFLIAL
FT                   HMKGESVTEIAAAAAVMRELATGVDLCGLDHTVDIVGTGGDCSGTFNVSTTSMFVAAAA
FT                   GCHVAKHGNRSVSSKSGAADVLEAAGLRLDLTAEQVARCVREVGVGFMFAPGHHSAMKH
FT                   AVVPRRELGVRTIFNVLGPLTNPARVPNQVLGVFSAELLEPLALVLQRLGSRHVLVVHA
FT                   RDGLDEISIADSTDVAELRDGEVRVYSLRPEDFGLQRAPLEAIRVSGPAESLALLLSVL
FT                   AGEPGPARDIVRLNAGAAIYAAGRAGSLAEGVTVAAQVIDSGEAQRRLERLVALTKRFD
FT                   "
FT   gene            180384..181181
FT                   /locus_tag="Alvin_0170"
FT   CDS_pept        180384..181181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0170"
FT                   /product="Indole-3-glycerol-phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   sml:Smlt4309 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61139"
FT                   /db_xref="GOA:D3RVL2"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL2"
FT                   /inference="protein motif:PRIAM:4.1.1.48"
FT                   /protein_id="ADC61139.1"
FT                   /translation="MTDTPDILKKIVQRKIEEISERRIRRSDADLSAALADVGPVRGFA
FT                   AALQTRVAAGEPAVIAEVKKASPSKGVLRADFHPAEIAAGYERGGAACLSVLTDVDFFQ
FT                   GADAYLQEARAACALPVIRKDFIVDPYQVREARLIGADAILLIAACLSDAQLSELNALA
FT                   HELGLDVLVEVHDAEELERALAVPGRLIGINNRNLRTFEVTLETTLGLLEAIPEDRLLV
FT                   TESGILTGEDVARMRGRGVHAFLVGEAFMRAPDPGVELARLFF"
FT   gene            complement(181178..181834)
FT                   /locus_tag="Alvin_0171"
FT   CDS_pept        complement(181178..181834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0171"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; cyclic
FT                   nucleotide-binding; KEGG: abo:ABO_2023 cAMP-regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61140"
FT                   /db_xref="GOA:D3RVL3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL3"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADC61140.1"
FT                   /translation="MSTQRALKEEPKWLKPFLAQCHTKSYDKNVDFIRQGQAAESLYYL
FT                   IEGSVAALMFDEDERRELMLAYINKGEFIGEMGLFVPQNTRSVIVRTRTRCKVAEITYQ
FT                   RLDRLLEEELAEVAKELLYSLGAQLSMRLQMTSRKVGHLAFLDVTGRIAGTLLDLCKQP
FT                   DAMTHPDGMQIRVTRQELGRIVGCSREMAGRVIKNLEEQGLVSVKGKTIVVYGAR"
FT   gene            181980..182399
FT                   /locus_tag="Alvin_0172"
FT   CDS_pept        181980..182399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0172"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: tgr:Tgr7_2796
FT                   OsmC/Ohr family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61141"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL4"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADC61141.1"
FT                   /translation="MKARVKWIDGVAMLGESGSGHGVVMDGPPELGGRNVGVRPMEMLL
FT                   LGLGGCTQFDVLLILRKGRQDVTDCVVELEAERAEQDPKVFTRIHVHFVITGRGLDPRR
FT                   VEQAIRLSAEKYCSASIMLGATATVTHDFEIREAP"
FT   gene            complement(182409..183071)
FT                   /locus_tag="Alvin_0173"
FT   CDS_pept        complement(182409..183071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0173"
FT                   /product="putative ubiquinone biosynthesis protein"
FT                   /note="KEGG: noc:Noc_0938 putative ubiquinone biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61142"
FT                   /db_xref="GOA:D3RVL5"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL5"
FT                   /inference="similar to AA sequence:KEGG:Noc_0938"
FT                   /protein_id="ADC61142.1"
FT                   /translation="MTNSQHTDSRRYTLLDHLLINTDQALRTVFGRPRLTERRNPAADL
FT                   MEADLRADQRRHVARLMRINHTGEVCAQALYQGQALTAKLPETRQRLERSAKEENDHLA
FT                   WCEERLDELGDRKSLLNPVWYAGSFALGALAGLAGDKWSLGFVVETERQVEDHLDDHLA
FT                   QIPAHDEKSRAILERMKADEIHHAQVAKSAGGADLPAPIRQAMKLTSRVMTRTAYWV"
FT   gene            complement(183090..184334)
FT                   /locus_tag="Alvin_0174"
FT   CDS_pept        complement(183090..184334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0174"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: net:Neut_0446
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61143"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL6"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADC61143.1"
FT                   /translation="MNTPVTLSSARSAPRLSNQDLLRLADQCVKCGLCLPHCPTYAKTR
FT                   HEADSPRGRIALVQGWLTGQLDMTPGLAAHLDGCLLCRACESACPSLVAYGRLLDGARA
FT                   RHVAMTPTWRRFWTGHRLGALSNARFMDALGRLASVYVGTGLARLVEIARLIRLRAIAP
FT                   RHRLLRALAVTARPVAAQPLDDADLDLFVGCSGASAQGGAIAATRLVCERLGLRVRIAS
FT                   EAVCCGAMQRHNGFPEAADRAREQCAQVHGGRPLVGASSACIAELREHPALTQAQEVCD
FT                   YLDRRTWPDALVLTPLARRVLVHEPCSHRRLLGGNAAVHRLLARIPGLEVAPLPDNDRC
FT                   CGAAGTYLLQQPEMAAALLDDKLIHIRDLKPDIIVTTNPGCALHLLAGVRESGLAIEVC
FT                   HPVELIARQLPSMST"
FT   gene            184516..184845
FT                   /locus_tag="Alvin_0175"
FT   CDS_pept        184516..184845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0175"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /note="KEGG: tgr:Tgr7_2790 ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61144"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL7"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2790"
FT                   /protein_id="ADC61144.1"
FT                   /translation="MARYSHHIFFCTNRREDGRQCCAQSNASNMRDYLKRRAKDEGLSG
FT                   PSGVRVNTAGCLGRCVDGPTIVVYPDAVWYTYADEQDLEEILSEHLKGGRVVERLRLPD
FT                   SGTAT"
FT   gene            185019..185456
FT                   /locus_tag="Alvin_0176"
FT   CDS_pept        185019..185456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0176"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: tgr:Tgr7_2789 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61145"
FT                   /db_xref="GOA:D3RVL8"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL8"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADC61145.1"
FT                   /translation="MTTTVSAKPAEVRRAWYLIDAEGKTLGRLASELARRLRGKHKPQY
FT                   TPHVDTGDYMVVINAEKIRVTGNKLQDKMYYHHTGYVGNLKSTNLEKLLQSAPERAIQI
FT                   AVKGMLPRGPLGRAMFKKLRVYAGPNHEHQAQQPQVLELNV"
FT   gene            185468..185857
FT                   /locus_tag="Alvin_0177"
FT   CDS_pept        185468..185857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0177"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: noc:Noc_2837
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61146"
FT                   /db_xref="GOA:D3RVL9"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVL9"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADC61146.1"
FT                   /translation="MSETQLATGRRKTSAARVFLSLGSGNITVNNRPLDEYFGRETARM
FT                   VVRQPLETAGLADRVDVKITVRGGGNTGQAGAIRHGIARALVDYNEELRSPMRRAGFLT
FT                   RDAREVERKKVGLHKARKRPQYSKR"
FT   gene            185878..185951
FT                   /locus_tag="Alvin_R0007"
FT                   /note="tRNA-Gln1"
FT   tRNA            185878..185951
FT                   /locus_tag="Alvin_R0007"
FT                   /product="tRNA-Gln"
FT   gene            186126..188900
FT                   /locus_tag="Alvin_0178"
FT   CDS_pept        186126..188900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0178"
FT                   /product="putative DNA methylase"
FT                   /note="KEGG: ajs:Ajs_2530 putative DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61147"
FT                   /db_xref="GOA:D3RVM0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM0"
FT                   /inference="similar to AA sequence:KEGG:Ajs_2530"
FT                   /protein_id="ADC61147.1"
FT                   /translation="MNAVEIEQAITDLAEQPFDAANFPYDFLEAFGNKATTIKRLRAGA
FT                   SNKSDLGGVLQTNNIHILTCDAGQVSKALKALKDSPATTKAKAKFILATDGTDFEAEDL
FT                   TSGETVACAFRDFPDHFGFFLPLAGISTVRQITENAFDIRATSRLNRLYVELLKDNPEW
FT                   GTDERRHDMNHFMARLIFCFFAEDTGIFGGKGKFTETVAQMSARDSSNTHEVISTLFLA
FT                   MNTRREQRAVANLPRWASSDVFPYVNGGLFSGSMEVPKFSKIARSYLLHVGGLDWTKIN
FT                   PDIFGSMIQAVADDEERGALGMHYTSVPNILKVLNPLFLDDLRAKLEEAGDNPRMLLNL
FT                   RKRMAKIRVFDPACGSGNFLVIAYKEMRAIEAEINKRRGEPDMRSAIPLTNFRGIELRD
FT                   FPAEIARLALIIAEYQCDVLYRGQKLALADFLPLSNENWITCGNALRLDWLSLYPPTGT
FT                   GVKLQGDDLFGTPLDQTEIDFENAGGETYICGNPPYKGSQEQTPSQKTDLDTAFRGRIK
FT                   STKSADYVAGWFILARDYIAKSDAACAFVTTNSINQGRQVSLIWPTILTDDIEIRFARP
FT                   SFPWSNLASKKAVVTVSIVGLGRRSNRPKLVFTQNTVKEAKYIGPYLVPDQSAIVLPST
FT                   SSLSPLSEMTYGSMPNDNGGLILSSDDAHSLVETYPQAQRFVKRLLGSNGTIHGQWRYC
FT                   LWISTADLDAALAIEPIRKRIEIVKNHRARSTRVTTKALAATPHLFGEVRHSDSQALAV
FT                   PCHSAEGRPYLPFALVDGDTVIDNSAIRLSEPRMYEVALYASRLHIIWIATVCGQLETR
FT                   YRYSNTLGWNTFPVPTLTEKNKDDLTRCAENILLAREHHFPATIADLYDPDKMPDDLRA
FT                   AHDRNDEVLERIYIGRRFKNDTERLEKLFDLYTKMTASTAPSKGKKRTARTRA"
FT   gene            188897..190954
FT                   /locus_tag="Alvin_0179"
FT   CDS_pept        188897..190954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0179"
FT                   /product="DEAD-like helicase"
FT                   /note="SMART: DEAD-like helicase; KEGG: ajs:Ajs_2529
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61148"
FT                   /db_xref="GOA:D3RVM1"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM1"
FT                   /inference="protein motif:SMART:SM00487"
FT                   /protein_id="ADC61148.1"
FT                   /translation="MSDTIKAVPSISVTYARKGVSTKANALGMRPMQERAYEKRGEQYL
FT                   LIKSPPASGKSRALMFIALDKLHNQGLKQAIIVVPEKTIGASFNDAPLSQFGFWSDWQV
FT                   EPKWNLCNAPGNDNGGKVKSLGAFLESDDRVLVCTHATFRFAVDAYGVKAFDNRLIAVD
FT                   EFHHVSANPDNKLGLHLGQFIARDKTHIVAMTGSYFRGDAEAVLPPTDEAKFDTVTYTY
FT                   YEQLNGYDYLKQLDIGYFFYSGSYVDDILNVLDPNEKTIIHIPNVNSRESTKDKMREVE
FT                   HIIEALGEWQGIDIATGFQLVKQPNGRVLKIADLVDDEATKRDRVSTALKDPAQKDNRD
FT                   HVDIIIALGMAKEGFDWIWCEHALTVGYRASLTEIVQIIGRATRDAPGKTRARFTNLIA
FT                   EPDASEKAVTEAVNDTLKAIAASLLMEQVLAPRFEFKPKNPDTGPTPGFDYGEGGYDPS
FT                   RCNVGVNEQTGAYQIEIKGLAEPKSQEAVRICQEDLNEVIATFIQDKTTIERGLFDEEL
FT                   VPEELTQVRLGKIIKDKYPELDTEDQEAVRQHAIAALTLTQQAKQRVIGGESDEAKPNT
FT                   ALINGVRRFAMDVRDLDIDLIDRINPFGEAYAILAKTMSEDSLKQVAAAISAKRANLTP
FT                   EEAKELAIRAVQFKKERGRVPALDSQDAWERRMAEGAAAFMRYKKEGRYE"
FT   gene            190947..192164
FT                   /locus_tag="Alvin_0180"
FT   CDS_pept        190947..192164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0180"
FT                   /product="Putative helicase"
FT                   /note="PFAM: Putative helicase A859L; KEGG: pau:PA14_15600
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61149"
FT                   /db_xref="GOA:D3RVM2"
FT                   /db_xref="InterPro:IPR018306"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM2"
FT                   /inference="protein motif:PFAM:PF10544"
FT                   /protein_id="ADC61149.1"
FT                   /translation="MSEFDLDELAEELSEFAAPETKNGRSPREERVIAGFEEIQRFVEK
FT                   QGRVPQHGEERDIFERLYAVRLDRLRALPDCRAVLEPLDHQGLLAGAPTIAEPSPDYDV
FT                   DQLADELADMDGTEDITVLRHVRTSAEKRAAEEIANRKTCTDFEMFKPLFERVQADLKT
FT                   GLRQSQPIEAGNRAIEAGDFFILDGVTLYVAEVGEPLKTTAGEVDCRLRLIFANGTESN
FT                   LLLRSLQRAFYDDPAARRLVSPDSGQLSFGGEFEADDVESGTIYVLRSLSDHPYVTQHR
FT                   DLIHKIGVTGGKVETRIAGAEHDATYLLAKVEIAATYKLAGINRTRMENLFHRLFASAR
FT                   LDITINDRFGHPVQPREWFLVPLFAIDEAVERIKDGTITNYVYDPKAAQLVKAAPVGGH
FT                   RGPGLD"
FT   gene            complement(192323..192472)
FT                   /pseudo
FT                   /locus_tag="Alvin_0181"
FT                   /note="hypothetical protein"
FT   gene            complement(192471..192646)
FT                   /pseudo
FT                   /locus_tag="Alvin_0182"
FT                   /note="hypothetical protein"
FT   gene            complement(192723..195560)
FT                   /locus_tag="Alvin_0183"
FT   CDS_pept        complement(192723..195560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0183"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: dar:Daro_0729 PAS; TIGRFAM: PAS sensor
FT                   protein; PFAM: chemotaxis sensory transducer; PAS fold
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; PAS fold-3 domain protein; SMART: chemotaxis
FT                   sensory transducer; PAS domain containing protein; PAC
FT                   repeat-containing protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61150"
FT                   /db_xref="GOA:D3RVM3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADC61150.1"
FT                   /translation="MRMNLPVTATEHVMRDDQLIVSKTDLKGRITSFNRDFADISGFSE
FT                   QELLGAPQNIIRHPDMPPAAFKDMWQTIQSGRPWTGLVKNRCKNGDFYWVEANVSPLRE
FT                   KGRITGYISVRRKPTREQIAEAEVIYARLRAGKPPQPLLRRIASSINDIRIRWALPGGL
FT                   VLISAFFILALNVSLMSLDRAAGQLQHIDDETQILEQAYNGMLGDGLQMAAAMRYLLLE
FT                   PSDKQARNNVEKASQQFARNLDTARRLSADDSEALQVLARIEQERQRHSEIQGRVLVQI
FT                   SAGDLLGAKQTYDTQDNVIWRAYKDLILEATAKVTRKAQAERNAAIAAANLAERQALAF
FT                   SLLALLTAILLGIWLVRKITRPLQKTLGYLEALSNGDYSSRIEITNKDELGEMMLAVKS
FT                   VQARLDFDIQDARRIASENLRIRTGLDNVTLPVTISDDRGQLVYLNAAAQRLWQTMEAG
FT                   VRQRHPGFTVAGMIGTNLATYFEDQAIAEVYRGRLDQTRHFDMVQSRRNLRMTATPIMD
FT                   EDGSYRGRVTQWQDRTAEVTAEHEIAELVQAAANGDFTRRIELQGKDGFFMQLGEGLNR
FT                   LIEIMAQGLADIAAVLNAMAAGDLNRTIEADYSGTFGQVKDDTNTTVARLREVVGRILE
FT                   VSEAISSAAGEIASGNSDLSARTEEQAASLEETASSMEELNATVRQNAQNAEQANQLAQ
FT                   SANTIAARGGDMVQRVVGTMSSIQESSRRIADIISVIDGIAFQTNILALNAAVEAARAG
FT                   EQGRGFAVVAAEVRNLAQRSAQAAKEIKELITDSVSKVEGGAELASQAGSTMSEILDSF
FT                   RQVTTLVDEITGASREQSSGIEQVTKAVAQMDEVTQQNAALVEQAAAAAESLEDQTRVL
FT                   AQAVSIFKLSGAGSTGARTPARTQAQPRSGMTASAAPKMTGTQSKSPVKASDSSLRKRP
FT                   KSIPATDDGEQWEEF"
FT   gene            195719..197647
FT                   /locus_tag="Alvin_0184"
FT   CDS_pept        195719..197647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0184"
FT                   /product="5'-nucleotidase"
FT                   /EC_number="3.1.3.5"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: maq:Maqu_0357 NAD
FT                   pyrophosphatase/5'-nucleotidase NadN"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61151"
FT                   /db_xref="GOA:D3RVM4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM4"
FT                   /inference="protein motif:PRIAM:3.1.3.5"
FT                   /protein_id="ADC61151.1"
FT                   /translation="MVRFAFSTRLAVAMLVGLAFVVSGGHSAAVETGTDAFRLTILHIN
FT                   DHHSHLEPALDARLAFAEPVGAIEVELGGFARVSAKIRELRARYPNSLALHAGDAITGT
FT                   LYYTLFKGEADAAAMNRICFDAYALGNHEFDDGDAGLAGFLRMLDGDPAGCRTPVLAAN
FT                   VVPALGTPLYPRAGERLIQPDVVRTVAGRRIGIIGLDISGKTRRSSRPLDSTVFLDELT
FT                   TAQQRIDALTSQGIDKIILLTHRQYLNDLDMALHLRGVDAIIGGDSHTLLGESFADWGL
FT                   NPSGPYPTETHDPDGNRVCVVQAWQYASVVGELHLSFDAAGHVARCEGTPHLLLGERFA
FT                   RDGQPLDATARQTVLDAIAAAPELGIVEPDPSTQALITRYSEQVGRLKQTIVGIAVQDL
FT                   CLERVPGQGLSALCDARATQAHGGDIQQLVTAAYLARVPEADVAIQNAGGARIDIPAGP
FT                   ISVSDVYSLLPFANTLVALRLTGTEIRAALEEAVAGFMDHADGSGGAYPVAANLRWELD
FT                   LSRPRGQRFSHLEIRRRGAPAWRPLEETDEVVVVTNSFLAGSGDGYETFKRASEDGRAS
FT                   DTFIDYAQGFIDYLQQDLGGAAPGDPILATPPEIRPLPCADYSTQRFVDGQGRLLQPDP
FT                   ANPPACR"
FT   sig_peptide     195719..195808
FT                   /locus_tag="Alvin_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.500 at
FT                   residue 30"
FT   gene            complement(197723..198856)
FT                   /locus_tag="Alvin_0185"
FT   CDS_pept        complement(197723..198856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0185"
FT                   /product="sodium ion-translocating decarboxylase, beta
FT                   subunit"
FT                   /EC_number="4.1.1.112"
FT                   /note="KEGG: mgm:Mmc1_3197 sodium ion-translocating
FT                   decarboxylase, beta subunit; TIGRFAM: sodium
FT                   ion-translocating decarboxylase, beta subunit; PFAM:
FT                   Na+transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61152"
FT                   /db_xref="GOA:D3RVM5"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM5"
FT                   /inference="protein motif:TFAM:TIGR01109"
FT                   /protein_id="ADC61152.1"
FT                   /translation="MDKLETLWLSMGIANMEWGQALMMSVGVLLIYLAIAKKFEPLLLL
FT                   PIGFGAILSNIPVAGIAGPDGLLGMIYSIGIETGVFPLLIFMGVGALTDFSALIARPST
FT                   LLLGAAAQFGIFATLIGAIALNLVPGFDFTLADASAIAIIGGADGPTAIFLASRLAPDL
FT                   LGAIAVAAYSYMALVPIIQPPIMRALTTKEERAVVMQQMRPVSRLERIIFPFVVLILCA
FT                   LLLPSAAPLIGMLTLGNLLREAGVVERLSRAAQNEIINVVTILLGLAVGSKLSAEKFLQ
FT                   TETLGILVLGALAFCIGTAAGVIMGKIMHRVTGGKINPLIGAAGVSAVPMAARVVNKVG
FT                   QETDHHNFLIMHAMGPNVAGVIGSAVAAGVLLALVGN"
FT   gene            complement(198861..200645)
FT                   /locus_tag="Alvin_0186"
FT   CDS_pept        complement(198861..200645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0186"
FT                   /product="oxaloacetate decarboxylase alpha subunit"
FT                   /note="TIGRFAM: oxaloacetate decarboxylase alpha subunit;
FT                   PFAM: Conserved carboxylase region; pyruvate
FT                   carboxyltransferase; biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: mgm:Mmc1_3196 oxaloacetate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61153"
FT                   /db_xref="GOA:D3RVM6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM6"
FT                   /inference="protein motif:TFAM:TIGR01108"
FT                   /protein_id="ADC61153.1"
FT                   /translation="MTQKTPLGITDVILRDAHQSLLATRMRTEDMLPIAAKLDQVGYWS
FT                   VESWGGATFDACIRYLGEDPWDRLRQLKAAMPRTPQQMLLRGQNLLGYRHYADDVVEKF
FT                   VERAALNGIGVFRIFDAMNDLRNLERAVHAALATDAHAQGTLSYTVSPVHNIDYWVDMG
FT                   RRLEDMGCHSICIKDMAGLLRPYVAEELVTRLKATCAIPIAMQCHATTGLSTAAIVKAA
FT                   EAGIDMVDTAISSMSMTYGHSPTESVVAIMQGTERDTGLDLNLLEEIAAYFREVRKKYA
FT                   RFEGSLKGVDSRILVAQVPGGMLTNMENQLREQGAADRLDEVLAEIPRVREELGFLPLV
FT                   TPTSQIVGSQAVLNVLMGERYKTITTETAGVLRGEYGATPAPVDQDLQSRVLQPGEEPI
FT                   TCRPADNLTAELDRLTEELEAIARERTLKLVDPVIDDVLIYAMFPQVGLKFIENRDNPA
FT                   AFEPRPWEIEDAPAGPAATTTVASGPEHYRIEVNGRAYDVTVSPQGTLEAVVPAGTAPV
FT                   SAAVPVQAQTVASPLAGTIVKVPVAVGQTVNAGDVVVILEAMKMETEVRAPAAGRVTDI
FT                   RVKEGEAVALGAPLIALG"
FT   gene            complement(200754..201002)
FT                   /locus_tag="Alvin_0187"
FT   CDS_pept        complement(200754..201002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0187"
FT                   /product="sodium pump decarboxylase, gamma subunit"
FT                   /note="TIGRFAM: sodium pump decarboxylase, gamma subunit;
FT                   PFAM: sodium pump decarboxylase gamma subunit; KEGG:
FT                   csa:Csal_0692 sodium pump decarboxylase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61154"
FT                   /db_xref="GOA:D3RVM7"
FT                   /db_xref="InterPro:IPR005899"
FT                   /db_xref="InterPro:IPR023424"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM7"
FT                   /inference="protein motif:TFAM:TIGR01195"
FT                   /protein_id="ADC61154.1"
FT                   /translation="MNDGALLFESFMLMLIGMGIVFSFLLLLVGILRLMSALILRLAPA
FT                   EEPPAVPSPAAAPLPADTSEDLIAVITAAIARYRAPR"
FT   gene            complement(201114..201281)
FT                   /locus_tag="Alvin_0188"
FT   CDS_pept        complement(201114..201281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0188"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: tau:Tola_0181 ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61155"
FT                   /db_xref="GOA:D3RVM8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM8"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ADC61155.1"
FT                   /translation="MAKAAREKIRLNSSAGTGHFYTTTKNKRNQPGKMEIKKFDPVARQ
FT                   HVMYKEGKIK"
FT   gene            complement(201297..201533)
FT                   /locus_tag="Alvin_0189"
FT   CDS_pept        complement(201297..201533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0189"
FT                   /product="ribosomal protein L28"
FT                   /note="TIGRFAM: ribosomal protein L28; PFAM: ribosomal
FT                   protein L28; KEGG: tgr:Tgr7_0325 ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61156"
FT                   /db_xref="GOA:D3RVM9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVM9"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ADC61156.1"
FT                   /translation="MSKVCQVTGKRPLTGNNVSHANNKTKRRFLPNLHEKRFWVEAEKR
FT                   WVKLRLTTKAMRTIDKKGIDAVLVDLRADGVKV"
FT   gene            201698..202090
FT                   /locus_tag="Alvin_0190"
FT   CDS_pept        201698..202090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0190"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   bcl:ABC3922 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61157"
FT                   /db_xref="GOA:D3RVN0"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN0"
FT                   /inference="protein motif:PFAM:PF04241"
FT                   /protein_id="ADC61157.1"
FT                   /translation="MPPASIWMTLGAVGGLLTVALGAFGAHGLKGRVDPALLANWQTAA
FT                   NYLGLHALAILACGLALLHRPESSLLHWSALAFAVGVCLFSGSLFVMTLTGLRQLGMIT
FT                   PIGGVILVLAWALLAVGAARLAGPSA"
FT   sig_peptide     201698..201775
FT                   /locus_tag="Alvin_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.619 at
FT                   residue 26"
FT   gene            202113..202859
FT                   /locus_tag="Alvin_0191"
FT   CDS_pept        202113..202859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0191"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   tgr:Tgr7_2898 protein of unknown function DUF558"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61158"
FT                   /db_xref="GOA:D3RVN1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN1"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ADC61158.1"
FT                   /translation="MRLTRLHVDLDLRPGAEIDLPSAQARHAVQVLRLERDAPLVLFNG
FT                   DGHDYSACLVEPGRDRVRVLVESRGDPELESRLDIHLALGISKGERMDFAIQKAVELGV
FT                   TRITPLFTRRAQVRLDGARLDKRLEHWQGVVVAACEQSGRRRLPTLEPAGGLEAWLETA
FT                   HGDGFAGGLLLDPLAERALPALPAPESGLTLLIGPEGGLDPREREAARRHGFQGVRLGP
FT                   RILRTETAPLAAIAVIQALWGDFRDP"
FT   gene            complement(202876..208524)
FT                   /locus_tag="Alvin_0192"
FT   CDS_pept        complement(202876..208524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0192"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; CheW domain protein; Hpt
FT                   domain protein; SMART: response regulator receiver; CheW
FT                   domain protein; Hpt domain protein; ATP-binding region
FT                   ATPase domain protein; KEGG: tgr:Tgr7_2900 putative CheA
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61159"
FT                   /db_xref="GOA:D3RVN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61159.1"
FT                   /translation="MADKQLIGGLKWVKGEIGATLRPVRDLIEAGADFDVETELDSVLK
FT                   ALSQIQGVLLALRLTTPARLVEEMHRLAECLEETEPEHYPEATVVLGQALDQLANHLDR
FT                   LDAGFEEPPLSLWSIINALRSARDQLPLTRSELLRFAISDQDGRSQWIPEELDILAEVI
FT                   RQVRPQFHRHLVGWYRNDTEALIQLGRIFHQLHDYLKDGTLTDLFGLAELFTAALQDGR
FT                   LESSPHARTLMGHMDWALKPLTQRPPVWPEVDARALIEQLLDILIAAGIEDDALTEARM
FT                   NYGPAPAVPIEAETQATLEAEAALAGLAGELVTELTDLKATFDRLTLAEHTDQDLIQGF
FT                   SDRLRRLATRLDEVEVGNLPARLRALADRFQTLDATDLKGQAARLESYAMELLGIESVL
FT                   LALADRRDAGAERLIAPDMDLSDLTAATLREAGYELSRVKEAIADWQSDPESREILSPI
FT                   EGYLTGVSGALRILGESPAADLAELVASLVQTAYVRHQRLPTDTQIDHLADAIAGLELY
FT                   IGHLQQPMPLGETLIDRAGRGISALQAELGALGEPPLASRALEADATPEPELELPSEPE
FT                   SESAHPADELDLESDDGETEFLDIFLEEAREEIDSARTQLARWQSDPSDADALATLRRS
FT                   FHTLKGSGRLVGALQVGDFAQAIEFLLNRLIETASSPSTEILDCIAEAVRVLPELVESE
FT                   AEGHPFDIEPHVVRATRLREGIGAESPSEPQPSVERQPEESPAEAASPVAEVGTSAPVE
FT                   ESLDHDSLFAADSELLDIFHTETLEHLSVVRAFLEGDESGGERPLYESIERALHTLTGS
FT                   ARMSGIESIARVTKAMELCIKPRRTSGEPLSEPLVTLFRRAAEAIEQRVEELPESGAGA
FT                   AALAALWSELNSPALQTPEPEHGSAVEVEPPEPGTPDLAPLELELDVAFEDEDSPESFA
FT                   AIDEHAPESFVELEEPLQLDAPIAAEASELELTLEAEPSPAEALPIADIEAALEPESEL
FT                   ESEPEPTPEPELEPEIELEPEIELEPLPELEPETARTDVLEAMREEPEPDRDSTGIDIE
FT                   ETDSAHTETPQPPAPVVEQPPKSEPERELEVMPEPAPAEIQAAPDPELAALFLEDARDL
FT                   LDKLDRQFRDWLLAPQDSAALAGVNRLLHTLKGSARLTGLPAIGDLSHALETRLKALDE
FT                   DQTGINDLTLELAQRAVDMLSLQVDALEQGAAIPRMAELVTELSRAPHGEPTTEAATPE
FT                   VALMRPAETAEPGAPAPMDHPLPTPAAAPAEAAPREGAGAIAAVPQIRVRSDLLNRLVN
FT                   HAGEISIYRGRLTQRNGQLGFGLGELDQTVVRLREQLRQLEIETQAQILNRFERSGESS
FT                   ERAETASDYDAEFDPLEFDRFSRLQQLSGSLAETVNDLISVKEMLAGYQREMTDLLTQQ
FT                   ARLADDLQDGLLRTRLVPFVQVVPRLHRLVRQTADSLGKSARLEVIGPEVELDRTILDR
FT                   LVAPLEHLLRNAVDHGLEDTKTRVARGKPATGMVTLALRREGNDAVISLGDDGKGLDLE
FT                   AIRKQAIARGLMTAESKLPDEAILQFIMEPGFTTSGKVTQISGRGVGLDVVASEIKAAN
FT                   GTMNLESVPGKGARFTIRLPLTLAIIDAFLVSVGDTVYAVPHSTVEGLARINREELLAI
FT                   YADPSKTYTARGHRYRVAYLGQALEANGPEPELGERRWLPVLLARIGDQRVALQADTLL
FT                   ESQRILVKPLGPQLTGVRWLSGGTILPDGRVALILDALALVRSGAIREQAPVLIAPEPA
FT                   SESVCVMVVDDSLTVRRVTSRLLRRQNMEVLTAKDGVEALTLLDERIPDVVLLDVEMPR
FT                   MDGYELTRHIRRSERLRNLPIIMITSRTGAKHRDYATQLGVNRYLGKPYQESQLLDEIG
FT                   ALIGKKSG"
FT   gene            complement(208555..210600)
FT                   /locus_tag="Alvin_0193"
FT   CDS_pept        complement(208555..210600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0193"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; KEGG: pmy:Pmen_0406 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61160"
FT                   /db_xref="GOA:D3RVN3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADC61160.1"
FT                   /translation="MATRFKLNLGKPALDGSHLLIAIAFGFCALFFAILALFSYLELAQ
FT                   LDELKARQGFIAAEQKILAQQLMRSAHEATTGEAETLDRLRRERQRFQATLVDLTQSIE
FT                   ESAKQEATSLLRADLRKIEQSWTPLAQGLDAILAAREPILAVRKLMGESREQLPRLRET
FT                   MTKVAKRLAAEDAAPALVLEAGFQLSRLERLESALDRYLLGGVAAGQALDETVKSSEAF
FT                   AEGLSTLISGVRGHSEAAGSRAALEEMTEQFATLETRSTEILRRLDGVRAAIGQLPGIQ
FT                   TTAGGVESALSELLTHSREAGRRFILLGLPIGTGAVLVFAALSLLSLAALVLIFLRDSK
FT                   AREAAYRAQTERDERAILRLLDELGDLADGDLTVEATVTEDKTGAIADAFNYAIEALRA
FT                   LVATINQTATQVAGSAQESRAISLRLAEASSAQSLQITQASAAVQSLTVQIDEVARNAG
FT                   ESAEVASRSVEVAGRGAQTVRDTIQGMDAIREQIQETSKRIKRLGESSQEIGEIVELID
FT                   DIADQTNILALNAAMQAAMAGEAGRGFAVVADEVQRLAERSRNATKQIEVLVRTIQADT
FT                   NEAVSSMEASTAGVVEGAHLAENAGEALREIENVSAYIAELTKRIADSSQRQSRQSAEI
FT                   NDTVQAIRAITEENTDGTRKAAESVEVLASLASDLQKSVAGFRLPA"
FT   gene            complement(210693..211295)
FT                   /locus_tag="Alvin_0194"
FT   CDS_pept        complement(210693..211295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0194"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: abo:ABO_0107 type IV pili signal
FT                   transduction protein PilI"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61161"
FT                   /db_xref="GOA:D3RVN4"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN4"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADC61161.1"
FT                   /translation="MAKNQRTRTDLHELIQKLDARCRARAAGLPDEARPPDSWTAVLFR
FT                   VDRQLLLAPLEQIAEVLELPWEITRVPGTKPWLLGVANNRGTLLPIYDLASLITGTPPR
FT                   IRKRFQDGAAERRREHVRGRERVLVVRQDDLPCGLVVSEAVGMRYIQNSDRVAGNVDGW
FT                   GAIGRYVETAYRLDGQPLPVIELTAMMADPLLNAALT"
FT   gene            complement(211288..211737)
FT                   /locus_tag="Alvin_0195"
FT   CDS_pept        complement(211288..211737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0195"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: net:Neut_2386 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61162"
FT                   /db_xref="GOA:D3RVN5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61162.1"
FT                   /translation="MRRFQDKLNPHRDLGAAATTLETPPTVLIVDDSPTETHILSTTLK
FT                   KAGYQVETACNGEEGVARARALRPDLILMDVIMPVLNGYQATRLLRRDAETADIPIIMV
FT                   TTKDLQTDRTWGLRQGATDYLTKPVDRQLLLERIRELLDGPASHG"
FT   gene            complement(211849..212259)
FT                   /locus_tag="Alvin_0196"
FT   CDS_pept        complement(211849..212259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0196"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: aeh:Mlg_0355 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61163"
FT                   /db_xref="GOA:D3RVN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61163.1"
FT                   /translation="MPDELDLRGTRILVVDDSKTIRRSAEVLLTKAGCEVQLAEDGFEA
FT                   LGKVVSFKPDLVFVDIMMPRLDGYHTCALIKNNPQLRDTPVVMLSSKDGLFDRAKGRLV
FT                   GARLYLAKPFTADELIGAVRASLSPAPSTESP"
FT   gene            212504..213475
FT                   /locus_tag="Alvin_0197"
FT   CDS_pept        212504..213475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0197"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: ppw:PputW619_0471 glutathione synthetase;
FT                   TIGRFAM: glutathione synthetase; PFAM: glutathione
FT                   synthetase ATP-binding; glutathione synthetase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61164"
FT                   /db_xref="GOA:D3RVN7"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN7"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ADC61164.1"
FT                   /translation="MNIRIGFVMDPIGSIRIKKDSTFAMLLAAQRRGWSLWYMEVGDLS
FT                   LLDGQAMARMRAVEVVDDPLGWFRLGEEVERPLDWLDTLLMRKDPPFDMEYVYTTYLLE
FT                   RAQQAGCLVVNDPRSLRDANEKVFTAVFPQCAPPTLVTRQARDIRAFQAEHGEIVIKPL
FT                   HGMGGASIFRLRPDDPNLSVVIETLTQHGRTFCMVQRFIPEIETGDKRILMVDGEPVPY
FT                   CLARIPAPGETRGNLAAGASAEARPLSARDRWIAEQVGPELRARGILFAGLDVIGDYLT
FT                   EINVTSPTCIRELDAAYDLDIAGDLMDCIAVRLGERADRSEH"
FT   gene            213558..214661
FT                   /locus_tag="Alvin_0198"
FT   CDS_pept        213558..214661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0198"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: tgr:Tgr7_2906
FT                   ApbE family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61165"
FT                   /db_xref="GOA:D3RVN8"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN8"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADC61165.1"
FT                   /translation="MGFVLSPSTLVRLARACTLLLVLSLTLTGCRDKAPVMLSRFTAFE
FT                   TPVDVSLVAVTRDQAERAATLVAQDFACLERDWASDGEAMERVNRLLAQGDPFVPPPSV
FT                   LRLVRLGQTLESESEGLVNLSIGRLVRLWGFDTATTASRHPPERERISDLVAAAPSMSA
FT                   ITIEGLTLRGSNPTLSLDLTPIARAQAIDLAIRHLKDLGVRNALVQAGSELRVLGERSG
FT                   QPWRVPVLRPSGSAVLAIVPLRGDEAMATVAEHDRSFTDRGRLYHAVLDPRTGRPATGA
FT                   RSVTVLSAETTYAAAAARALFIAGPTDWRRLAGRLGVQQALLVDAEGRLHLTPAMAERL
FT                   ERVDADEPVAIVEPEWPAPVAQDGRRP"
FT   gene            214658..215668
FT                   /locus_tag="Alvin_0199"
FT   CDS_pept        214658..215668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0199"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: eba:ebA1737
FT                   putative TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61166"
FT                   /db_xref="GOA:D3RVN9"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVN9"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ADC61166.1"
FT                   /translation="MTATGIRTLERPRELVIQGTRVPSTPFVAALAGAGWLHLLLILAV
FT                   SFVWPEPGPPPESAMEVVLLKDIGAGVPNRASEAALAQRDQVGQAPLGDAAIPTFGEAP
FT                   EASSDTRAQTEAPAGDADLRTVTPEPATASTPTEVPPHDDPLARPDAMTLPLREPPTAP
FT                   ILATEAEAPPRPEVDPLTPRQTVVDAAQILASQGLEVARLTSSQTASAAGGSKRARRKS
FT                   ISASTREFRYASYLAAWAQKVERIGNLNYPQAARDQRLYGSLILHVAVRADGSLENIRV
FT                   VRSSGFDLLDQAAIRIVELAAPFSPFPPDIAAETDVLDIVRTWQFMRGDVLGWER"
FT   gene            215808..216371
FT                   /locus_tag="Alvin_0200"
FT   CDS_pept        215808..216371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0200"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   tgr:Tgr7_2910 protein of unknown function DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61167"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVP0"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ADC61167.1"
FT                   /translation="MPFSTSLTNHLLIAMPGLQDPNFARTVTYICEHTEQGAMGIVINR
FT                   PLDVTLGALLAQLDIPAVRPGVTETPIYQGGPVQTDRGFVLHTAGYSYDSTLSITPDIS
FT                   VTTSRDILEAIAGGEGPDQVLIALGYAGWGSGQLEQEMSANAWLNGPASDEIIFRMDPS
FT                   ARWMAAAQLLGVDLNLMSGEAGHA"
FT   gene            216388..216795
FT                   /locus_tag="Alvin_0201"
FT   CDS_pept        216388..216795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0201"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: avn:Avin_03140
FT                   Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61168"
FT                   /db_xref="GOA:D3RVP1"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:D3RVP1"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ADC61168.1"
FT                   /translation="MTLLGFDFGPRKIGVAVGQTITRSATPLTTLRSQGEKPDWTRIEA
FT                   LIREWQPSALVVGLPFQMDDTEVAWSPRVHRFARQLEGRYRLPVHLVDERLTSREAHRQ
FT                   LAERDRRTPTLEAVDALAAALILETWLCEQV"
FT   gene            216782..217321
FT                   /locus_tag="Alvin_0202"
FT   CDS_pept        216782..217321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0202"
FT                   /product="Uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: tgr:Tgr7_2912
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61169"
FT                   /db_xref="GOA:D3RMB1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB1"
FT                   /inference="protein motif:PRIAM:2.4.2.9"
FT                   /protein_id="ADC61169.1"
FT                   /translation="MSKSDIWKDAAEIEAAIDTMTERLRERLERRGIERPLMIGIHTGG
FT                   VWVAERLHARLGLAEPLGHLDISFYRDDFSRVGMHPQVRPSYLPVGVDDRHLILVDDVL
FT                   QSGRTIRAAHNVLFDYGRPASVTLAVLLERDGRELPIAADVAGFEAGFGADEQIKLSGP
FT                   EPLLMLRARRGANPIR"
FT   gene            217361..218359
FT                   /locus_tag="Alvin_0203"
FT   CDS_pept        217361..218359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0203"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: mca:MCA2333 aspartate carbamoyltransferase
FT                   catalytic subunit; TIGRFAM: aspartate carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61170"
FT                   /db_xref="GOA:D3RMB2"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB2"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ADC61170.1"
FT                   /translation="MTTPNPQLDAHGRLKHFLTIDGLSRELLTEILDQAEGFLGVAQQA
FT                   VKKVPLCRGKVVANLFFETSTRTRTTFELAAKRLSADVLNLNISTSSTAKGETLLDTLR
FT                   NLEAMHVDMFVVRHAESGTAHFMAAHAAPHVSIVNAGDGRHAHPTQAMLDMLTIRRHKP
FT                   DFDQLSVAIVGDILHSRVARSQMLALRTLGVPDVRVIAPRTLLPTRVEEAFGVTAYHDL
FT                   SEGVRDADVVIMLRIQRERMNSALLPSEHEYFQLFGLTEERLATAKPEAIVMHPGPINR
FT                   GVEMDSQVADGRRSVILEQVTNGIAVRMAVMSMCLGNQHLGSQSQEEATHA"
FT   gene            218352..219638
FT                   /locus_tag="Alvin_0204"
FT   CDS_pept        218352..219638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0204"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; KEGG: mca:MCA2332
FT                   dihydroorotase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61171"
FT                   /db_xref="GOA:D3RMB3"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB3"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ADC61171.1"
FT                   /translation="MLNAPRLSIRHGRLIDPASGHDAVADIHLAEGRVLAIGAAPSGFQ
FT                   PDRTLDARGQVVCPGFVDLCARVREPGLEQKATIASEGRAAAASGVTTLCCPPDTRPVI
FT                   DNPAVARLIHQISKRHGLTRVLPIGAMTVGLEGQSITEMAALKLAGCPALGQADRPIRD
FT                   TQVQRRALEYAATFGLPVFLLPLDPELSAGGCAHEGIVGTRLGLPGIPEAAETVAVARD
FT                   LALAEQTGARIHFRGLSTARGVEMLAEARARGVRASGDVALHQLFLSEHDLEHFDANCH
FT                   LVPPLRTPADRDALRDALAEGVLTAVCSDHQPHDPDAKLGPFPETAPGLSGLETVLPLA
FT                   LRLVADGVLDLMGMIERLTVGPAAILERDLGRLAPGAAADLCVFDPEAVWTLSPDTWIS
FT                   QGRNTPFMGRELRGRVSWTLLGGRIVFER"
FT   gene            complement(219673..221004)
FT                   /locus_tag="Alvin_0205"
FT   CDS_pept        complement(219673..221004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0205"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: tgr:Tgr7_1303 capsule polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61172"
FT                   /db_xref="GOA:D3RMB4"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB4"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ADC61172.1"
FT                   /translation="MLSAFTGRRVLLLQGPMGPFFTRLRRDLEAAGAKVFKINFCPGDQ
FT                   LFYPTGAVDFRGTLDEWPTFLSQFVAQHAIDTVMLFGDCRHYHIVVPHVVRWRHVALYV
FT                   FEEGYLRPDFITIERGGANNFSSLPRDPDFYRTQVPPLAERPDPLPVKHAFSRTALFAV
FT                   LYALANALLGWRYPNYRHHRSLEPFSQAYYWLLSGWRKFWFGQRERGLARLLFEPLAKR
FT                   FFLAPLQTHNDAQLSVHSHYSTIEEFIEDTMISFARAAAPEHHLVFKHHPLDRGYRDYT
FT                   DFLRRMIIKHGLEGRVHYVHDVHLPTLLDKALGTVVINSTVGLSSLLHGTPVCVMGDPI
FT                   YNIPGLTFQGSLDAFWSTPGTVDRELYRRFRTWLLLQNQANGNFYRRLSTLTNHSGMAW
FT                   PPALGLPDVASEPVMQECPTRLAVMPPSHGGGELRPMARASTEF"
FT   gene            221332..221736
FT                   /locus_tag="Alvin_0206"
FT   CDS_pept        221332..221736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_0245 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61173"
FT                   /db_xref="InterPro:IPR032258"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61173.1"
FT                   /translation="MLRVVLLMCATFLAGCAQWSDLMLGESTKVAEGQTVDSVSFSQLL
FT                   GHEPTNTLVTLSNSPWGSSVQVLLHETYAAASGRNCRRLTVDPEGQSYPALACQHPKKD
FT                   KDWVPVRLLQIGGRPVLNQSTSLPAWNERR"
FT   sig_peptide     221332..221385
FT                   /locus_tag="Alvin_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.554 at
FT                   residue 18"
FT   gene            221733..223418
FT                   /locus_tag="Alvin_0207"
FT   CDS_pept        221733..223418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0207"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; Soluble ligand
FT                   binding domain; KEGG: tgr:Tgr7_1307 polysaccharide export
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61174"
FT                   /db_xref="GOA:D3RMB6"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB6"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ADC61174.1"
FT                   /translation="MIALLHCLNSFERPGRLLVGLWLLFVLVPTVGAQGISAKVDVPDD
FT                   QRVQTPLTSNIPSTLLGPSRVDDIQPFGSSLFAGGFSARRVSELNPGYRIMPGDQVTVR
FT                   AWGALEVDLMLPVDAQGNIFIPDVGPVQVKGVTSAGLNDVVTRAIKQVYTDNVSVYTSL
FT                   QGVQPVAVFVTGFVKKPGRYSGAPSDSVLNYLDQAGGIDIEAGSFRDVRVLRNRRPIAE
FT                   IDLYPFLLDGLLPQPQLEDGDTIVVGRQGTMVTVSGDVVQPYRYELTARTQSVADLMQW
FT                   VQLKPGVSHVLLTGVRDAGPYSSYLPFDDLGAHWLQDGDELLFSIDQRHETIVVQVEGS
FT                   FSGPSRFTVPRDARLMELLDSIPVDPQLADVDSVSIRRKSVAQRQRESLDESLKRLETA
FT                   YLGASSSTVDESKIRVEEAKLIQDFVNRARQLEPSGRLVVAESGQVRDTTLQDGDVITI
FT                   PNRSDSVFVTGEVLVPQAMVYQDRQGVDDYIERAGGFTDRANKRDILLARQSGEVVAAD
FT                   KAQLRPGDEILILPEIPTKNLELAKTLSQIVYQIAVATKVALDL"
FT   gene            223436..224230
FT                   /locus_tag="Alvin_0208"
FT   CDS_pept        223436..224230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0208"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tgr:Tgr7_1306
FT                   ABC 2 transport system integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61175"
FT                   /db_xref="GOA:D3RMB7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB7"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADC61175.1"
FT                   /translation="MSSTGIRSPWQVTWSVWHALFMREVLARTMGNRLGWFWMLAEPVA
FT                   FIAIMVGIREMMGRMRLVTGAEFIPWLIVGITAFFLFRESFTRSLTAIEANQALFAYRQ
FT                   VKPIDPVLVRSTMEAVLKSVVLLILMVIGVLLGMDVLPDDPLGALFLWCSIWLLGVGGA
FT                   MVMSVVVRLVPDTQHVVAMLMLPMFILSGAIFPIQTMPHSIQVYLLYNPMLHGVELLRL
FT                   EFFPGYTAISGVSLDYLWHWSLTMLALGLALHRRFESRLKAQ"
FT   gene            224227..224916
FT                   /locus_tag="Alvin_0209"
FT   CDS_pept        224227..224916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0209"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tgr:Tgr7_1305 polysialic acid transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61176"
FT                   /db_xref="GOA:D3RMB8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC61176.1"
FT                   /translation="MIEVRSVYKRYHTRNHQAADWVLRDVNFHLPPSVSLGVVGGNGVG
FT                   KSTLLRLIGGMDHPDRGEVIRRCRVSWPIGLTGGFQGSMTGRQNVKFIARIHGDTDRIQ
FT                   QVVDFVQDFAEIGKAFDEPIKTYSSGMRSRLAFGLSLAFEFDVYLSDEATATGDASFKA
FT                   KAKQAFDERVGKASIIMVSHSEGILRDLCQAGLWLRKGEAIWFDDIADALAAYHESIGQ
FT                   VKPRKAA"
FT   gene            224913..225992
FT                   /locus_tag="Alvin_0210"
FT   CDS_pept        224913..225992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0210"
FT                   /product="chain length determinant protein"
FT                   /note="KEGG: tgr:Tgr7_1304 chain length determinant
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61177"
FT                   /db_xref="GOA:D3RMB9"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMB9"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1304"
FT                   /protein_id="ADC61177.1"
FT                   /translation="MKPLRQNPLWTVILFFVLGATLYWSFIASDRFVSRANVVLLSAQI
FT                   SKPDVGLSAILRGMSNNDLLILRDFMRSTDMLARLQTELDLRAHYSNSDIDWFSRLSAP
FT                   DVPTETFHRYVLKRLSIEFDEYAQVLRISAQAYDPGMAQRIVALLLEAGEEHMNVMGHR
FT                   LAEEQVHFIEKQVEVLHQRMLEDSERMLSYQNEHGLVSPTETVGSLSGVIAKLEGELAG
FT                   LQARKAALSVSQSERAPEMMKLDSEIKGMREQIATERARLARASGDALNRLAAEYELLR
FT                   LQYEFSNELYSSAVTALENTRVEAARALKQVSVLQTPTLPEYSTQPRRLYNITVFAILA
FT                   ALTGIILQLLLAIIRDHKD"
FT   gene            complement(226010..228010)
FT                   /locus_tag="Alvin_0211"
FT   CDS_pept        complement(226010..228010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0211"
FT                   /product="Capsule polysaccharide biosynthesis protein"
FT                   /note="PFAM: Capsule polysaccharide biosynthesis protein;
FT                   KEGG: bmj:BMULJ_00622 putative capsule polysaccharide
FT                   export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61178"
FT                   /db_xref="GOA:D3RMC0"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC0"
FT                   /inference="protein motif:PFAM:PF05159"
FT                   /protein_id="ADC61178.1"
FT                   /translation="MIGVLSRGILRIPGLEVVLGEPVVAVSPWRARPELSAIAGWGLKA
FT                   TSRRARDYARRHGLPYLALEDGFLRSVGLGNQDPPLSLIVDDLGVYYDATRPSRLETLI
FT                   RHPLSDTETARARSLRSAWCAARVSKYNHLREEREPLPSPAVLVVDQTFGDPAITHGLA
FT                   DSKSFQHLLEAALDENPRAVILVKIHPDVFAGRKRGHFDPERLARLERVRLLTRDLHPV
FT                   SLLERVETVYTVTSQLGFEALLWGRRARVFGMPFYAGWGLTEDELPRLERRAPVGLESL
FT                   IHGALIAAPRYLDPETGERCEIERVLEWMGLQRRMRERFPETIRALNFSAWKRPLVRRF
FT                   MQGSRVEFETRPHDARQIKGDARIPLAVWGLAAAPEGRTILRLEDGFLRSVGLGADLVE
FT                   PLSWVIDQRGLYYDPSRPSDLEILLETQVFDEALLERARRLRERIVASGLTKYNVGAAH
FT                   WQRPATARRVILVPGQVETDASIRLGAPGIRHNLELLRAVREAHPDAYVLYKPHPDVTA
FT                   GLRAAGEHESAARTWCDELIVDVPMATLLDAVDELHVLTSLAGFEALLRGKRVVCHGQP
FT                   FYAGWGLTEDRLPPARRTRRLSLEMLVAGALLLYPTYVSRVTSRFTTAEHALDELLEWR
FT                   ARGERLTFWRRVFVRPVLGRLAALRDRRPSG"
FT   gene            228067..228990
FT                   /locus_tag="Alvin_0212"
FT   CDS_pept        228067..228990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_00621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61179"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC1"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00621"
FT                   /protein_id="ADC61179.1"
FT                   /translation="MRPVLQASGRPIHCYTFSRSLPDPSALTGASVVLVRYVPAAWAGF
FT                   IERHRSRLGELIFFMDDDLFDLNAARGTNWRYRLKLARLATWRRDWLKAQGAALWVSTP
FT                   YLRDKYADWQPQLIRPAPLPAPIVDEHVRVFYHGSASHEAEIRWLHPVIEAALQAEPRL
FT                   SFEIIGTSRVNRLYRRLPRTTVVHPMSWPTYRAFIAMPGRHIGLAPLLDSPFNHARSCT
FT                   KFFDITRAGAVGIYAPGPVCADMIEHDVNGWVVALDPDAWTNAILRLTRDVPLRRSLLD
FT                   GARATAPRSVPWSGSTTRADPPWAYD"
FT   gene            complement(228953..231076)
FT                   /locus_tag="Alvin_0213"
FT   CDS_pept        complement(228953..231076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0213"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   vap:Vapar_0767 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61180"
FT                   /db_xref="GOA:D3RMC2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC61180.1"
FT                   /translation="MKIKKTAESALTPLERPPHLTCKNGVYEIDSIPAWIELTWQGELP
FT                   SGWVLLRGRLIRRGRDFSARLFIETDGADYHYDLPISLKGTLLELIELPDGVRRLRLQP
FT                   MRSLGKFELHDWRLEPAGWLKRTAYRWRRVLPVYAKLSRRQRSILGLRLYTPLFDLERA
FT                   YRLAGNTRFYAPSLFYEQWFALFGQLSHHDRRLIRRRLRRWTRARPHFEIHLDDRTDRH
FT                   AGALAKTLASLESQLYRDFSLNGAATAGTPDWTLHLEHGMTLSEHALYWFAEVIRAHPA
FT                   ARLIYCDHDVHDESGQPRNPVFKPDWSPELLRSTPYIGPTVIFHHETRRQFMSEHGLPE
FT                   PTSSADLHALLLGLCESLKSEQILHLAAPVWHLPSTIRIDSSPNVVQAHLDRIGVSATV
FT                   SPTERGHYDVRYTLPDPPPRVSLLIPTRDKLEYLRPCVESLLSSSTYPDFEVLIIDNGS
FT                   VEPETRDYLNRLVERSRSQTNRATIRVIRDERPFNFSALNNAAAHQAQGDVLCLLNNDT
FT                   EIITPDWLEIMVGHLIQPGVGVVGAKLYYSDGRIQHAGDTVGPGGCAHHLHAFLDRADP
FT                   GYCDRAILAQDLSAVTAACLLTWRHLYLQLGGFDEEHLPVAFNDVDYCLRVREHGWRVV
FT                   WTPRAELYHHESVSRGKQEDPRKIARAARELAYMRQRWGAVMRHDPFYNLNLSYQRPDF
FT                   SLSHMPMVDRPWL"
FT   gene            complement(231079..234024)
FT                   /locus_tag="Alvin_0214"
FT   CDS_pept        complement(231079..234024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0214"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bha:BH3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61181"
FT                   /db_xref="GOA:D3RMC3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC61181.1"
FT                   /translation="MRTVHDNPPNPRILHMPRFRLVHLSPGRWRHLRTQARQRKIAALI
FT                   AQSPYFDADFYLAQAPDVAARTYWVENPALHYLLYGGQEGRRPSACFNSGWYLEQYPDV
FT                   KAAGMNPLLHYLHHGRTEGRLPRPLRALTWHERLWSSEAIEAQRQALQELETLLDSHEG
FT                   CAQEASAAAWSLGRWYAWMDQWPEAARVMKRFSQIADPVPGHLAPHLLDIDAAMRVGEF
FT                   GQAHDRLKPLLERRPDHADLCLLAANLIQAEAQDDRDDTAIRQRLAWINRPYLAQGLEP
FT                   LGLRSNANPSAPVPMLDRLRTDTRATRRRAAPGTDVQTLVSIIVPAWNAATTLETALES
FT                   LVRQTWTDLDVIVVDDCSSDDTAAIVERFATRDPRVRLLRHASNRGAYAARNTGLASAR
FT                   GAFITTHDSDDWSHPRKIESQVRPLLESDVLVATLSHWVRTSRDLRFGQWSTPSGWMGW
FT                   VHRNVSSLMFKRSVFEQLGYWDRVKVNADTEYYYRVIKAFGADRVREVLPGIPLSFARH
FT                   SPTSLTQHPETSLRSVFGGMRKAYQDAAYQWHAQARAPSDLYVPAHPDKRPFPAPPEIC
FT                   HLNDSLQTECSDTTDSNHVVSFEIQRPDTQEQTSVIRKALFGQKKKIEIVLHVGMPKCG
FT                   SSALQAYLSGVDFEKASKGRFAYLALTKEKRILTPHELHKITLRSPRRYTSSCSVESFK
FT                   TFSPEDKKNLQKKIRHIGNRYDKIVFSCEGWGFNHRFFSDEDLFAHEDFRVRILAYIRP
FT                   QIEWLNSAWWQWGAWTDLSFDKWIETQKGNLNWNRLHQNWSQKNWVEGVDFRLMQGDVV
FT                   HDFLDYLGLDRTERHTESPLINQSLPAPLLRLFQRHRELRAGPHDSETDFILSRRLNLD
FT                   SGKSPWVIHSDLAKKLIGFFLSENRKLSFSLTPAQRKSMLEDERWWTSELYSLRAAKNP
FT                   TPEEPDLEDLEALAVAALRAIIDLDRQIQKTKNANSLERKIRSAFGSKFIP"
FT   gene            234031..235464
FT                   /locus_tag="Alvin_0215"
FT   CDS_pept        234031..235464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kinesin K39"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61182"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61182.1"
FT                   /translation="MTGYQRFPVDSGGFMEHFVITTGFSRSGWSRGLAALARDQFAEGV
FT                   DEILETWRARAAHDVSVESIGAPPLERFGAWLDSVEPGHTILSSDERDLWLLDQWAEHY
FT                   PQARFLLFYTDPETALIAALKAGADPADFLDGWRAAVHRLVRFQRRHRQRSLLLDAESA
FT                   RLDPQAMVEAAQRIGLMLRLDEQLSQADEDPVFERLVARRWLDRESDLALLQAELEAHA
FT                   YPLGERPAVADPDVDQLLELYRREQAFHRRLTAERDEQARLVQENANAAKAQSKLAAER
FT                   GAELERLQARLSALEAQHTALETSRKQLEASRKQLETSHKTLEATHKDTVEENELLLLQ
FT                   LHQVQEELESQFLQGKQQLETLSAEKAALAKDKEALTRDKATLTAARDEQSKLAAERGV
FT                   ELKRLQERLSALEAQHTALETSRRQLEASRKQLETSHKTLEATHKDTVEETSCCYYSSI
FT                   KSRRNWNHSFCKASSNSKR"
FT   gene            235833..236231
FT                   /locus_tag="Alvin_0216"
FT   CDS_pept        235833..236231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hya:HY04AAS1_1576 glycosyl transferase family
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61183"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61183.1"
FT                   /translation="MLTEKSEPTPPSSQTPKNRRYKRPPALKSGGFIGKKRKERQRLER
FT                   YVTIIRESGLFDEAWYLSQYPDVAAAGYDAIEHYVCHGIQENRHPAPWFDTAFYLERNP
FT                   DVANSIMNPLVHYHQFGKAERRPTRRGY"
FT   gene            236235..237248
FT                   /locus_tag="Alvin_0217"
FT   CDS_pept        236235..237248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_1518 methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61184"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61184.1"
FT                   /translation="MTTIDTLIHLGAGPCRELDAHLALQPERLILVEADPSLAEALSAR
FT                   VQGLESVDVRHLAVASKPGEVTFHRYNLPDAGSLHPATGLKALFPGLKRLQTLTMEAVG
FT                   IGDLIDSFQLESDAVHRLIVDLPGEEFPCLRALYDGGQLHRFQWLSMYCGHEPLYEHGL
FT                   AAGAILDWLSEQGFDLVECDETQDPDRPCWILKRNPLKLECLTLQSQIQQFLADKSALT
FT                   KDKAALSAARDEQAKLAAERQQQIEALNAEKAALAKDKAALAAARDEQAKLAQARQVEI
FT                   DNLKSRLQEQQKRVTELDSQLTERDQRQTLLDEELHKAEGQIELIKDLLLRNELGQ"
FT   gene            237541..238554
FT                   /locus_tag="Alvin_0218"
FT   CDS_pept        237541..238554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0218"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mch:Mchl_0349 SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61185"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61185.1"
FT                   /translation="MVSTSLPAPASTALSQSPPPAAHAGDLLPRDEQLFDRVLTQWQFG
FT                   DWNRLATLDPEGFAHHPRRARLALLAAAGHQQLGHQDETRRLVHLAYEWGCDRTLIKRV
FT                   LISGVYNTLGRVNALAGRQSHARERLETALAVGAPGQDLGLLMPVRVRQQFDDTGLPAH
FT                   TIATPRALGQTTDSKADQATLEAAKVAWMLGDWNTLTTFDKADLVQHPARAELARLIAA
FT                   GYQQVGDMAAADRCTQLALAWGEDRRLMRATLTSGAFNLLGRACAASLRYGAAQANFAR
FT                   ALQIMQVRDDVNHSRLKARIEHQVAMIPGLDLAETVAAILGAEPETADGTAELAAS"
FT   sig_peptide     237541..237615
FT                   /locus_tag="Alvin_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.932 at
FT                   residue 25"
FT   gene            238583..239779
FT                   /pseudo
FT                   /locus_tag="Alvin_0219"
FT                   /note="hypothetical protein"
FT   gene            239818..241005
FT                   /locus_tag="Alvin_0220"
FT   CDS_pept        239818..241005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0220"
FT                   /product="UDP-sulfoquinovose synthase"
FT                   /EC_number="3.13.1.1"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   dol:Dole_1303 UDP-sulfoquinovose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61186"
FT                   /db_xref="GOA:D3RMC8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC8"
FT                   /inference="protein motif:PRIAM:3.13.1.1"
FT                   /protein_id="ADC61186.1"
FT                   /translation="MSHILILGGDGYLGWPTAMYFSARGYAVTVVDNYFRRNACTELDV
FT                   GMLYPLPSLSERARIWHEKTGYEIKVVIGDLTDPEVMRGLFDGRVKYQWAVDPTFSGIP
FT                   ETVVHYAEQPSAPYSLIDYRYANITVSNNLLVTNNLMFAVRDFAPETHMIKLGTMGEYG
FT                   TPNIDIEEGWIEIEHKGRKGTFLFPRQASSLYHTTKIMDTDLFWFGVRMWNLKVTDLMQ
FT                   GPVYGLETDESAVDDRLKTLFNYDEVFGTIVNRFIVQAVVGYPLTVYGKGGQTRGYLNL
FT                   KDTLQCVHMSEKTPAKAGELRIFNQIMETFSVNELAELTQRVGRKLGYDVTIKNIENPR
FT                   KEAEEHYYNPTYQGLIDLGVEPHYLTEEVMESMFRVVAGYKDNIRQDVIFRGVKW"
FT   gene            241332..243116
FT                   /locus_tag="Alvin_0221"
FT   CDS_pept        241332..243116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ate:Athe_1243 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61187"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61187.1"
FT                   /translation="MRICFFTANPFGMFGTTGTFKLIEEASVVCDTYTFSREPMPGNTI
FT                   YEAPETLSIELYDYLAKRHYPKIIEKVKAFNPCVLYIFNYSEWPELAAALKSQFPKIPI
FT                   FLDLQTPLLAQGDKREDIRSRGERAQCYITKVFTYSKSNIETWIKNPAVLYHEYPLGVD
FT                   CASVPPYRRKALKNHQGPYHAIYFGSLNPLREIDKFVFLLQKSLGALEKQVTLDLYGDK
FT                   VSDQYREKILLHEDSWLRLNLRPAISQKELFQKFSDYDFGIAWVPNTQYTDSPSLKLIE
FT                   MMASGMPVIASNTNAHRLCIEGCEQIPLFDETEFSLTEALSKLLTHLASHNPTININAS
FT                   KRYSFTKIFADHLLPIMAAELATLGGKRGTESSNLLQATPLDESLTNLSFDKSNCPDFI
FT                   TYALISSFYINGQQPLTEYLRKICEYRSQSECIQLQKYVVTNHPKQLVGILNKKDICLT
FT                   RPIVLAKTLDKIKQTNLKELFDFLSCRFIIIDPELLLSQLRLDEVMSIFSDTAVLNVIL
FT                   GRHVVASIIDAKVLQNTKDCKKATIQDYCDDALKAKSIDFKVLHQLTQKNEKNCTKKLS
FT                   QIYCRHKYQSYKTGLSLK"
FT   gene            243134..247013
FT                   /pseudo
FT                   /locus_tag="Alvin_0222"
FT                   /note="hypothetical protein"
FT   gene            245085..245925
FT                   /locus_tag="Alvin_0223"
FT   CDS_pept        join(245085..245381,245383..245925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Alvin_0223"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: fre:Franean1_3262 transposase IS4 family
FT                   protein; manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61188"
FT                   /db_xref="GOA:D3RMD0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD0"
FT                   /inference="protein motif:COG:COG3293"
FT                   /protein_id="ADC61188.1"
FT                   /translation="MTSKKESSQKYPSDISDEEWEIVESIFEELEPYTTGRPRSSDLRE
FT                   ILNAIFYLNKTGCPWRYLPNDFPSYKLVNYYYNKWTDNKLLENLNTALREQLREKKDRK
FT                   PDPTGAIIDSQSVKGTPESRRASGFDGGKLVKGRKRHIVVDTMGCVLVVWVHAANMFDG
FT                   TAAREVIARLFLLIQSVKIIWADGAYAGAELIEWVFKQFACTLTIVKKQTGRQGFHVLP
FT                   RRWVVERTFAWLGRSRRLSKDYERKPTSSESQVYLASSRLLLRQICNNQIHYKLATS"
FT   gene            246994..248622
FT                   /locus_tag="Alvin_0224"
FT   CDS_pept        246994..248622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0224"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   dth:DICTH_0816 glycosyl transferase, group 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61189"
FT                   /db_xref="GOA:D3RMD1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD1"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC61189.1"
FT                   /translation="MKNGKFNLIAWYHGNRSQFVALLHSIVKNNFYLNIEVTVGTSRPR
FT                   EAVYLIRPFLKYFFIRVVRLNQGDNFLGVVNSAQNTLCQNILISAYNPIFERDFLPAFI
FT                   DQLHKEIQKPLGRIRTLSGNGGKFLLLDNSIKTIPLSTNEINFISSFVCGASDNKHYLN
FT                   QRSAQNAKHANFQLNILFVGPWAFSLDTGLKNIDLIYPSLLTALKGCKFHILHGAPKRP
FT                   EFTNSLLNCYDVTFHSVCDNTIKAWMAKCIEIGKQYNIDIFTNVFYGFYFGYFAAKTAN
FT                   ILGKKSVVRFPANEIAVRVLQGVYDDIDGDTRKALDLRQERAAVQLADKVIAVSPIEQQ
FT                   RLKQLSNDRGKVFWCMRGVDLNLYRPEEKRKQRVANNFLFAGRSAKVKGHELIEGAAQI
FT                   IENYDPDIRFYFAGQFEKKVEGNRVYLGYLRHDELRLTYGLMDGLILPSACEGFANVVV
FT                   EACACGLPCLISQEISNALFQHGKNVLIFKRTANDITEKVLSIKNDQQLFLRLQRKSRE
FT                   LAEKTFDSSYWGEEYRSIVLGERCT"
FT   gene            248979..249965
FT                   /locus_tag="Alvin_0225"
FT   CDS_pept        248979..249965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0225"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   rxy:Rxyl_1236 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61190"
FT                   /db_xref="GOA:D3RMD2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADC61190.1"
FT                   /translation="MNNKVLITGGCGFIGTSLIHKLLARYPTAHIRIVDNFVTGSPADL
FT                   AEVCVFQSTQAADLAQATLTAGVFLLEGDIRDADFLLQCAQGVDCIVHLAANTGVGPSV
FT                   EDPRLDMDCNVVGTFNALEAARLNGVKRFIFASSGAPAGEVEPPIHEELPPHPVSPYGA
FT                   SKLAGEGYCSAYYRTFGIETICLRFGNVYGPRSKKKSSVVAKFIRQALQGEPCIIYGDG
FT                   TQTRDFLYIDDLVRAVMLAMEQPVGGETFQIATGMERTVGEVATLLAKALEKRGTHMDI
FT                   QHDSPRLGDVRRNFSDTSKAARLLEWRTEVEVPEGIERTLDWFFEQA"
FT   gene            250028..251074
FT                   /locus_tag="Alvin_0226"
FT   CDS_pept        250028..251074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: min:Minf_2056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD3"
FT                   /inference="protein motif:COG:COG3551"
FT                   /protein_id="ADC61191.1"
FT                   /translation="MANFPPLKKIVVVFGSGRSGTSLLTQLLATMGLSISENLLGGHVE
FT                   NPDGFFEDIDLLELNKNIIAELGFSPFLPFPADWLEHNAATQFVKPARDLLEKKVTASK
FT                   NTLVVKDPRFSVLLPFWAKIFKLLNIFPIYILSVRHPSATANSLVKQAPNAIFPALAEL
FT                   IWLSRTCDALWHVSGNCFIAHYEEILEQTEQFCTAIAHYLEDFGIEDITAHGLSDSKVV
FT                   KERLNRSSALRNEAVNPLVSVLYSQLLKSRHGDFDKKALMSKVSECRRAMEGFKGWYLA
FT                   AQQAQKKLGDSEIRLADLKSEVAKMRKDQFAMQQQLKAVQKENQRLEVMVAEVDKLSGA
FT                   LAGLSEYP"
FT   gene            complement(251400..251762)
FT                   /locus_tag="Alvin_0227"
FT   CDS_pept        complement(251400..251762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0227"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   nmu:Nmul_A2650 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61192"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADC61192.1"
FT                   /translation="MDALGNPVRLIVTAGQEADITQGAALIEGFVTEAVIADKGYDSDA
FT                   LVAAIEATGAQAIIPPRRHRHTKRKVDWHRYKARNLVERFFNRLKQFRRVATRYDKLAN
FT                   RYNAFLHLACAYIWLL"
FT   gene            complement(251783..252154)
FT                   /locus_tag="Alvin_0228"
FT   CDS_pept        complement(251783..252154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0228"
FT                   /product="IS298, transposase OrfA"
FT                   /note="KEGG: nmu:Nmul_A2018 IS298, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61193"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD5"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A2018"
FT                   /protein_id="ADC61193.1"
FT                   /translation="MDRRMLSDEQWSRIADFLPGKPTDKGGRAVDNRRFVEAVLYIART
FT                   GCPWRDLPKELGNWHSVYVRFARWETYGVWHRVAEALQGEADMEELFIDATIVRAHQHA
FT                   AGAPKKTVAIRRSVARAGA"
FT   gene            252237..253643
FT                   /locus_tag="Alvin_0229"
FT   CDS_pept        252237..253643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0229"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   scl:sce2484 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61194"
FT                   /db_xref="GOA:D3RMD6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC61194.1"
FT                   /translation="MAEAKRNQRLLKDFAEAQRLYRDRQFSIARKRLAAYRAGIDYESF
FT                   PRQDRRPAEQIIHSSVVLVSYGSGQGLLDCLYSLRKQIDPHFEIILVDQGGNESVHAEL
FT                   ATWPLLWVCPPINLFPSEGRNLGAYFARGELLIFLDDDAIAHEDFTAQAWFGMHQTQAL
FT                   ALRGRILPRSPGQPTTATPPHYDLGDHLCLAPANLEGNLVVRRAAFQVVRGFDPLIFGH
FT                   EGRELGWRLHQARRHGAFADTPWRGIYYWPMLQIRHDFANGERLATKRARHALGQAYLD
FT                   TFAPGAFDAPERMDPALAELTPETLANQLPGPGITLILRAGTDLTQTQRLLTSLIQQAF
FT                   QRPIEVLISAPNAKAAVAMIRPFLVRLTIRVLSPRYLHSRQNLSDLVGLGRYASIALVA
FT                   ETAVFSSNPWPTMLTTLEQQAVVAGPGELAETLLLCHRWTLGRGFTEPLDTPLPQLIKR
FT                   LTIGGLINRV"
FT   gene            253636..254721
FT                   /locus_tag="Alvin_0230"
FT   CDS_pept        253636..254721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61195"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD7"
FT                   /inference="similar to AA sequence:KEGG:RCOM_0386120"
FT                   /protein_id="ADC61195.1"
FT                   /translation="MFKARHLYVALSGHGFGHLAQVAPVVNAWQCRHPARRLTIQTALP
FT                   ETVVRARIPGVSCIVIGEADFGLRMADALTVQIDASLAAYRTFHTDWERHLTWQIGLLR
FT                   EATPDLILADIPYLTLAAAARLDIPAVALCSLNWADVLAAYAPESPDLDRLCAPMLDAY
FT                   NSAAVFLCPEPSMPMPTLRNVHPIGPIGVLGRSQRPLIDHRLGLRDDETLVLIGLSGME
FT                   MRLSLTHWPRLPGVHWLTPPGTDAQRDDVHDWTILGARPMVDLIASCDAFLTKPGYGAF
FT                   VEAACHGTPVLYVERDDWPEEPGLSRWLHTHGRAQRLSREQFAQGNLGVPLRELLVLPA
FT                   CESAAPTGIAEAVTWLERLMR"
FT   gene            254898..255575
FT                   /locus_tag="Alvin_0231"
FT   CDS_pept        254898..255575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61196"
FT                   /db_xref="GOA:D3RMD8"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD8"
FT                   /inference="similar to AA sequence:KEGG:M446_3014"
FT                   /protein_id="ADC61196.1"
FT                   /translation="MKKTENKYDLHFLHVGKTGGTAIKSALSDYLVLSRYSLLLHSHET
FT                   SVKDVPENSKFMFFLRDPISRFVSGFYSRKRKGQPRYFSDWRPGEKEAFELFQTPNDLA
FT                   NALAGGALQDAALKAMHSITHLRKYKHWYVTLDYFETRLADVFYIGFQETMDSDFSKLK
FT                   VLLDLPDSLQLPNDDVGAHRNPQNLDKSLTPKAVAALTDWYAEDYVFFSRCKDFKTSNN
FT                   GRG"
FT   gene            complement(255629..266923)
FT                   /locus_tag="Alvin_0232"
FT   CDS_pept        complement(255629..266923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0232"
FT                   /product="outer membrane adhesin like protein"
FT                   /note="KEGG: rsh:Rsph17029_3182 putative outer membrane
FT                   adhesin like protein; TIGRFAM: outer membrane adhesin like
FT                   protein; PFAM: Hemolysin-type calcium-binding region; Ig
FT                   family protein; SMART: Dystroglycan-type cadherin domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61197"
FT                   /db_xref="GOA:D3RMD9"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR040853"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMD9"
FT                   /inference="protein motif:TFAM:TIGR01965"
FT                   /protein_id="ADC61197.1"
FT                   /translation="MANPSATSANLYFIAGDLSDLDTLLAGLPTEAEVHLLDPETDGLA
FT                   QILAALEGRSGLNAIHVVSHGDSGRVDLGNLVLDGAVLDERAEDLVTLGEHLSEDGDIL
FT                   LYGCNVAEGESGAAFVARLAELTGADVAASENFTGTSVLGADWTLEFQTGPIESVTLAI
FT                   PAYDTVLGTDSQLPSGLASAPYTWGSYTFQTKYDGEITDSDPENPLRAGNKWDRYILNG
FT                   VEAGTTVYVYMGNSSTVDDYLQVARGGSIVTQDDDRGDGERSYDAFVTWVYQPGDEIRA
FT                   TTYSPGYRGTYSIYIGTNNPSAPPPQPEDIGSNPVPTPTAPTFTDSYSNIGTVVDTSTN
FT                   DTSFSNLTGTLTATDSTPTGTLSFSGGGTQTYGALSVATNGSFTFTPNAAAINTLAAGA
FT                   TASHNFTVSVSDGSLSSSKTLTVSFSGVNDLPSVTGDAVMPGILEDAGNTNALNPGTTV
FT                   ANLFGARFSDVDTGASFKGIYIVSNAATAGEGVWRYSVDNGASWSDVTNGTTLLSTYKL
FT                   QFVPTANYNGTPGALTIRVIDNNDGQSTNTATVSVAVAPVNDPPTFTSSQGAATLTETV
FT                   NWDDAVASSKVEIDSGALSGTLTANDIEDGTSGIQFGIRGGTSSVGTVTKDGFYGTLTL
FT                   DTSTSNWTYTPTNFVAINALAQGASVTESFEFRVTDQDGASTTQTLTITLTGTNDAPIL
FT                   DAEISDQSFSGSGSWSFQVPADTFSDAEGLGLTYSVEVVSDASGNTLLNDGVLANQIPG
FT                   LSFDPSSRTFSGDPTTDGTYYIKVTATDSDGVTASDVFQLDLSNVGNQPPYVANPIAPV
FT                   VVADIPEQFSVEFSSALGGSELSFDGQTIPLGTGQTGAQVASAVVSAGDTTNYTVALKG
FT                   GSPETVIFTAKSDGDVTDSTYNDLVGAGTYAGSPAISKVQDGITGSPESFVLNLVNNDG
FT                   TERTLTFDGTTVTISADVLTTGGTIADLFVTADSESGFANWSVTKVSETEVRFTHINNG
FT                   DQLDISLDDFSGTYKDLALLPPSISGTVDGSSGQPEIFEVTYGTGLSGSTLIFDDVTAT
FT                   AGTALTAEQVAQAVVDAGNTSNWSVALDGSDPSKVVYTSLNQGDQTDPQDTDFTGSYNT
FT                   DGGGTLILAKLADGAGWSYQVPLTTFADPENNALTYSAELDGTPLVDSQALSFDSGTRI
FT                   FSGDGSSLPPGVITIIAHDAISGGAATAVVPLTLSTTDAGVSAGAAIPEETWTGAGEHS
FT                   FQIPADAFSYADGDSDGSSLSYSATLDNDDPLPSWLHFDGDTATFSGNPPAGAAGSLNL
FT                   KVTANDTTGAPSSAVQTFTLTIADPNDAPVVTTHLEDQSHNGTAGWSLNVGTLFSDPDG
FT                   NADGTPTTAGLTYGAEVSDGAGGWTSTLPTWLSFDGNTGVFNGNPPAGTPYLNLRVTGT
FT                   DPGGASTSTSFILDLAAAADGATAVNTPGTLATPSDNNGGNIQLGDILSAPVPTDADGV
FT                   PGTVNYQWQVSADGSTWSDIAGATAATFTVTQSVSSQQIRAQAFYTDGGGYAESPVSNA
FT                   LTIPTFNLPGSVTIAGSLAPGQILTATISDGNGLTRATPTYTWYRGDSEGAKTTVVGNL
FT                   SAYTLTNADGNKYITVEVSYTDDEGTPETVTGTRSTAVTLGAMPPVAGDDAATAIEASG
FT                   VANATPGTNPTGNLFQNDTDANSGDTKTLTAIRRGESEGSGAVGTTDSGEYLYSVAGQY
FT                   GTLRVKANGDYIYEVNQSNYFVESLNTSDSLTDAFNYTVTDGAGFSDTAVLRVTIQGAD
FT                   DALTVSSLPERFEMLEDVPAYLPPAFSITDVDSPDQNITVTFITSAGSLSATSGEGVTV
FT                   TGSGTGTLTLTGALSSLGPWLQTPERILYSSVLDVNGTGAASIEFLTNDGGGDVSRGTI
FT                   QVDITAVNDAPDGADAHRVTLEDTPYIFSAADFGFTDTPDEVSGGSSAHILLSVVLTTL
FT                   PANGKLQLDGVDVEAGDEISVSDITAGKLAFVPTTDENNASTPGDDYTSFTFQVRDDGG
FT                   VDNSGVDLDPTPNTLTLAVTPVNDAPVLTNAVESQPTLTTIDEDTIDSPGHRISDLVRA
FT                   VDGTNPAGVTGQSVVTDVDFTTQASADDEAWDHGIAIYGLTNAGPALGLGGVWEFSTDD
FT                   GASWIPIDTGQINGGDTALLLRSSDKIRFVPDEDNATEAGIDYYLWDGLVAGVADQQGT
FT                   YADVAVRGGTTNYSTASDSARITITPLNDAPILDLNGTAVGTGYQALFKPRGVEVAVVA
FT                   SDMTITDVDLPDTIVSATVALTAGALDNLFGTIYETLSAPLGAFNAPSGAILNIVANSD
FT                   NTELTISGTGTQGDYVAALKTVTYDNANPSPITGDRTVTISVTDGALTEPGNPLTTTSI
FT                   TTVAVPWVPVIDLNGSSDTSENRDFSIGYTEGSAGVPIANPTATITDQDGNLDSVTLTL
FT                   NNPLNGAAEYLYLDANQLALLPSYGLQITGNGTHEITFSSLSGSPDRDATTFQHFLRGV
FT                   KYINEAAATDSSGLRTVTVSAVDDDGYDSVNATTTITLTQVNDVPTGADQTIEIAENAI
FT                   YTFQTADFGFSDVNDIPPDDLAFVQITRLPDAGTGSLTLDGAPVALDQFISASDIAAGR
FT                   FVFSPIGDAIAAPKASGYASFAFRVQDDGGTANGGIDLALSANTLTFDVLAVNDASVLD
FT                   GEAIALTTMDENALGNTGQTVSDLLGGANDVDPGALSGVAIYDASNAGPGGGTWQYRID
FT                   GGTWTAFPVVSEGAALLLKATDEVRFLPDGDNGTTASFDYYAWDQSAGSAGTTADVSTT
FT                   RGGTSAFSLDGARASIEVTDVNDAPTLDLDDDGSGTGFTAIFRPRGDAVAVVDDDLVIA
FT                   DVDTGDTLSGATLTLAGIRDAGFETLSSSLGESYAGSLGTLTISGNGTETLTISGAGTH
FT                   AEYATLLQSVRYLNSNPSATAGDRQVTISVTDSAVTEPGQARSASAVTTIQTPWTPVID
FT                   LNGPGGAGRHHSVSYTEGQGALAIATADSTITDQDGNIAHLTVTLRDGAPTGGTTESLG
FT                   IAASLISTLAGLGITTTQTNAWTLEFDGPKDVSYYQLALRGVRYTNTSEAPAGTATVTV
FT                   TPTDAGTGALVGVGATTTINFIGVNDAPTGSVTLDGTPAELQTLTANTSALGDLDGLTG
FT                   ASYAYQWQVSANGGTSWSDLSGATGASHALDDTLGGRQVRVQVSYTDDAGFTNTVASAG
FT                   QAITNVRDSFRLTEGPDTYDGRANPIAQVIEALGGNDTVQGGAGDDRLYGQDGDDSLNG
FT                   QYGDDVLDGGAGNDRLTGGPGTDTVLGGDGDDWLGGGFGNDRQEGGDGNDVFAGNPSGD
FT                   DVLDGGAGEDRADYSESSDAVRVDLRQSGPQWISTASGTDTLISIEQLTGSAYADTLTG
FT                   NTAANRLAGGEGDDTLSGQEGDDWLDGGAGNDRLTGGPGTDTVLGGDGDDWLGGGFGND
FT                   RQEGGAGNDVFAGNPSGDDVLDGGAGEDRADYSESSDAVRVDLRQSGPQWISTASGTDT
FT                   LISIEQLTGSAYADTLTGNTAANRLAGGEGDDTLSGQEGDDWLDGGAGNDRLTGGPGTD
FT                   TVLGGDGDDWLGGGFGNDRQEGGDGNDVFAGNPSGDDVLDGGAGEDRADYSESSDAVRV
FT                   DLRQSGPQWISTYSGTDTLISIEQLTGSAYADTLTGNTAANRLAGGEGDDTLSGQEGDD
FT                   WLDGGAGNDWLGGGSGTDILTGGTGVDTFVFDTVPTISNIDVITDFNHAEDVIALSSAV
FT                   FTAFTGHEGERVGQNANLFYNNFSGTLYYDADGSQPGSAVAFAILGQDTHPVTFDTVLI
FT                   IA"
FT   gene            complement(267003..273878)
FT                   /locus_tag="Alvin_0233"
FT   CDS_pept        complement(267003..273878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0233"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   rsk:RSKD131_3707 hemolysin-type calcium-binding region,
FT                   RTX"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61198"
FT                   /db_xref="GOA:D3RME0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME0"
FT                   /inference="protein motif:PFAM:PF00353"
FT                   /protein_id="ADC61198.1"
FT                   /translation="MTTNVAALSSALYFIASDLSDLDTLLTSLPPEADVHLLDPEVDGL
FT                   AQILATLEGRAGLSAIHVVTHGASGRVDLGSLNLDGAMLETRAEDLAVLGQHLGEDGDI
FT                   LLYGCNVAEGETGAAFVARLAELTGADVAASVDVTGAAALGGDWELETTVGVVNTTPLT
FT                   SPNYDALMAAITISNLDDYSNYTEGDGIVALDNGDIAFAGGTDYSGGYLQFEITSAASG
FT                   ERLALQTDATPSDVDGEISIVGTTVYRGTGSGHEIIGSVDATLNGQNGQPLRINFSNVF
FT                   ENGDFQDDALNSTAITGWTTQLNEGRSGERVRLDGVYQIAGQSTPIDTTYPTNNGSIGD
FT                   NTTGGTFNQSAYVADHDSNSNYEVRLNTGSSSINQSYGVIRGPYVYSNGTVSLQQGDSV
FT                   SFWWKALAGGDAYDAYGYLIDVNTGNTITILDETGNSETGGTSGATETIVISAGQEGVY
FT                   RFVFVAGSYDFTGGKALGGELLIDAVTVTQANPPGSIDDFDISAIAQKITYENTADDFV
FT                   SLPLTRTLTISVEDGSANVGTATSTITVTGQINDAPSFTSPATLSTIAEDTGNPTGSTV
FT                   SDLFDALYSDPDEDYVPADTLGGIVVVGDASAPSEGTWEYSTDGGSGWQAVGSVSASNG
FT                   LLLSAASLLRFVPAPDYSGTPGALSVHAVDSTFGGSYTNGASRATFDVTSDDSAAETSA
FT                   VSASAVTLGTSITASNDAPVLTPGTGQDLTSITEDDTGNTGQTIASLLATITDPDPANA
FT                   GTASIEQGVAIYATAITGTGSGVWQYQVDSGSWTPFGTVSETSALLLKDTDKVRFVPDT
FT                   LNGTTASFSYYAWDQASGSAGSTADVTSRGGDTPFSLNGDSTSIMVTDVVDPPTLDLDA
FT                   DDSSSATGNDYQTTFKARGTEVAVVDSDITITDPDGSMMTEARVAITGGAFDNLFGTDY
FT                   ETLSARAAGAGSATITSFSAPSGATLTITGNGTPEVIISGAGTLADYQSALQTIFYNNA
FT                   NTSPFNGDRTLTVTLTDDSGEVATADTTVKVQWVPVVDLNGSSDDSTNRDYTVAYTEDD
FT                   PGLVIANPTATITDQDGNIVSLTLTLTNPLNGAEEYLYLDPTQEANLAGDGITLTGNGT
FT                   HELTFTGSGDATIFQYYLRGVKYLNTAEDTDTSAHRIVVVNATDNDGNDSLAATATITM
FT                   APINDAPAGADKTLTINEDSAHTFSQADFGFTDSNDLPPNSLLAVKITSLPALGSLTLA
FT                   GNAVSAGQFVSAADIAAGELVYTPVSEGSGNDYASFTFQVQDNGGTANGGVDLDASANT
FT                   ITIDVDPVNDAPVLSGSGSNLTTIDEDATSNTGHLVSSLIPGISDVDPVNLQGIAIHAT
FT                   SNAGPGVGTWQYQLAGSSTWIAFGAVSESGALLLKDTDSVRFVPDAQNGTTASFDYYAW
FT                   DQSAGSAGTTADVSTTRGGTSAFSLDGARASIEVTDVNDAPTLDLDDDGSGTGFTAIFR
FT                   PRGDAVAVVDDDLVIADVDTGDTLSGATVTITAGDRDNDFILQETLSSSLGESYAGSLG
FT                   TLTISGNGTETLTISGAGTHAEYATLLQSVRYLNSNPSATAGDRQVTISVTDSAVTEPG
FT                   QARSASAVTTIQTPWTPVIDLNGPGGAGRHHSVSYTEGQGALAIATADSTITDQDGNIA
FT                   HLTVTLRDGAPTGGTTESLGIAASLISTLAGLGITTTQTNAWTLEFDGPKDVSYYQLAL
FT                   RGVRYTNTSEAPAGTATVTVTPTDAGTGALVGVGATTTINFIGVNDAPTGSVTLDGTPA
FT                   ELQTLTANTSALGDLDGLTGASYAYQWQVSANGGTSWSDLSGATGASHALDDTLGGRQV
FT                   RVQVSYTDDAGFTNTVASAGQAITNVRDSFRLTEGPDTYDGRANPIAQVIEALGGNDTV
FT                   QGGAGDDRLYGQDGDDSLNGQYGDDVLDGGAGNDRLTGGPGTDTVLGGDGDDWLGGGFG
FT                   NDRQEGGDGNDVFAGNPSGDDVLDGGAGEDRADYSESSDAVRVDLRQSGPQWISTASGT
FT                   DTLISIEQLTGSAYADTLTGNTAANRLAGGEGDDTLSGQEGDDWLDGGAGNDRLTGGPG
FT                   TDTVLGGDGDDWLGGGFGNDRQEGGAGNDVFAGNPSGDDVLDGGAGEDRADYSESSDAV
FT                   RVDLRQSGPQWISTYSGTDTLISIEQLTGSAYADTLTGNTAANRLAGGEGDDILSGQEG
FT                   DDWLDGGAGNDWLGGGSGTDILTGGTGVDTFVFDTVPTISNIDVITDFNHAEDVIALSS
FT                   AVFTAFTGHEGERVGQNANLFYNNFSGTLYYDADGSQPGSAVAFAILGQDTHPVTFDTV
FT                   LIIA"
FT   gene            complement(274056..274829)
FT                   /locus_tag="Alvin_0234"
FT   CDS_pept        complement(274056..274829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0234"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; transcriptional regulator domain protein; KEGG:
FT                   dac:Daci_5378 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61199"
FT                   /db_xref="GOA:D3RME1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61199.1"
FT                   /translation="MPSSLIHQSLPLFWFKMDTLPHTHRPTIAIVEDEADLRLNLELFL
FT                   RSCGYPAWSVGSAEALYKHLVTRPTQIIIVDIGLPGEDGFSLIEHLAAANRYGLIAMTA
FT                   RGATADRIQGLKRGADLYFVKPVDLYELEAGIESVLRRLNQISRRRGEDQPDPWVLDLF
FT                   DSSLHAPNGEAVALTAREIELLAYLMSRPGEIIGKEDLLLHLSGSTAMDDFHRIETLLY
FT                   RLRKKAEQTLGLGLPVRSVFGRGLSFIGPAHIKRL"
FT   gene            274960..276915
FT                   /locus_tag="Alvin_0235"
FT   CDS_pept        274960..276915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0235"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   Diverse 7TM receptor extracellular region 2; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   dac:Daci_5380 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61200"
FT                   /db_xref="GOA:D3RME2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC61200.1"
FT                   /translation="MLLWSGPGQAGEEQRRWRLGSDLRYGLYLDDSGALGVEEVMALKA
FT                   DSFMPLCGVMALGYTRAAVWLRFEPPPLAPGQHDWWLEVAPSYLDTVDLYQNDGSQWSV
FT                   QHAGDWRPFAERAITHRHFVFSLRPDGQGPIFLRLQSASSMVGILTLWEPGAFVAADTH
FT                   RTLAWGLHLGAFAMLTVLMALLAVVFRNRELAIIALVGSFNLLAMAATKGFLAEWLWPS
FT                   QPRVASHAVGWISTWMLASACWMMRELLTRGTRQRWLDRCLMVATGLFVLAPLSLAIDR
FT                   YGEFMGPLYLLHALAAVMGVWVALIRVREHAGIYELAILTAFVIYVSVVVPLLLVLLGI
FT                   LGQASTLMSVWIVVIPLFLTISAVAQTLRIRRHYCAMAVARDQALDAARAAERRLEGEV
FT                   RLRTSELVRAQEKLRASLEFERRLRLEQRHLVDMLSHEFRTPLAIVDAVATNLTAVPPA
FT                   DGLDLRRRVDQIRRATGSLAQLIANYLNNDLLERGAFEASVRVTAIEPLIAEVSRLVAR
FT                   SPRHIFLVDPSEAPPFWSLDPFLIRIALNNLIDNAFKYAPPGEVCLTVRADEDSESLSL
FT                   MVSDLGTGISSEEAERIFDKFQRGRRISGIRGTGLGLFICREIARVHGGGIHLRMGDDS
FT                   LMGGVTFEIRLPLHPM"
FT   gene            277107..278840
FT                   /locus_tag="Alvin_0236"
FT   CDS_pept        277107..278840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0236"
FT                   /product="type I secretion system ATPase"
FT                   /note="KEGG: rce:RC1_0357 proteases secretion ATP-binding
FT                   protein PrtD; TIGRFAM: type I secretion system ATPase;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61201"
FT                   /db_xref="GOA:D3RME3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME3"
FT                   /inference="protein motif:TFAM:TIGR01842"
FT                   /protein_id="ADC61201.1"
FT                   /translation="MKPHHRTDDELRSALKASRDSFLFAGFFSLFINLLMLTPALYMLQ
FT                   LYDRVLVSRSESTLIMLTLLLVWLFVVMGLLEVLRSRILVRVSARLDMQLHPRLFGAMF
FT                   DARLRDGRGAGTQPIDDLSSLRQFLTGNGLFAFFDAPWMPIYIGVLFLLHPLIGIFAIF
FT                   AGVVLLSLAVANEMSTSKPLSKANGLVISARSYLGGNLRNTEALEAMGMLPRIHGRWLE
FT                   RHREALRLQALASDRAAFLSNSSKILRMLFQSLTLGLGAYLVLQQEVSPGGMIAASILL
FT                   GRALGPIDQLIGGWKGFLATRSAYKRLHDLLNSIPPRPRFMPLPAPDGRVSLEGVLAVP
FT                   PGSTLTVLRGVQFDIAAGEVIGIIGPSAAGKSSLARVLLGVWPVAAGKVRLSGADINHW
FT                   NRDELGPYIGYLPQDIELFDGTVSENIARFGEVDPERVVAAAKRAQVHEMILRLPKGYD
FT                   TPIGEGGAVLSGGQRQRIGLARAMYDKPVLIVLDEPNSNLDDQGELALVKAIAQLKSEG
FT                   TTVIIITHRPSLLGSVDKILVLREGHVEMFGPRDQVLAQFARPTAVSRPATGAISVQAA
FT                   G"
FT   gene            278850..280166
FT                   /locus_tag="Alvin_0237"
FT   CDS_pept        278850..280166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0237"
FT                   /product="type I secretion membrane fusion protein, HlyD
FT                   family"
FT                   /note="TIGRFAM: type I secretion membrane fusion protein,
FT                   HlyD family; PFAM: secretion protein HlyD family protein;
FT                   KEGG: avn:Avin_16250 type I secretion membrane fusion
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61202"
FT                   /db_xref="GOA:D3RME4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006144"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME4"
FT                   /inference="protein motif:TFAM:TIGR01843"
FT                   /protein_id="ADC61202.1"
FT                   /translation="MDITTADSAPLPTNDKPERLAGLLLLLLALGGFLSWAFLAPINGA
FT                   AVASGVVAVESARKIVRHLDGGVVSEILVREGDRVEEGEVLVRLDDTEASARLEIARGQ
FT                   YLALRAQEARLIAERDGLTQIPFADELIAAQGDMRIAEAITGEQRVFLARRQSLDGEKE
FT                   VLDQRRDQLQEQIRGLEALIATKTKRIGLYQEEIDGLLNLFDKGLGDKRTLREYERLSA
FT                   ELEGERAQHRSDIAAARIQIGETEIQIAQLKRKFTSEVVTELRDVETQLADLRERMRAL
FT                   GKTLERTVIRSPAAGAIVGSSVHTIGGVIRPGDHILDVVPEDESLIIEARVQPIDVDRV
FT                   SPGLEADLRMSAFNTRTTPVVQGRVLTISADRLLDESTRQYYYLARIQVTDDGMAKLKG
FT                   LTLQAGMPVEAMIKTGERTFIDYLVRPFTDSLAKAFREE"
FT   gene            complement(280175..281305)
FT                   /locus_tag="Alvin_0238"
FT   CDS_pept        complement(280175..281305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0238"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: tmz:Tmz1t_1123 UDP-N-acetylglucosamine
FT                   2-epimerase; TIGRFAM: UDP-N-acetylglucosamine 2-epimerase;
FT                   PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61203"
FT                   /db_xref="GOA:D3RME5"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME5"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADC61203.1"
FT                   /translation="MPMPLIDIIAGARPNFMKIAPIIRALEARQAAGGSLRYRLVHTGQ
FT                   HYDSRMSGDFFAQLGIPEPAVNLEVGSGSQAEQTAAIMTRYERLLLEAPCRLCLVVGDV
FT                   TSTMACAIAAQKRCIPVAHVEAGIRSGDWTMPEEINRMVTDAITNWFFTTSEVANANLR
FT                   RAGVDESRIFFVGNTMIDSLLANLPRLRQPPFWDELGLRAGEYFVLTLHRPANVDRGDG
FT                   FARLLAAIGAGTRGLPVVFPVHPRTAKTLHELGEVPANVQLVDPQPYLEFNYLVRSAKA
FT                   VITDSGGITEETTVLGVPCLTLRDSTERPETVTIGTNELIGTDPAKLGPALDRLFAGEW
FT                   KRGTIPERWDGQTGPRIVAALEQLLHLGRTSNSHAM"
FT   gene            281560..283374
FT                   /locus_tag="Alvin_0239"
FT   CDS_pept        281560..283374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0239"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: sugar isomerase (SIS);
FT                   glutamine amidotransferase class-II; KEGG: nis:NIS_0647
FT                   glucosamine--fructose-6-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61204"
FT                   /db_xref="GOA:D3RME6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME6"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ADC61204.1"
FT                   /translation="MCGIVGYIGAQEATAIVLAGLRELEYRGYDSAGLAVLEAGALRCF
FT                   KAVGKLDNLVAKVGDYRSSGPVTAIGHTRWATHGKPTEANAHPHGLTHSQVVHNGIIEN
FT                   YLALRDSVDTPFLSQTDSEVIVHLFEQRLAQQQPGLSGALAAFRDTLAALRGAYAILLI
FT                   SETLPGHVFFARLGSPLQIGLAADGCHFASSDAAMVGVCATAVYLEDGQWGVAGTDGLQ
FT                   LFDATGAVVEPRLLPLPASSLAARKEGFRYFMEKEIYEQPQVLADILTGRLRDEAVTLD
FT                   EFPSAWLANFSSVTLCACGTSYHAALAGSYLLERLARVPAKVEIASEFRYRDPVLDPRG
FT                   LFVVISQSGETADTLEALKLAKAQGLATLALCNVDNSSMVREASQTLLLRAGIEKGVAS
FT                   TKAFSAQVMTLWLLALYWAQSRDTLDTARRVEEIAAMRRTLDVVRVQKPVHERLHRLSK
FT                   RYLHGHGFFFIGRDLFYPLALEGALKLKEISYLHAEGYPAGEMKHGPIALADAELFTIA
FT                   LMARSTLYDKIKSNVEELSARDATIIAISTEDFELADDLIRIRAFEHPMLEFFEMLVVV
FT                   QLLAMEIAIRLGNDVDMPRNLAKSVTVE"
FT   gene            complement(283411..285111)
FT                   /locus_tag="Alvin_0240"
FT   CDS_pept        complement(283411..285111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0240"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; KEGG: app:CAP2UW1_2844 sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61205"
FT                   /db_xref="GOA:D3RME7"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME7"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADC61205.1"
FT                   /translation="MELHSFILSAIVLLTAAALSVTLFKHLGLGSILGLLVAGVAVGPH
FT                   SPGPYVTAHVEDVRNFTELGVVLLLFMIGLEMQPKRLWALRREVFGLGTVQILLSGLVI
FT                   ALYLSIYAPSWPVALLMGLTMALSSTALVMQLLHERGDLSTRHGTTAFAVLLMQDLAVV
FT                   PLLAIVPLMSDLGRAADEVSLGEQLLHVVALVGLVLVAGRYVVPFALDRLLRQNNREAF
FT                   ALVVMLAVFLAAWAMHEAGLSMALGAFMMGMLLSTTRFSFQIQAHVEPFKGLLMSLFFV
FT                   AVGMSIDLPAIADHPWLLAQHVLVILAIKLAALFGIAVVFGLPRGVATRVAFLLAQNGE
FT                   FGFVLFGFAKTLGLIDDATFVIALSVISVSMMLTPILVRIGDQVARRLERRPGPIQSFD
FT                   EATTGVVPKGRVVIGGYGRVGHTIATLLEVNQIPFIAFDTNPANVEHGVRDGRPVYYGD
FT                   IGDMELLTAAHVEGASLVVLTIDHGPTAHRAVSHIHQAYPYVPVIARARDLDACGSLIR
FT                   AGATRAYPEAIESSLRLGAEALQMLGVSTEDVDSLLKGVRGQNYAQVVD"
FT   gene            complement(285222..286550)
FT                   /locus_tag="Alvin_0241"
FT   CDS_pept        complement(285222..286550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0241"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: hha:Hhal_1170
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61206"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME8"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ADC61206.1"
FT                   /translation="MSQHPESRGLAVPSRRLSRLWHLGRATGDLAAGIGVKGLIDLART
FT                   RAGGQPARIQLSPEHTRRFTDRLARMRGAVMKMGQLMSMDGSDIFTPEAAEIMSTLRER
FT                   AEPMPLSQLSRVLETEYGAGWDKRFKRFEFTPIAAASIGQVHRAETRDGRRLALKIQFP
FT                   GVRESIDSDIANLAMLGRSFGMAPKGLDIAPFLEEARRQLHREADYDAEAEALESYRVW
FT                   VGDDPDFHIPAVHRDLTTRNILAMDFAEGVPVDRLAGPEYRRAERDRAATLLMRLTLRE
FT                   LFEFGLVQTDPNFGNYLYDAASGRIVLLDFGATKPVAPELVEQYRRLAASAISGDRAGM
FT                   RAASVALGYVGADDPDEHVEAMMDLLELASEPLRHPGHYDFGLSDLFERIYHRGRALFH
FT                   SGVFSTAPAPETLFLHRKFMGSFMLSRRLRARVELCEMARACL"
FT   gene            complement(286691..289762)
FT                   /locus_tag="Alvin_0242"
FT   CDS_pept        complement(286691..289762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0242"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: syn:slr2098 hybrid sensory kinase; TIGRFAM:
FT                   PAS sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-4
FT                   domain protein; response regulator receiver; Hpt domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS domain containing
FT                   protein; response regulator receiver; Hpt domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61207"
FT                   /db_xref="GOA:D3RME9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RME9"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADC61207.1"
FT                   /translation="MDPRLSIPDLFFLFAPDGTILEFRGPTDRLYVPPEQFIGKHPGEV
FT                   LPPDVAALFDRYLAAAVERSELVSFQYVLPLPDGPREFEARICPLNTNAQFLGVVRDLT
FT                   NARRLAERELLIETMFAQTTDSIALVDPETGRFLAFSDAVYRDLGYTREEFACLSITDI
FT                   QAEQASEEIAANIAAILNADIGGFATRHRDKEGRIHDVEINFRRVIHDGRTLISSVWRD
FT                   VTELKRQERERLETARELEAYRGHLEELVATRTAELEAAKVAAEGANRAKSAFLSNMSH
FT                   EIRTPMNAIIGYSHLIRQEPLTPRQTEQLNRLNDSAQHLLQIINDILDLSKIEAEKLTL
FT                   EARDFEPARVLDHVFNLVADQIQAKELNVLVDLDHVPLRLHGDGVRLGQILLNLISNAV
FT                   KFTERGQIAIAVYPMSVPLAGAADPETLWLRWTVRDTGIGMTAEQLARLFRAFEQADGS
FT                   TTRRYGGTGLGLAISKRLTELMGGRIGASSQPGTGSEFWLEIPFEPAREPAHPDPKLED
FT                   LRGRRALVIDDHPEARAILIHLLESLGLRAEAVAGGLEGVSAVIEADRRGDPYHLITID
FT                   WKMPDMDGLETVRRLQALPVRYHPELLMVTAYGDQLPDSCREDMGAIQVLAKPVTPSGL
FT                   HDALAAALQGARDLPVVQDRVDTPADHGERLRGARILVAEDNEINQEVILQLLQATGAR
FT                   VTLAENGREALEQVCANAYDLVLMDVQMPVMDGLEATRAIRARAEYRELPILAMTANAF
FT                   ESDRRQCIEAGMNDHLAKPIEPERLTETLARWLPHVLERTADIQPAPRTETRNAPPPTS
FT                   LVDRQALESIPGLDLEQGLKPLRGNLALYLRLLGRFIDQHRADTDQLAEHLGRGDLAAL
FT                   EHEAHQLKGSAATLGAHVLRDLAQTLEQSARAHQPSERLQPVLELLAAELEALTGHLCA
FT                   VLPHLDADQPPAPAAPADDLDRARLNTVLTQLAELLADHDTAVNDLFEQVRPLLRAAFG
FT                   ETANRLDRQIRGFDYEQALETLHAVRMTDEDSRD"
FT   gene            complement(289797..290432)
FT                   /locus_tag="Alvin_0243"
FT   CDS_pept        complement(289797..290432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0243"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: mms:mma_2596
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61208"
FT                   /db_xref="GOA:D3RMF0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF0"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ADC61208.1"
FT                   /translation="MPNTISALEALDRLREGNQRFAQNLTSLDRMMSYQRRAELTAGQK
FT                   PFAIILGCSDSRAPAEILFDQGLGDLFVIRVAGNVVAPSQIGSVEFAVSRYNTRLVVVL
FT                   GHSHCGAVSATIETLLEGEGSESRNIASIVDRVKPSVQPLLDTDLRYDREALRGAAVRA
FT                   NVRASANQLRHGSRIIESLIESDGLLVVGAEYALETGRVDFFDGVPDA"
FT   gene            complement(290494..291792)
FT                   /locus_tag="Alvin_0244"
FT   CDS_pept        complement(290494..291792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0244"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   tcx:Tcr_0917 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61209"
FT                   /db_xref="GOA:D3RMF1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF1"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADC61209.1"
FT                   /translation="MSLLKLKLHWQILIALVLAVLVGLIVGRETGLFGVSFYAIFDFVG
FT                   QLFLNALKMLIVPLIVSSIIVGVSGLGGSEHLGRLGGKTLGYYAMTSLLAILVGLALAN
FT                   LIQPGVVEGDPAEVFGFSAEAAALQERLGDRDAGDVVEVFLRMIPTNVIEAAAQGQMLG
FT                   LIFFSLLYGFFLTRLNETQGGIQRRFFEGLFEIMMRITDLIMRFAPIGVFALVARTVAD
FT                   TGLEAFGPLALFFLTVTLALATHFLVVMPLLLYFLGGVDPRRHYAAMGAALVTAFSTAS
FT                   PSATLPITMDCVEKNAGVSNRTSSFVLPLGATVNMDGTALYECVAVLFIAQAYGLELSL
FT                   GTQFLVVSLALLTSIGVAGIPAASLVAIAIILSAVGLPLEGIGLILAVDRVLDMMRTAV
FT                   NVFSDSCGAVIIARSEGERNVLKLQPNSTVPSV"
FT   gene            complement(291811..293784)
FT                   /locus_tag="Alvin_0245"
FT   CDS_pept        complement(291811..293784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0245"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; KEGG:
FT                   dat:HRM2_24260 alpha amylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61210"
FT                   /db_xref="GOA:D3RMF2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF2"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADC61210.1"
FT                   /translation="MYEQVSHALLNDILDDLSHQVVREDLRHFYTRLGANFYAIHSLFA
FT                   HLYGHREDFKERITELTERLARAYIARPESLRRLDMEREENHNWFLSQEWTGMALYLDG
FT                   FAGNLQGLMQRLPYLQELGVNMVHVMPILRCPLGASDGGYAVSDFRDIDPRAGTVEDVR
FT                   ALGEAMRARGMLLTLDVVVNHTSNEHDWAQRARNGDKTYQDFYYVFPNRDVPDMFEETL
FT                   PEIFPETAPGNFTWDADMGKWVMTVFNTYQWDLNYSNPAVFIEMLDIVLFWANQGADIL
FT                   RLDAVAFLWKKIGTTSQNEREAHLILQMMKDCCQVVAPGTLFIAEAIVAPSEIIKYFGE
FT                   DAVIAKECEIAYNATFMALLWDAVATKNAKLLSQGIKSLPVKLDRATWLNYVRCHDDIG
FT                   LGFDDADIRACDYDPYAHRRFLVDWFTGAFEGSPARGRPFGVNHKTGDARIAGALASLA
FT                   GLDAALDSGDQTAIDHSVALILTLHGMILSFGGIPLIWYGDEVGTLNDCSFLDDVNKAG
FT                   DARWIHRPRIDWNRVERRREQGTVEQRIFDGLKRLIAVRKNTPAFADFNNRELIDAGNP
FT                   HIFAFLRTHPSMPGSSVLVAANFDVTPQYLDLDAPAYRGLFRGGQIQDLVSGDSPALLN
FT                   NRVVIPPYHFYWLADQRARSLL"
FT   gene            complement(293818..294579)
FT                   /locus_tag="Alvin_0246"
FT   CDS_pept        complement(293818..294579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61211"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF3"
FT                   /inference="similar to AA sequence:KEGG:PSEEN0611"
FT                   /protein_id="ADC61211.1"
FT                   /translation="MLILVSGEGPTDMGRCTGADPVMGTAFEAGPMAWLVDQIAETSEG
FT                   YPFIDAELMFCVSKQRLSEVSKRLQPASLPGRRRGKETAYYFRNARGLAQIAAELAKLW
FT                   EQPVIPILFRDGDGTQSAGRGVWRDKWDSMCHGFAYEGCSVGVPMIPNPKSEAWLLCAL
FT                   KLFQPYQHCDHIEQASGNDAGLEPLKAQLEAALGEPSTAAQLAELVRDGRVDAARIAMP
FT                   SFVEFRHRLQAVLAAPEKSRGEQSAHGCVGQ"
FT   gene            complement(294557..295768)
FT                   /locus_tag="Alvin_0247"
FT   CDS_pept        complement(294557..295768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0247"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: pen:PSEEN0610
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61212"
FT                   /db_xref="GOA:D3RMF4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF4"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADC61212.1"
FT                   /translation="MSAQPAPPIRLRSIYVDNFKSLVDFQLSLAAFTCLIGLNGSGKST
FT                   VLQAIDFISRLFKGNVSQWLEQRQWKPGDINSKLSGKSNLKLSIDLSGADGNFSWDCSF
FT                   NRSLLRCTQETVKLNGKTLLSVADGHYWFGDVVHAGATVARTKVAFEYEGSILSQLKDE
FT                   VLPKPLLPLKRFLQQTASLDLLAPQLLRKRAAQSQGELGMGGERLSAFLSELSDEQRLT
FT                   LGSQLKTAYPHLEQFVTRSLRAGWKELGIREQFGDKGLYTEARHINDGMLRLMAILAEI
FT                   LTDHQFLLFDEIENGINPELVEFLLDVLVNAHQQILVTTHSPMILNYLDDSVAREGVQY
FT                   LYKTPEGFTRAVPFFSIPSLAAKLEVMGPGEAFVDTHLSRLPEEIDAMRTINVERPNAD
FT                   PRQR"
FT   gene            complement(295781..296194)
FT                   /locus_tag="Alvin_0248"
FT   CDS_pept        complement(295781..296194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0248"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc; KEGG: neu:NE1373 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61213"
FT                   /db_xref="GOA:D3RMF5"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF5"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADC61213.1"
FT                   /translation="MSAAKVFFDTNILLYLLSEDVAKADRAEALLAAGGVISVQVLNEF
FT                   ASVASRKLRLSWPEIHEVLDTVRRLCRVEPLLLATHERGLEISEHYGFSIYDALIVASA
FT                   LSAKCEVLLTEDLQDGQRIDDRLLVRNPFGQTC"
FT   gene            complement(296181..296414)
FT                   /locus_tag="Alvin_0249"
FT   CDS_pept        complement(296181..296414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0249"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: neu:NE1374
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61214"
FT                   /db_xref="GOA:D3RMF6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF6"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ADC61214.1"
FT                   /translation="MQVSRWGNSLAVRLPAAVVEALDLHEGDAIEIQVDSARALSIGKA
FT                   PDNRALLERLRKYRGRLPEGFRFDRLEAHERG"
FT   gene            complement(296506..297426)
FT                   /locus_tag="Alvin_0250"
FT   CDS_pept        complement(296506..297426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0250"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: noc:Noc_3070 PfkB
FT                   family of carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61215"
FT                   /db_xref="GOA:D3RMF7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF7"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADC61215.1"
FT                   /translation="MKHTSVQIFGEVLFDHFPDGRRVLGGAPFNVAWHLAAFGAAPRFI
FT                   SAVGEDSEGEQIRASMEDWGLITSCLQTDPEHPTGAVTVSLVDGEPSYDIVPERAYDFV
FT                   RAPEDIAPGGLLYHGTLALRGPVSAATLDELKSAGPDLIFLDVNLREPWWSLDQTRELV
FT                   TEADWVKLNRDELARLSDAAPEHEGWLASDPESRSALIESAQRFLERHDLAGLIVTLGA
FT                   EGALGLTQDADPVLVAPPHALEVVDTVGAGDAFAAVTLLGLIHGWPLATVLERAQAFAA
FT                   RIVGQRGATRADRALYAPLIADWKR"
FT   gene            complement(297441..298277)
FT                   /locus_tag="Alvin_0251"
FT   CDS_pept        complement(297441..298277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0251"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: sucrose-6F-phosphate phosphohydrolase; KEGG:
FT                   dba:Dbac_2913 HAD-superfamily hydrolase, subfamily IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61216"
FT                   /db_xref="GOA:D3RMF8"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF8"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ADC61216.1"
FT                   /translation="MNARSLLLCTDLDRTLIPNGREPESPEARPWFRRLVAEPEVALAY
FT                   VTGRHRALIESAIAEYALPVPNFVIGDVGTSLHVIVEGVWERVQDWETEIATDWAGPAD
FT                   IADWLADLDGLREQEREKQGPFKLSYYTPADLDPETLRARIRERLERHEVRANLIWSID
FT                   EAAGVGLLDILPAKASKRHAIEFLMCRIGRGLDTTLFAGDSGNDLEVLVSPVRSILVAN
FT                   AHPEVREMAVAQSRELDLADRLYCAQGGWRGLNGNYGAGILEGVAHFRPDLADRIG"
FT   gene            complement(298274..300502)
FT                   /locus_tag="Alvin_0252"
FT   CDS_pept        complement(298274..300502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0252"
FT                   /product="sucrose-phosphate synthase"
FT                   /note="TIGRFAM: sucrose-phosphate synthase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: sucrose-6F-phosphate
FT                   phosphohydrolase; glycosyl transferase group 1; KEGG:
FT                   mgm:Mmc1_3516 sucrose-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61217"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR012821"
FT                   /db_xref="InterPro:IPR012822"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMF9"
FT                   /inference="protein motif:TFAM:TIGR02472"
FT                   /protein_id="ADC61217.1"
FT                   /translation="METEGTALRGRQETGELHPMYILMLSLHGLIRGHDLELGRDADTG
FT                   GQTKYVVDLARALGERADVSRVDLVTRRVVDPAVSPDYAEAVEPLNAKARILRLDAGPE
FT                   GYLPKEQLWDHLDGFVDNLTALLHEQGQWPDIIHSHYADAGYVGSRLANLIGVPLVHTG
FT                   HSLGRDKRQRLLAAGLDSDQIDARYNMLRRIDAEETTLATAELVITSTHNEIEEQYGLY
FT                   DYYLPERMRVIPPGTDLKQFHPPADDDPLPPFAEVVERFLDEPDKPLILALSRADHRKN
FT                   IIALVEAYAESPRLRALANLLIVAGNRDDIRDLDEGARTVLTDILITIDAHDLYGQVAL
FT                   PKHHSADEVPEIYRLVARSGGVFINPALTEPFGLTLLEAAATGLPLVATENGGPVDIIG
FT                   NCKNGLLVDPLDRTAIAEALLKILEDRETWTTYSQNGLAGVRRFYSWTSHAERYRALIG
FT                   PLTELHEHIPDTPPMRRAMVYRDRALFTDLDQSLLGDPEGVEQFVAMMKRNKRCANFGI
FT                   VTGRRLDSVLIELKRHGIPVPDVLITSLGTEIHYSGQLVLDDYWADHVDHLWSPRAVRR
FT                   ALAEIPGLVPQRKIEQSRFKISYHYDPTIAPSVEEISTLLRTRELSVNVIHAFGQFLDI
FT                   VPIRASKGQAVRYVTHRFGIPLEHVLVVGGSGADEDMMRGNTLAVVVANRHHEELSQLA
FT                   DLDRIYFAEQAHAKGILEAIDHYDFFRSCRVPDPIPQPVAEPEPEAPA"
FT   gene            300714..301130
FT                   /locus_tag="Alvin_0253"
FT   CDS_pept        300714..301130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0253"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mac:MA0735 phenylacetic acid degradation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61218"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG0"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ADC61218.1"
FT                   /translation="MNPSQIQDFFRNDRFAAHVGIELLEVGSGRARAQLLIDDRHLNAV
FT                   GVAHGAAIFSLADLVFAVASNSHGTVALGVNVSVSFMKAARCGLLIAEADEVSINPKLA
FT                   TYVIRVSDEAGQAVALMQGTVYRKQEALDDYIGR"
FT   gene            301171..301944
FT                   /locus_tag="Alvin_0254"
FT   CDS_pept        301171..301944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0254"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="PFAM: molybdopterin binding domain; KEGG:
FT                   mfa:Mfla_0357 molybdopterin binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61219"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG1"
FT                   /inference="protein motif:PFAM:PF00994"
FT                   /protein_id="ADC61219.1"
FT                   /translation="METEAREPVAFGLIVIGDEVLNGARVDGHLPAFKRLIGERGHTLA
FT                   RYWMLPDDPDVLTTHLRFSMGRPEPVFVCGGIGATPDDHTRACAAAAAHVELVRHPEAA
FT                   RLIEDKFGESAYPHRILMADLPAGADLVPNPVNQMPGFTLARHWFLPGFPKMAWPMAEW
FT                   VLDRHFGRCVQARESAVLVRGVPESQLIPLMRRLTLEYPELKHFSLPHMGEDPHIRLGF
FT                   RGRDGLDDAMRELRQALDEAAFEYIEAPVDGARED"
FT   gene            complement(301972..302307)
FT                   /locus_tag="Alvin_0255"
FT   CDS_pept        complement(301972..302307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sru:SRU_2625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61220"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61220.1"
FT                   /translation="MANLTDLISDLVAATDQMKPAAQGDDWDMVERLQKRRRVLIESIV
FT                   ERAAHEPITEEDAERLRAVRRHEATVAALAGTQRQALREAIAELQGEGRIDKLSRMQRA
FT                   YRDSGYS"
FT   gene            302404..303636
FT                   /locus_tag="Alvin_0256"
FT   CDS_pept        302404..303636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0256"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bmr:BMI_II330 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61221"
FT                   /db_xref="GOA:D3RMG3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG3"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADC61221.1"
FT                   /translation="MPAHTAMPECRISPARSSARSRLSPPISTSTRYLQAGVLCAALAL
FT                   ALTGCEPAKPTAAKREMPPPSVIAVAAETRTIEDEAKFVGRVVAVDRVELRARVEGFLK
FT                   ERRFKEGQTVVVGDVLFLIEPDQYAAVVEQREADLEKAKADSQNADAQLARGLELLKQK
FT                   NIAQAKVDELQAAAAVAKASIAQAQAALNAARLDLSYTRIIAPIAGRIGLANLSVGNLV
FT                   GPSSGVLATIVSRDPIHVQFPVTQRDLLAARRQIESKGGDPRKVVIQARLPNGKLYEHS
FT                   GHLDFVDVTTDRATDSVTLRAELPNPNGTLVDGQYVGVVVQSGEPESAILIPQSALQVD
FT                   QQGLYVLIVDAEGKAQVRRVKTGQTKGAEIAVTQGLNAGDLVIVEGIQGVTPGQPVKAA
FT                   PPQQAETGAKP"
FT   gene            303633..306794
FT                   /locus_tag="Alvin_0257"
FT   CDS_pept        303633..306794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0257"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   sme:SM_b21498 putative acriflavin resistence protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61222"
FT                   /db_xref="GOA:D3RMG4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG4"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ADC61222.1"
FT                   /translation="MISDVFIDRPRLAIVISVVLTLVGLVALTQLPVAQFPDIVPPQVS
FT                   VSTSYPGASAAVVESTVAQPLESRINGVDNMLYMKSSSNNDGSYSLTVTFALGTDPDIN
FT                   TVNVQNRANLAMAQLPEEVKRQGLTVKKQSSAMLQVVALYSPKNSYDGLFLSNYAAINV
FT                   IDTLARVPGVGEVSQFGPLDYSMRIWLDSDRLTALGLTPSDVVSAIQSQNVQAAVGRIG
FT                   AQPMTSDQQFQITLQTQGRLSDVEEFERILVRANPDGSRILVSDVGRVELGAKQSDAVS
FT                   RLDGRPTAAMAIYLAPGANAVSVADGVDAAMQKLAERFPDDLDYAVVYDTTDFVKASLE
FT                   KVVHTLFEAFVLVILVVFLFLGSWRATLIPLIAVPVALIGTLAFLLLIGFSLNTISLLA
FT                   MVLAIGIVVDDAIVVVENVERLMEEEGLSPREAAKKAMGQITGPIIAITLVLLSVFLPV
FT                   AFIPGITGQLFQQFAAVVAFSMLISAINALTLSPALCALLLKPTHHQRGIMRYVMGGID
FT                   RVRDGYAAVVRRLVRFSLLVLVLIAGVGLATGWLFKITPTGFLPTEDQGAFMAHVQLPE
FT                   GASVNRTLAVVEQVEQIVLADPAVEHVIAIPGYNIVDGSIQSNAAAIVGRLKPFEERTT
FT                   PDLAATAVIRRIAVETAGLSAARVMPFNLPPIVGLGTGSGFEYQLLDLQGSEPADLAAV
FT                   MRGLVLAANQDPVLSRVYSTWTTSNPQVDLKLDREKAQTLGLPINSIFNALQSTLGGYY
FT                   VNDFNRFGRVWQVKIQGEESDREAFEDVYRIHVRNTEGEMVPLRALMSAELIVGPQLIQ
FT                   RYNNYRSVTLQGGPKPGYSSGEAIAAMERVSVETLPNGYGFSWTGTALQEKDAGGKTPI
FT                   VLGLAVLFAYLFLVGLYESWSMPTVVLLSVTVGVLGAMVALLIARLANDLYAQVGLVVL
FT                   IGLASKNAILIVEFAMEQRASGRSILEAAVTGARLRIRAVLMTSFAFILGLVPLILASG
FT                   AGEASQRAVGTAVFGGMLAAALIGIFLIPMLYVVFQRLREWAHGSASQHGGAEPNASHP
FT                   NEAHP"
FT   gene            306957..307391
FT                   /locus_tag="Alvin_0258"
FT   CDS_pept        306957..307391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0258"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: mag:amb0279
FT                   rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61223"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG5"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADC61223.1"
FT                   /translation="MPYQSVRRFVALIVASLVFVAGAQAGGLDLSPQEALAKAKAGEIL
FT                   LIDIRTPPEWRETGVAPEAHRIDMTDPKFLERLLQDMGGDKSAPIALICRTGNRSGYVQ
FT                   KQLQKMGFSQVHNVPEGMAGSRSGPGWIRRGLPVETCTNC"
FT   sig_peptide     306957..307034
FT                   /locus_tag="Alvin_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.970 at
FT                   residue 26"
FT   gene            307456..308019
FT                   /locus_tag="Alvin_0259"
FT   CDS_pept        307456..308019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0259"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61224"
FT                   /db_xref="GOA:D3RMG6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG6"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ADC61224.1"
FT                   /translation="MKKSPLALAAVLFAVAVTPALAANPKVALDVSIGGQPAGTITLEL
FT                   FADVVPRTAENFRALCTGEKGEGLAYAGSPFHRIIPGFMIQGGDFTNGNGTGGKSIYGE
FT                   MFEDENFTLKHESAGTLSMANAGPNTNGSQFFITVDSTPWLDGRHVVFGKVVDGMDVVR
FT                   AMEQQGSRSGRTQAPVMLEACRQL"
FT   sig_peptide     307456..307524
FT                   /locus_tag="Alvin_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            complement(308074..308424)
FT                   /locus_tag="Alvin_0260"
FT   CDS_pept        complement(308074..308424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0260"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: Hpt domain protein; SMART: Hpt domain protein;
FT                   KEGG: sml:Smlt4296 putative sensor histidine kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61225"
FT                   /db_xref="GOA:D3RMG7"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG7"
FT                   /inference="protein motif:PFAM:PF01627"
FT                   /protein_id="ADC61225.1"
FT                   /translation="MRHLNHDVLDTLRETLGESDFFEVTNTFAQQFERQLQALRQHAEC
FT                   RELPECAHILHSLKGSAGNIGAQTLAEITQTFEQQIRGGDISLESMIEVLSSTINTTID
FT                   ELRDSGYLGAAP"
FT   gene            308608..309777
FT                   /locus_tag="Alvin_0261"
FT   CDS_pept        308608..309777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0261"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; Metal-dependent
FT                   hydrolase HDOD; SMART: response regulator receiver; KEGG:
FT                   pmy:Pmen_4310 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61226"
FT                   /db_xref="GOA:D3RMG8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61226.1"
FT                   /translation="MIRVMIVEDDPATGALLRQLVRRIWPGATVTLDADPLLALDRWRT
FT                   QGADLILLDWELPGMSGLEILKTIRRLGAKTSCVMITSHSDREQILAARAFHVDAYIVK
FT                   PFDAKQIMERLSRIVDVDMASDVSCESFESLDDFIESRLKQDLPGLPIAPELVERIVGI
FT                   RAMEAPERIRLLRECQFEPGLLFRMLSLANSSRYIDGMDVVETFEGAIRKIGLDAFINL
FT                   AVEVSLHPGSHIEHASLAHKCFELRRRAMSLVGILVKLREHLEFNLDSCRTACILHSMA
FT                   ELSLLQLMQTWVDAGHAIDETTRDAVFDRYTERAREPLQAQWTIPNTLRERIDALDRLP
FT                   AGTVVRKEPIIMRIVALLHAGDPQRELPRLMARFGLSGRIDAISTGSAS"
FT   gene            complement(309840..310802)
FT                   /locus_tag="Alvin_0262"
FT   CDS_pept        complement(309840..310802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0262"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: maq:Maqu_3695
FT                   DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61227"
FT                   /db_xref="GOA:D3RMG9"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMG9"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ADC61227.1"
FT                   /translation="MRHNRETRYWERCAGFWSWRGAFLALILVLGCTPPVVADVSPRSV
FT                   TAPQTTTEQAATPPALILANVYREGIDLSRYWVSEKLDGVRAYWDGSRLITRGGQPIAV
FT                   PVWFTDGFPAIPLDGELWMGRGTFEVLSGTVRSLEPDHDAWRAVSYRVFDLPGMDAPFG
FT                   ERLQALERLLADTPNPRIAPVEQFRVADHADLMARLETVVAGGGEGLMLHRDDAPYRAG
FT                   RSDDLIKVKPYLDAEARVIAHLPGKGKYEGMLGALLVEEPSGQRFRLGSGFSDAERRSP
FT                   PPIGSRVTFKYHGRTRNGIPRFASFLRVRDPATRSDSTH"
FT   sig_peptide     complement(310686..310802)
FT                   /locus_tag="Alvin_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.903 at
FT                   residue 39"
FT   gene            complement(310828..311844)
FT                   /locus_tag="Alvin_0263"
FT   CDS_pept        complement(310828..311844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0263"
FT                   /product="dihydroorotate oxidase"
FT                   /note="PFAM: dihydroorotate oxidase; KEGG: tbd:Tbd_2467
FT                   dihydroorotate dehydrogenase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61228"
FT                   /db_xref="GOA:D3RMH0"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH0"
FT                   /inference="protein motif:PFAM:PF01180"
FT                   /protein_id="ADC61228.1"
FT                   /translation="MNLKTTYLGLTLKNPLVPSASPLSRSLSAAREMEDSGAAAIVMYS
FT                   LFEEAITAEAESMTRFLHHQDTGFAESSAGFLPDHQDFENGLERYLEQIRRLKESLDIP
FT                   VIASLNGVTTGGWVKHALELQQAGADALELNVYYIAGDISQNGAQVEQRYLDLLTELRG
FT                   RIRIPINMKLSPSFSSIGHFVGRLAAAGANGVSLFNRFYQPDINIDSLRLQARLHPSTS
FT                   AEALLAMRWIALLYGRVPGLSLGATGGIHTSEDAIKLLLAGADVVHLCSVLLQKGPVYT
FT                   GLILRGIADWMEEQGFESVEDFRGRVSALTVPNPAELERANYINVLDSYSAAPGVMT"
FT   gene            complement(311920..315501)
FT                   /locus_tag="Alvin_0264"
FT   CDS_pept        complement(311920..315501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0264"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="KEGG: sus:Acid_6996 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain-containing protein; TIGRFAM: pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; PFAM: pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein;
FT                   Pyruvate-flavodoxin oxidoreductase, EKR domain;
FT                   Pyruvate/ketoisovalerate oxidoreductase; SMART:
FT                   Pyruvate-flavodoxin oxidoreductase, EKR domain"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61229"
FT                   /db_xref="GOA:D3RMH1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH1"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ADC61229.1"
FT                   /translation="MSHNSLVTLDGNEAAAYVAHLTNEVIAIYPITPSSNMGEWADEWS
FT                   SLGVKNLWGTVPDVVEMQSEGGAAGAIHGALQGGSLATTFTASQGLLLMIPNMYKIAGE
FT                   LTPTVFHVSARALAAQALSIFGDHSDVMACRATGYAMLCAGSVQEVMDFALIAQAATLE
FT                   SRLPFLHFFDGFRTSHEVNKIERLPVETIRALIDEELVKAHRERALNPDHPKLRGTSQN
FT                   PDVYFQGRETVNPYYAAAPAIVQGVMDRFAALTGRQYRLFEYVGAPDAERVVMLMGSGL
FT                   GAAEEAVEHLTARGEKVGLLKIRLFRPFDASALIAALPASASRIAVLDRTKEPGSDGEP
FT                   LYKDVTTALARAFSAGELSTMPRVIGGRYGLGSKEFTPAMVKAVFDELAQETPKNPFTV
FT                   GILDDVGHTSLAWDPDFKADAIQGVTACVFYGLGSDGTVSANKNSIKIIAEETPNHGQG
FT                   YFEYDSKKAGAVTISHLRFGPNPIKSTYLIGDNEANFVACHQPTFLTRYDMLDKARAGA
FT                   VFLLNSHTPPDRVWDDLPKRMQRTIIDKGLTFYVIDAYGIAAATGMGRRINTIMQTCFF
FT                   AISGVLPREEAITQIKHAVEKTYGKKGQALLDRNYQAIDAALAGLHQVQVPAQVTSTFD
FT                   RPPVVPDAAPEFVRRVTATLMAGHGNQLPVSLMPADGTWPTGTTRFEKRQLALQLPKWD
FT                   ENLCTQCGKCPLVCPHAAIRAKVYPAALTNGAPASFKHAAIKGKDFPEGYRVSYQIAPD
FT                   DCTGCGLCAEVCPIRDRTNPDHKALDMVEAGEIQPAEQLNWDFFLTLPEYDRTQLDATK
FT                   IKHAMMMQPLFEFSGSCVGCGETPYIKLATQLFGDRMLIANATGCSSIYGGNLPTTPYT
FT                   TNAEGRGPSWNNSLFEDNAEFGLGLRLAVDKQAEQARELVARLAGRIGETLADGLLNAD
FT                   QSTESGIHEQRERVAALKAKLAGIDSAEARALLALAEQLVKRSVWIIGGDGWAYDIGYG
FT                   GVDHVLASGRNVNLLILDTEVYSNTGGQKSKATPLGAVAKFAAGGKPTFKKDLAMMAMA
FT                   YETVYVAQVAFGAKDVQTVRAFLEAESYDGPSIIIAYSPCIAHGVDLSNNLRQQDMAVN
FT                   SGHWPLLRYDPRRTARGENPLLVDNKAPSVPYRDFINSETRFSLLTRTHPEAAERFLDL
FT                   AQKHVDTRFSLYEQLAHLAVQKGPASE"
FT   gene            315722..316225
FT                   /locus_tag="Alvin_0265"
FT   CDS_pept        315722..316225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0265"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase;
FT                   KEGG: tgr:Tgr7_2151 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61230"
FT                   /db_xref="GOA:D3RMH2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH2"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADC61230.1"
FT                   /translation="MNTASASTDKGACKRLRVRPMCQADLDAVLAVEYAAYAFPWSREI
FT                   FEDCLKAGYNCWLGEIDATIVAHGVMSVAVGECQIFNLGVHPDWQGRGLGRQMLRHLLR
FT                   LARRREAETAFLEVRVSNTAALALYRAEGFCEVGRRRHYYPAPNGREDALVLALELMTV
FT                   GPGS"
FT   gene            complement(316306..316459)
FT                   /pseudo
FT                   /locus_tag="Alvin_0266"
FT                   /note="hypothetical protein"
FT   gene            316753..319812
FT                   /locus_tag="Alvin_0267"
FT   CDS_pept        316753..319812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0267"
FT                   /product="Peptidase M10 serralysin"
FT                   /note="PFAM: Peptidase M10 serralysin; Hemolysin-type
FT                   calcium-binding region; KEGG: cph:Cpha266_2326
FT                   hemolysin-type calcium-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61231"
FT                   /db_xref="GOA:D3RMH3"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH3"
FT                   /inference="protein motif:PFAM:PF08548"
FT                   /protein_id="ADC61231.1"
FT                   /translation="MATYYFSKITNGQTLTFTPGSDILQFDDDTISAGLGSVTQVQTDL
FT                   LFSYGGKTFTLKNVVLGQLTMSNVKFKNGSLLLVGDNTTDIAKDELNNPLTGAAQSDFL
FT                   HGLGGNDTLDGKAGADIMIGGDGADTYIVDNDSDQVNETNASTGLDQWDTVKSSVSYTL
FT                   GANVEQLNLTGATAINGTGNTLKNVLIGNSAANRLDGGKGDDRMEGGNGNDTYVVDSTK
FT                   DEVIETSALAAGGVDTVESWISYTLTANVENLLLLGTANNSATGNTLNNRLTGNSGSNR
FT                   LDGVTGADTMEGGDGQDVYVVNSADDVVIETNTSTSSLQIDLVEASLSYTLTANVEWLQ
FT                   LMGTTSINATGNTGDNLLIANVGNNVFDGVSGNDTVSYSLSSPYIASINPKSSINQSAN
FT                   PALAGVKVSLAVTGAQATIGSGMDKLNNIDNLIGSRFNDQLTGNSSANILDGGLGADVL
FT                   IGGDGNDIYYVDGNDTVIETNASKTQSDTVRSIVSYVLGANLEKLELIGSDNIHGTGNE
FT                   LQNTIIGNDKDNLLDGAGGADRLEGGKGNDTYLVDGFDTVIEAGSAGTDTIMTEVGILN
FT                   NTLPTNVENLLLLGSVNLTGKGNTLANVIYANVGDNLLDGVKNTSSSSKDTLSYEFGAT
FT                   AGVRVNLSLLGSAQNTGGSGTDTLVGDSFHNLTGSYYNDILQGTTSDNVLNGLGGSDTV
FT                   SYENSATGSVIINLNLSTRQNTLGSGGDTLLSIENITGSTFDDTIIASSGNNIMDGGLG
FT                   SDTVSYVKSDGLVAVNLAVTTAQNTGGSGKDTLIKIENLIGSNYNDSLTGNTGANRLDG
FT                   GKGADALKGGAGDDVYVVDNAGDVVTEAFSQGNDTVQSWINLTLGGNIENLELMYDKSL
FT                   GDANNPKTGTGNTLNNTLTGNALSNTLSGLGGNDVLDGAGGQDSLTGGGGADRFVFSVV
FT                   TDTSASMPDVITDFTRSQSDKIDLSLATFYEGVFKFVGIKAFSGVSGELRYQTLSNKTL
FT                   ITGDTNGDKVADFAIELTGAIAMQASDFVL"
FT   gene            complement(320029..320341)
FT                   /pseudo
FT                   /locus_tag="Alvin_0268"
FT                   /note="hypothetical protein"
FT   gene            complement(320536..322284)
FT                   /locus_tag="Alvin_0269"
FT   CDS_pept        complement(320536..322284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0269"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   gvi:gll2284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61232"
FT                   /db_xref="GOA:D3RMH4"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH4"
FT                   /inference="protein motif:PFAM:PF04434"
FT                   /protein_id="ADC61232.1"
FT                   /translation="MLDTVITVDNLMDLAGSKVFWRGESYFSGNAVGRVRVMGDRIKAR
FT                   VQGTEVYQVELWDDGGQLGYDCTCPHAADGYFCKHCVAVGLAWIGGAADRPDVDDEDGT
FT                   AVSRTPTDPWKLIQSYLETQPQETLVSRLMEIARRDDRLYQSLLLKAERGRSGSDQAKR
FT                   FRRAIDEATRGAEDDWQSAEEFAEDLGAVIDALEELLEPQSATLLIDLTEHAIERAEKA
FT                   MQHIEDDEEGAGVEVVERLGELHQKACRLAPPDPVELAERLFRLEGRQDLQFVSFSPDT
FT                   YSEALGERGLKRYRELVEAQWRDLSPPDAGRYDPQYARLKRLMECLARLDGNVEELVAI
FT                   RARDLDSSYSYLDIAEIWTQAGEPERALEWAERGLAAFPENTSNRLRDFLVAAYLERGR
FT                   RDEALALTWVQFDEQPELSCYQKLKAVAERLGIWPEQRERALKRLEEYIQTEAAKTSRW
FT                   RPRTSEPDYSSRVEIALWEEDPEAGLEAVGRGTCDSRLLIRLAGQLEAGQPDEAMKLYR
FT                   RIIQPTIEQTNSRAYEEAVKLIRRVGELMKQQERLPEFREYVEGLRARYRAKRNFIKLL
FT                   DTVRTA"
FT   gene            complement(322307..323806)
FT                   /locus_tag="Alvin_0270"
FT   CDS_pept        complement(322307..323806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0270"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: tgr:Tgr7_2877 anthranilate synthase; TIGRFAM:
FT                   anthranilate synthase component I; PFAM: Chorismate
FT                   binding-like; Anthranilate synthase component I domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61233"
FT                   /db_xref="GOA:D3RMH5"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH5"
FT                   /inference="protein motif:TFAM:TIGR00564"
FT                   /protein_id="ADC61233.1"
FT                   /translation="MTPKTFNALAEQGYNRIPVACEVLADLETPLSVYLKLAKGPYSYL
FT                   FESVQGGEKWGRYSIIGLPARTVIKIRGRQIQVERDGQVIESTESADPLAWIEQYQSRF
FT                   QVAEIEGLPRFTGGLVGYFGYDTIRYIEPKLAVCPNPDQLGTPDILLMVSDEVVVFDNL
FT                   SGRLYIIVHLDPTAGDTLEAGEARIGALNAMMRQPIPNGQSNPPREVEESHFVSGFTES
FT                   AFKEAVERIKEYILAGDCMQVVLSQRLSIPFGAPPLDLYRALRGLNPSPYMYFLDLADF
FT                   QIVGSSPEILTRLEDGVVTVRPIAGTRRRGHTEAEDQALEAELLADPKELAEHLMLIDL
FT                   GRNDTGRVSEIGSVRLTDRMIVERYSHVMHIVSNVIGRLKEGLSAIDVLRATFPAGTVS
FT                   GAPKIRAMEIIDELEPVKRGIYSGAVGYLSWNGNMDTAIAIRTAVIQDGTLHIQAGAGI
FT                   VADSVPESEWQETMNKGRAIFRAVTAAEVGIDRYGCGVKRV"
FT   gene            complement(323944..324618)
FT                   /locus_tag="Alvin_0271"
FT   CDS_pept        complement(323944..324618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0271"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   noc:Noc_2493 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61234"
FT                   /db_xref="GOA:D3RMH6"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH6"
FT                   /inference="protein motif:TFAM:TIGR01449"
FT                   /protein_id="ADC61234.1"
FT                   /translation="MSLLQPKMILIDLDGTLVDSVPDLTYCVDAMMARLGRPARGEAAV
FT                   RTWVGNGIERLVRRALIGRLDGEPDETDYQRAYPIFLELYAENTFNRSQIYPGVREGLE
FT                   FMRDAGYPLGCVTNKAARFTEPLLQHLGIHDFFGIVISGDTLPRKKPDPLPLIHAAGHF
FT                   GVKPEASLMIGDSVSDVNAARAAGFKIICTSYGYNHGVDIRESDPDAVIDSFVELRELL
FT                   AS"
FT   gene            complement(324650..325342)
FT                   /locus_tag="Alvin_0272"
FT   CDS_pept        complement(324650..325342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0272"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: tgr:Tgr7_2879 ribulose-phosphate 3-epimerase;
FT                   TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61235"
FT                   /db_xref="GOA:D3RMH7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH7"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ADC61235.1"
FT                   /translation="MPADLIAPSILSANFAKLGEEVDNVLASGADIVHFDVMDNHYVPN
FT                   LTIGPLVCEALRKHGVTAPIDVHLMVKPVDRLIPDFAKAGATYITFHPEASEHVDRTLQ
FT                   LIRDSGCKSGLVFNPATPLTYLDYVLEKVDMILLMSVNPGFGGQSFIPTALDKLREVRE
FT                   IIDDSGLDIRLEIDGGVKADNIAEIKAAGADTFVSGSGLFGQGRDSDPNRYDSIVAEMR
FT                   RALARVDR"
FT   gene            325610..326650
FT                   /locus_tag="Alvin_0273"
FT   CDS_pept        325610..326650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0273"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: psa:PST_1060
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61236"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ADC61236.1"
FT                   /translation="MQYRRLGRSDIDVSALCLGTMTFGQQNSESEAHAQLDLALAVGIN
FT                   FIDTAEMYPVPPMAETQGLTETYIGTWLKSRGCRDRVVLATKVAGPGDWLPHIRGGTNR
FT                   LDQPNIEAAIDASLKRLQTDWIDLYQLHWPDRRTNFFGKLGYEPVDDSDSVPLLETLEV
FT                   LADLVKAGKVRQIGVSNETPWGLMRYLALAERHDLPRMVSIQNPYNLLNRSFEVGLAEI
FT                   AIREPCGLLAYSPLAFGVLSGKYLNGQRPADGRITLFERFSRYSNGEAERATAEYVALA
FT                   ELHGLDPAQMALAWVTSRPFVTANIIGATTLTQLESNIGSLDLTLDDAVIAGIESIHTK
FT                   QPNPAP"
FT   gene            complement(326703..327095)
FT                   /locus_tag="Alvin_0274"
FT   CDS_pept        complement(326703..327095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0274"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: pmu:PM1926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61237"
FT                   /db_xref="GOA:D3RMH9"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMH9"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ADC61237.1"
FT                   /translation="MKKTLITAGLLAGLLPFASSATANSGIGHVQKGIASFYHDSLHGR
FT                   KTASGQVYDKRRLSAAHRTLPLGTKIRVTDTRTGRSVIVRVNDRGPFAKGRIVDLSKEA
FT                   AKELGIVDRGIARVDLKVLSTPQQGS"
FT   sig_peptide     complement(327024..327095)
FT                   /locus_tag="Alvin_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.946 at
FT                   residue 24"
FT   gene            complement(327250..329889)
FT                   /locus_tag="Alvin_0275"
FT   CDS_pept        complement(327250..329889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0275"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; glycoside
FT                   hydrolase family 17; KEGG: pau:PA14_49360 glucosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61238"
FT                   /db_xref="GOA:D3RMI0"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC61238.1"
FT                   /translation="MNRSVNFVIPILIAVLTISAWWILNRPNEEPAWPTRIQGFSFSPM
FT                   RADDDPSQKRFPSVEDIDADLALLKGRAHAVRSYTVESTLAEIPRLAAQYDLNVTLGAW
FT                   IGDDPEANEAELGRLREILSKGYRNLVRVIVGNEAILRDDVEVMELVEYLDRVRQFTWL
FT                   PVSTAEPWHVWLKYPTLVEHVDFITIHLLPYWEGVPLDQAVDYAISRYNQVKEAYPNKP
FT                   IIIGEVGWPSNGRRNRGAEASLANQTRFLRRFLAAAESEHYVYYVMEAFDQPWKLRTEG
FT                   ATGTYWGVYDTNREPKFDFTEPVVRIPQWRELAGLSVVMGVLLLAFLYRDSSTLSKRGK
FT                   SFLALITYAISTAAVWVVYDYTRQYMTPATAIVGVLLLIGGVGVIVLLMAEAHEWAESV
FT                   WLRRWRRPFPLRSVPDDQLPFVSVHVPAYNEPPELLKETLDGLAALDYPHFEVLVIDNN
FT                   TKDPAVWEPVRDYCARLGERFRFFHVDPLAGYKAGALNFALRHTDPRADVVAVIDADYI
FT                   VRPPWLRHLVPAFGDPEVAIVQAPQDYRDAHQNAFKAMCMAEYRGFFHLGMVTRNERNA
FT                   IIQHGTMTMIRRQTLDAVDGWAEWCITEDAELGLRLFEGGHKALYIPCTYGQGLMPDTF
FT                   ADFRKQRYRWAYGAVRILLHHRRELLGLRGTSLSLGQRYHFVAGWLPWFADGFNLLFNF
FT                   AALAWSVAMVMAPDTITPPYMTIALVPLVLFLFKMSKSLFLYRRRVTATLRQSLAAGLA
FT                   GLALSHTIARAMFGGLVTGKLGFFRTPKMAEAPAVIRALADAREEALLAFAFLFAAVSV
FT                   MQRDDAFMLDVRIWVAVLVVQAIPYLATVLVSLMSAWTHLSANLVGPMSDMDCREANGV
FT                   DQPVSREA"
FT   gene            330263..331537
FT                   /locus_tag="Alvin_0276"
FT   CDS_pept        330263..331537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61239"
FT                   /db_xref="GOA:D3RMI1"
FT                   /db_xref="InterPro:IPR004963"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI1"
FT                   /inference="similar to AA sequence:KEGG:Neut_0423"
FT                   /protein_id="ADC61239.1"
FT                   /translation="MCRVMPGRSLVLATLLMMAANVSAAWTTISASSFTDEDGIERFPA
FT                   CSQGDTFSFFVDEPESAEGLLLYFAGGGACWDAATCVGSAQTDSPTYYGSIWETAESLD
FT                   ALSADVDGSGAGGILTTRLDNPYARFVKVYIPYCTGDVHIGSSDTNYDYTLPSESGVQT
FT                   APSSRTIHHRGFDNLLAALTWIRSNLSVDDFSEITVAGSSAGGYGALLNFPVIRESLGA
FT                   EGADYSIIIDSSNGVLTNGFVDRAFGPSKTDPGVWNARQNLHPSLAAIPDLDASSLWVT
FT                   AIKTVARRYRDTRLSQSTAAYDLVQSIVYWTMKAVDQGTYDPFVEPTQNELLRLDLLEW
FT                   SPKARWAMVSTALQAPNYRYYLGAGQGHIHLLLDEASSLFPTTNYFEEDSAMGVLYTNW
FT                   LHDMLYNNRFLITDWRNLTCFPNCL"
FT   sig_peptide     330263..330337
FT                   /locus_tag="Alvin_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            331761..332435
FT                   /locus_tag="Alvin_0277"
FT   CDS_pept        331761..332435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0277"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; transcriptional regulator domain protein; KEGG:
FT                   maq:Maqu_3740 two component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61240"
FT                   /db_xref="GOA:D3RMI2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61240.1"
FT                   /translation="MHILLVEDDPQMADYLRKALIEAGAVVDRAADGREGLLMAAGSDY
FT                   DVLILDRMLPGLDGLAIVRTLRASGNRTPVLFLSALGDVDDRVEGLRAGGDDYLIKPFA
FT                   FSELQARVEALLRRGAAEAPETRLRVGDLEMDLLKREVTRAGQSIQLQPREFRLLECLM
FT                   RHAGRVVTRTMLLEQVWDYHFDPQTNVIDVHISRLRGKIDKDFDPPLLQTVRGAGYRLQ
FT                   AG"
FT   gene            332432..333847
FT                   /locus_tag="Alvin_0278"
FT   CDS_pept        332432..333847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0278"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   hch:HCH_00580 signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61241"
FT                   /db_xref="GOA:D3RMI3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC61241.1"
FT                   /translation="MRVSALVRRLRARVARVARGSIFRLALLYVLLLAGSLGILLGFIY
FT                   WSTAGYMGRQTTETIEAEIRGLAEQYRRRGLVGLTTLISERVASDPVGASVYLLVDERF
FT                   ERVVGNLDRWPSESPDANGWIRFRLREWGTDHTDEHEARAQVFLLRSGLMLLVGRDIRD
FT                   LEATRHLILDALTWGLAITLALALAGAWLMGASLTRRLEAINLTSREIMEGDLTRRIPL
FT                   SGSGDDFDRLADGLNRMLERIEALMASVRQVSDNIAHDLRTPLTRLRNKLELLAAALAE
FT                   SSESRLLAEEAIADAEELLATFNALLRIARLESGSRRAAFGPVDLVPLIEDLVELYEPL
FT                   AAEREQRLDWTAGASSIVVEGDRDLLFQVMANLVDNAIKYTQPGGHIQLAVDSAGGQAR
FT                   VLVADDGPGIAPEFREQVFRRFFRVDDSRATPGSGLGLSLVQAVIALHRAHIELSDNEP
FT                   GLRVSLSFGRSPQ"
FT   gene            complement(333841..336102)
FT                   /locus_tag="Alvin_0279"
FT   CDS_pept        complement(333841..336102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0279"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; surface antigen variable number
FT                   repeat protein; KEGG: tmz:Tmz1t_1473 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61242"
FT                   /db_xref="GOA:D3RMI4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI4"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ADC61242.1"
FT                   /translation="MSFIKPSFRPWLALSLIVLAVLTLPAPPVEAAERPKIGLALSGGG
FT                   ARGAAHVGVLKLIEELGIPVDYVAGTSMGSIVGGLYAMGLSPDEIEQTIEEIDWDGIFQ
FT                   DEAEREERRMRRKLEDRNYLVKARPGVQERERKVNLVPALIQGQKLELALRKYSLPASR
FT                   IQDFDDLRIPFRAVATDVVTGEAVVLGEGDLATAMRASMAVPAVFAPVEIGDRLLVDGG
FT                   LAMNMPVSVVRQMGADIVIAVDVGGPRREREEISNVLTMLDQIASLVTWRNTQEQIATL
FT                   GGRDLLITPALGHEVLASDFGKMLQAIAIGERAAEDARPELARLALPSAQYAAYRERHQ
FT                   RSPYTRPTIRAVRIENHSRLSDRVISERLDVEPGDRLDPAALEHQLASIYDQDNFESVR
FT                   YRLEDQTDAEATLVVTAREKSWGTSSLQGGLEFSSTTGGDSRFNIGLAYTMAPLNAFNG
FT                   EWRTQLQLGEEPGLYTALYQPLDPLEKWYVMAGLGYLNDNLVIFDPEAHSKPIAEYQLT
FT                   RAGGALEFGRNLDTWGRLGLRYARFDGRAEQRIGAAFYPDYDFDAGELSLRFSVDELDS
FT                   LTFPRHGWSLDAQVLTSRGELGASHDYDQGSLSWLHAQSWGRNSLLTGMTLAGSFGGEA
FT                   PPQSYYRLGGFLNLSGFNQNELSGANLGLVRAIYLRDLGTGLVKTYAGGSLEVGNVWNR
FT                   RSDIDWDSLRLGGSLFVGADTFIGPLYLGYGQADSGNGALYLFLGRPWGNQQDGLSGAY
FT                   "
FT   sig_peptide     complement(336007..336102)
FT                   /locus_tag="Alvin_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.988 at
FT                   residue 32"
FT   gene            complement(336188..337396)
FT                   /locus_tag="Alvin_0280"
FT   CDS_pept        complement(336188..337396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   azo:azo3699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61243"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI5"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ADC61243.1"
FT                   /translation="MIKLGLDRLLENPELRKPLWGRRVALLGHPASMTRHGHHALDALM
FT                   ALKELDIVAAFGPQHGMRGDKQDNMIETPDEIDPRHGIPVYSLYGEVREPTAAMLDGFD
FT                   VLLIDLQDIGTRIYTYVTTLVYLMCACAAHGKTLWVLDRPNPAGRPIEGSLLEPGWESF
FT                   VGAGPIQMRHGLTLGELAKWFVAHLNLDLDLHVVAMEGYHPNEAPGYGWPVLELSWVNP
FT                   SPNASSLNMARCFPGTVLLEGTTLSEGRGTTTALELIGAPDLDLDRLLARMERERADWL
FT                   QGALIRPCWFEPTFHKHAGQRCAGFQIHTDNADYRHAHFKPYRLIALLFKCIRLEYPDY
FT                   PLWRHFHYEYETERLAIDLLSGGTFLREWVDDPAAGPEDLEQRLQPDEAHWAEAVRPLL
FT                   LYA"
FT   gene            337546..338577
FT                   /locus_tag="Alvin_0281"
FT   CDS_pept        337546..338577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0281"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: tgr:Tgr7_2069
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61244"
FT                   /db_xref="GOA:D3RMI6"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI6"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ADC61244.1"
FT                   /translation="MRRSDFHYELPAELIAQHPLPERSGSRLLVLDGSQTPPRDRMFTD
FT                   LPSLLKPHDLLIFNNTQVMRARLFGHKETGGQVEILIERLLDAREALAHVRASKSPKPG
FT                   SRIRVTDGAWLSVVGREGDLFRLRALESDFGEQMARHGHMPLPPYIQRPDDVLDESRYQ
FT                   TVFARRTGAVAAPTAALHFDEPMLARLDALGVARAEITLHVGAGTFQPVREDDLERHHM
FT                   HSEWLEVDETVCERIERTRQLGGRVIAVGTTSVRSLETAAADGRLRPFRGESRLFIRPG
FT                   YRFRVVDAMITNFHLPESTLLMLVAAFSGYSEIMKAYRHAIDQRYRFFSYGDAMFLTRQ
FT                   DAA"
FT   gene            338693..339076
FT                   /locus_tag="Alvin_0282"
FT   CDS_pept        338693..339076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: net:Neut_1983 histone family protein
FT                   nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61245"
FT                   /db_xref="GOA:D3RMI7"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61245.1"
FT                   /translation="MEHSNLSLEEIQRQLEEADNKKAQLEKLLKDKREEGKGAVVEQIR
FT                   NIILDNGYDPEEIMNLVLRRRRKLVSDRQYRRYVDPDNPENVYSRGVLPGWMKEKMAQQ
FT                   GYDPNSKEDREAFKANSLRLVEG"
FT   gene            339439..339714
FT                   /locus_tag="Alvin_0283"
FT   CDS_pept        339439..339714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0283"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1
FT                   like RNA-binding protein; KEGG: hch:HCH_00155 RNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61246"
FT                   /db_xref="GOA:D3RMI8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI8"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /protein_id="ADC61246.1"
FT                   /translation="MNIYVGNLAYSVTQDELRDAFGAYGEISSVNLITDKFTGSSKGFG
FT                   FVEMPNNSEADAAIKGLNETPLKGRNLKVNQAKPRGERPASRGPRW"
FT   gene            339842..341677
FT                   /locus_tag="Alvin_0284"
FT   CDS_pept        339842..341677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0284"
FT                   /product="peptidase M61 domain protein"
FT                   /note="PFAM: peptidase M61 domain protein; PDZ/DHR/GLGF
FT                   domain protein; SMART: PDZ/DHR/GLGF domain protein; KEGG:
FT                   noc:Noc_1493 peptidase M61"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61247"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMI9"
FT                   /inference="protein motif:PFAM:PF05299"
FT                   /protein_id="ADC61247.1"
FT                   /translation="MTHSASSNSTLLYRVCPVSPQAHLFEVEILVDPPSDGALVLSMPA
FT                   WIPGSYMIRDFARNIVAISAFDACGRPVALDKRDKQSWTLGAVTGPCRIRYRVFAWDLS
FT                   VRGAHLDTTHAYFNGPALLLRVHGQDDRPCRLELLPPADESCDDWRLATSLEPLDVDPR
FT                   GFGLYGADDYEDLIDHPVEMGRFRELAFRVSGVPHRFAITGRHRLDERRLLDDLTRVCA
FT                   EHAALFGELPIDRYLFLVTVLGEGYGGLEHRYSTSLLCVRDDLPQPGEDTPTEGYKRFL
FT                   GLCSHEYFHLWHVKRIRPRALIESSLEREAPTRTLWAFEGITAYYDELALVRAGCIGEK
FT                   DYLGLLAQTLTRVARTPGRRVQTLAESSFDAWIKFYKPDENAPNALVSYYAKGALVALM
FT                   LDLTLRRDTQGACSLDDVMRELWRVHGRTGLGVEERGVEAIASAVSGLDLSGFFACALD
FT                   STAELDPTELLASVGVALRWRPNRGDKDLGGHVERFEPVTAKPTLGVRLRSGETLIQNV
FT                   LSDGAGERAGLAPGDQLLALDGLRVTPANLETLVARAAGESVVLHVFRRDELLTLTAQP
FT                   QPAPEDTCELNLLEDVPDSVKQARAAWLSSVSADG"
FT   gene            341670..342668
FT                   /locus_tag="Alvin_0285"
FT   CDS_pept        341670..342668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0285"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: vcj:VCD_001305 biotin-protein ligase/biotin
FT                   operon repressor; TIGRFAM: biotin/acetyl-CoA-carboxylase
FT                   ligase; PFAM: biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix type 11 domain protein; biotin protein
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61248"
FT                   /db_xref="GOA:D3RMJ0"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ0"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADC61248.1"
FT                   /translation="MDERQLALIRRLADGRSHSGEAIAREFGLTRAAVWKTLRKTAEAF
FT                   GLDLISERGRGYRLATPLELLDAERIREALSDAGRARLSRLDIHPLIGSTNSELMRLAA
FT                   EGAPSGSVCLAERQTAGRGRRGREWVSPFGVNLYLSLLWRYPFAPSNLGGASLAVGAVL
FT                   ADALNGLGTEGPALKWPNDLLWRRRKLAGLLLEVAGESQGPCHLVVGLGLNLRMTAGQG
FT                   SAIDQPWTSLETMLGTAMIGRNALVARLLEALLEALDRYGREGLSPFLTRWRAHDAYLG
FT                   EPVRLLIGERVIEGVHAGVGEDGSLLLETSEGCRTFQAGEVSLRPVSTQAQ"
FT   gene            342683..343417
FT                   /locus_tag="Alvin_0286"
FT   CDS_pept        342683..343417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0286"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: noc:Noc_0189 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61249"
FT                   /db_xref="GOA:D3RMJ1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ1"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ADC61249.1"
FT                   /translation="MNLLIDIGNTNLRWTAHGSEAEWSVRIARHSGAIPLDLLAAWEAI
FT                   PTPERVIVSHVGGPAVAEALERVTRALWRIEPEFVRVAPSAAGVCIAYEHPERFGVDRW
FT                   LALIAAHAERRQATLILDAGSAATFDLLLADGRHLGGLILPGVEMMRTSLLMGTHIPRV
FT                   EYEPTDVDWATDTTTAVAAGSLGAIAALASRLHDRLADAAGESPRFILTGGDAERVYPY
FT                   LDRPSETIPDLVLRGLVSLSLD"
FT   gene            complement(343464..344921)
FT                   /locus_tag="Alvin_0287"
FT   CDS_pept        complement(343464..344921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0287"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   gme:Gmet_2718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61250"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ2"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADC61250.1"
FT                   /translation="MAEQPDSQLYSDAESELLRNTLEQLRQEAEEEIKRLSARLGEGDF
FT                   APSSQVATATERLALQQEMLLMQQSLDAKEQALDHITEECRRLEDAMEDKHLALEGLRK
FT                   ELDRKEQSLQEAHTEIDRLRQELLEASRAAEQRAAATPSQPVIVRGGKTPRWLVPTTGL
FT                   LAVLLTVSAVANLYLMRDRPETPAPDRNTRVATVPVERPPVSSVPSGPRTESAPEPKPS
FT                   GPPAVAGTTQPPRIHQDRLRDGTPGPAMVVLAGGAFRMGHNSLGGEDFSPARSVKVGPF
FT                   MMAAHEVTFLEYDRFARATGRELPDDQGWGRGTRPVVGISWEEARDYTAWLAQQTGRRY
FT                   RLPSEAEWEFAARAGTTTPFWWGQNADSNRTVCFDCGSQWDNRSTAPVMSFPANPFGLY
FT                   ETAGNAMEWVADCYRARYQDAPNDGRALVSGDCASRVARGGAFNKPADSMRAFVRARFA
FT                   PDTKLNMLGFRVARDPGPTDQDASGRR"
FT   gene            345157..346470
FT                   /locus_tag="Alvin_0288"
FT   CDS_pept        345157..346470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0288"
FT                   /product="uncharacterized membrane-anchored protein"
FT                   /note="KEGG: aeh:Mlg_0619 uncharacterized membrane-anchored
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61251"
FT                   /db_xref="GOA:D3RMJ3"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ3"
FT                   /inference="similar to AA sequence:KEGG:Mlg_0619"
FT                   /protein_id="ADC61251.1"
FT                   /translation="MPVPFKEHPLRHQLVTELHARTYIPLQAPARLSHIAAVCGERGSG
FT                   RTVRHLYELLEHYGVPRPERVEQYYLVHLGDIRLLWERHTEFVSYTFSLPGAFAHPFAN
FT                   PVIAQLPADWLAGIPGEVVAAVSLALEPAGEAEYSLDELSALFGGNPVIGSEVVGGLAR
FT                   AYSDLHIHSDGFSRILLRDQGLSPNQAGRLAKRLLEVSSYRAMALLGLPPAREANACLS
FT                   DAERRLVAVSSRMACQEDRSHEVPESELLAELTDLAAEIEAVAARTSYRFEASRAYYSV
FT                   VMQRLEQLRQRRIEGLQTLTEFLDARLTPAIATCESTAKRQQGLAERAARLTSLLRARV
FT                   EVELQKQNRGLLESMNKRAKLQLRLQETVEGLSVIAIGYYGVGLLGYLFKGLEAHGLPF
FT                   MFDATYATGLAAPLVVLIAWLGIRRMKARLLKSEHANV"
FT   gene            complement(346474..346905)
FT                   /locus_tag="Alvin_0289"
FT   CDS_pept        complement(346474..346905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61252"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61252.1"
FT                   /translation="MFLQSLGHEVLNPALDDDDFQLAVDVAQTAYGRHAPDVIVGSSRG
FT                   GAVAMHLQSRDTPLVLLCPAWRNHGRVDRVKPETWILHSRQDDVVAYADSEQLLAHSGL
FT                   PASRLITTGADHRLVDPDSLDALRSLCAAIENARIEQAT"
FT   gene            complement(346996..347508)
FT                   /locus_tag="Alvin_0290"
FT   CDS_pept        complement(346996..347508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61253"
FT                   /db_xref="GOA:D3RMJ5"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ5"
FT                   /inference="similar to AA sequence:KEGG:PSPTO_4961"
FT                   /protein_id="ADC61253.1"
FT                   /translation="MKMPGSFRYGRLALVALLGLAIVLVLSQVGRRGNPNPRPVAYLGS
FT                   DGVPEVVLKQNQLDQYVVTGRINGERIEFLVDTGAADVALPYEVAQRLGLRLHPGAVSK
FT                   TGNGNVRSWTAWLDSVDVGGVVAHQVKATVLPNMAGEQALLGMAYLKHMEVWLAGGRMR
FT                   LRPYVTP"
FT   sig_peptide     complement(347425..347508)
FT                   /locus_tag="Alvin_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.860 at
FT                   residue 28"
FT   gene            complement(347505..348044)
FT                   /locus_tag="Alvin_0291"
FT   CDS_pept        complement(347505..348044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0291"
FT                   /product="putative aspartyl protease"
FT                   /note="KEGG: pag:PLES_53511 putative aspartyl protease"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61254"
FT                   /db_xref="GOA:D3RMJ6"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR011969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="InterPro:IPR034122"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ6"
FT                   /inference="similar to AA sequence:KEGG:PLES_53511"
FT                   /protein_id="ADC61254.1"
FT                   /translation="MSDEERVRDDWPARLGRAMLFGAWISGLALLALFFHQWLERDNNP
FT                   NPNPLTVQGADGVVEVVLQRNRAGHYVASGKINGEPVRFLVDTGATDVALSLDLARRLD
FT                   LRLGPEGASRTANGITRTWPTRLARVELGGLVAHGVRASVLPNMPGDEVLLGMSFLKPL
FT                   ELIQRGDTLTLRGTLP"
FT   gene            complement(348037..349302)
FT                   /locus_tag="Alvin_0292"
FT   CDS_pept        complement(348037..349302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0292"
FT                   /product="2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: catalytic
FT                   domain of components of various dehydrogenase complexes; E3
FT                   binding domain protein; biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: aeh:Mlg_2608
FT                   2-oxoglutarate dehydrogenase E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61255"
FT                   /db_xref="GOA:D3RMJ7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ7"
FT                   /inference="protein motif:TFAM:TIGR01347"
FT                   /protein_id="ADC61255.1"
FT                   /translation="MSLEVRVPALPESVADARVLTWSKRPGEAVREGENLVELETDKVV
FT                   LEVPAPRTGVLSEILAAEGAMVHTDDVLALISEGAVSVAPAPKPASTPSTAPTATPTPP
FT                   AAATQPNAPPHVTPSARQLVKELHLEPSQIPSRDGRIQKADVLAYLDAREHQAPERHPD
FT                   LAAAPAAQTPVEPALAPTPALSGEAGRPEQRVPMTRLRARIAERLLQAQQNAALLTTFN
FT                   EVNLSAVNALRARYKETFEQRHGVRLGLMSFFVKAAVEALQRFPVLNASIDGEDILYHG
FT                   YYDIGIAVSSPRGLVVPILRNADQLGMAEVEQGIADFGQKARDGSLSYEELTGGTFSIT
FT                   NGGVFGSLLSTPILNPPQSAILGLHKIQERPIVENGQIVVAPMMYLALTYDHRLIDGRD
FT                   AVQFLVAIKELLEDPARLLLRV"
FT   gene            complement(349299..352172)
FT                   /locus_tag="Alvin_0293"
FT   CDS_pept        complement(349299..352172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0293"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /EC_number="1.2.4.2"
FT                   /note="KEGG: aeh:Mlg_2609 2-oxoglutarate dehydrogenase E1
FT                   component; TIGRFAM: 2-oxoglutarate dehydrogenase, E1
FT                   subunit; PFAM: Transketolase central region; dehydrogenase
FT                   E1 component; SMART: Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61256"
FT                   /db_xref="GOA:D3RMJ8"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ8"
FT                   /inference="protein motif:TFAM:TIGR00239"
FT                   /protein_id="ADC61256.1"
FT                   /translation="MSTLLDLFRGSSALYGGNAAFIEDLYERYLVDPESIDVAWRARFD
FT                   GLRQEAANEPATAETPHGPIRDNFRRLAQEPRAHASSRTADCLDPAAAEKQAAVLSLIN
FT                   GYRYRGHQVADIDPIRLREAPRIADLDLDYHNLGPEDMDQVFNTGSLYAPDRLPLREIV
FT                   SMVQETYCGTVGSEYMHITSTQEKRWIQKRLEGYRAKPELDAAGRRWLLTLLTAAEGIE
FT                   KYLHQRYVGQKRFSLEGGDALIPMLDELIQRAGRQGMQEIVIGMAHRGRLNVLTNIFGK
FT                   PPADIFDEFEGRVQMDWRQMVGDVKYHMGFATDVETPGGLVHLVLGFNPSHLEIINPVI
FT                   EGSVRARQRRRGDRTGDQVLPVLIHGDAAFAGQGVVMETLQLSQTRSYGTGGTVHIVIN
FT                   NQIGFTTSHPLDARSTPYCTDVAKMVQAPVFHVNGDDPEAVIFVTRLALDFRNQFHKDV
FT                   IVDLICYRRLGHNEADEPAVTQPMMYRKIRQHPTPRAVYAERLIAQGLLTHDEEQAMVT
FT                   SYRDSIEQGVLIARPVLCGLDNIARVDWSFCRGKHWNQDIDTGVPLETLRTLSEAMLRL
FT                   PEGFELHPRVEKLWEERRKMALGDQLLNWGYAENLAYASLLDAGIPVRLSGQDVGRGTF
FT                   VHRHAKIHDQVTGESYTPLQHLGPHQGAFIAIDSILSEEAVLGYEYGFATAEPHALTLW
FT                   EAQFGDFANGAQVVIDQFISSAGTKWGLYCGLVMLLPHGMEGQGAEHSSARPERFLQLC
FT                   AGHNIQVCVPTTPAQMFHLLRRQMVRPYRTPLIVMTPKSLLRHRLAVSSLDELTHGQYQ
FT                   VLIPETDPIDPAEVERVVFCSGKVYYDLLEARRARGQTNVALLRIEQLYPFPKDAFASA
FT                   LEPYAHVEEIVWCQEEPQNQGAWDQIKHRFHNLIQEGKRPYYVGRPASAAPAVGHRAAH
FT                   VEQHERLIDEALNGQYNPTMNKRIPPQ"
FT   gene            352401..352667
FT                   /locus_tag="Alvin_0294"
FT   CDS_pept        352401..352667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61257"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61257.1"
FT                   /translation="MPNDLDSAERLAIPDFMEDRQSDALERREARIRLAKLEADIAYFQ
FT                   ARLELIGEPNSSHRAAQRKLFHLLHKATAKQILDTRRRHTELR"
FT   gene            352855..353781
FT                   /locus_tag="Alvin_0295"
FT   CDS_pept        352855..353781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0295"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: pag:PLES_56541 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61258"
FT                   /db_xref="GOA:D3RMK0"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK0"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADC61258.1"
FT                   /translation="MSNSIRIATRKSPLAMWQAEHVTARLKALHPGLTVEIIGMTTKGD
FT                   QLLDSPLSKVGGKGLFVKELEQGMLAGEADIAVHSMKDVPVEFPEGLHLAVIMERENPY
FT                   DAFVSNTYANLAELPEGACVGTSSLRRQCQLADRRPDLRIEPLRGNVNTRLAKLDAGEY
FT                   DAIILAAAGLIRLGFESRIRDCIDPVDSLPAIGQGAIGIECRVDDERVHQLIAPLADRD
FT                   TTDRVLAERAMNARLNGGCQVPIGGHAVLDGDRLILKGLVGTTDGSRILRAEASGPRAE
FT                   AEAIGVRVADDLLGQGADAILSALMGH"
FT   gene            353785..354540
FT                   /locus_tag="Alvin_0296"
FT   CDS_pept        353785..354540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0296"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   tgr:Tgr7_0028 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61259"
FT                   /db_xref="GOA:D3RMK1"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK1"
FT                   /inference="protein motif:PFAM:PF02602"
FT                   /protein_id="ADC61259.1"
FT                   /translation="MSTPADLAGRGVLVTRPAGQAEPLCRLIESAGGRAIRFPTIAIEP
FT                   THDPEATALLAESWDLLYFVSPNAVEQAQALVADGTWPRVERVAAVGRGTARALEAAGR
FT                   APDLVPNDRYESEALLEMPELSDMRGRRVLIVRGVGGRGLFAQAMSERGAEVRFAEVYR
FT                   RARPAVDVAPLLAHWREEVDFVMATSDEVLLNLAELLGQEGQASLLATPLVVIAERTAQ
FT                   TARNLGFQTIRVAERADDSSIVRALIALS"
FT   gene            354589..356370
FT                   /locus_tag="Alvin_0297"
FT   CDS_pept        354589..356370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0297"
FT                   /product="AAA-ATPase-like protein"
FT                   /note="PFAM: AAA-ATPase-like; KEGG: ctc:CTC00457
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61260"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK2"
FT                   /inference="protein motif:PFAM:PF09820"
FT                   /protein_id="ADC61260.1"
FT                   /translation="MQFPYGLSDFGKLIRGGYWYLDRTDRLAILEAMGDQLIFLRPRRF
FT                   GKSLLLSMLEHYYDLNRADRFDALFGSLAVGRNPTPLRNQYFVLKWDFSLIPAYGEIAD
FT                   IEAALHRYLNGCLTQFVADYQDHWTREIQLHPGDALASFQSVLGAVHATPHRLYLLIDE
FT                   YDNFANEVMMADRPGSQDRYQTLLQGEGLFKSVFKAVKAGAGGLGVDRVFITGVSPIVL
FT                   SDMTSGYNVGEDIYLLPQFNDLCGFTESEVSAVLRQLAGEGGDWSADDALATMRTFYNG
FT                   YRFSEDATESLYNPTLSLYFLKALAHQGRYPRRMLDENLAMDRNKLIYIAQLSGGEELL
FT                   VEALSGEDQVLVPELVQRFGVADVLAAVKDEPFMASLLYFFGILTLAGLTSFDECRLRI
FT                   PNLVARGLYVERLRERWLPLTESARELPEATRALGQRGDLVPLAELIEQRYFRVLSNRD
FT                   YRWTNELLVKFAFLTLLFDDRLYMAVSELETGRGYVDLALIVRPDKRRFQVLDLLLEFK
FT                   YLSLKELNLTGEQVRERSREALAELAPVAKKLDEAEAQARAYGAALKERYGFAELHAFA
FT                   VVALGLERVVWRTLKVG"
FT   gene            complement(356469..357089)
FT                   /locus_tag="Alvin_0298"
FT   CDS_pept        complement(356469..357089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61261"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61261.1"
FT                   /translation="MYPFVRVFLAGLLALLMSACATGPVSSVWTQPGQTPRQYERLVVF
FT                   GVTNSPKVRRAYEDNFVKQLQALGVTARAGHELVSDRNLGRLTRLTEGYAKVKADGVLI
FT                   THLVSDEAPNPRPAARIGSVPDHYRHLVGYFSQVYEEVCAPGYYSDLKSLRLETNLYDA
FT                   KQERLVWSGRSQPLDPTSERTTISQVIEEIVAQMQRDGFLPSR"
FT   sig_peptide     complement(357006..357089)
FT                   /locus_tag="Alvin_0298"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.631 at
FT                   residue 28"
FT   gene            complement(357279..357566)
FT                   /locus_tag="Alvin_0299"
FT   CDS_pept        complement(357279..357566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0299"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: aeh:Mlg_2530 oxidoreductase
FT                   FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61262"
FT                   /db_xref="GOA:D3RMK4"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK4"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADC61262.1"
FT                   /translation="MSFKIEILPDGPSFEANPGETLLRAALRQDVELPNGCRSGHCGAC
FT                   AITLKSGFIHYPSGEIEALHGRPAGTCLTCQAVAHSDLTIEVKPPPVLAL"
FT   gene            357582..358478
FT                   /locus_tag="Alvin_0300"
FT   CDS_pept        357582..358478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0300"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   mca:MCA0540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61263"
FT                   /db_xref="GOA:D3RMK5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK5"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADC61263.1"
FT                   /translation="MQHIVIVGCGYVGERLARQYIERGDSVLGLVRSRSGLERLAAAGI
FT                   PAVRHDLTGADPMPGSLAGTRLFHLAPPPAQGQEDLHTRRLVASFDQAGHPRRLVYIST
FT                   TGVYGDCAGAWVDEDWPTQPTLDRSRRRLDAEECLRRWSREHGGELIVLRVAGIYGPDR
FT                   LPLERLKRGLPLVRPEEAPYSNRIHVDDLVTVCVAAMERGRHGAIFNVSDGQPSTMTDY
FT                   FIRIAEAAGLPHPPLITMAEASAHLSEGMMGYMSESRRLSSRRLREDLGVELRYPTLSE
FT                   GLAQALGEQGLHRPTMA"
FT   gene            358495..358893
FT                   /locus_tag="Alvin_0301"
FT   CDS_pept        358495..358893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dba:Dbac_1087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61264"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK6"
FT                   /inference="similar to AA sequence:KEGG:Dbac_1087"
FT                   /protein_id="ADC61264.1"
FT                   /translation="MMKTHALPLALLCAATLASQGAGATDEASFRFDTTANLYEVCALT
FT                   EDSPGFVVANQACRAFIEATVQYHDEISARRKLKRLVCYPKGTTIEDGKQVFIAWADRQ
FT                   SDDAKLMAEQPVVGLVRALAAKYPCERR"
FT   sig_peptide     358495..358569
FT                   /locus_tag="Alvin_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.689 at
FT                   residue 25"
FT   gene            358984..359211
FT                   /locus_tag="Alvin_0302"
FT   CDS_pept        358984..359211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dba:Dbac_1088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61265"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK7"
FT                   /inference="similar to AA sequence:KEGG:Dbac_1088"
FT                   /protein_id="ADC61265.1"
FT                   /translation="MKAMAFIGILSAALVLAGCGTTTGSRAGSGAAMGAAGGALIGSMN
FT                   ANAGRGALIGAGVGALGGYLYDQHEKGHID"
FT   sig_peptide     358984..359067
FT                   /locus_tag="Alvin_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.489 at
FT                   residue 28"
FT   gene            359656..359934
FT                   /locus_tag="Alvin_0303"
FT   CDS_pept        359656..359934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0303"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1
FT                   like RNA-binding protein; KEGG: cts:Ctha_1599 RNP-1 like
FT                   RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61266"
FT                   /db_xref="GOA:D3RMK8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK8"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /protein_id="ADC61266.1"
FT                   /translation="MRIYVGNLPYSMNDDELRNIFGQFGELASAEVIKDKFSGQSKGFG
FT                   FVDMPNNSEADAAIKALNETEMKGRKLTVNEARPRAERPRGGGGGRY"
FT   gene            complement(359951..361435)
FT                   /locus_tag="Alvin_0304"
FT   CDS_pept        complement(359951..361435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0304"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: tgr:Tgr7_0008 UbiD
FT                   family decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61267"
FT                   /db_xref="GOA:D3RMK9"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMK9"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADC61267.1"
FT                   /translation="MQYRDLRDFIDQLEQRGELHRVSVEVDPYLEITEICDRTLRAGGP
FT                   ALLFERPKGSRIPLLGNLFGTPKRVALGMGEESVEALREVGRLLAFLKEPDPPKGMKQA
FT                   WETLPIFKKVLDMAPKVRRNPACQEVVLSGSEIDLGRLPIQHCWPGDAAKLITWGLVIT
FT                   RGPDKPRQNLGIYRMQVLGPNRVIMRWLSHRGGALDYRDWQRAKPGKPFPVAVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSRTELASCLESDLQVPANAEIVLEGHIYPDDMAP
FT                   EGPFGDHTGYYNEVDSFPVFTIERMTHRRDPIYHSTYTGRPPDEPAVLGVALNEVFVPI
FT                   LRKQFPEIQDFYLPPEGCSYRLAVVSIRKQYPGHAKRVMMGVWSFLRQFMYTKFVIVVD
FT                   EDVNTRDWTDVIWAMTTRMDPARDTLMIENTPIDYLDFASPVSGLGSKIGFDATNKWPG
FT                   ETTREWGQPIRMDEGVRERVDRIWGDLGIQLEPRQG"
FT   gene            complement(361458..363500)
FT                   /locus_tag="Alvin_0305"
FT   CDS_pept        complement(361458..363500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0305"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: tgr:Tgr7_0006 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61268"
FT                   /db_xref="GOA:D3RML0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML0"
FT                   /inference="protein motif:PRIAM:3.4.24.70"
FT                   /protein_id="ADC61268.1"
FT                   /translation="MPNPLLDQAGLPAFNLIRPEHIEPAVDARLAECREAIERLTREVA
FT                   VPTWENFVEPLDEVDDRLNRTWSPVGHLNGVLNSEALRAAYNACLPKLSEYGTEVGQNE
FT                   ALFQAYRAVAAQEHLDAAQRKLLENALRDFHLSGVDLPPEKKARYKAISQELSQLTSKY
FT                   SENVLDATNAWSKHITDQTRLTGLPESALALARQNAERQGLDGWLFTLDMPYYLPVMTY
FT                   ADDRELRFKFYEAFGTRASDQGPHAGQWDNTELMERILALRHELAQLLGFANYAERSLA
FT                   TKMARSPDAVLGFLDDLAARSVGQARRELAELEAFAREQHGVEQLEPWDITYYSEKLRV
FT                   HRYQISQEELRPYFPITRVLFGLFGVVERLFGIHIQEAPAFETYHPDVRFFEIRDLLTG
FT                   ELRAQFYLDPFARPNKRGGAWMDVCTNRMHTSRCDQIPVAYLVCNFTPPVGDQPSLLTH
FT                   NEVETLFHEFGHGLHHMLTRVDYPGVAGINGVPWDAVELPSQFMENWCWERESLDLFAA
FT                   HWETGAPLPEELYTRMIAARNFQSAMQMVRQLEFALFDFRMHREYDPARGGRIYEILDA
FT                   VRDQVAVIRPPAFHRFAHGFSHIFAGGYAAGYYSYKWAEVLSADAFSLFEEHGVFDADT
FT                   GRSFLENILEKGGSEDAMTLFVKFRGREPTTDALLRHSGIVAEAA"
FT   gene            complement(363644..364285)
FT                   /locus_tag="Alvin_0306"
FT   CDS_pept        complement(363644..364285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0306"
FT                   /product="Protein of unknown function CNP1-like protein"
FT                   /note="PFAM: Protein of unknown function CNP1-like; KEGG:
FT                   nmu:Nmul_A1844 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61269"
FT                   /db_xref="InterPro:IPR014861"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML1"
FT                   /inference="protein motif:PFAM:PF08750"
FT                   /protein_id="ADC61269.1"
FT                   /translation="MDSTQGESCRIMVGLLSMHDPWHPMRQIRFTRLYVLFAILWATSV
FT                   PAEESPFIHEPEPFTPSSVKPGTPWTEALTRLPPLPADADLIEFRLDGPQDSFRYFIDG
FT                   KHLNVGPDEVVRYTLVARSGTGARNLSFEGIRCTPQGHYRVFAYGTGSGFTPVNEDWQG
FT                   IGPATERYRVELQRHHFCIPRAFKPRPLKDIKRSLQGHIAPRQNSGFLPD"
FT   gene            complement(364308..367703)
FT                   /locus_tag="Alvin_0307"
FT   CDS_pept        complement(364308..367703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0307"
FT                   /product="Protein of unknown function DUF2126"
FT                   /note="PFAM: Protein of unknown function DUF2126;
FT                   transglutaminase domain protein; transglutaminase domain
FT                   protein; SMART: transglutaminase domain protein; KEGG:
FT                   tgr:Tgr7_1014 transglutaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61270"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR018667"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML2"
FT                   /inference="protein motif:PFAM:PF09899"
FT                   /protein_id="ADC61270.1"
FT                   /translation="MSILVALNHKTEYRFDRSVGLSPHVVRLRPAPHCRTPIRAYSLKV
FT                   EPEGHFINWQQDAFGNYLARLVFPEKTRRLSIEVDVIAEMITINPFDFFLEESAYHYPF
FT                   EYAPDLRKELAPYLEITDDGPLLREWLAGVDRTKRETVYFLVDLNQRLQQDIGYVIRME
FT                   PGVQSCEETLEKRLGSCRDTGWLLVQILRHLGLAARFVSGYLVQLTADVKALDGPSGPE
FT                   QDFTDLHAWAEVYVPGAGWIGLDPTSGLFAGEGHIPLACSPAPRGAAPIEGATDKCEVE
FT                   FYFHNQIERIHEDPRVTKPYTEEQWTAIEALGHQVDAELRTNDVRLTMGGEPTFVSIDD
FT                   MDGEEWNTAALGPTKKVLAEDLLRRLHARFAPGGLLHLGQGKWYPGEQLPRWALSCFWR
FT                   KDGEPVWRDTALFGHEDGDYGHGPAEAEHFIRTLARHLGVDPDHAAPAHEDAWYYLWRE
FT                   ARLPVNVDPLDNKLKDPNERQRIARLFDQGLNRVAGFVLPLRWWGLGIEGGWKSGRWTF
FT                   RDGRLFLIPGDSPMGLRLPLDALPHVPDGDQEPLLERNPFEPVAPLRSPYDEVARRYSR
FT                   LVEPARTPQTLREQGVQPRDLAARYGRLAPRDEAHQDVRPQTAPSDTPHPDLIRTALCI
FT                   EPRLGRLYCFMPPVTHLEHWLDLVMCIEDTAAELGLPIIIEGYEPPRDPRLQKLAVTPD
FT                   PGVIEVNIHPAESWDQLVSDTQILYEEARLARLGTEKFMLDGRHTGTGGGNHVTLGGPT
FT                   PADSPLLRKPDLVQSLITYWQHHPSLSYLFSGLFIGPTSQAPRVDEARDDRLYELDIAF
FT                   QQMPPGEVPQPWIVDRVLRNLLTDVTGNTHRTEFCIDKLYSPDSASGRQGLLEFRGFEM
FT                   PPHHRMSLAQMLLLRTLVARFWKEPYRRQPIRWGTELHDRFLLPHFVRQDFTDVICDMR
FT                   RAGYPIELDWFEPFFEFRFPHYGDLITDNGIDMELRAAIEPWHVLGEEVTAQGTARFVD
FT                   SSVERMQVKVNGMVGDRHVLVCNGRRVPLRPTGRRAEFVAGIRFKAWSPPSGLHPTIPA
FT                   HNPLVFEIVDLWNRRSLGGCTYYVAHPGGRSESSFPVNSYEAESRRIARFRVMGHTPGE
FT                   IDPPPEEPAGEHPYTLDLRYRPGC"
FT   gene            367811..369112
FT                   /locus_tag="Alvin_0308"
FT   CDS_pept        367811..369112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0308"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: hch:HCH_00368 response regulator; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF domain
FT                   containing protein; PAS fold domain protein; PAS fold-4
FT                   domain protein; SMART: GGDEF domain containing protein; PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61271"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC61271.1"
FT                   /translation="METTDTVMPYEAIDASALLNSLHAGVVVHGPGTEILYANPRALEL
FT                   LRLSATQALGKAALDPEWRFLDEHKRLLPVEQYPVNRVLARNEAVTNQIIGVVDGRSAD
FT                   ITWVLANAYPERDQNGIIAKVVVSFIDITGEKRDIPFEQIVAYASDPVVVTEADPVVGQ
FT                   GPRILYVNDAFTDLTGYTPEEVIGQSPRILQGEHTDPEARARIRQALIDRAPIREQILN
FT                   YTKGGQEYWVELKIVPLRNARGEVTHFAAIEHDITVQKAEELVLRELATTDPLTGVLNR
FT                   RGFSEQAQGRLAGALRDGQELSLAMIDIDFFKRINDTHGHAVGDQALIHLAGLLRTSFR
FT                   ESDVIGRLGGEEFAVLLPGATLEQSHVLMDRFRMRLAATPLKLHDGRWLGFTASIGVAE
FT                   LNPEKAGLAALTKAADSALYAAKHSGRNRVYLAP"
FT   gene            complement(369123..372332)
FT                   /locus_tag="Alvin_0309"
FT   CDS_pept        complement(369123..372332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0309"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /note="KEGG: eba:ebA2985 diguanylate
FT                   cyclase/phosphodiesterase domain-containing protein;
FT                   TIGRFAM: diguanylate cyclase; PAS sensor protein; PFAM: EAL
FT                   domain protein; PAS fold domain protein; response regulator
FT                   receiver; PAS fold-3 domain protein; GGDEF domain
FT                   containing protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAS domain containing protein; PAC
FT                   repeat-containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61272"
FT                   /db_xref="GOA:D3RML4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC61272.1"
FT                   /translation="MRVLHVEDNPADADLTRRRLARRAPDIELDQVDRQSDALERLPVP
FT                   GRYDLALLDLRLPDGSGLDLLAWIRERRLPLAVVVLTGSGDQDAAIAALQAGADDYLTK
FT                   GERAFERLPTTLRDAWRRFRLAQTRQARPLRVLYAEHTPADIDLTRRHLARYAPHIRLT
FT                   VVDDAEQILKRLPTDPLTPTAFDLLLLDYRLPGLDALETVKVLRAERGLDIPIVMVSGQ
FT                   GSEEVAARAMHLGVNDYLSKHPGYLHQLPATLEKAWSLTQLERERANLRAASERLALAL
FT                   ATSPVILYSRRLGPDERPLTWISENIARLLGYSPTLALQPGWWNSRLHPEDREAALDWL
FT                   RELDRGGAMVHAYRLIDAQGRVRWIQDEVTLLETDGGTTHEATGAWHDITATKTGEQMR
FT                   ETRLAVLDALIDKHSLTDILGEIATRLERMEPDMRVSIQIGSDGPHLPAERTVPERPAD
FT                   WVAPFKDGAGQMLGRLFVHYVEPRAPTPTERELIDECACIAGLAVTRVRADTRLRQAAT
FT                   VFESTREGVIITDLEGRILDVNRAFTEISGYSEPEVLGRNPSLLRSNRQDHAFYQAMWH
FT                   SLKTTGHWQGEIWNRRKSGELYPQILTINTVADSQGRPSHYVGVMTDISQLKQSEARLE
FT                   HLVHYDPLTNLPNRRLVQSRLEHALERADRQGGRVAVLFVDLDRFKTVNDSLGHPSGDV
FT                   LLELLARRLSERVREDDTLARLGGDEFLVLLENLQRPEDAAAVAESLLSLLQQPFHLPN
FT                   GQELYVGASIGISLYPDDGHTVTDLIQHADVAMYQAKEEGRNTYRFYTPSLTQTARERL
FT                   GLEARLHRALASEEFVLHYQAQIDMRDGRLIGCEALVRWHSATEGLVAPDRFIPLAEET
FT                   GLIVPLGEWVLRQACADCQSWRARGLTDLTVAVNLSGRQLRSPDLVERVTRVLRETGLP
FT                   AERLKLELTESMIMDQREQALERLRALKALGVRLSIDDFGTGYSSLAYLKRLPIDELKI
FT                   DRDFVRDIPEDSSDMEIAATIIAMARNLRLNVIAEGVETPEQCDFLIRQGCTAGQGYLF
FT                   GRPLPAEAFAQVMRACGTTAC"
FT   gene            complement(372337..372768)
FT                   /locus_tag="Alvin_0310"
FT   CDS_pept        complement(372337..372768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0310"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: azo:azo3382 putative
FT                   two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61273"
FT                   /db_xref="GOA:D3RML5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61273.1"
FT                   /translation="MIDTTGARPILLVEDNPMDLDLTLRAFRRRKLANPIEVARDGQEA
FT                   LDWIPRWAAGAPTPLVVLLDLKLPCLDGLEVLRQFRADPVSEHLPVVVLTSSSEDRDIQ
FT                   AAYRLGANSYIVKPVDFEKFTEVAAQIELYWCLLNHPAR"
FT   gene            complement(372765..374360)
FT                   /locus_tag="Alvin_0311"
FT   CDS_pept        complement(372765..374360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0311"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; CHASE domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; KEGG: azo:azo3383 putative
FT                   two-component system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61274"
FT                   /db_xref="GOA:D3RML6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC61274.1"
FT                   /translation="MQARSSRSTPSRRSWFLAGLVLLLVLATVQFIERLARERDLEQER
FT                   LGLITELAALGAHIEGVINAHLLLVHGLTAVISAHPDIGQAEFSRIAHGLVDERHALRN
FT                   IAGAPDLVVSLLYPLPGNESVIGLDYLRHPIQGPAALKALDSGQSVLAGPLPLIQGGMG
FT                   FLLRDPVFVTSATPDAPRRAWGLVTAVIEMDRLYRQTGLPEVLPRLRLALQAIDGTEAG
FT                   GAVFFGDPATLAQEPVSIVIEIPGGVWRLSAVPRSGWHNAIHSHVPIQLLGLLVALAAA
FT                   AMTYLLVHANEILEARVAARTAELATINKELETFTYSVSHDLKAPLRGIDGYSRLLLED
FT                   HRDRLDEEGQLFLNNVRQGVAQMGQLIEDLLDYSRMERRELHGVQIDLEPMVERLIREL
FT                   QDDIQASGARLEVDLGGLSVHADPDGLLLVLRNLLDNALKFHRPGEPPVISLRAQATET
FT                   TVRLDIQDQGIGFDMRFHDRIFEIFQRLQRAEDFPGTGVGLAMVRKAMQRMGGRIHAES
FT                   RPGHGTTFHLELPR"
FT   gene            complement(374515..375579)
FT                   /locus_tag="Alvin_0312"
FT   CDS_pept        complement(374515..375579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0312"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: maq:Maqu_3037 fructose-bisphosphate aldolase,
FT                   class II; TIGRFAM: fructose-bisphosphate aldolase, class
FT                   II, Calvin cycle subtype; ketose-bisphosphate aldolase;
FT                   PFAM: ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61275"
FT                   /db_xref="GOA:D3RML7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML7"
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /protein_id="ADC61275.1"
FT                   /translation="MALISMRQMLDHAAEHGYGVPAFNVNNLEQMRAIMEAADETDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAIEEWPHIPVCMHQDHGTSPAVCQRSIQLGFSSVMM
FT                   DGSLGEDGKTPTSYEYNIEVTRRVVEMAHACGVSVEGELGCLGSLETGQAGEEDGIGAE
FT                   GTLDHSQLLTDPNEAADFVKKTGVDALAIAIGTSHGAYKFTRPPTGDILAIERIKEIHT
FT                   RIPTVHLVMHGSSSVPQEWLKIINEHGGDMGETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   MASTGAIRKSLHDDRKNFDPRKYFTAATKAMKDICKARYEAFGTAGNASKIKVISLEGM
FT                   TARYAKGELDPRVN"
FT   gene            complement(375648..377090)
FT                   /locus_tag="Alvin_0313"
FT   CDS_pept        complement(375648..377090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0313"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: noc:Noc_2805 pyruvate kinase; TIGRFAM:
FT                   pyruvate kinase; PFAM: Pyruvate kinase barrel; Pyruvate
FT                   kinase alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61276"
FT                   /db_xref="GOA:D3RML8"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML8"
FT                   /inference="protein motif:TFAM:TIGR01064"
FT                   /protein_id="ADC61276.1"
FT                   /translation="MPRRTKIVATLGPATDPVSVTDEILAAGVDVVRLNLSHDTHDRHR
FT                   ERAARIRERALAAGQEIAVLMDLQGPKIRIGKFTDGKIQLARGDRFAIDTHCPIDAGDR
FT                   TRVGTTYVELANDVRHGDTLLLDDGAIELWVDAVVDGRIACQVVTGGTLSNNKGINKKG
FT                   GGLSAPALTDKDKDDIRFAAEIDADYLAVSFVRNGDDVRLARELFYEAGGRGGIVAKIE
FT                   RAESLKGIDDIINAADAIMVARGDLGVEIGDAELPAVQKRLISRARELNSVVITATQMM
FT                   QSMIESPIPTRAEVFDVANAVLDGTDAVMLSAESSIGKNPAKVVEALDRICLEAEKSAT
FT                   RSGHRLDSVFGRVDEAIAMAAMYTANHLGVKAIAALTETGSTVKWMSRISSGIPIYGLT
FT                   RSVPTQRKVRLFRGVYPVAFDVASTDMHEVNREVIEELLRHGTVQHGDLVIITKGDRSG
FT                   VEGQTNIMKIMRVGEHRLLNED"
FT   gene            complement(377197..378378)
FT                   /locus_tag="Alvin_0314"
FT   CDS_pept        complement(377197..378378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0314"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: tbd:Tbd_0161
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61277"
FT                   /db_xref="GOA:D3RML9"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D3RML9"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ADC61277.1"
FT                   /translation="MSFIKLTDLDLAGKRVLIRSDLNVPVKNGQVTSDARITASMPTFE
FT                   HCLKAGAKVMVMSHLGRPEEGVFSEADSLQPVAEALAAKLGRDIRLIRDYLDTPPTVAD
FT                   GELVLLENVRFNKGEGKDNEDLSKQYAALCDVFVMDAFGTAHRAQASTHGAGKFAPVAC
FT                   AGLLLAEELDALQKALANPARPMVAIVGGSKVSTKLTVLESLSEKVDQLVVGGGIANTF
FT                   LAAAGFPVGKSLCEEDLIPTAKALMEKMTARGASIPIATDVVCGKQFNENEPAVTKAAS
FT                   EVAEDDMIFDIGPDSAQALADIIAKAGTIVWNGPVGVFEFDQFGEGTRTVSMAIAQAAG
FT                   FSLAGGGDTIAAIQKYDIYDQVSYISTAGGAFLEYLEGKTLPAVAMLEARAKD"
FT   gene            complement(378499..379500)
FT                   /locus_tag="Alvin_0315"
FT   CDS_pept        complement(378499..379500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0315"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: tbd:Tbd_0160 glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: Glyceraldehyde 3-phosphate
FT                   dehydrogenase, NAD(P) binding domain; Glyceraldehyde
FT                   3-phosphate dehydrogenase, catalytic domain; SMART:
FT                   Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61278"
FT                   /db_xref="GOA:D3RMM0"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM0"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ADC61278.1"
FT                   /translation="MTIKVGINGFGRIGRMAFRAIAKDFPGIEVVAINDLLDPDYLAYM
FT                   LKYDSVHGNFKGDIAVDGHTMIVNGKPIRLTAEKDPANLKWGEVGVDLVIESTGFFLTE
FT                   EACQKHIDAGAKKVVQSAPSKDATPMFVYGVNHREYTGQAIVSAASCTTNCLAPVAKIL
FT                   HDNWGIKRGLMTTVHAATATQKTVDGPSMKDWRGGRGILENIIPSSTGAAKAVGKVLPE
FT                   LNGKLTGMAFRVPTSDVSVVDLTIELSKEAKYDEICAAMKAASTSGDLAGVLAYTDEKV
FT                   VSTDFRGCPYPSIFDAEAGIALDGTFIKVVTWYDNEYGYTCNMLRLVEYVAK"
FT   gene            complement(379588..381591)
FT                   /locus_tag="Alvin_0316"
FT   CDS_pept        complement(379588..381591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0316"
FT                   /product="transketolase"
FT                   /note="KEGG: mca:MCA3046 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase central region;
FT                   Transketolase domain protein; SMART: Transketolase central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61279"
FT                   /db_xref="GOA:D3RMM1"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM1"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ADC61279.1"
FT                   /translation="MSSRRELANAVRALAMDAVQKANSGHPGAPMGMADIAEVLWNDFM
FT                   RHNPSNPKWADRDRFVLSNGHGSMLIYALLHLTGYDLGIEDLKQFRQLHSRTPGHPEYG
FT                   YAPGVETTTGPLGQGITNAVGMAIAEKALAAQFNKPGHDIVDHYTYVFLGDGCLMEGIS
FT                   HEACSLAGALGLGKLIAIYDDNNISIDGEVRGHGDTPGWFLDDTPKRFEAYGWHVIPKV
FT                   DGHDAGAIKSAIEQARAVSDKPTLICCQTIIGFGSPNKQGKEECHGAALGDDEIALTRE
FT                   NLGWNHAPFVIPDNVRQGWDAKERGAAAESDWNAKFDAYANAFPAEAAEFKRRMAGELP
FT                   ADWSEKADAFIKSVVEKGETIASRKASQNALNGFGPLLPELMGGSADLAGSNLTLWKGC
FT                   KGVSKADGGNYIFYGVREFGMSAIMNGIALHGGFIPYGATFLMFSEYARNALRMAALMK
FT                   VPSIFVYTHDSIGLGEDGPTHQPVEQIPTLRLIPNMSVWRPCDAVESAVSWKLAIERKG
FT                   TPSCLIFSRQNLAHMPRSDEQLANIARGGYILRDCAGAPDAIIIATGSEVELAIKAAEA
FT                   MSDKAIRVVSMPSTDTFDQQDAAYKESVLPKAVTARVAVEAAVSDGWWKYVGSSGAVLG
FT                   VDRFGESAPAGALFKEFGFTVENLISKVQSVL"
FT   gene            complement(381871..382428)
FT                   /locus_tag="Alvin_0317"
FT   CDS_pept        complement(381871..382428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0317"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: mca:MCA2020 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61280"
FT                   /db_xref="GOA:D3RMM2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM2"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADC61280.1"
FT                   /translation="MVSTETPLCDFGAPAPDFALPGVDGRIWTRDQCKGPRGLLVMFIC
FT                   NHCPYVKAIRDRLVRDARELAALGIGCVAISSNDVNDYPEDSFDHMKQVAEAFHFPFPY
FT                   LYDESQAVARAYGAVCTPDFFGYDSELGLQYRGRLDASRKEAAPPDVRRDLFEAMKQVA
FT                   ETGAGPIEQIPSMGCSIKWKAH"
FT   gene            382641..383831
FT                   /locus_tag="Alvin_0318"
FT   CDS_pept        382641..383831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0318"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: hna:Hneap_0413 S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61281"
FT                   /db_xref="GOA:D3RMM3"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM3"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADC61281.1"
FT                   /translation="MSKDYIFTSESVSEGHPDKMADQISDAVLDEIYRRDPNHAKARVA
FT                   CETLVKTGFVMLAGEITVTDADLKIDYEKVVRRVVKEIGYDNSECGFDGNNCGVLIALG
FT                   EQSRDINQGVDRESEEAQGAGDQGLMFGYATNETDMLMPAPIDYAHRLVKRQAEVRKNG
FT                   TLPWLRPDAKSQVTMRYSNGKPVGVEAVVLSTQHSEDVSESVLHEAVMEEIIKPVFGAT
FT                   GWLDANTKYHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDR
FT                   SAAYAGRYVAKNIVAAGLADKCEIQVSYAIGVAEPTSVSIDTFGTNKISEDRIIELVRA
FT                   HFDLRPYGIIRMLDLTNRELIKYQDTAAYGHFGRNEPGFTWERTDKADELRAAAGI"
FT   gene            384022..384774
FT                   /locus_tag="Alvin_0319"
FT   CDS_pept        384022..384774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0319"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cyt:cce_3443
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61282"
FT                   /db_xref="GOA:D3RMM4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADC61282.1"
FT                   /translation="MSEYRLLIDLHKQAERQGPGSDAATEKAIALAGLAPTTPLKIADI
FT                   GCGTGAAALVLARRLNAQITAVDFLPDFLDVLAQRAERAGLSERITPLAGSMDSLPFAD
FT                   EEYDVLWSEGAIYNIGFARGIADWKRYLKPGGLLVVSEITWTTAERPPELQAHWMSEYP
FT                   DIDLASVKIGQLEQSGYAPIGYFVLPPTCWLDNYYRPMQERFRDFLARHDDSAEARAIV
FT                   AAEQREIELYEQYSAHYSYGVYIARKLA"
FT   gene            384959..386365
FT                   /locus_tag="Alvin_0320"
FT   CDS_pept        384959..386365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0320"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; S-adenosyl-L-homocysteine hydrolase, NAD
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61283"
FT                   /db_xref="GOA:D3RMM5"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM5"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ADC61283.1"
FT                   /translation="MSEFTDYKVADINLAGFGRKEIAIAETEMPGLMAIRRKYAADKPL
FT                   AGARITGSLHMTIQTAVLIETLVDLGAEVRWCSCNIFSTQDHAAAAIAARGIPVYAWKG
FT                   ETLEEYWWCTEQVINWPDGKGPNMILDDGGDATLLVHKGVEFEKAGAVPAPKADDNEEW
FT                   TAILGVLGRTFERDREHWHKMAAGIKGVTEETTTGVHRLYEMAKNGSLLFPGINVNDSV
FT                   TKSKFDNLYGCRESLVDGIKRATDVMIAGKIAMVCGYGDVGKGCCQSLRGLGATVWVSE
FT                   IDPICALQAAMEGYRVVTMEDAAPVADIFVTATGNLNVITHDHMAAMKNQAIVCNIGHF
FT                   DNEIDVAGITKYQWEEIKPQVDHVIFPDGKRIILLAQGRLVNLGCATGHPSFVMSNSFA
FT                   NQVLAQIELFTKTEQYPIGVYVLPKHLDEDVARLHLEKIGARLTELSKTQADYIGVAVE
FT                   GPYKPDHYRY"
FT   gene            386446..387303
FT                   /locus_tag="Alvin_0321"
FT   CDS_pept        386446..387303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0321"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: aeh:Mlg_2264 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61284"
FT                   /db_xref="GOA:D3RMM6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM6"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ADC61284.1"
FT                   /translation="MTTSTTPTRVYSVELFPPKTAEGMDKLKQEIPRINALGPAYFSVT
FT                   YGAGGSTREGTFETVAWLRAQGIDTAPHLACIGSTRDQVREILAHYHEQGINRLVALRG
FT                   DLPSGMGAGNSGDFRYANELVSFVRAEFGDAFVIEVAAYPEYHPQSGSPARDLENFKRK
FT                   VEAGAEAAITQYFYNAEAYFGFVESCERAGITIPIVPGIMPITNYTQLARFSDACGAEI
FT                   PRWIRRRLEGYGDDVESIRAFGHEVVLGLCRRLIEGGAPGLHFYTMNQSGPVTRLWSEL
FT                   GLSD"
FT   gene            387512..388828
FT                   /locus_tag="Alvin_0322"
FT   CDS_pept        387512..388828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0322"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   paa:Paes_1578 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61285"
FT                   /db_xref="GOA:D3RMM7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADC61285.1"
FT                   /translation="MSDLDRLYRLGPIHLAPSVTRLQAATLLFSAFFSIGLMTFIAVGQ
FT                   TYILNAHLGISTDVQGTISGDLVFWTEIITLALFIPAGILVDRVGRRLIFAIGFLLLAV
FT                   TYVLYPMAGSVDELYLYRIVYALGVVTVATALSTVMADYPAERSRGKLVATVGVLSGLG
FT                   IVVINQFFGGLPKTLTADGMDGIQAGYVTHYIVAGIAVVVAVLVWLGLQKGTPTHHEER
FT                   LSARDLFVSGFAQARNPRILLAYLAAFIARGDQSVNATFLILWGTTAGLAAGMDSGEAV
FT                   KNGTLIFVLAQVAALVWAPIMGPFMDRMDRVTGLALSMALAAVGNLAVIWMADPTPGSA
FT                   WLFCVLLGIGQISVYLASQSLVGQEAPRNKRGSVMGAFNVAGAIGILIITAIGGRLFDG
FT                   VAPYAPFVLVGAVNVLLLVLCVAVRLSGPAKPAAALEKV"
FT   gene            388856..389170
FT                   /locus_tag="Alvin_0323"
FT   CDS_pept        388856..389170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mva:Mvan_1709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61286"
FT                   /db_xref="GOA:D3RMM8"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61286.1"
FT                   /translation="MPQGLACYHAIYYETPLMGEVVMAQVIVRELEDVVKQGLKRRAAR
FT                   HGNSMEEEIREILRNAVRQEQAPPSRLGSRIAARFRDQGLDTDLPELQGSEARAATFGE
FT                   "
FT   gene            389167..389598
FT                   /locus_tag="Alvin_0324"
FT   CDS_pept        389167..389598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0324"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   cph:Cpha266_2640 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61287"
FT                   /db_xref="GOA:D3RMM9"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMM9"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADC61287.1"
FT                   /translation="MIVLDTNVLSALMQSQPEAGVVDWLDQQPAESVWTTAINVFEIRY
FT                   GLHRLAHGKRRRALEEAFTALLDEDLEGRVLVFDTAAANQAARLAGERCRTGRPVDMRD
FT                   TQIAGICEARNATLATRNTRHFEDLRTPVVNPWNEQGAV"
FT   gene            complement(389632..391668)
FT                   /locus_tag="Alvin_0325"
FT   CDS_pept        complement(389632..391668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0325"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: tbd:Tbd_1500 membrane-bound
FT                   proton-translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61288"
FT                   /db_xref="GOA:D3RMN0"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN0"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ADC61288.1"
FT                   /translation="MSTDFVLWLAIGSGGLAIVFGLAVVAWITAQSAGSERMQEIAAAI
FT                   QAGARAYLNRQYTTIGMVGAGLFVVLWLFLGMATAGGFAVGAILSGLAGYIGMNVSVRA
FT                   NVRTAQAATVSLESALAVAFRGGAVTGMLVVGLGLLGVAGYFLYLGADETALHALIGLA
FT                   FGGSLISIFARLGGGIFTKGADVGADLVGKVEAGIPEDDPRNPAVIADNVGDNVGDCAG
FT                   MAADLFETYAVTIIATMVLGGLMFKGADGGVNMDYVLYPLALGAVSIIASIVGAFFVKV
FT                   NEGGKIMNALYRGTAVAGGLAFVFFAIVTGLMMGEHFFSLLFCALIGLGLTAALMFITE
FT                   YYTATEYHPVQYVAEASQTGHATNVIAGLAVSMKSTALPVLAVCIAIWASYLTADLYGI
FT                   AIAATAMLSMAGMIVALDAYGPITDNAGGIAEMSGLPEDVRKTTDALDAVGNTTKAVTK
FT                   GYAIGSAGLAALVLFADYTHNLEVAGKMQVFSLSDPAVIIGLFIGGLVPYLFGAMAMEA
FT                   VGRAAGSVVIEVRRQFREIKGIMEGTAKPDYSRAVDLLTKAAIKEMVVPSLLPILVPVA
FT                   VAIGMNILMGDGAGIRALGGMLIGTIVTGLFVAISMCTGGGAWDNAKKYVEEGNFGGKG
FT                   SETHKAAVTGDTVGDPYKDTAGPAINPLIKIINIVALLLVPLL"
FT   gene            391971..393827
FT                   /locus_tag="Alvin_0326"
FT   CDS_pept        391971..393827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0326"
FT                   /product="V-type ATPase 116 kDa subunit"
FT                   /note="PFAM: V-type ATPase 116 kDa subunit; KEGG:
FT                   trq:TRQ2_1106 V-type ATPase 116 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61289"
FT                   /db_xref="GOA:D3RMN1"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN1"
FT                   /inference="protein motif:PFAM:PF01496"
FT                   /protein_id="ADC61289.1"
FT                   /translation="MLRFRPVQARWFETYLPHEQTVRGIEIIAQSGVVELETDPRLSEP
FT                   MDTHRLHYFVQRARTLIDSHRDDLPGGRHRPTALLGNPVHLANQALHRMRLWSARVDFL
FT                   KEQLAEQQAERKELHLLGEALWAMRRDGIELRELFSETRFLCKCLFVCPKASCPEGDEV
FT                   AGQTALIVRGPRHDFLFMLGLRDQRAVISHLVVEQGCEQVGVPSWLSGDPAQRVRQIRD
FT                   HASELEREITRLEAELRALRHDPEIAEARANLETLAWYLDTASRYLDGLELCHVTGWTT
FT                   ADDPERLQRELWESGIEAVVRYPDPPPMTAPPVTTLQSGWAQPFRPLLLLWGTPGRQEI
FT                   DPSGLLALIVPLLFGYMFPDVGHGLLLTGFAVLFWRRWPDIRFLLPCGLAAMVFGLLFG
FT                   EVFGFSEWLPALWVRPFDDPLLILIVPMVFGVGLLLLGLIFSGVEAKWSGTLGHWLAVE
FT                   AAVLVLYLSLLAALFDTRALPVAGLALVHYVVGSLWKGRGRGLWVLASAGGRLLFSLFE
FT                   LMLNTISFARVGAFALAHAAFSHTIMTLADGVEQPVGWLLIIVLGNFFEIVIEGLVVFV
FT                   QTTRLVLFEFFGHFLQAKGRLFRPVPRPVTSAETVRPPPGHG"
FT   gene            complement(393888..395015)
FT                   /locus_tag="Alvin_0327"
FT   CDS_pept        complement(393888..395015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0327"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: noc:Noc_2727
FT                   ApbE-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61290"
FT                   /db_xref="GOA:D3RMN2"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN2"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ADC61290.1"
FT                   /translation="MDHRTTFDADILTENALPMIDSHWRPVLALLLIALLALSGCTERT
FT                   DPMIELSGPTMGTYYSVKIARPPEGLSAETLEPELIQVLDAVIAEISTYDPNSELSRLN
FT                   ANPSTDWIPVSENLLTVIAEGQRIAELTNGAYDVTIGPLVNLWGFGPERRPDRLPTETE
FT                   IQAARERVGYQKLELRDSPPAVRKARGDLYIDLSSLGEGYGADRLVDWLESRGVSDYMV
FT                   AIAGAIRAKGLNAKDQPWGIAIEQPLPDRRAVHRVIPVSGHALSTSGDYRNFFEKDGKR
FT                   YSHEIDPMTGTPVDRQLGSVTVIGDVGMVVDGLATALMVLGEERGPALAEVQGIAAYFI
FT                   VRESEDFRGIASPALQTYLDTAVQASSAALTNTER"
FT   gene            complement(395019..395438)
FT                   /locus_tag="Alvin_0328"
FT   CDS_pept        complement(395019..395438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0328"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ele:Elen_1575 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61291"
FT                   /db_xref="GOA:D3RMN3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC61291.1"
FT                   /translation="MSWSWSIQPISSLVTRSALAKPATRLYPAERRTPYARTRGHIEFR
FT                   IDTCNFCTICAHKCPTQAIQVSKLDKTWAIDHSRCILCSICVEDCREGCITLSPLPCPP
FT                   MRAKEVLTFRQEHTPPPARETVTVAPPEDERRARE"
FT   sig_peptide     complement(395376..395438)
FT                   /locus_tag="Alvin_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.774 at
FT                   residue 21"
FT   gene            complement(395444..396526)
FT                   /locus_tag="Alvin_0329"
FT   CDS_pept        complement(395444..396526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0329"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.5.11"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: cth:Cthe_3020 ech hydrogenase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61292"
FT                   /db_xref="GOA:D3RMN4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN4"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ADC61292.1"
FT                   /translation="MSNTTIVPFGPQHPVLPEPIHLDLELDDERVVRALPSIGYVHRGL
FT                   ELLAERYDFIEMANVAERICGICSFIHGQGYCQGIEQLMGVEIPPRAAYLRTVWAEISR
FT                   IQSHVLWLGLAADALGYESLFQHSWRIREMMVDIIEETTGGRVIFGVCKVGGIRKDVDD
FT                   ETLRGVRRRIGEIRAAFDEIATIFRDDPTVRQRTVGVGLLSAADAHALGAVGPVLRASG
FT                   VAHDTRRLGYAAYGELDWEPIVEQDGDCYARCLVRVREVDQSFDLITQCLDRMPTGEIE
FT                   ISVKGKRPKGEAMFRLEQPRGEVCYYISASGKKNLDRFRVRTPTFANIAPLIHMLKGCE
FT                   LADVPVIVLTIDPCVSCNER"
FT   gene            complement(396530..396934)
FT                   /locus_tag="Alvin_0330"
FT   CDS_pept        complement(396530..396934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0330"
FT                   /product="NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 30 kDa
FT                   subunit; KEGG: mhu:Mhun_1744 ech hydrogenase, subunit EchD,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61293"
FT                   /db_xref="GOA:D3RMN5"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN5"
FT                   /inference="protein motif:PFAM:PF00329"
FT                   /protein_id="ADC61293.1"
FT                   /translation="MSLGEPFNELTPDQWVPTAEQHQRDGFRLVQMTGTARADHFEILI
FT                   SYEQDYRCTHYRVQLPRDPLPELPSLSAIFPAAFTYENELKDLFGLSFPGLTVDYGGNF
FT                   LRTKTKLPFSGAVTIKKEPAKPAAKSAPET"
FT   gene            complement(396931..397395)
FT                   /locus_tag="Alvin_0331"
FT   CDS_pept        complement(396931..397395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0331"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: mbn:Mboo_0026 NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61294"
FT                   /db_xref="GOA:D3RMN6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN6"
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /protein_id="ADC61294.1"
FT                   /translation="MSFLKKSPWVLHYAATSCNGCDIELLACLTPTYDVERFGIVNTGN
FT                   PKHADIFLVTGSVNEESRKVVENLYAQMPDPKVVVAIGACALSGGIFRDAYNVYGGIDQ
FT                   VLPVDVYVPGCAARPESIIDGIVQALDILEQRAKARKRQRKIVSQELEAR"
FT   gene            397511..397798
FT                   /pseudo
FT                   /locus_tag="Alvin_0332"
FT                   /note="hypothetical protein"
FT   gene            397812..398180
FT                   /locus_tag="Alvin_0333"
FT   CDS_pept        397812..398180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0333"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc1948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61295"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61295.1"
FT                   /translation="MWFEVLPENCPPNKSVNPNGETYYRLAESPEIKCSDFWSHRKLWP
FT                   KKLFKVPECRACSVSVFSEIDACTDLRKLKIHQGKPVVAIILNNDSGKVQQTGNNIFHY
FT                   SWWRALNFDPLLSSRLVK"
FT   gene            398180..399328
FT                   /locus_tag="Alvin_0334"
FT   CDS_pept        398180..399328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pdi:BDI_2560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61296"
FT                   /db_xref="UniProtKB/TrEMBL:D3RMN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61296.1"
FT                   /translation="MGVAMNLLTPRLNLLFYDYPQVFTAKDKVDCYYVCMVVEELESGP
FT                   LYLALQISNKRLRGLLSGALDLRAIYQFPEISLFRLAEFQEDGETLAFTGAAYDMCPVE
FT                   YLPDEGLYFDGDEIAGEALEHNSPVSHIGLSVKEAEKNAQIGIAKLSEFLALYQNVLKH
FT                   LARIAAKEIKCKINRKETPFNVDVYGFSHGSFTVHVKSSYQCDLFGDNALLAAAYSKLN
FT                   GFIELAESPESAVIELQKIKGHAANSIIKLVEFVDSQCCPLTHSWASPSTGRSEKRDLS
FT                   VSSAKALAELCRQRNDLFDEEIVLEGSIVRANEEANTWKMTNLRDGKRYSGEVDPDSGL
FT                   SMTGVIIGKEIYRFYCRERVEVVLGTGQEVTRLRVYKIEKNV"
FT   gene            complement(399404..399664)
FT                   /locus_tag="Alvin_0335"
FT   CDS_pept        complement(399404..399664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0335"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin Txe/YoeB; KEGG:
FT                   mmw:Mmwyl1_4022 addiction module antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61297"
FT                   /db_xref="GOA:D3RN13"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN13"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ADC61297.1"
FT                   /translation="MKLTFSSNAWDDYLYWQNTDKTVIKRINALIKDIKRTPFEGIGKP
FT                   EALKHGLSGYWSRRINDEHRIVYKVVEDSIFIAQLRYHYSY"
FT   gene            complement(399661..399912)
FT                   /locus_tag="Alvin_0336"
FT   CDS_pept        complement(399661..399912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0336"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: sde:Sde_1845
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61298"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN14"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADC61298.1"
FT                   /translation="MDAISYTAARANLAKTMEKVCDDHAPVIITRKSESPVVMISLEDY
FT                   QAMEETAYLLRSPANARRLLESIAELESGKGTVRAIAE"
FT   gene            complement(400109..400972)
FT                   /locus_tag="Alvin_0337"
FT   CDS_pept        complement(400109..400972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0337"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: mem:Memar_0363 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61299"
FT                   /db_xref="GOA:D3RN15"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN15"
FT                   /inference="protein motif:PFAM:PF00146"
FT                   /protein_id="ADC61299.1"
FT                   /translation="MNTHYAWWLAIAFVVLGPVVGALLAGIDRRLTARMQSRQGPPILQ
FT                   PVYDVLKLFEKDTLVVTRLQTLYLWFFLFFMVISGFILFLGSDLLLSLFALTVSGIFLC
FT                   LAAYSTNSPYSNIGSSRELMLMMAYEPMLILVPLGFYLTTDSFRVADIVAGSPWQVLQL
FT                   SGILVGFLFVLTIKLRKSPFDLSTSHHGHQELVKGLTTDFSGSDLALVEIAHWYENVIL
FT                   LGWLYLFFAPWGPWLALPIAFALFFVEVLVDNTHARLTWSSTLKATWWVTLLAGVTNLM
FT                   LLPLVV"
FT   gene            complement(400969..402903)
FT                   /locus_tag="Alvin_0338"
FT   CDS_pept        complement(400969..402903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0338"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mpl:Mpal_2724 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61300"
FT                   /db_xref="GOA:D3RN16"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN16"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADC61300.1"
FT                   /translation="MYSIGLLILFPLLAGLAIARAPDSTIRAQRVRWSAGAIAVATILL
FT                   TLLHLGLGPEFYSIPGWLHSTLDHFFMLAGVALALVLLYFCRRIVAREWYIPVLILLQT
FT                   GLMLSAELAPVHPEVAHPFYIDSFTLLMALIVGVVGGLICLHAVQYMRDYHAHEHAVAD
FT                   RQPAFYFVIFLFLAAMFGIVFTNHLTWLFVFWEVTTLCSFWLISYSGTDEAIRNGFRAL
FT                   GLNLIGGVTFAAAIAWLTYGPGLHTWELDRLVAAGSALALIPAALIAVAGLAKSAQLPF
FT                   SSWLLGAMVAPTPISALLHSSTMVKAGVFLLVKLSPVFYGTFAGLLLSLIGGVTFLVTS
FT                   LVAVNQRNAKRVLAYSTIANLGLIVMCAGVGTAAAMWAAILLILFHAVAKALLFLAVGT
FT                   TEHLIGSRDIEDMEGMVYRRPEMAAMLLVGILGMFLAPFGMLLSKYTTFQAFLNMGVMP
FT                   GDGLMLAAILAFGSAPTLFFWSKWMGKLVAMPRRPQPSTEPIARDELLALGALTVITYV
FT                   ACALFPLADKVFVIPYTHYLAVLGLIPDVQAVIPWETVWLMTLMLGVLFVLPLLFWWRP
FT                   PRFAEVSGYLSGANVDGSASYRGAMGAERMVESRGYYMTGFFHETTLLRYGGLGAAALI
FT                   ALMIGGAAL"
FT   gene            complement(402983..404245)
FT                   /locus_tag="Alvin_0339"
FT   CDS_pept        complement(402983..404245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0339"
FT                   /product="Citrate transporter"
FT                   /note="PFAM: Citrate transporter; KEGG: cvi:CV_0365
FT                   membrane anion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61301"
FT                   /db_xref="GOA:D3RN17"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN17"
FT                   /inference="protein motif:PFAM:PF03600"
FT                   /protein_id="ADC61301.1"
FT                   /translation="MTTLIVLVFLLVYLGLFLGGLPFLQLDRTGVALLGAIVLLATDVV
FT                   DMNQVWEAVHPPTLALLFAFMVISAQLRLSGFYDWVVWRLDRFDLPPSALLGAVILTSA
FT                   LLSAVFSNDIVCLAMAPVLADACRARRLDPVPFLLALACAANLGSAATLIGNPQNMLIG
FT                   ERLALDFGGYLRLAAMPVGLGLAATWVILLGLSRRRWHLAAPVAANPEPESEATSHRQR
FT                   AEDQAPGLDRWQTIKGLGVAGVLLLAFLFAPWPRDLLALAGAGLLLTSRRLHSHRMLGL
FT                   VDWQLLVLFVGLFIVNHALQETGLPARAITALAGLGMDLHDPAPLFGAGAILSNLVSNV
FT                   PAVMLLLPAATEPMSGPVLALSSTLAGNLLIVSSIANIIVVQAAARQGLLIDWRAHARV
FT                   GLPVTLTTLAIAALWLGVLQG"
FT   gene            complement(404300..405082)
FT                   /locus_tag="Alvin_0340"
FT   CDS_pept        complement(404300..405082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_1605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61302"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN18"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_1605"
FT                   /protein_id="ADC61302.1"
FT                   /translation="MSNAHQAFDHWLSTLGPLRLALEGRVGWEFGALFAAQPWLAQSPR
FT                   GDGHPVLVLPRFLGCDLSTQPLRDFLDRLGYRAEPWGLGVNLGPRAGVMDACLERLEHL
FT                   HATHGRRVSLIGWSLGGLYARELAKEAPEQVRLVITLGTPFAGDQSDPSELWRLQERMT
FT                   GESIGLPLRHGPLDQAPPVPTTSILSRSDGIVHWTDSLEREGPITENILVESSHLGLAF
FT                   NPLSLHAIADRLAQPEDAWRPFERTGARAWLYPALPRA"
FT   gene            405215..406501
FT                   /locus_tag="Alvin_0341"
FT   CDS_pept        405215..406501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0341"
FT                   /product="integral membrane protein, PqiA family"
FT                   /note="TIGRFAM: integral membrane protein, PqiA family;
FT                   PFAM: Paraquat-inducible protein A; KEGG: rme:Rmet_4089
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61303"
FT                   /db_xref="GOA:D3RN19"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN19"
FT                   /inference="protein motif:TFAM:TIGR00155"
FT                   /protein_id="ADC61303.1"
FT                   /translation="MSHPSLTECPECGLLQRHKPPPLGGLIECARCGAVLHRDRPDSLN
FT                   RTLALTLAGLLLFVIANSFPFIAFNLRGNETHTTLLTGVLNLYDAGQWGIAAVVLFTSV
FT                   LAPGLQLTLLLAVLVPLALERMPPWLPRLFRLVRTLAPWGMMDVFMLGILVSVVKLAEM
FT                   ASIVPGASLFAFAALILVLAAAQAALNPDLVWSRVPMPNPNLAAVRPGDDHLACDVCEL
FT                   VMPRTAAIREGDRLRCPRCTHVLHRRKPESLQRTWALVLAAILCYIPSNLLPIMTLTSF
FT                   GREQSDTILSGVIFLLAHGMWPLALIVFVASLVVPLLKLLLLTLLLLSVQFRWNWNPRE
FT                   RTRLYRLTETAGRWSMVDVYVVTILVALVQVGNLANVQAEAGAVFFCAVVVLTMLAAMS
FT                   FDPRLIWDRLESVEPEHAPMTLNEADKPA"
FT   gene            406498..408171
FT                   /locus_tag="Alvin_0342"
FT   CDS_pept        406498..408171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0342"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: mca:MCA0363 paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61304"
FT                   /db_xref="GOA:D3RN20"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN20"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADC61304.1"
FT                   /translation="MTETEREPDIRSPDPIPEAVARSRGRLSLVWLIPLVALAVGVWLA
FT                   VKTWSERGPIVTIEFKSASGLAAGQTRVKFKDVDIGQVKSIDFSPDLKTVIVSAELKRT
FT                   FADFLTEHTRFWVERPRVTLSGVSGLDTLVSGAYIALDPGQAGRSRRHFTGLEQPPVIT
FT                   TFEDGGRFRLRAPTLGSLNIGSPVYYRQIQVGQVIGYGLEPDGRAVGIEIFVAAPHDAL
FT                   VTPDTRFWNASGLDVSLSAAGVQVDTQSLLSVVLGGIAFGTPDTLDPAQAHDPYPEVFP
FT                   LYRNREAAHARIYARKERYLLLFEGAARGLTSGAPVRLKGIDIGRVLDIQLQLDTEALE
FT                   FRIPVLIEIEPERIVRRGEAEAPDERRLVERLVERGLRAQLKLDSVLSGALYVDLDVDS
FT                   GAPAGRLVRQGEHLVIPTRPGSLEAITTQLASVLEKLDTIPIEQIGRDLSQTAAGANAL
FT                   VNAPELKGAVIELEATLAQVRATATRLDRELGPELTKTLRESTATLERARALLSDRSPL
FT                   YVETQRMLQEVANAARSMRLLTDYLERHPEALLQGKGRGR"
FT   gene            408196..408861
FT                   /locus_tag="Alvin_0343"
FT   CDS_pept        408196..408861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0343"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   mca:MCA0364 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61305"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN21"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ADC61305.1"
FT                   /translation="MTLSLARWIPLSLALSIGLPGCASTPPSNFYTLAPIPAFEAKSSS
FT                   VDREGRDDRLEEELAIGLGPVTFPLFLDRPQIVSRASANRLSIDELERWGGTLQDDFLR
FT                   VWSENLALLTGSSRILILPSEIRYPLDVRLSAEILAFEGTAEGQAELRVRWSVLEPNMD
FT                   QVLLTRESRYQRAIAQPGDAQALLAALSLTLADFSREVAEALRHILVQREWIGTQSVH"
FT   sig_peptide     408196..408267
FT                   /locus_tag="Alvin_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.823 at
FT                   residue 24"
FT   gene            408979..410184
FT                   /locus_tag="Alvin_0344"
FT   CDS_pept        408979..410184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0344"
FT                   /product="ammonium transporter"
FT                   /note="PFAM: ammonium transporter; KEGG: tbd:Tbd_1701
FT                   putative ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61306"
FT                   /db_xref="GOA:D3RN22"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN22"
FT                   /inference="protein motif:PFAM:PF00909"
FT                   /protein_id="ADC61306.1"
FT                   /translation="MESLQAGTDVLFILIGAVMVLAMHAGFAFLEVGTVRAKNQVNALA
FT                   KIMTDFAVSTIAYFFIGYSLAYGIDFFSGAQVLQDRNGYELVKFFFLLTFAAAIPAIIS
FT                   GGIAERARFYPQLLASFLIVGVLYPFFEGLVWNGNLGVQDFIESILGAKFHDFAGSVVV
FT                   HAVGGWIALAAVLLLGPRQGRYRKDGSMTAHPPSSIPFLSLGAWTLTVGWFGFNVMSAQ
FT                   TVEAVSGLVAVNSLMAMVGGILAALIAGKNDPGFLHNGPLAGLVAVCAGSDVMHPMGAL
FT                   VTGAVAGALFVYAFTLTQNRWRIDDVLGVWPLHGLCGLWGGIAAGVFGLEVLGGAGGVS
FT                   LLAQVAGTLAGVIIALLGGFLIYGLLKWAFGLRLTQEEEYLGADLSIHRITAQPDYNRG
FT                   EV"
FT   gene            complement(410305..410607)
FT                   /locus_tag="Alvin_0345"
FT   CDS_pept        complement(410305..410607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0345"
FT                   /product="sulfur relay protein, TusE/DsrC/DsvC family"
FT                   /note="TIGRFAM: sulfur relay protein, TusE/DsrC/DsvC
FT                   family; PFAM: DsrC family protein; KEGG: mgm:Mmc1_0048 DsrC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61307"
FT                   /db_xref="GOA:D3RN23"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN23"
FT                   /inference="protein motif:TFAM:TIGR03342"
FT                   /protein_id="ADC61307.1"
FT                   /translation="MSATLSVALDNEGFLLDRDDWSEEVAVELAQSDGFEMTEQVMHFI
FT                   REARAMYEEDGVVPPIRIFAKKQKVSTKDLYDIFKKGPMKLICKWGGLPKPTGCV"
FT   gene            complement(410690..411472)
FT                   /locus_tag="Alvin_0346"
FT   CDS_pept        complement(410690..411472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61308"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR024423"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN24"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1648"
FT                   /protein_id="ADC61308.1"
FT                   /translation="MAALNFDHLRPLQDQLEGHAIYGAIQRIEDLRIFMQHHVFSVWDF
FT                   MSLIKYLQRQIAPVAVPWQPTSDPSLRYFINELIQEEESDAIPLGSGEVLYASHFELYC
FT                   RAMNEIGADGGLPERFLALVNEQGLDKALYSPLVPLPARYFSETTFCFIREDKPHLVAA
FT                   ALTLGRENLIPTMFRQLLDRMGIDETQAPIFHAYLKRHIHLDEDFHGPLSMRLLETLCG
FT                   DDPERIEEAEIAAEEALCARIRFWDGVLEAIESGRSTQ"
FT   gene            complement(411579..412478)
FT                   /locus_tag="Alvin_0347"
FT   CDS_pept        complement(411579..412478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0347"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: hch:HCH_06977
FT                   periplasmic protein TonB, links inner and outer membranes"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61309"
FT                   /db_xref="GOA:D3RN25"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN25"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ADC61309.1"
FT                   /translation="MPHAADRPAGRTWLWLALLLSAALHVAVAAVLWRTERSYSTEPEA
FT                   RPLVFELVRPGADEAATDEPPHDHRPSSPETASVPSASANDDAMPVPPAPVQTPARSPV
FT                   DPVAFASRATKPVPKTSQRPTRPVRSDPTPKQADPPPASAPRSTQASEPRNQRPRPPST
FT                   RHSAATGSATEAASARNSASPVSPGRTQTTQPGESAAGQRAAERAYLTALQRAIARHQR
FT                   YPAGARRHGQTGVTTLAFVIEADGRIGQIRLAQSSGHASLDQAALQALTRLGRFDPIPR
FT                   SIGRSRWSLRIPIRFDLK"
FT   sig_peptide     complement(412389..412478)
FT                   /locus_tag="Alvin_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.815 at
FT                   residue 30"
FT   gene            complement(412484..413111)
FT                   /pseudo
FT                   /locus_tag="Alvin_0348"
FT                   /note="hypothetical protein"
FT   gene            complement(413119..413730)
FT                   /locus_tag="Alvin_0349"
FT   CDS_pept        complement(413119..413730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0349"
FT                   /product="N-acetylmuramyl-L-alanine amidase, negative
FT                   regulator of AmpC, AmpD"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   SMART: N-acetylmuramoyl-L-alanine amidase family 2; KEGG:
FT                   kpe:KPK_4628 N-acetyl-anhydromuranmyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61310"
FT                   /db_xref="GOA:D3RN26"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN26"
FT                   /inference="protein motif:PFAM:PF01510"
FT                   /protein_id="ADC61310.1"
FT                   /translation="MVAISNSADSSSGSGLDADGWLVGAEQRPSPNQDARPPETAIDLL
FT                   VIHNISLPPGEFGGDWIDALFLNRLDPNAHPYFAPIASVRVSAHLLIRRDGRLIQYVSC
FT                   ERRAWHAGVSSFQGRERCNDYSIGIELEGTDETPFTEAQYARLVACTHQIRRHYPAITD
FT                   ARIVGHADIAPGRKTDPGPAFDWLRYRRAVGASPSGTEHR"
FT   gene            413855..414718
FT                   /locus_tag="Alvin_0350"
FT   CDS_pept        413855..414718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0350"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: psp:PSPPH_0841 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61311"
FT                   /db_xref="GOA:D3RN27"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN27"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADC61311.1"
FT                   /translation="MSRTSAVPQLSIPFDPALIESQVRAALDEDVGSGDLTASLLPADQ
FT                   EARAELVTRESAVLCGTAWFETVFRLLDPAVQIHWEASDGQGIEPGQRLCVIEGRSHVL
FT                   LTAERTAMNYLQTLSGTATLARRYADAVAGLPVRVLDTRKTLPGLRLQQKYAVRCGGCH
FT                   NHRLGLFDAILIKENHILAAGSIPAALEAARTLHPGVPVEIEVESLEELEIALDAGASI
FT                   VLLDNFALDDLRRAVAVTSGRAQLEASGGISLDTIRAIAETGVDRISVGALTKDVRAVD
FT                   LSMRFS"
FT   gene            414874..415446
FT                   /locus_tag="Alvin_0351"
FT   CDS_pept        414874..415446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbl:Sbal_0939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61312"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN28"
FT                   /inference="similar to AA sequence:KEGG:Sbal_0939"
FT                   /protein_id="ADC61312.1"
FT                   /translation="MIRHRPIARLLLLSALTLSFSATAEELPESAQRIVPQLQEWGANP
FT                   ILVEAVREQNALGRSLEDVQRLDADWMGASTVTPFMQTLMDNAPARELKRLEQTRPYFL
FT                   ELFLMDGQGANVAMTNKTSDYWQGDEDKFVESFKQGQGAVHLGEVEFDSSAQAYLVQIS
FT                   VPVMDEGRAIGALTVGIDLDRLEQETP"
FT   sig_peptide     414874..414948
FT                   /locus_tag="Alvin_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            415519..417183
FT                   /locus_tag="Alvin_0352"
FT   CDS_pept        415519..417183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0352"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: psa:PST_0298 chemotaxis transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61313"
FT                   /db_xref="GOA:D3RN29"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN29"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADC61313.1"
FT                   /translation="MKWFQNLAFRYKLILPLGVVVLLFFLFAASTLYRIDTLGEEVANL
FT                   VQSDMPVINDLLQADRDLYQALVAERTLIFMDVGSENYAATAAQHAENVQQAYERITRA
FT                   AATIASSRLVALPDITEKLKAFEASYRSWEPLSQQVVESRSSDTRAGRSTAIGLTLNES
FT                   RAAFESMRDLLDQIETVVIMSSEESVQRTETDVSATQRDTLILLAVCLIVMGAMVFGLP
FT                   PMIVRPIRRILDRVEDIAEGEGDLRARLDEDSRDETGQLARTFNRFLNRLHQLIGQSVS
FT                   SAGQLAQAGERLKTVAGESDRAIMEQLTQIQMVATAVHEMAATVNEIARNSARAADSTQ
FT                   AAEAGVRSGTHVVGEASVAIGHLAEVVTRASEAIVALESESKSIGAVLEVIKGVAEQTN
FT                   LLALNAAIEAARAGESGRGFAVVAAEVRNLASRTQQSAGEIESMIAALQSSARNMVGIM
FT                   QSGQGMVETTLQKAEQASRSLDDITHAVTAVNDMITQIASAAEEQSVVTEEINKNTLKI
FT                   QQLAEHAASASDQTATAREDLIVLTQDLHASLACFKV"
FT   sig_peptide     415519..415605
FT                   /locus_tag="Alvin_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.675 at
FT                   residue 29"
FT   gene            complement(417207..418133)
FT                   /locus_tag="Alvin_0353"
FT   CDS_pept        complement(417207..418133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0353"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; SMART: heat shock protein
FT                   DnaJ domain protein; KEGG: mca:MCA1727 curved DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61314"
FT                   /db_xref="GOA:D3RN30"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN30"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADC61314.1"
FT                   /translation="MQYKDYYKTLGVSRTASQEEIKRAYRKLARQYHPDVSKEPNAEAR
FT                   FKEINEANEVLKDPEKRATYDALGSGWRAGDDFRPPPGRWGDFDFKTGGASGDYSDFFS
FT                   SIFGRAFRPEGRGAGRQRGQDQTITLAIDLEDSHQGATRQIKVDLPATGSNGQSSARSR
FT                   TLNVRIPAGVTQGRQIRLAGQGLPGRHGGPAGDLYLEIAFKPHRLFTPDGRDIQLRLPV
FT                   APWEAALGATVQVPTLGGSVNLKIPPGSQSGRKLRLKGRGLPGTPPGDEIVQLEIVIPP
FT                   AETETARDLYRRMAEQLPFDPRAQLGV"
FT   gene            complement(418200..418694)
FT                   /locus_tag="Alvin_0354"
FT   CDS_pept        complement(418200..418694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0354"
FT                   /product="Protein of unknown function DUF2442"
FT                   /note="PFAM: Protein of unknown function DUF2442; KEGG:
FT                   eba:ebA5913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61315"
FT                   /db_xref="GOA:D3RN31"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018841"
FT                   /db_xref="InterPro:IPR036782"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN31"
FT                   /inference="protein motif:PFAM:PF10387"
FT                   /protein_id="ADC61315.1"
FT                   /translation="MSEYFFPRLESVVALAPYRLRTTWSTGEVLELDVEERLRRHPALA
FT                   PILDPAVFAGVHISDWGQSVEWFDEEFGADNLYAWAKEQNGEVSHEMFDEWMTRNGLSL
FT                   SRAAEALGISRRMVSYYRTAHKPIPRQTWLACLGWEAVKPDANVMPRRVPSAHEYAALH
FT                   A"
FT   gene            complement(418691..418879)
FT                   /locus_tag="Alvin_0355"
FT   CDS_pept        complement(418691..418879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA5912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61316"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN32"
FT                   /inference="similar to AA sequence:KEGG:ebA5912"
FT                   /protein_id="ADC61316.1"
FT                   /translation="MYFDDHPPPHVHVKLRDGRDCIVDLNSFEIQGRVAAREIREALDW
FT                   IRARQSVLLEQWHRNHA"
FT   gene            419116..420666
FT                   /locus_tag="Alvin_0356"
FT   CDS_pept        419116..420666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0356"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: tgr:Tgr7_2153 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61317"
FT                   /db_xref="GOA:D3RN33"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN33"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ADC61317.1"
FT                   /translation="MSAKDHLIIFDTTLRDGEQSPGASMTRDEKVRIAKALEKLRVDVI
FT                   EAGFPIASPGDFEAVKAVAEAVKDSRVCGLARALDADIDRAGEALKNANAGRIHTFIAT
FT                   SPIHMEKKLRMSPDQVLEQAVYAVKRARNLTDDVEFSPEDAGRSEIDFLCRILEAVIDA
FT                   GARTLNIPDTVGYNIPDQFGSLIATLRARIPNADKAIFSVHCHNDLGLAVANSLAAVRN
FT                   GARQVECTINGLGERAGNAALEEIVMTVRTRQDLFDCDTRLDTTQIMNCSRLVSGITGF
FT                   AVQPNKAVVGANAFAHESGIHQDGVLKHRETYEIMRAQDVGWSENRMVLGKHSGRNAFR
FT                   ARLQELGVVMNSEEDLNAAFARFKDLADKKHEIFDEDLQALVTETTLETANERVKLVSM
FT                   RVCSETGETPSAALVLAVDGQERSGTATGGGPVDATFKAIESLVQTGSTLKLYSVNAIT
FT                   SGTDAQGEVTVRLEKGGRIVNGQGADTDILVASAKAYINACNKILHPAERAHPQAADV"
FT   gene            420677..421672
FT                   /locus_tag="Alvin_0357"
FT   CDS_pept        420677..421672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0357"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   hha:Hhal_0689 phage SPO1 DNA polymerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61318"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN34"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADC61318.1"
FT                   /translation="MVERPPLDEERRLAYLEAMGVSVWALRSPWVAMSDSRAAESGDSV
FT                   PSATALPLLDASGTPPRVVAESTPRASAPVEPAPMTVETAARPAPASAAREAPSTLADA
FT                   PSAEPESWPFPDWDETPEYSPSLMDEWDAMGHPPASEAEAVNPIERMDWDALDAAVRGC
FT                   RACRLWETRTKTVFGVGDRRADLMIIGEAPGADEDRQGEPFVGRAGQLLTRMLAAIGFS
FT                   REQVYIANVLKCRPPGNRDPKPDEALACQAYLHRQVALIEPRVILSVGRISAQQLLKTD
FT                   TPVGRLRGQWFDYGPAHIPLRVTYHPAYLLRSPEQKAKAWDDLTEVWRRL"
FT   gene            421899..422273
FT                   /gene="sgpB"
FT                   /locus_tag="Alvin_0358"
FT   CDS_pept        421899..422273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sgpB"
FT                   /locus_tag="Alvin_0358"
FT                   /product="Sulfur globule protein"
FT                   /note="KEGG: mgm:Mmc1_2538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61319"
FT                   /db_xref="InterPro:IPR035173"
FT                   /db_xref="UniProtKB/Swiss-Prot:O52179"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_2538"
FT                   /protein_id="ADC61319.1"
FT                   /translation="MKKLATAAAVAALLGASASASAWWGPGWGGPGYGSGMGDWMNDMF
FT                   GDGYGDFNMSMSGGGRGYGRGNGYGRGYGYGNPYYGYGYPYYGGYGAPYGAYGAPYAFP
FT                   YGAPYGAPVAPAAPAQSESK"
FT   sig_peptide     421899..421967
FT                   /gene="sgpB"
FT                   /locus_tag="Alvin_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.967 at
FT                   residue 23"
FT   gene            complement(422340..423095)
FT                   /locus_tag="Alvin_0359"
FT   CDS_pept        complement(422340..423095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0359"
FT                   /product="glutamine cyclotransferase"
FT                   /note="PFAM: glutamine cyclotransferase; KEGG:
FT                   mmr:Mmar10_1722 glutamine cyclotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61320"
FT                   /db_xref="GOA:D3RN36"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN36"
FT                   /inference="protein motif:PFAM:PF05096"
FT                   /protein_id="ADC61320.1"
FT                   /translation="MKSGLGLVALLMLWCGVALADSAPVLGYRVVASYPHDSSAFTQGL
FT                   IFIDGTLYESTGNYGRSTLRRVDLETGRVEQDIRLAPNLFGEGLTDWRGRLVQLTWRER
FT                   LGIIYDAKTFERLETFSYTGEGWGLTQDGQHWIMSDGTDELRFLDPETRNVVRRVKVRA
FT                   GKRPVHRLNELEYINGAIWANVWRSDHLVQIAPDSGQVTAVVDLTTLYPSSERVGPEAV
FT                   MNGIAHDAATGRLFVTGKHWPRLYEIVIE"
FT   sig_peptide     complement(423033..423095)
FT                   /locus_tag="Alvin_0359"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(423092..425110)
FT                   /locus_tag="Alvin_0360"
FT   CDS_pept        complement(423092..425110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0360"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="KEGG: tgr:Tgr7_1759 excinuclease ABC subunit B;
FT                   TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase domain
FT                   protein; UvrB/UvrC protein; type III restriction protein
FT                   res subunit; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61321"
FT                   /db_xref="GOA:D3RN37"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN37"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADC61321.1"
FT                   /translation="MSNPSSPAFELVSPFAPAGDQPEAIRRLVEGLNDGEAGLTLLGVT
FT                   GSGKTFTIANVIAQVQRPALILAPNKTLAAQLYGEMREFFPRNAVEYFVSYYDYYQPEA
FT                   YVPATDTYIEKDAAINEHIEQMRLSATKALLERRDVIIVATVSSIYGLGDPEAYLKMVL
FT                   ILKRGERIDQRAILRRLAELQYTRNEIELSRGAYRVRGDVIDIHPAESDDEALRIALFD
FT                   DEIETLSLFDPLTGEVRRQVSRYTVFPKTHYATPRETILKAIDLIKPELRERLDWLRAN
FT                   DKLVEAQRLEQRTLFDLEMMLEVGYCQGIENYSRYLSGRQPGEPPPTLYDYLPPDAILV
FT                   IDESHVTVPQLGGMYRGDRSRKENLVNYGFRLPSALDNRPLQFEEFQSRQPQTIYVSAT
FT                   PRAFEIEHSGAVIEQVVRPTGLVDPEVEVRPALSQVDDLLSEIGPRVAADERVLVTTLT
FT                   KRMAEDLTEYLDEHGVKVRYLHSDIDTVERVEIIRDLRLGAFDVLVGINLLREGLDMPE
FT                   VSLVAILDADKEGFLRSTDSLIQTIGRAARNANGKAILYADRITGSMQRAIEESERRRA
FT                   KQIAANEAQGITPQTIRKAVADILEAHTPGAPMKAREYARVAEQVAEYGRLTPQQMAKR
FT                   LKTLEKQMYQHAKNLEFEEAAAIRDQIRELQARGLAA"
FT   gene            425254..426444
FT                   /locus_tag="Alvin_0361"
FT   CDS_pept        425254..426444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0361"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mca:MCA2202 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61322"
FT                   /db_xref="GOA:D3RN38"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN38"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADC61322.1"
FT                   /translation="MTTKLAARVQAVKPSATLAITARAAALRAEGKDVIGLGVGEPDFD
FT                   TPEHIKAAAIRAIESGFTKYTAVDGTPDLKRAIIAKFQRENGLDYAPNQILVSCGGKQS
FT                   FFNLAQALLDPGDEVVIPAPYWVSYPDMVLLAGGLPVFVQAGAAQSFKITPAQLKGAMN
FT                   EKTRLVVINSPSNPTGMAYSREELEALGEVLRDFPKVIIATDDMYEHIRWSSAPFVNIL
FT                   NACPDLAPRTLVLNGVSKAYSMTGWRIGYAAGPAHIIKAMNTIQSQSTSNPTSISQVAA
FT                   QVALDGPQECIGVMLKAFMERHDFVVERLNQIPGIECLPTDGTFYVFPKVQKLIERLEG
FT                   VNNDLELGEYLIEKAGVAVVPGSAFGLGGYMRLSIATSRETLERALDRIEQAVKNA"
FT   gene            426486..426561
FT                   /locus_tag="Alvin_R0008"
FT                   /note="tRNA-Asn1"
FT   tRNA            426486..426561
FT                   /locus_tag="Alvin_R0008"
FT                   /product="tRNA-Asn"
FT   gene            complement(426727..428568)
FT                   /locus_tag="Alvin_0362"
FT   CDS_pept        complement(426727..428568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0362"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: slo:Shew_2954 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61323"
FT                   /db_xref="GOA:D3RN39"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN39"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADC61323.1"
FT                   /translation="MLIKHKLVGLSALSVISLLIVLLASWWTWLQLERLASAGQLTAQL
FT                   TSRILKVERHGQDFFFQHAERDAVELREHLRALDQDIARLAGLLGQDAIPATQFDALRQ
FT                   EIAQYQERFEQFFNESKTIGLDHESGLYGSLREAVHHAEASVKETGRDDLLAGILQLRR
FT                   DEKDFMLRSSTKYVDNFKANYAALIARPEIDETVTRALARYHQDFLNLVESQIRVGLSA
FT                   DQGLRADLNAQMQGLQSQIDTIRTNLETHLQSAELRAAWRLAAFGLAVMVLVGLLTWLI
FT                   ARRLNRGISRAVSVIQNIADDHDLTLRLDVSGKDELARMGEHLNSMLDSVARVILQCQR
FT                   TIDDLSQTLAQLSANAEQTSVGGRHQLSEADQLATAITQMVATVEEIARNTETAADRTH
FT                   RASLHAQQGRVQVDTTIQRIDTLATRLAGSTQAADELVQSSTTIGSVLDVIRGIAEQTN
FT                   LLALNAAIEAARAGEQGRGFAVVAGEVRTLAMRTRTATEEIGGIISALQQKTGTIVSLI
FT                   QECREEGLAGSAQANEAGAFLQRITEDMAGVQEMSTQIAAAVQEQTHVATEINRNIVAI
FT                   RDIADHTASAADANASTSTQIAQSATELAHSISRFRC"
FT   gene            428929..430284
FT                   /locus_tag="Alvin_0363"
FT   CDS_pept        428929..430284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0363"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Transcriptional regulator, histidine kinase
FT                   sensor-like; histidine kinase A domain protein; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   KEGG: dar:Daro_1896 PAS/PAC sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61324"
FT                   /db_xref="GOA:D3RN40"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018771"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN40"
FT                   /inference="protein motif:PFAM:PF10114"
FT                   /protein_id="ADC61324.1"
FT                   /translation="MRLMKLKDLVDLDELRELCESFTALTGAVTAVLDLDGNILVATGW
FT                   QRICTQFHRAHPRTALRCRQSDTILAGCLGRGESYNVYRCQNGLVDVAVPIHVGGEHVA
FT                   NFFTGQFFFEPPDIDYFRRQAEEFGFDEAAYLAALAEAPIFTERQVRSMMDFLTRLARV
FT                   MGEMGLARVRQQEANRTLQQHRDHLEELVQARTAELSLAKEQAEAANRAKSAFLANMSH
FT                   ELRTPLNAITGMAYLVRASGVSVKQAGWLDTLDGASRHLLEIISAILELSKIEAGGMEL
FT                   DTVPIRLDTLVASVVDTILPQARAKHLHIGLELDPVSTPLMGDPARLRQALLNYAANAV
FT                   KFTATGSVTLRTKVIEQTPEFVMMRFEVEDTGVGLPADVIDRLFENFEQADNSATRRFG
FT                   GTGLGLAMTRRLAHLMGGTVGVSSTPGEGSTFWFTARLGARPAAFQIQCAER"
FT   gene            430339..431691
FT                   /locus_tag="Alvin_0364"
FT   CDS_pept        430339..431691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0364"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: mca:MCA1812 U32 family
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61325"
FT                   /db_xref="GOA:D3RN41"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR032525"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN41"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADC61325.1"
FT                   /translation="MNSNHPKPPELLSPAGTLRNLRYALAYGADAIYAGLPRYSLRVRN
FT                   NDFDLSNLAVGIAETHRQGKRLYLAANLMPHGAKLKTFIDDMRPIVELGPDGLIMADPG
FT                   LILMAREQWPELPIHLSVQANTVNAAAVRFWQRQGLKRVILSRELSLSAIAEIRDACPD
FT                   MELEVFVHGALCIAYSGRCLLSGYFNHRDANQGACTNACRWEYRLGVTAGEAEAGPGGE
FT                   PDHWHEHAETEPAPARRHTAAESVYLLEEAQRPGDYMPIFEDEHGTYILNSRDLCAIEH
FT                   VERLVAMGIDCLKIEGRTKSHYYVARATQAYRAAIDDAVAGRPFRPELKHDLEGLANRG
FT                   YTEGFYRRHAPSETQNYAYGASRNQRRIFVGDLGDAGPGWAEVEVRNRFALGDTLELMT
FT                   PNGNRTFRLERLETLAGEPLEVAPGSGWRVRIPVPEPVGDSALLTRALEPG"
FT   gene            complement(431708..432142)
FT                   /locus_tag="Alvin_0365"
FT   CDS_pept        complement(431708..432142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0365"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   tgr:Tgr7_0887 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61326"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN42"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADC61326.1"
FT                   /translation="MNERFWETTPLTELTAAQWESLCDGCGKCCLEKFEDEETGNIVYS
FT                   RVACALLDLETCRCRRYAERAQHMPDCVTIVPQVLAWPNWLPETCAYRRLAEGRPLPVW
FT                   HPLISGDPASVVDAGHSVRGRVIGPETGEDPLMNLIDWIR"
FT   gene            432283..432804
FT                   /locus_tag="Alvin_0366"
FT   CDS_pept        432283..432804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0366"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: aeh:Mlg_2037 methylated-DNA--protein-cysteine
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61327"
FT                   /db_xref="GOA:D3RN43"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN43"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADC61327.1"
FT                   /translation="MCHDAQCLIETPIGRLGLHWRGDVLTGIELDPLPADGQSPSECEP
FT                   PQAITRQLDAYFQAPETRFELPLELAGTAFQQRVWALLRAIPAGQTRTYGEIARELGSA
FT                   ARAVGQACRANPCPIVVPCHRVVGQRGLGGFAGDLSGRRLAIKRRLLEHEGILRYSTLV
FT                   DSTLGPTTVL"
FT   gene            432812..433705
FT                   /locus_tag="Alvin_0367"
FT   CDS_pept        432812..433705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0367"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="TIGRFAM: tyrosine recombinase XerD; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: pfo:Pfl01_1025 site-specific tyrosine
FT                   recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61328"
FT                   /db_xref="GOA:D3RN44"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN44"
FT                   /inference="protein motif:TFAM:TIGR02225"
FT                   /protein_id="ADC61328.1"
FT                   /translation="MDDRALIEGFADALWMERGLSRNTLTAYQSDLRAFAHWLSQERGR
FT                   TLIAAERADLLDYLARLAKQGRNPRSSARLLSCLRQFYQHLRRRGLIEADPSARVEAPK
FT                   LGRPLPKSLSEADVEALLNAPDTEDARGHRDRTMLEVLYASGLRVSELVNLTPSQVSLT
FT                   QGVVRILGKGGKERLVPLGEDACNWLRDYVRGPRFDILGGRASDFLFPTRRSDCMTRQA
FT                   FWQLIKRYAILAGVAKPLSPHTLRHAFATHLLNHGADLRVVQMLLGHSDLSTTQIYTHV
FT                   ARERLKQLHARHHPRG"
FT   gene            433793..434275
FT                   /locus_tag="Alvin_0368"
FT   CDS_pept        433793..434275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0368"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   tgr:Tgr7_1196 protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61329"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN45"
FT                   /inference="protein motif:PFAM:PF04461"
FT                   /protein_id="ADC61329.1"
FT                   /translation="MPSFDVVSEIDLQEVRNAVDQSNREIGTRFDFKGVNASFELSDDK
FT                   ILLTGEQEFHLQQMMDILRQKLVKRGIDLASLDPGEPVTNLSSARQEVKLKQGVDSDTA
FT                   KTLVKAIKASKAKVQAQIQGDQLRVTGKKRDDLQEVIALLRGGDWGLPLQFNNFRD"
FT   gene            434288..435022
FT                   /locus_tag="Alvin_0369"
FT   CDS_pept        434288..435022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0369"
FT                   /product="Disulphide bond isomerase, DsbC/G-like protein"
FT                   /note="PFAM: Disulphide bond isomerase, DsbC/G-like; KEGG:
FT                   mca:MCA0575 thiol:disulfide interchange protein DsbC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61330"
FT                   /db_xref="GOA:D3RN46"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN46"
FT                   /inference="protein motif:PFAM:PF10411"
FT                   /protein_id="ADC61330.1"
FT                   /translation="MNRLTQRLLIAAALVLSSGLALAAPEQKIREALKEIAPDLEISNI
FT                   QPSPIKGLYEVMAGTDLMYITADGRHFISGHIVDLKTREDLTEPRLSEARKRLIDRIGE
FT                   NDMVVFGDKDAKHTITVFTDIECGYCRKLHSQIADYEKEGIRVRYLFFPRAGKGSPAFD
FT                   EAVSVWCAGDAEARRTAMTKAKAGEPVASKTCDNPVEEHMALGADLGLRGTPAILTDTG
FT                   ELIPGYVEPKRLAAQLNSQSGG"
FT   sig_peptide     434288..434359
FT                   /locus_tag="Alvin_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            435050..435832
FT                   /locus_tag="Alvin_0370"
FT   CDS_pept        435050..435832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0370"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: gyc:GYMC61_1956 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61331"
FT                   /db_xref="GOA:D3RN47"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN47"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADC61331.1"
FT                   /translation="MDANPISAFELDFAWCTDQGRVRQRNEDAVVVCPEFGLIVVADGV
FT                   GGASAGHVASRLATGTIAERFGRRVGASANAEKARLYLQAAVEEANITILRHAKEHPEC
FT                   AGMGTTVVVGAVGQDWLAFAHVGDSRLYRLRGEELVQLSRDHSFIQEVVDQGFFNTRED
FT                   ARRYGIGENILTRALGSTPSVAVSSDVIAIDSGDLFLFCTDGLSGLVPDDWLKQILSSI
FT                   GDDALESAADALVRLANERGGNDNITLALLRVGERVAV"
FT   gene            435840..436613
FT                   /locus_tag="Alvin_0371"
FT   CDS_pept        435840..436613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0371"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: smt:Smal_2921
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61332"
FT                   /db_xref="GOA:D3RN48"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN48"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ADC61332.1"
FT                   /translation="MFDRPTRLFIVLGGFFVCNALIAEFLGVKIFALEATLGLAPLDWN
FT                   LFGQSGSLSFTAGVLLWPVVFIMTDIINEYYGRRGVRLLSYLTVGLILYAFAFAYLSIG
FT                   LSPADWWVGIQSGQGVPDMQAAFSAIFGQGMWIIVGSVVAFLIGQIVDVTVFHRIRRLT
FT                   GGRHVWARATGSTLISQFIDSFVVLYVAFVLGPQQWPMELFLAVGTVNYVYKFVVAIVL
FT                   TPLIYLGRALIDRYLGDELSGTLRERAAAAEGLAW"
FT   gene            complement(436772..436984)
FT                   /locus_tag="Alvin_0372"
FT   CDS_pept        complement(436772..436984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gbm:Gbem_0768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61333"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61333.1"
FT                   /translation="MNIHRKTMPSEEGRRLLGALSQAVDKALERKRRLGQYAVIWQGGK
FT                   PVVLGEDAPQSAASNHETEIGLLGS"
FT   gene            complement(436981..437559)
FT                   /pseudo
FT                   /locus_tag="Alvin_0373"
FT                   /note="hypothetical protein"
FT   gene            complement(437748..437996)
FT                   /pseudo
FT                   /locus_tag="Alvin_0374"
FT                   /note="hypothetical protein"
FT   gene            438200..438442
FT                   /locus_tag="Alvin_0375"
FT   CDS_pept        438200..438442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61334"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN50"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_0869"
FT                   /protein_id="ADC61334.1"
FT                   /translation="MITGIVGQAGWMGMQRGMDGLSQNASEIAGAGVKPLEGTTVRDIS
FT                   EPLIDQTENLRQVEASAKVLQSSTDAFDHLIDILA"
FT   gene            complement(438418..439602)
FT                   /locus_tag="Alvin_0376"
FT   CDS_pept        complement(438418..439602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0376"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tgr:Tgr7_1999 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61335"
FT                   /db_xref="GOA:D3RN51"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN51"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC61335.1"
FT                   /translation="MRVLMISDVYFPRVTGVSTSIQTFAREFGAKGHEVTLIAPDYGSS
FT                   DYDASANESFEIIRIPSRYLPIDPEDRILQPFKIRRLTDTLKGRGFDLLHIQTPFIAHY
FT                   SGLGLAKRLELPVVESYHTFFEQYLHHYVPWVPARWMHGAARHFSTSQCNGVDALVVPS
FT                   QAMLDVLRDYGIQTAAEVIPTGIDLDQFSQGDGQRFRARHDIPPERPVLVLVSRLAFEK
FT                   NIEFILRALVRIKAEVPDVLLVIAGEGPAQRDLERLAEQLGLADNTRFLGYLNRDGSLE
FT                   DCYRAGTAFLFASRTETQGLVLLEAMALGVPVVSTAVMGTKEVLGEGQGALIAEEDEVD
FT                   FAGKAVRLLKDPTLRKRLAREAVEHAHDWSAPVLADRLLKFYERVIDQARISIR"
FT   gene            439685..440098
FT                   /locus_tag="Alvin_0377"
FT   CDS_pept        439685..440098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0377"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Transcription elongation factor A
FT                   (SII), 1; K03145 transcription elongation factor S-II"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61336"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61336.1"
FT                   /translation="MVDRSHLVRFIRTAGLVWILGWPALAGAQGQQTVVPALWGQGVKS
FT                   CADYLASRPGPGAPAGIAGEEYRLYRQWLAGLVTGLNLAVGRDVLAGSELEAAMLRIGS
FT                   LCEKQPQEDFFNTSLRLIRSLGQLQSAPGQAKP"
FT   sig_peptide     439685..439771
FT                   /locus_tag="Alvin_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.822) with cleavage site probability 0.686 at
FT                   residue 29"
FT   gene            440236..441279
FT                   /locus_tag="Alvin_0378"
FT   CDS_pept        440236..441279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0378"
FT                   /product="phosphate ABC transporter periplasmic binding
FT                   protein"
FT                   /note="KEGG: abo:ABO_2685 phosphate ABC transporter
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61337"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN53"
FT                   /inference="similar to AA sequence:KEGG:ABO_2685"
FT                   /protein_id="ADC61337.1"
FT                   /translation="MNKTLIAAAVTLAATTLSTQAMARDTINIVGSSTVFPFSTAVAET
FT                   FGRTTSFNTPKVESTGTGGGMKLFCGGVGVDHPDITNASRAMKTSEFEACQEAGVKEIT
FT                   EVKIGYDGIAIANSKTSGAWDLSLKDVYLALAKDVPDGKGGFMANPYKTWKDVNADLPE
FT                   VKIEVLGPPPTSGTRDAFVELAMEGGCDSIPEIKELKKTDKDKHKAVCHGIREDGAYIE
FT                   AGENDNLIVQKLVANPSALGIFGYSFLDQNADKVQGAKIDGVDPTYDSISDGSYPVSRS
FT                   IYFYVKKAHVGTIPGIEEFVKEFTSDKAWGPEGYLADKGLIALPDDERAAVAEAAQSLK
FT                   PMDKPAK"
FT   sig_peptide     440236..440307
FT                   /locus_tag="Alvin_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            441365..442756
FT                   /locus_tag="Alvin_0379"
FT   CDS_pept        441365..442756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0379"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mca:MCA1072
FT                   phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61338"
FT                   /db_xref="GOA:D3RN54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN54"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ADC61338.1"
FT                   /translation="MYSWILMLVVLAAMAGAYQIGRQRAIASAGGPTRIKQLHSLPTYY
FT                   GLYAALWAGLPALMLMGLWIGLQDQIVIGLVTSHLPTEVVSGLSEGRLGLLINDIRNLA
FT                   TGNIVSAEVTPEIQAAADQYNRLNLISQWAMWAVVLAVVLAGLAYAWMRTQPRLRARNR
FT                   VESAFTVMLIIFSSIAILTTLGIVLSVLFESLLFFQKVSPLEFFFGTNWSPQIALRADQ
FT                   VGASGAFGAIPLFTGTLMVSLISMLVAVPIGLLSAIYLSEYAHRRVRAIAKPTLEILAG
FT                   IPTVVYGFFAALTVAPFIRELGMSFGLDVASESALAAGLVMGIMIIPFVSSLSDDVINA
FT                   VPQSLRDGSYALGATQSETIRRVVIPAALPGIVGGILLAVSRAIGETMIVVMAAGLAAN
FT                   LTANPLDSVTTVTVQIVTLLTGDQEFDSAKTLAAFALGLTLFLVTLTLNVIALSIVRKY
FT                   REQYE"
FT   gene            442749..444053
FT                   /locus_tag="Alvin_0380"
FT   CDS_pept        442749..444053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0380"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mca:MCA1073
FT                   phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61339"
FT                   /db_xref="GOA:D3RN55"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN55"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ADC61339.1"
FT                   /translation="MNNPADTTPPRRAIDIVNASLKRRYARERRFRWLGATAVTLGMVF
FT                   VVLLFADIILKGYTAFQQTYIQLPIELAAATIDPDGARDPATLARADYMKLIREALRER
FT                   FPEVTDRRDRRLLNSMISVGAPDLLRERVMADPALIGTTQELWILADDDIDMLVKGYID
FT                   RNAPASDRRVGDQMIAWVDRLEAEGRVAKRFNTIFFTHGTSREPELAGIAGALMGSFYT
FT                   LVLTFLLSFPIGVGAALYLEEFAPKNRWTDLIEVNVNNLAAVPSIVFGLLGLAVFIGFF
FT                   GVPRSTPLVAALVMTLMTLPTIIIASRVALKSVPPSIREAALGVGASPLQTQFHHVLPL
FT                   ALPGILTGSIIGMARALGETAPLLMIGMIAFIVDIPKGFNDAATVLPVQIFLWADSPER
FT                   GFVERTSAAILVLLAFLFVMNLAAVLLRRRFERRW"
FT   gene            444127..444990
FT                   /locus_tag="Alvin_0381"
FT   CDS_pept        444127..444990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0381"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: cpb:Cphamn1_1231 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61340"
FT                   /db_xref="GOA:D3RN56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN56"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ADC61340.1"
FT                   /translation="MNTMVEVMDKTTGAISSADLAQDRPSAATVGDVTVADPRMTCRNV
FT                   DVWYGPKQAIKGVSLDIGKNEVLSMIGPSGCGKSTFLRCLNRMNDTIDGCRVTGSIQLD
FT                   GQDIYDKGLDPVPLRAQVGMVFQKPNPFPKSIYENVAYGPRIHGLTNNKAELDELVETS
FT                   LRKAGLWNEVKDRLDQPGTGLSGGQQQRLCIARTIAVSPEVILMDEPCSALDPIATAII
FT                   EELIDELRANYSIAIVTHSMQQAARVSQRTAYFHLGDLIEVGETNQIFTNPQHRLTEDY
FT                   ITGRFG"
FT   gene            445010..445768
FT                   /locus_tag="Alvin_0382"
FT   CDS_pept        445010..445768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0382"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="TIGRFAM: phosphate transport system regulatory
FT                   protein PhoU; PFAM: PhoU family protein; KEGG: noc:Noc_2395
FT                   phosphate transporter PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61341"
FT                   /db_xref="GOA:D3RN57"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN57"
FT                   /inference="protein motif:TFAM:TIGR02135"
FT                   /protein_id="ADC61341.1"
FT                   /translation="MSDPAIDKPAGDLMAGHTVRRYDQELAKLRAIILQMGERVIDQTQ
FT                   AAVAALIEGDESQTYRVLDREPLIDYLSLDADEEVFRVIARRQPTAVDLRIVLALSKIA
FT                   GEVERAGDKAVRIAREALELRQQEQDGELLVEPLRAAFQALDDRACCMFERSVHAVTGF
FT                   DVNQALTIFENEPALYAAAHDLRQLLGESDSDGLVPRQAIALFHCAQALKRIGNHASNI
FT                   AEQVIYVALGQDVRYRNREILIETLRHRGY"
FT   gene            445887..447008
FT                   /locus_tag="Alvin_0383"
FT   CDS_pept        445887..447008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0383"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family; PFAM:
FT                   Esterase PHB depolymerase; KEGG: rru:Rru_A1969 esterase,
FT                   PHB depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61342"
FT                   /db_xref="GOA:D3RN58"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN58"
FT                   /inference="protein motif:TFAM:TIGR01840"
FT                   /protein_id="ADC61342.1"
FT                   /translation="MNETLKTILAEAMHLGREGRFTEATALIQRGLHLTQPLPEQRESH
FT                   PSAGDPDRRPVVEADFEVIEDIGRTGGRSIHGHFTHGIETRDYRVYVPAGADDRPRPLI
FT                   LMLHGCQQDAEDFARLTRFDPLADELGFIVLYPTQPRTANATGCWNWFLPEHRRADQGE
FT                   AAWLIALTQAIATRYQADPHHIHVAGLSAGGAMALTLAATQPALFRSVGVHSGLPHGLA
FT                   QDQLSALTLMHQGPTAVSGGRTAMDGIGVPVIVFQGDADLRVNPANASGIIEQALSGAP
FT                   EARSGLDASGVERETGRAPGGLGYTRTRYLAADGSSRAELWMVQGGGHAWFGGDPAASF
FT                   AEPRGPDASREMVRFFLERSVPDARATGTDRSG"
FT   gene            complement(447000..447941)
FT                   /locus_tag="Alvin_0384"
FT   CDS_pept        complement(447000..447941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0384"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   ttu:TERTU_2108 lytic transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61343"
FT                   /db_xref="GOA:D3RN59"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN59"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADC61343.1"
FT                   /translation="MPEVKRLGPAVGLLSALVLPVLLIGCASNDSTAMNGSYDLYEGVV
FT                   SAREYGYVRPALDVRVRGRSRVVERGASGGDLWQRVRSGMQLNLQANARIDATLERFRR
FT                   DPRYLERLSRRGAPYLPLIVAEIERRGLPMELALLPHVESRYDPAATSPKAAAGMWQFI
FT                   PSTAREMGLRLDDYTDERRDVVASTRAALDYLERLNKRFEGDWELTMAAYNCGPGCVSS
FT                   AIEANRRAGRPTDFWSLDLPNETKQYVPQILAASKLVAGSGRYGQHLPAIPDRLGKLRT
FT                   ARRQNTDTLSGARGRVVENNEQVRIRERDRSS"
FT   gene            448121..448888
FT                   /locus_tag="Alvin_0385"
FT   CDS_pept        448121..448888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0385"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: tgr:Tgr7_0954
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61344"
FT                   /db_xref="GOA:D3RN60"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN60"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADC61344.1"
FT                   /translation="MTTDPLQPDQSDPLQAWYRSALGAEVANHEGDCVRRLLANTFGYY
FT                   LVQVGASERFGEALTASRIRHRVLLPGTPPTGAVQGLSIVGEPDALPLASDSIDAVLLP
FT                   HVLEYSDRPRAILAEVERVLIPEGRLILLGFDPLSLWALGRLWWPACRRAPWNGRWRLA
FT                   VQVEHWLNELGFEIEVCERALFCPPIVSPAGARCATIESLGRRFWPLFGGLYVIRAVKR
FT                   VATLTPLKPYRTSRHALLPGGAVRPTTRGTGHV"
FT   gene            448881..449324
FT                   /locus_tag="Alvin_0386"
FT   CDS_pept        448881..449324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0386"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: cja:CJA_2049 RNase H"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61345"
FT                   /db_xref="GOA:D3RN61"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN61"
FT                   /inference="protein motif:PFAM:PF00075"
FT                   /protein_id="ADC61345.1"
FT                   /translation="MSDCVEAFTDGACKGNPGPGGWGVLLRWGEVEKELHGGERETTNN
FT                   RMELMAVIMALEALKRPTPIRITTDSQYVKRGVGEWMPRWKRNGWRTADRQPVKNRDLW
FT                   ERLDRALGQHEVSWRWVKGHAGHAENERADWLANLGVPTTGGR"
FT   gene            449327..450049
FT                   /locus_tag="Alvin_0387"
FT   CDS_pept        449327..450049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0387"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: hch:HCH_02528 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61346"
FT                   /db_xref="GOA:D3RN62"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN62"
FT                   /inference="protein motif:TFAM:TIGR01406"
FT                   /protein_id="ADC61346.1"
FT                   /translation="MRQIVLDTETTGLEPREGHRIIEIGCVELVDRRPTGRNFHEYLNP
FT                   ERQIDAEAEAVHGISNAFLADKPRFAERAERLVEYLRGAELIIHNAAFDVGFLDHEFGL
FT                   WRGAEAPRIADLCTVTDSLLMARKLHPGQRNGLDALCKRYAIDNSHRTLHGALLDAEIL
FT                   ADVYLAMTGGQVSLYLGGEGMNGSGVGEGPVHRGRLDPERPRLRVVRATQTELEAHRVR
FT                   LDAIWKASGGCVWLGGTD"
FT   gene            complement(450050..450817)
FT                   /locus_tag="Alvin_0388"
FT   CDS_pept        complement(450050..450817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0388"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: tgr:Tgr7_0212 putative transcriptional
FT                   regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61347"
FT                   /db_xref="GOA:D3RN63"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN63"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADC61347.1"
FT                   /translation="MNQSTVISIESIRVACRHCTLSSLCLPMGLTPEDVERLDDIVKRA
FT                   RPLHRGDILFREGDRFRSLFVVKTGSLKTFAPSSEGGEQVLSFHLPGEILGLDAIDKGE
FT                   HACSASALETSAICEIPFGRLEELTAIIPSLQHQMYRLLSKEIGQDTDMLLLLGKKNAE
FT                   ERLAAFLLSFSQRLHKRGLSATDFHLSMSRHEIGNYLGLAVETVSRLFTRFQDDGLVRV
FT                   ERKHIELLDLQGLEEILGGVGPGRRQPQRQHHT"
FT   gene            451119..452762
FT                   /locus_tag="Alvin_0389"
FT   CDS_pept        451119..452762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0389"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: tgr:Tgr7_1182 CTP synthase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61348"
FT                   /db_xref="GOA:D3RN64"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN64"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ADC61348.1"
FT                   /translation="MTKFIFITGGVVSSLGKGIASASLAALLEARGLRVTMIKLDPYIN
FT                   VDPGTMSPFQHGEVYVTDDGAETDLDLGHYERFLRTRMGRNNNFTTGQIYESVIRKERR
FT                   GDYLGRTVQVIPHITDEIKASIRLGAEGADIAMVEIGGTVGDIESLPFLEAIRQMRVEE
FT                   GPENSLFMHLTLVPHIRTAGEIKTKPTQHSVKELRSIGIQPDILLCRAEKLLPDEERRK
FT                   IALFTNVSEKAVISAIDADNIYRIPRLLHAQSLDELVVRQFHLDVPEADLAEWDRVMDG
FT                   FDHPEQSVRIGMVGKYMNLTEAYKSLSEALAHAGVHTNTKVEIVYVDSEVIEREGTDCL
FT                   DGLDAILVPGGFGERGVEGKVMAVRYAREQRVPYLGICLGMQVAVIEYARHMADLEGAH
FT                   STEFDRQTPHPVIALITQWRDEQGRIETRSESDDLGGTMRLGGQNCRLEPGSLARSVYG
FT                   QPQVRERHRHRYEFNNAYLDTLKDAGMRFSGWSLDNRLVEIIEIPDHPWFIACQFHPEF
FT                   TSTPRDGHPLFEGFVRAALVQRQFNGEPAA"
FT   gene            452759..453592
FT                   /locus_tag="Alvin_0390"
FT   CDS_pept        452759..453592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0390"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: aeh:Mlg_1840
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61349"
FT                   /db_xref="GOA:D3RN65"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN65"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ADC61349.1"
FT                   /translation="MMPLAGFEVGLDRPLFLIAGPCVIESETLAQETAGALKELTEALG
FT                   ISFIYKSSFDKANRSSGASFRGPGLEEGLRILESVRATIGVPVLTDVHEDTPLAEVAAV
FT                   VDVLQTPAFLCRQTNFIQAVAQQGRPVNIKKGQFLAPWDMKHVVEKARATGNDRVMVCE
FT                   RGVSFGYNNLVSDMRSLAVMRETGCPVVFDATHSVQLPGGQGTSSGGQREFVPVLARAA
FT                   VAAGVAGLFMETHPDPDRALSDGPNAWPLRRMRDLLSTLVEIDRLVKTAGFVEQG"
FT   gene            453719..454996
FT                   /locus_tag="Alvin_0391"
FT   CDS_pept        453719..454996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0391"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: tcx:Tcr_1260 enolase; TIGRFAM: enolase; PFAM:
FT                   Enolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61350"
FT                   /db_xref="GOA:D3RN66"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN66"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ADC61350.1"
FT                   /translation="MSEIVDVRAREVLDSRGNPTVEADVITADGAIGRAIVPSGASTGS
FT                   REALELRDGDKSRYNGKGVLTAVANIRSELREAIVGMDVADQTAIDRCMIELDGTDNKA
FT                   RLGANALLGVSLAVAHAAAQEKALPLYQSLASGPYRLPVPMMNIINGGEHADNSVDFQE
FT                   FMILPVGAGSIREAVRYGAEVFHALKSVLHARGLATAVGDEGGFAPDLASNEAAIEAIL
FT                   EAIHKTGFKLGSDIYLGLDVAASEFYQDGQYVLKGEGRTLSSDGMIDLLEQWVSKYPIL
FT                   SIEDGLAEGDWDGWKRLTERLGDKVQIVGDDLFVTNTRILQEGIDKGIANSILIKVNQI
FT                   GTLTETLEAIAMAHKAGYTAVVSHRSGETEDSTIADLAVATGAGQIKTGSLSRSDRVAK
FT                   YNQLMRIEDQLADEAVYAGRDAFKWL"
FT   gene            454977..455360
FT                   /locus_tag="Alvin_0392"
FT   CDS_pept        454977..455360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0392"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: psa:PST_1558
FT                   septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61351"
FT                   /db_xref="GOA:D3RN67"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="InterPro:IPR023081"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN67"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ADC61351.1"
FT                   /translation="MRSSGSKAIRRGLGAWRSLTLSRMVLRMHWLILVLILLLGALQYR
FT                   LWVGEGSIAELHSLKREIAFEESELERLRTRNRELQAEVDDLREGSEAIEERARSELGM
FT                   IKPGEIFIQVIERPAPVNPEGKP"
FT   gene            455357..456058
FT                   /locus_tag="Alvin_0393"
FT   CDS_pept        455357..456058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0393"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   ppg:PputGB1_1168 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61352"
FT                   /db_xref="GOA:D3RN68"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN68"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ADC61352.1"
FT                   /translation="MTTRLWAILPAAGVGRRMGSAVPKQYLELASRTVIEHTLELFVDH
FT                   ARIAGVVVALGVEDGYWEATAYATHPKVRRAPGGAERCHSVLNALAALDGQADADDWVL
FT                   VHDAARPCLRLDDLERLIDGLLDDDVGGLLGIPVRDTMKRAGSGERIDTTVDRSSLWHA
FT                   YTPQMFRLGLLRRALHEALEAGDLVTDDASAIERLGLAPRLIEGHADNIKITRAEDLPL
FT                   AHFHLQRQGRI"
FT   gene            456071..456550
FT                   /locus_tag="Alvin_0394"
FT   CDS_pept        456071..456550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0394"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: noc:Noc_0855 2-C-methyl-D-erythritol
FT                   2,4-cyclodiphosphate synthase; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; PFAM:
FT                   MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61353"
FT                   /db_xref="GOA:D3RN69"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN69"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ADC61353.1"
FT                   /translation="MLIGQGFDAHRFAPDRRLVLGGVEIPHDRGMLAHSDGDVLIHALC
FT                   DALLGAAGLGDIGRHFPDTDAAYADIDSRILLRRVINSLRERGLRVHNADMTLIAQQPK
FT                   LAPYIPAMRETLAADLECDPLRVNVKATTMEHMGFTGRGEGIAASAVVLLVEADG"
FT   gene            456559..457644
FT                   /locus_tag="Alvin_0395"
FT   CDS_pept        456559..457644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0395"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   mca:MCA2519 tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61354"
FT                   /db_xref="GOA:D3RN70"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN70"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADC61354.1"
FT                   /translation="MSDSTLPRWTTFNDLPRAHGEPLGSGQLRVEPEDFQVTEVLGFEP
FT                   DGEGDHCLLWVRKTGANTEWVARRLAATAGVPLSTVGYAGLKDRWAVTEQWFSLPRPRA
FT                   GEPEPDWGPLAEQGIEVLEVHPHRRKLKRGSLSGNRFRIRLRDCRLDPAALDARLESIR
FT                   ARGVPNYFGEQRFGHDDGNLHRAHALLTGAARRVPRHQRGLWLSAARSQIFNELLAERV
FT                   RRGDWDRLQPGDCPQLAGRHSFFLAETLDETLHERVARFDLHPTGPLWGRGELPSRLDV
FT                   QGLEHTVAAGLDPWPERLAGQGLEQERRSLRLMVADLTADLADGCLRLEFGLSSGAYAT
FT                   SVLREIVDTFEQLQRRDGSDG"
FT   gene            457637..458560
FT                   /locus_tag="Alvin_0396"
FT   CDS_pept        457637..458560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0396"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: dar:Daro_0110 response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61355"
FT                   /db_xref="GOA:D3RN71"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN71"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61355.1"
FT                   /translation="MAKLLVVDDEPINLEIIGHCLEDEHQLAFAEDGLEAWAMLEASPQ
FT                   AYDGVILDRMMPRMDGMEVLRRLKADKRFRDVPVIMQSAADSSEQVAEGLAAGAWYYLA
FT                   KPYAPKALRSIVSAALDDRRNRKDLAQIGGRLQTILDLADRASFRFRTLEEVSVLSSTL
FT                   AQMCPNPETVAMGLSELMLNAVEHGNLGIDYAQKGRLIEDGLWQDEVERRLAEPAQSTR
FT                   HASVELERDPECLIFTIRDQGLGFDWQRYLDLDPARAFDSHGRGIAMARHLAFAHMEYR
FT                   GAGNEVRVSVALTDPTDSTACDDDSI"
FT   gene            458547..460055
FT                   /locus_tag="Alvin_0397"
FT   CDS_pept        458547..460055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0397"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   tgr:Tgr7_2558 peptidase U62 modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61356"
FT                   /db_xref="GOA:D3RN72"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN72"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ADC61356.1"
FT                   /translation="MTRSDARRAPWIATRDDHGAPNLARLADIAQTFVAHAPVCDAWTL
FT                   RLVAETTDHLEVRQGVVEPSLIGCSLGAMVTVVEGAGSGYAATSDLSRAGLCAAAERAR
FT                   DWARVQARLGLFDARLQPPGATVADYRTPVEESWESRPLADKLALLQAANQALDIDERI
FT                   QDWSAWLTHRRVEQLLIGSAGARVTQVLDYVHPGVQVVANAGSQTQRRHGGGADGGLQG
FT                   GLENLVRLGFLEDATRLAEEAIALLDAPECPSDVRDLILMPNQMALQIHESIGHPLELD
FT                   RILGDERNYAGTSFVTPEMFGHYRYGSELLNVTHDPTLPGELISVAADDEGTPAAREVL
FT                   IRAGILERPLGGALSQARSGLPGTATSRASGWDRPPIDRMGNLNLEPGQGSLADLVGQV
FT                   ERGILMDTNRSWSIDDSRNKFQFGCELGRLIEDGQLKGLVRNPGYRGLSAEFWRSLAGV
FT                   GGPETLGVGGVLNCGKGEPNQAVYVGHAAPPCLFRRVAVFGGGE"
FT   gene            460052..461374
FT                   /locus_tag="Alvin_0398"
FT   CDS_pept        460052..461374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61357"
FT                   /db_xref="GOA:D3RN73"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN73"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_2559"
FT                   /protein_id="ADC61357.1"
FT                   /translation="MTPEAFFTLAERLSAGLTGDEVLFCNLGGEVSDFVRLNHNRMRQA
FT                   GNVRAAGLTLTLIDGARQAEAAFDLSGDPETDLALGRTLIGRLRERLAVLPDDPYLQYA
FT                   TEPSTGMAHQEPRALPPAEEAVATLIEAAEGLDLVGIWASGLIRTGLASSLGHRHWHER
FT                   ASFNLDWSLYLSGDKALKSSYSGFDWNPDVVHERLRTMRAGLEILRRPARRLDPGRYRA
FT                   YLAPPAVEELMGMLAWGGFDLRDHRTQQTPLLKLVRGECAFDPRITLREDHARGLMPGF
FT                   TPEGFILPPSVTLIDAGAFGDCLVDARSGREYGEPVNAASGSPESLSLEPGDLPESEVL
FT                   ARLDTGLWIGHLWYCNWSDPNEARVTGMTRFGTFWVEDGEIQCPIDVMRFDDSLYALLG
FT                   TRLEALTRERELRLSPETYEGRSSASVLLPGVLVSGIALTL"
FT   gene            461423..462910
FT                   /locus_tag="Alvin_0399"
FT   CDS_pept        461423..462910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0399"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   mca:MCA1772 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61358"
FT                   /db_xref="GOA:D3RN74"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN74"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADC61358.1"
FT                   /translation="MNPLKRLASQTAVYGVSSVLGRFLNYLLVPFLTYTFAPAEYGVVA
FT                   EFYAYMGFLAVLLAFGLETGYFRFRAGGEWRPETVYGTVFSFLVLVNALCFLAFLLWSQ
FT                   PLAALLRHAEHPEYIGWCAAILALDSIGALAFARLRAEERAGYFATIKLIEIGANVGLT
FT                   IFFIYVARQAHEADPGSLLGRLWDPDIGIGYVFIANLAASALKLLLLTPQFVSGLGAFD
FT                   TGLFKRLIRYSLPMVVIGMAGIVNEMLDRAALKYLLPHDDATNMAQLGIYSACYKLSIL
FT                   MSLFIQAFRYAGEPFFFSYAKRHDAGRTYAVVLNWFVLCCVFLFLLVTLYIDVFQYFVG
FT                   ADYRSGLDVVPVLLLANLLLGVYVNLSIWYKLTDRTLMGAGVSLIGSAITIGLLFWWVP
FT                   VHGYMGAAWAHLVCYGTMVVLSYALGRRYYPVPYDVWRVLGHIAFGIGLYLASRWLVTE
FT                   QGWHWLVAGTVCMAAFLVVVGWEAWRLRRGASAIPGV"
FT   gene            complement(462920..464491)
FT                   /locus_tag="Alvin_0400"
FT   CDS_pept        complement(462920..464491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0400"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Pas/Pac sensor"
FT                   /note="KEGG: tgr:Tgr7_1324 methyl-accepting chemotaxis
FT                   sensory transducer with PAS/Pac sensor; TIGRFAM: PAS sensor
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; PAS fold-3 domain
FT                   protein; SMART: chemotaxis sensory transducer; PAS domain
FT                   containing protein; PAC repeat-containing protein;
FT                   histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61359"
FT                   /db_xref="GOA:D3RN75"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN75"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADC61359.1"
FT                   /translation="MKINLPVTQKEYDYPASWIIVSTTDIKGVITYCNKPFIEISGFSE
FT                   HELIGVNHNVIRHPDMPPAAFKNLWDTVKKGKPWRGIVKNRCKNGDHYWVDAYVTPVYE
FT                   GETLVGYQSVRTKPTRAQIETAERLYARVRARNLEDLPNRLIPEFSHTAWLSAAFGVVG
FT                   LGAILAAWLGNLWVGIGTLILALILARISAHAILKHIHEAVHVAKKIAAGDLSSPILVQ
FT                   DNNETAEILQAIKMLQARLATVMGNIQESATGVASAAAQLAQASNSTHNLMEQQHQETD
FT                   MVATAMNEMSATVAEVANNTTAAADAAHQASHKAREGRMVVRHSVDGIRELAEGVGEAA
FT                   QTIHQLEIESANIGKILDVIRGIAGQTNLLALNAAIEAARAGEQGRGFAVVADEVRALA
FT                   QRTQESTQEIQDMIARLQQGARSAVSMMQRGQEQAEQSVLEANETDHSLEAITQSVEHI
FT                   NDMSDQIATAAEEQSAVVEEMNRNVESIRHLSVQTLQSTDDVVGATSHLEDLAGRLMGL
FT                   VHQYKI"
FT   gene            464797..465180
FT                   /locus_tag="Alvin_0401"
FT   CDS_pept        464797..465180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61360"
FT                   /db_xref="GOA:D3RN76"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN76"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2527"
FT                   /protein_id="ADC61360.1"
FT                   /translation="MNPEKVVFGFFIVLALTLNFGFFVGEIDNPDHHHAWELFFVVVVN
FT                   MIATVLKFGDRTQMGAVLLATSLVAMLQLLAASLIWTIAAHATETGLTPSIMASIVSLS
FT                   GGAMIANVVSVVLLVIETVLLRR"
FT   gene            465207..466925
FT                   /locus_tag="Alvin_0402"
FT   CDS_pept        465207..466925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0402"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: mgm:Mmc1_2358
FT                   TrkA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61361"
FT                   /db_xref="GOA:D3RN77"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN77"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADC61361.1"
FT                   /translation="MDTIFFLVLRRMRTPLLTLIVVYAIAMAGLALIPAQDADGQPTAM
FT                   SLFHAFYFVSYMSTTIGFGELPNAFTDAQRIWVSLSVFFTVAVWIYAIGNLITLLQDST
FT                   LQRAIAERRFRTLVRRLGVPFYLVCGYGQTGSALVRGLMERHIQSVVIDVDPERISLLQ
FT                   LDNQREYVPALCADARSPQALEAAGLKHPLCRGVVALTNVNEANLKIAIAAKLLHPEVK
FT                   VICRADSHEVEANMASFGTDHIYDPFDAFASYIAFSIQSPCQTLLIDWLSGRGGEELDE
FT                   PRYPPRQGRWVICGYGRFGKAMYKHLKARGFELSVIEAEPHKTGIPTEGVVHGRGTEAV
FT                   TLEQARIRQAVGLVAGTDQDADNLSIIMTALALNPDLFVIARENHIQNQELFDRVGAQA
FT                   IMNPSTIIAHRIRMRLITPLLSDLSRLARLQRDEAWASQLISRIIALVDGRKPYVWEVS
FT                   LDTMQAPAIQDATRRGQTITLGTLLRDPLERERTLPAIPLLLIQGEERRPLPALKAPIG
FT                   PGDRLLFCGREEARWRMDWVLCNIHALRYVIDGESRREGPAWRWLAAWQSRLRGV"
FT   gene            466952..467503
FT                   /locus_tag="Alvin_0403"
FT   CDS_pept        466952..467503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0403"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B2153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61362"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN78"
FT                   /inference="similar to AA sequence:KEGG:H16_B2153"
FT                   /protein_id="ADC61362.1"
FT                   /translation="MHAIMTRLGQDHARLSRVLDLLEELLDRFHDGQEPDYELMDELLE
FT                   YMDSYADIVHHPIEDLIFQRLLDKGVEPSEVFSIPMRQHAGLSQLAKDFRQSLLGILSE
FT                   EVLLREDVEAAGRALVGNQRGHLIQEEREAFPLAIEHLTEADWAEIEAAAPAVEDPLFG
FT                   APDPQRFKALYRQLVEQVQP"
FT   gene            467544..468542
FT                   /locus_tag="Alvin_0404"
FT   CDS_pept        467544..468542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kko:Kkor_1808 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61363"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN79"
FT                   /inference="similar to AA sequence:KEGG:Kkor_1808"
FT                   /protein_id="ADC61363.1"
FT                   /translation="MHATTTALKSPPWLENAEGRPRRIGVEIEMSGLKLDALAAEVADF
FT                   FGLDIRERGRYERVLHGDPAGDWVVELDYDLLKRLGRQERTDATLADEIGRSAEEMLAW
FT                   AAEAMVPVELVGPPLPLQRLGEVEALIARLRAAGAKGTSDALVNAFGLQFNPEVPDTGA
FT                   PVITACLKAFLCLSDWLVARADIDLTRRVTSYVDPFPLDYVRRVIAPDYWPDLATLIDD
FT                   YLADNPTRNRMLDLLPLFLFLDEERVRRVTQDSLIKARPTFHYRLPDCEIHRPDWGLYL
FT                   AWNDWVEVERLAADAARLNACCAAYQAHLDRPLDRWLGDWAAILEAEWIGP"
FT   gene            468527..469225
FT                   /locus_tag="Alvin_0405"
FT   CDS_pept        468527..469225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0405"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; KEGG: kko:Kkor_1809 peptidase
FT                   C26"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61364"
FT                   /db_xref="GOA:D3RN80"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN80"
FT                   /inference="protein motif:PFAM:PF07722"
FT                   /protein_id="ADC61364.1"
FT                   /translation="MDRPVIAITGPARGAFGPRALVALAVRLYGGQPLQVRPGDDLERL
FT                   TYHGVVVTGGHDVEPVLYAAEPEVEPNYDPARDALEMAMIRAALAEGLPLLGICRGAQL
FT                   LNVCRGGTLFQELRSRRSKTSHRWTVLPLKTLCVTEDSRVLGRILAPCCRRHINSLHNQ
FT                   AIDRVGEGLQVSGRDLDGIVQAIEDPEAGFLLGVQWHPEFLLYLSRQRALFGALVAQAR
FT                   CVLVAGTSAN"
FT   gene            complement(469387..469518)
FT                   /locus_tag="Alvin_0406"
FT   CDS_pept        complement(469387..469518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61365"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61365.1"
FT                   /translation="MVSLAEPTVCVDGMELEPRSGVDVVTPGVAGVLSDPESTRGGV"
FT   gene            469972..470925
FT                   /locus_tag="Alvin_0407"
FT   CDS_pept        469972..470925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0407"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K01192 beta-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61366"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61366.1"
FT                   /translation="MRYGHTSSPSQATLLDLSWGGALCQTPRALPISDRPLWLILPWAL
FT                   GETIEIETTLLRQKDLANGRHLLALRFQRLSLLHQARLEKLLGRLQADDVQSNAPMAPV
FT                   LVATLEVSIQTVDEWRWALGEIAKGRLRIRAPADFTPGQSVGLQFNGVPTRARLRLRAR
FT                   VLATESKAMLGIRVMRSTILTLEFEHPLEVLRQWVEWLLRQIPPDVKPSSPLADLQQQT
FT                   SQSAVIPARLVLSEGERCALEIGFPEALDYLMTAWGDVSTFEMVFRQLLFGDTGASGTW
FT                   TPEAWEELQLLQDVHDQVFGLSEARRIRLKVGRDVR"
FT   gene            471042..471758
FT                   /locus_tag="Alvin_0408"
FT   CDS_pept        471042..471758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0408"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   prw:PsycPRwf_1595 pyruvate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61367"
FT                   /db_xref="GOA:D3RN83"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN83"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADC61367.1"
FT                   /translation="MQEKRLQRRVGIEVPIRVCRPDSDVTIMARYQDLSWGGASFVTND
FT                   LTIQCDHRLIMRLPWTNGQFFAIEADVVRCEPLESGHQRVAVRFSRVGHQDDRRLAKLI
FT                   ELLSSTLHETAQATAPAMPLLELVLDDQDEVREKLSQVAEGYLFITACGTYRIGQSLLL
FT                   LIEYTDDFPGLRLRARVKSQSIDDQGDGERPCLVTLELGFEHPLDELHKLAHLSMRYQR
FT                   KRARFMGPYPGPSSYQ"
FT   gene            complement(471826..472929)
FT                   /locus_tag="Alvin_0409"
FT   CDS_pept        complement(471826..472929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0409"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="KEGG: aeh:Mlg_0737 ferrochelatase; TIGRFAM:
FT                   ferrochelatase; PFAM: ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61368"
FT                   /db_xref="GOA:D3RN84"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN84"
FT                   /inference="protein motif:TFAM:TIGR00109"
FT                   /protein_id="ADC61368.1"
FT                   /translation="MTFMNTPDYRHDTPERLGVLLVNLGTPDSPSVPDVRRYLAEFLSD
FT                   RRVVEMARLPWMLLLHGIILRTRPARSAHAYQSIWTPEGSPLLEISRRQAAALQSRLDA
FT                   RLGGPVTVALGMRYGQPSIASGLAELRAANARRVLILPLYPQYSATTVGTVFDAVAREL
FT                   MRWRWLPELRFVNQYHDEPGYIAALAASIRAHWAEHGQAERLLLSFHGIPKDYFDQGDP
FT                   YFCHCHKTARLLAEALELPAERWGLSFQSRLGKQEWLKPYTDATLEDWGRSGVKSVQVL
FT                   SPGFSADCLETLEEIAVENRELFLEAGGQSYEYIPCLNDNADHMELIADLVVCHCSGWP
FT                   EIERPAAEADELAKRVARARSCERSCR"
FT   gene            473145..474353
FT                   /locus_tag="Alvin_0410"
FT   CDS_pept        473145..474353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0410"
FT                   /product="succinyldiaminopimelate transaminase"
FT                   /note="TIGRFAM: succinyldiaminopimelate transaminase; PFAM:
FT                   aminotransferase class I and II; KEGG: noc:Noc_2124
FT                   succinyldiaminopimelate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61369"
FT                   /db_xref="GOA:D3RN85"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019878"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN85"
FT                   /inference="protein motif:TFAM:TIGR03538"
FT                   /protein_id="ADC61369.1"
FT                   /translation="MNPDLGRLQSYPFEKLAALKQGIDPPRERDPIGLQIGEPKHPTPS
FT                   LIAEALIAHLHRLSVYPTTRGLPELRGAIADWLGARFRPESGAPLAVDPERHVLPVNGT
FT                   REALFAIAQAVVDRTHPAPLVLMPNPCYQIYEGAALLAGAEPQYLACRPENGFIPDFDA
FT                   VDAAIWDRCQLLYLCSPGNPTGAVLDRPTLTRLIELAERHDFVIASDECYGDIYQDEDA
FT                   PPPGLLQAAAALGNDGFERCLVFHSLSKRSNAPGLRSGFVAGDARLIRDFLAYRTYHGC
FT                   AMPLPTQYASLAAWRDEAHVRENRRLYREKFAAVTEILGPVMPVTTPAGGFFLWLETPI
FT                   PDTDFARDLYAQENVTVLPGRFLSREIDGYDPGAGRVRIALVSPLDECVDAAKRIRAFV
FT                   ERL"
FT   gene            474395..475216
FT                   /locus_tag="Alvin_0411"
FT   CDS_pept        474395..475216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0411"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: tgr:Tgr7_1152
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61370"
FT                   /db_xref="GOA:D3RN86"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN86"
FT                   /inference="protein motif:TFAM:TIGR00965"
FT                   /protein_id="ADC61370.1"
FT                   /translation="MSDQQNIILEAFERRAEITPRNVETHVRDAVQDVIERLDQGTLRV
FT                   AEKRDGDWVVNEWVKKAVLLSFRIEDNAFMKGGFTNYYDKVPSKYADANSREFREGGVR
FT                   VVPPATARKGSYIASGCVLMPSYVNIGAYVDSGTMVDTWATVGSCAQIGKNVHLSGGVG
FT                   IGGVLEPVQAAPTIIEDNCFIGARSEIVEGVIVGEGAVISMGVYIGQSTKIYNRETGEI
FT                   TYGRVPPGAVVVSGNLPAKDGSHSLYCAVIIKQVDERTRGKVGINELLRDI"
FT   gene            475236..476372
FT                   /locus_tag="Alvin_0412"
FT   CDS_pept        475236..476372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0412"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: tgr:Tgr7_1150 succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61371"
FT                   /db_xref="GOA:D3RN87"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN87"
FT                   /inference="protein motif:TFAM:TIGR01246"
FT                   /protein_id="ADC61371.1"
FT                   /translation="MSPTLELACELVRRPSVTPEDQGCQELIAERLAAIGFTVEPMPFG
FT                   EVTNLWARRGSEGPLLCLAGHTDVVPAGPLDLWDSDPFDPVIRDGMLHGRGAADMKGSV
FT                   AAMVTAVESFVAAHPDHPGSLAFLLTSDEEGPAVNGTAKVIERLQQRGEHIDYALVGEP
FT                   SSREQLGDSIKNGRRGSLSGFLTIHGKQGHVAYPHLAKNPFHAAADALAALCAVVWDQG
FT                   NAYFPPTSFQIANLNMGTGAENVIPGQLEAQFNLRFSTELDPETIKRRVRAILDQGDFD
FT                   YELSWRLSGHPFLTTPGELVDAARSAIREVCGIETELSTSGGTSDGRFIAPTGAQVLEL
FT                   GPLNATIHQVDECVAVADLDQLHRIYGRMIERLLLPAA"
FT   gene            complement(476397..476675)
FT                   /locus_tag="Alvin_0413"
FT   CDS_pept        complement(476397..476675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0413"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: neu:NE1829 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61372"
FT                   /db_xref="GOA:D3RN88"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN88"
FT                   /inference="protein motif:TFAM:TIGR01215"
FT                   /protein_id="ADC61372.1"
FT                   /translation="MGLLDYFVSSRAKTTGNASVAKERLQILVAHDRVARDKPSYLPQL
FT                   QQEILAVIRKYVEVDMDAVSVTYEQEESHEVLELNIILPESASASSA"
FT   gene            complement(476679..477488)
FT                   /locus_tag="Alvin_0414"
FT   CDS_pept        complement(476679..477488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0414"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: mca:MCA3067
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61373"
FT                   /db_xref="GOA:D3RN89"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN89"
FT                   /inference="protein motif:TFAM:TIGR01968"
FT                   /protein_id="ADC61373.1"
FT                   /translation="MARIIVITSGKGGVGKTTTAAALSMGLAQRGKRTVVIDFDVGLRN
FT                   LDLIMGCERRVVYDFINVINGEANLNQALIRDKRCDSLYVLPASQTRDKDALTREGVER
FT                   VLTDLGDNYDFIVCDSPAGIEHGAYMAMYFADDAIVVTNPEVSSVRDSDRMLGILSSRS
FT                   KRAEENLDPIREYLLLTRYDPMRVANGEMLSVDDVQEILSLKLLGVVPESRAVLNASNA
FT                   GIPVILDRESDAGQAYGDMVSRYLGDDVPHRFLHPEKKGLLSRIFKG"
FT   gene            complement(477540..478355)
FT                   /locus_tag="Alvin_0415"
FT   CDS_pept        complement(477540..478355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0415"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; Septum formation inhibitor
FT                   MinC domain protein; KEGG: mca:MCA3066 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61374"
FT                   /db_xref="GOA:D3RN90"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN90"
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /protein_id="ADC61374.1"
FT                   /translation="MAEKPTSSTNASDGAGTFELKAASFTLPIIRLLDNDIETVASRLG
FT                   AKVEKAPDFFRNTPVVIDLSDLARDQKPIALPQLVGLLRGYGMIPFGVRGANAEQTAAA
FT                   EALELAILRESYVRRTKSVGELATETEPEPVPATVSRASQAPGKPQAPTETAQPHITGQ
FT                   SGFMLVTRPVRSGQRIYAAGGDLSIIAPVSSGAELMADGNIHVYGPLRGRALAGMSGNM
FT                   EARIFCHDLQAELISIAGHYRVSEGIPHELRGVPVQIFLDQKILRIEKL"
FT   gene            complement(478548..478892)
FT                   /locus_tag="Alvin_0416"
FT   CDS_pept        complement(478548..478892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0416"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   tgr:Tgr7_1076 histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61375"
FT                   /db_xref="GOA:D3RN91"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN91"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ADC61375.1"
FT                   /translation="MSDTIFGKIASGEIAADLVYKDEDVVAFRDISPQAPTHLLVIPRK
FT                   PIPTLDAAGPEDAALLGKLLLVAAQVAREAGIAERGYRTVINCNAEAGQTVFHLHLHVL
FT                   GGRPMQWPPG"
FT   gene            complement(478917..479513)
FT                   /locus_tag="Alvin_0417"
FT   CDS_pept        complement(478917..479513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0417"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: aeh:Mlg_1508 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: Zinc finger
FT                   C4-type, RecR; TOPRIM domain protein; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61376"
FT                   /db_xref="GOA:D3RN92"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN92"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADC61376.1"
FT                   /translation="MGERSLLNQLIEALRCLPGVGPKSARRIAFHLLERDREGGARLAR
FT                   VMAEAMVAIRRCSRCRTLTEHEVCALCANPNRDGSLLCIVEQPSEVVAIEQATDYRGRY
FT                   FVLGGRLSPLDGIGPDELGLDVLEARLRDESIAEVILAISPTVEGGATAQFIADRAARH
FT                   GVRVTRIAHGVPLGGELEYVDGGTLALAFSGRHAL"
FT   gene            complement(479519..479842)
FT                   /locus_tag="Alvin_0418"
FT   CDS_pept        complement(479519..479842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   hit:NTHI0569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61377"
FT                   /db_xref="GOA:D3RN93"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN93"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADC61377.1"
FT                   /translation="MKALGGLLKQAQKMQEDMQQAQARLAQEETTGEAGGGLVKVTLNG
FT                   QHQAKRVEIDPSLMGDDKEMLEDLITAAINAASQRIAEKTKETMSELTAGMPLPPGMKL
FT                   PWS"
FT   gene            complement(479975..481624)
FT                   /locus_tag="Alvin_0419"
FT   CDS_pept        complement(479975..481624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0419"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tgr:Tgr7_1073 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61378"
FT                   /db_xref="GOA:D3RN94"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN94"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADC61378.1"
FT                   /translation="MSYQVLARKWRPRSFDDMVGQQHVVRALSNALDRDQLHHAYLFTG
FT                   TRGVGKTTLARILSKALNCEQGVGSHPCGVCSACREIDSGRFVDLLEVDAASRTKVDQT
FT                   RELLENVPYAPARARFKVYLIDEVHMFSSHSFNALLKTLEEPPPHVKFLLATTDPQKIP
FT                   VTVLSRCLQLNLRRLLPGEIADRLTYVLEHEGLAFEPAALPLLARAADGSLRDALSLLD
FT                   QAIAFGGGRVIESETRAMLGTVSGDLALDILDALADGDGAAVLGSVERVAAMTPDFAEL
FT                   LRELIGLLHRLALIQQVPATLTADDPDRTRLLALAGRLAPEDVQLFYQVALTGQADLPL
FT                   APDPRGGLEMVLLRALAFRPAPRATRMSDSPRTAATTEHAPTASVHPNVQASPVPLQPA
FT                   GAPPQTEPGASESAPIQSGTPTLETAADWQRLAARLSIGGIANQLAHNCAFREYSNGRL
FT                   SLQLDPAAERLRAPSTVTRLKSALEQALGRSIELEIKVAHPEQETLAQRRTREAGERQQ
FT                   MAVEQMHADPVARSVRETFDADWAPGSIRPAD"
FT   gene            complement(481690..481812)
FT                   /gene="ffs"
FT                   /locus_tag="Alvin_R0009"
FT   ncRNA           complement(481690..481812)
FT                   /gene="ffs"
FT                   /locus_tag="Alvin_R0009"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            482007..483281
FT                   /locus_tag="Alvin_0420"
FT   CDS_pept        482007..483281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sun:SUN_1027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61379"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61379.1"
FT                   /translation="MSHDSTRLLGALALGLLLLTSGAGAQTADSTEAGANADLWSQTRE
FT                   RAAGWWEQSRDLAGQTMRDARGLFDGQEPDFNQIWQRALPTLDQALLLEQRHQTLPESA
FT                   WFGHDQKANQAEIDALLDEAVSILSVSPALKYRDRIQAQQEQIVRWRAEIADHRQKRVT
FT                   APSESTFKKTIADYDALIAAREADIRRAAQEVEALKREFAQSLRAIGLKLEDEQLDLLL
FT                   STVVGDNLVDLGILFDNVKSITLQLEELLEQSGEDLQSARRYYGLYVVLLKSLDRMHVQ
FT                   IDEAIDERYLPQIDDIVGQTQTLAADTERLLRETPDRRTLLEGNLQAQQLTLQAAGFYR
FT                   QYLVDQAAQVRQAREELEKDIAAAWNTYETVRVSGELVGLVRSSQLLLEGLMNRQAPAL
FT                   RPFESLEMQREIQKLTRQLRGEVSG"
FT   sig_peptide     482007..482084
FT                   /locus_tag="Alvin_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.865 at
FT                   residue 26"
FT   gene            complement(483278..483844)
FT                   /locus_tag="Alvin_0421"
FT   CDS_pept        complement(483278..483844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlt:Rleg2_4147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61380"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61380.1"
FT                   /translation="MFRILAVATAAASVLISGCLPPPPGHFGSFATPVTPDEYGRRLCR
FT                   HLELEDYAACLSEVLGYFEEPRPDDLPYGRNSNAGPIALVLDRRVYLGRYDGSPLVTRF
FT                   RVTHGNQSCQGGYDAFAGSTDAILDVQCSDGRRGWADLTSALDGRNGIGRLELEDGTQA
FT                   EIVYGYTALGQAEPYPYVHWTPPAD"
FT   sig_peptide     complement(483749..483844)
FT                   /locus_tag="Alvin_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.801 at
FT                   residue 32"
FT   gene            complement(483933..484751)
FT                   /locus_tag="Alvin_0422"
FT   CDS_pept        complement(483933..484751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0422"
FT                   /product="Protein of unknown function DUF2272"
FT                   /note="PFAM: Protein of unknown function DUF2272; KEGG:
FT                   mca:MCA0717 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61381"
FT                   /db_xref="InterPro:IPR019262"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN97"
FT                   /inference="protein motif:PFAM:PF10030"
FT                   /protein_id="ADC61381.1"
FT                   /translation="MRRFHTQTRCRSGRIAAVDRLGRWLILVASLALLSCAAPPESVGP
FT                   EGRTGTWSGYPIGTPPAPNPALKRAIIARAEQEWAYFGRQEIVFKGAVESIPLVGDWED
FT                   DGARQSNRVNVYWRSVGESRLTGMDCQKPWSAAFISWIMRNAGVPTHQFRPAIAHWVYL
FT                   ADLIESASLPGRYFVPRRLQDYSPEPGDLICAYRQPSRVIMTDGAVRAGTLTGLRAHCD
FT                   LVTAKHGRTLEVIGGNVRNSVSKVRLELDGRGRLQPIPRRPWFLILQNRL"
FT   gene            complement(484762..486549)
FT                   /locus_tag="Alvin_0423"
FT   CDS_pept        complement(484762..486549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sat:SYN_02727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61382"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN98"
FT                   /inference="similar to AA sequence:KEGG:SYN_02727"
FT                   /protein_id="ADC61382.1"
FT                   /translation="MRRHGSEAFIGLILLGLLVCAPAPAAPERSWEPGLATESGTCIWT
FT                   APLEPRPGQPLEVFAVSTDGALERLNLTDPAGQTRPLRTLAQGGPPWSLYGTVFRPERG
FT                   TYRLEAMRHGQVVARTEITIGNGMSDRGSGRWDLATEALYAAWIEHLFNAPPEQALTFE
FT                   SLTPVLSDPAQNFLFGYLGANEDNSLRSEPDCADLPYYLRAYFAWKLGLPISYRACNRG
FT                   SRSRPPRCESPIVDTRFVGTRAPIGTFREATRRLVDTVHSGSARTGLRDEATDVYPVAL
FT                   SRETLWPGTLYADPYGHVLILVKWLPGDGRTAGRLLAVDAQPDNSVARKRYWEGNFLFA
FT                   QTASAGPGFKVFRPLEPKGAGWRLASNAELDGRSGRPAFSLEQADLDSDSFHARVARII
FT                   DPRGLDPVRAYDSVLEALMEQLETRVTSVDTGERYMREHPGAVVPMPSGPAIFETVGPW
FT                   EDYATPSRDMRLLIALKVVEGLPERIRRHPELYALAGEDTASAADRVARLHEQRLDART
FT                   ITYTRSDGSPWRLSLRELYARRANLEVGYNPNDCVEIRWGATPGSAEAATCGRRAPSDQ
FT                   QTRMESYRAWFRDTTRPPR"
FT   gene            486670..489006
FT                   /locus_tag="Alvin_0424"
FT   CDS_pept        486670..489006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0424"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   ppd:Ppro_0903 multi-sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61383"
FT                   /db_xref="GOA:D3RN99"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RN99"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC61383.1"
FT                   /translation="MMTRFSRLSMRDKVIAVVMLVSALVLLVLALLVVIADIIERRGAL
FT                   VERVGALTRVASISTSAALAFQDAPGAEEILAALGTEAEIIGIEIRDLDRVSFARYRSP
FT                   HPHHRTLQKRIEISEQREREAGDAPWPSDTQPNARFQRGYLDVHMTVQIDGRPLGYMDL
FT                   QYDTTDLTRRIWLQVWLALVVFAGGLGLAFLLASRLHRLISEPIARVAVAMERITLDED
FT                   YGVRLGSIGTDELATLTRAFDAMLERIEQRDAELREARDAAERANRAKSHFLANMSHEI
FT                   RTPMNGIIGMTELLQETDLNAAQRDCTRVIQDSAAALMRIINDILDMSRIEAGRLELER
FT                   LDFDPRESIERTLEPLREIAQRKGLEFAIELDPELPARLRGDPGRLRQILTNLVSNAIK
FT                   FTEQGRVSVTLDCLERTDDWVRFVIAVRDTGIGLSTEECSRLFERFSQADVSTRRRYGG
FT                   TGLGLAISRQLVELMGGGIDVESKPGLGSVFRVELVLESSESPPAVDRRLAGLQTLVLV
FT                   QEPSLAAQLGGMLEDLGMSVEHQTSLAAAIESALTRAARGQTFDVLLLEHEQLPAPTSP
FT                   AGSLLHEMSARALAVLRLRARGGAAGDDPVWGRLPEIGLPPTHVELQNGLSAIIRSRGA
FT                   GGHGEGAKQRPSLGLRVLVAEDNPANQRVIEWMLTALDCEVELHPNGRSLLESFTARPA
FT                   DLVLMDCQMPVMDGYETTRRLRKLESALGRRVPIIAVTAQAMAGDRERVIAAGMDDHLS
FT                   KPFTLEALATLLTRWKTERTWISSE"
FT   gene            489003..493145
FT                   /locus_tag="Alvin_0425"
FT   CDS_pept        489003..493145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0425"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s)"
FT                   /note="KEGG: gsu:GSU1037 sensory box/response regulator;
FT                   TIGRFAM: diguanylate cyclase; PFAM: EAL domain protein; PAS
FT                   fold-4 domain protein; response regulator receiver;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; GGDEF domain containing protein; SMART:
FT                   EAL domain protein; GGDEF domain containing protein; PAS
FT                   domain containing protein; response regulator receiver;
FT                   histidine kinase A domain protein; ATP-binding region
FT                   ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61384"
FT                   /db_xref="GOA:D3RNA0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC61384.1"
FT                   /translation="MNTSSPQRLGAGHAPLADLSHALHTQLNGLLGMSELLMETVLDPT
FT                   QRGYVETLARAGRRLQDVIRDVLDLARIETGQIQLAPREFDLMGALEAVLDSAVEQAEV
FT                   AGLELAGDLAPDLPYRVLGDPDRFGRLLRYLIEDLIDLTPAGELLVRASWLEDRLRVEI
FT                   LTGQANGLVLPADSGAPWTGRAAGSGLGLTVACAWAECMGGRIWSEPESLDGRLTCVEL
FT                   PLAVASSERRGRHLGGILAGGRVLLLAPEGLMAQTLEARLDDQGLSVSRATEVEAARRA
FT                   VREAASSGAPFDALLVDARVKGLEPLLSERSIQSEPALAALQRLLLVPRRSGWRDDQAA
FT                   ALAVTAQLTKPVTPGVVLAALNGSGAEPVRAESWIAEDEPPVATPRAGLGLRVLVADDN
FT                   AINQDTVTAMLRSLGCESRIVFDGQAAIEALSRESFDLVLMDCKMPLMDGYEAARRIRL
FT                   QEGESRTRLPIIALTAHALEGDQERCRAAGMDDYLTKPLSRRALRAMLERWSPRRWEGG
FT                   ATGPDPEFGSGPLYALSAGVEAFMDWPILDPGPLDRVRALDATTGSALQARLIGGFLEA
FT                   ESGLSAALRSALEARRSAPLTEAARALGASAATLGLRRLAGLCEHLERLPESALTPRMS
FT                   VESIATLDALLVQSRAAVESLAVRSTTDAASTADPARSSGSMDAPDALDGSPQRHPVEP
FT                   PSILMISVDPVLESGVRSQLAETEWQIVFAHDAQSTLESVARRRPDLILLDLMAPGLDG
FT                   HEICHRLRQYPGLELIPILALIEDEDHAAIERAYEAGATDFQFKPLKWPLLLHRIRYLL
FT                   RGQATLEALHRSEASQSALIAAIPDALLRLDSQGRVLQFKSGWLPGQARARPESSVSTL
FT                   SDLLPESACAVIRRELAATLVEHGVRELEIDVTDEHDEARVFEARLIAIDADQIILLLR
FT                   DMTERQRRQRVIQQLAYQDSLTGLANRRRFNLDLARALAHARRRDDRLALLCLDLDRFK
FT                   RVNDSLGHGIGDDLLRVAAQRLQDAVDEVGTALKPQGIAFAGTIARLGGDELTLILKGR
FT                   DAERIAMRVADAILNKFRQPFRLGGHSLVCTASIGIALSPDDGDTPEILLKHADTALYA
FT                   AKLQGRDTYRFFTAPMGARVRQRLETEARLRHALEHDEFRLHYQPILDSRTRAPIALEA
FT                   LLRWEDREQGLREPESFIPVADESGLILPIGAWVIAEIGRQLAHWANQGHVQPVSINLS
FT                   EAQFSDRGLIERLFRLARACPPGTIELDVTESLLLARDARLLDTLARLREQGMRVAIDD
FT                   FGTGYSSLALLKHLPIDTLKIDRTFIQEIGREHTTELLIRTMIGLGHGLGLRLVAEGVE
FT                   TEEQLAFLAREGCHAVQGFLLQPPVPASKVVPGCDGS"
FT   gene            complement(493089..494294)
FT                   /locus_tag="Alvin_0426"
FT   CDS_pept        complement(493089..494294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0426"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   nis:NIS_0323 Na+/H+:dicarboxylate/amino acid symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61385"
FT                   /db_xref="GOA:D3RNA1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA1"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ADC61385.1"
FT                   /translation="MRRLYSIPSGLILGIALALLLPQGAPTVAWIGQIFLSLLKLLMLP
FT                   LILVSIYASLAGGRDLRHIGGRALLYYLITSCIAAALGTGIGLTLSQNVPVGLLDLEAV
FT                   APDGAAFSLERLIANLIPTNLFASLAEGNILHIVVVAMLAALASRRLQADQRDTLLGGA
FT                   RALDALLMQLLAGILTLAPIGIAALVYTSLAAMDWAEILQLHAFVWAVALAAGLHALVV
FT                   LPLLYHLLTGRAPWRLALACREPLLTALSTASSSATYPVSKRALERFGVPERITSLTLP
FT                   LGATLNMDGSALYQSILLIFMSQLAGVDLTPWQALFIVLLTMASSAGTAGIPGGGIAMM
FT                   AFMLDLLGLPQTYLALYLIVDRFFDYPITAVNVWGDLVVAAGLSRTVATRHDLGSRNGR
FT                   LE"
FT   sig_peptide     complement(494205..494294)
FT                   /locus_tag="Alvin_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.686) with cleavage site probability 0.477 at
FT                   residue 30"
FT   gene            complement(494318..495781)
FT                   /locus_tag="Alvin_0427"
FT   CDS_pept        complement(494318..495781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0427"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG:
FT                   dau:Daud_1441 UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61386"
FT                   /db_xref="GOA:D3RNA2"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA2"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ADC61386.1"
FT                   /translation="MLTDALTHLLATTDFAWSRPAPEAPRPTNIQWRADACDDGSILLF
FT                   QRFDDGLTDSEIHRRYFAGRRFAALVTNRPLDCFDRMPGVALHVTRPGDWAEVVRRFCD
FT                   VVYPLAPGALRFIGVTGTNGKTTTVKYLESILAAHGRRVLSIGTLGVFLDGVRQVETGF
FT                   TSPPLIELRRLLHAHQDQADVVVMEASSHALDQGRVAGIPFQDAGWTNFTQDHLDYHRD
FT                   EASYFAAKAHLLDLIRPGGRLYCTSRAVADRLAALGPTPVPVEVLEPARLPPEAIAAKP
FT                   FLALAHNRANYALAVALAERVLDAMPTDETRQHWRHLQPVDGRFDCRVHGNRAIVIDFA
FT                   HTPDALDTILGAIREGFPDARVVTLFGCGGDRDRSKRPLMGAAVARHSDAIIVTSDNPR
FT                   HEPPERIIDDILTGFPEDQDYSVVVDRAEAIARLFDQLAARPDDEPWVALIAGKGHERY
FT                   IDRDGHKTPYSDQEQVDANLQRLGWTSAS"
FT   gene            495893..496465
FT                   /locus_tag="Alvin_0428"
FT   CDS_pept        495893..496465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_3541 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61387"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61387.1"
FT                   /translation="MRRITVTAVALSAFLPTLVLAQAWTPYGPYAPGVAQPAPYAGYPG
FT                   AYGPPVPPPSGFESAPWPSQGAAERMAPRERPAWPRLSLTRRATDDAYLIEIQLQNIQP
FT                   DQVEIRPAGRGLVITHSATVRFSQNDTLPGGDGYQSRYSISRDTSGRRVGLPPDADLAG
FT                   MTREVYEDGRILIRVPRVADAWRGGRW"
FT   sig_peptide     495893..495958
FT                   /locus_tag="Alvin_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.846 at
FT                   residue 22"
FT   gene            496474..496908
FT                   /locus_tag="Alvin_0429"
FT   CDS_pept        496474..496908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61388"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA4"
FT                   /inference="similar to AA sequence:KEGG:Tbd_2136"
FT                   /protein_id="ADC61388.1"
FT                   /translation="MRFETPQDVEDAYYDALEAGDAEAMASVWADSDAIFCLLPMTPLA
FT                   VGEQVGRLWRILFEQGRGFDLQVRHLLWIEEGDLAVHLVEERPQIQADQFQPGVPLPPP
FT                   LYATHVFRRAADGWRLLMHQSSPTPPPAPSMPSAGRTALA"
FT   gene            496920..498329
FT                   /locus_tag="Alvin_0430"
FT   CDS_pept        496920..498329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0430"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: mca:MCA1711 hypothetical protein; TIGRFAM:
FT                   MiaB-like tRNA modifying enzyme; RNA modification enzyme,
FT                   MiaB family; PFAM: Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61389"
FT                   /db_xref="GOA:D3RNA5"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA5"
FT                   /inference="protein motif:TFAM:TIGR01579"
FT                   /protein_id="ADC61389.1"
FT                   /translation="MRVRLQTLGCRLNEAELESWARDFQARGFTIVEDETAPAELIVVN
FT                   TCAVTGEAVRKSRQILRRAQRRHPGARLIVSGCLVSLDGGATSAGTAQAFPLSSLLPTS
FT                   TPPASSTVASDGLIVVNRDKDRLVELVLAALGLDSGLPHPSATNAMDLAAPLFARGRQR
FT                   AFVKIQDGCRYQCTFCVTTQARGPERSRPLPEIVREVERFQDSGIREVVLTGVHLGGYG
FT                   ADLGTDLTHLIERLLNETAIPRLRLGSLEPWDLPERFWSLFADRRLMPHLHLPLQSGSD
FT                   RVLRRMARRCKRDEYIRLVEGARAAIPDLNLTTDIIVGFPGEDDDDWRQTFELAESLRF
FT                   GHIHVFGYSPRPGTPAAGFANPVDARTRRRRVGELESLAHRSRLQILRDQIGKTVMLLH
FT                   ERLPDAFEGRPRSGYTPNYLPVHVHSAAPIGEGSLIQVRITGLDAAAGLLIAEPTGVEP
FT                   MAPECIEPAQA"
FT   gene            complement(498320..498499)
FT                   /locus_tag="Alvin_0431"
FT   CDS_pept        complement(498320..498499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: proline-rich, actin-associated protein Vrp1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61390"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61390.1"
FT                   /translation="MEIGSVHIQPMKPSQPAAPTPPPGGNIENRQPPPEPSPPTPPSRP
FT                   GAESTSQSGIDVYA"
FT   gene            498685..498772
FT                   /locus_tag="Alvin_R0010"
FT                   /note="tRNA-Ser1"
FT   tRNA            498685..498772
FT                   /locus_tag="Alvin_R0010"
FT                   /product="tRNA-Ser"
FT   gene            498892..499092
FT                   /locus_tag="Alvin_0432"
FT   CDS_pept        498892..499092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61391"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61391.1"
FT                   /translation="MASIRTFDNRAKPWQVSIRCKGQRFVECFRTKKEADFDRWSKIFG
FT                   GELDQLVKLVCRPISPEPVSI"
FT   gene            complement(499130..500473)
FT                   /locus_tag="Alvin_0433"
FT   CDS_pept        complement(499130..500473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0433"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: lhk:LHK_02578 HipA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61392"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA8"
FT                   /inference="protein motif:PFAM:PF07805"
FT                   /protein_id="ADC61392.1"
FT                   /translation="MSRHADPIRLQLSRGPLASRQLFEKIGVSQPTGSRALKALGGEVV
FT                   RFGSGRAIHYALRDEARGLPDIAIYRVDVEGQIRRLGMLIPVRPEGFVMRQENGAAHHS
FT                   DGLPWWLLDMRPQGYLGRAYAVRYGAELGLPGSLSDWTDTHALRALLVHGHDVVGNLLL
FT                   GEMARERFLSAPPPTPVPMAEKAGHYVQLAAEAARGDTPGSSAGGEQPKFTTFAETPDG
FT                   PRHVIVKFTEPVDGLVSERWSDLLLAEHLALETLREAGVAAARTRVIDHGQQRFLEVER
FT                   FDRVGAAGRRAIISLGAFDAEFVGSGRDRWPIVVRRLSASGEIRSEAADEADLLWAFGT
FT                   LIGNTDMHLYNLSFVSEHGRPYGIAPAYDMSPMCFAPRSGGGMADTIQKATIHSDVSNE
FT                   TWRLAGQLARDFLARIQRQSVFSRRFDPCLHSLTQHIEAASVQIAKLG"
FT   gene            500746..501072
FT                   /locus_tag="Alvin_0434"
FT   CDS_pept        500746..501072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfn:XfasM23_0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61393"
FT                   /db_xref="GOA:D3RNA9"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNA9"
FT                   /inference="similar to AA sequence:KEGG:XfasM23_0373"
FT                   /protein_id="ADC61393.1"
FT                   /translation="MTTFVLDTLAYAETLKAGGFNEQQAATQARALAEIIDRQMATKAE
FT                   VEAHENNLRRDIEALRLEMKRDIAETNARIAESKAELIRWVVGAGFLQTTLIIVALMKM
FT                   GGMV"
FT   gene            501238..503916
FT                   /locus_tag="Alvin_0435"
FT   CDS_pept        501238..503916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0435"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; PAS fold-2 domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   Phytochrome central region domain protein; histidine kinase
FT                   A domain protein; GAF domain protein; SMART: response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   ATP-binding region ATPase domain protein; GAF domain
FT                   protein; KEGG: cyh:Cyan8802_1511 multi-sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61394"
FT                   /db_xref="GOA:D3RNB0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013515"
FT                   /db_xref="InterPro:IPR013654"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61394.1"
FT                   /translation="MPNDLPDLDQCASEPIHLAGAIQPHGVLLALHESPWRIVQATANC
FT                   KDRLGIAPAALLERELDSVLGVELLTAAQAGLATYREQPSAPVSFAWCSPLDGVAFTGY
FT                   VHESEALVILELEPVPSPPGASDDLLARAVRGLVGVRAQADLPLKLQQAATLLRDLTGY
FT                   DRVMVYRFDPVDWHGEVVAEARRPDLEPYLGLHYPASDIPDQARRLYLINRTRAIVDID
FT                   YVPVPIEPEPNPITGRPLDLSRSLLRSVSPVHVEYLRNMGVRATLTLSLFHDDRLWGLI
FT                   ACHHLSPYWVSDEIRRVMDWMAQDLETQIQVAEDRRRRLYEQHLKTCRERVMAAMRQGV
FT                   RLQNLLTGAHQADLLGAVGAEGMALIAGSQVYTAGTTPEAERISQLAVDLRRHIDDDHS
FT                   SLFATDCLSDHLPETVDLGPTAAGLMFLRLASARDLGLLWFRAEQVRHVTWAGNPDKAV
FT                   NIGPDGRIGPRQSFAAWQQTVRLRSWRWAQEELASATELGALIDIELRHQAEAASQAKS
FT                   IFLANMSHEIRNPLNAVLGMARLMRQQALIPTQAERLDKIEVAGRHLLDLINDILDLSK
FT                   IEDGKLTLEESEVRIEAIMRNLVAMLSDQAAEKGLKLCVKLQAWPSHLLGDSARLQQAL
FT                   LNYASNAIKFTQYGSVTLRAFPEADLGDSVLGRFEVEDTGIGIAAEHLSRLFNEFEQLD
FT                   TSITRQYGGTGLGLALTQQLARLMGGEAGVESTLGVGSTFWFTVRLRRGTPSIAPVSAP
FT                   APMEMDELMQVCAGRRLLLVEDEPINREVTLELIADLELHTDTAENGVEALEYVQRHRY
FT                   DLILMDMQMPVMGGLEATRRIRRLPMDTQPPIVAMTANAFADNQTQCLEAGMNDFLTKP
FT                   VEPQQLLATLQYWFSRTEHQS"
FT   gene            complement(503907..504683)
FT                   /locus_tag="Alvin_0436"
FT   CDS_pept        complement(503907..504683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0436"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="KEGG: aeh:Mlg_1994 hydroxyacylglutathione hydrolase;
FT                   TIGRFAM: hydroxyacylglutathione hydrolase; SMART:
FT                   beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61395"
FT                   /db_xref="GOA:D3RNB1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB1"
FT                   /inference="protein motif:TFAM:TIGR03413"
FT                   /protein_id="ADC61395.1"
FT                   /translation="MLAVQPIPAFEDNYIWLLTEGGGNAVVVDPGDAEPVLERLSAEHL
FT                   TLTAVLITHHHYDHTGGLDELLAAFPGLEINGPDDDRIRALTHRRREGETFVPAGLTTP
FT                   FQVLEVPGHTSSHIAYLGAGRLFCGDTLFAAGCGRVFDGTFEQLAHSLERIAALPVDTL
FT                   CYCAHEYTQANLGFAEWVEPDSPALAERVRQTQLQRARGQPTVPSRLDLERATNPFLRT
FT                   REPKVIAAAERQAGHRMATSAEVFTALRRWKDERYD"
FT   gene            complement(504688..506592)
FT                   /locus_tag="Alvin_0437"
FT   CDS_pept        complement(504688..506592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0437"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="KEGG: tgr:Tgr7_0832 1-deoxy-D-xylulose-5-phosphate
FT                   synthase; TIGRFAM: deoxyxylulose-5-phosphate synthase;
FT                   PFAM: Transketolase central region; dehydrogenase E1
FT                   component; Transketolase domain protein; SMART:
FT                   Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61396"
FT                   /db_xref="GOA:D3RNB2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB2"
FT                   /inference="protein motif:TFAM:TIGR00204"
FT                   /protein_id="ADC61396.1"
FT                   /translation="MPHRTLTDSGVGAHRRPLLDSIDSPADLRALSESQLPELASELRS
FT                   FLIECVSKTGGHLAAGLGVVELTLGLHYVFDTPHDRLVWDVGHQAYPHKILTGRRDRMC
FT                   TLRQKDGISGFPKRGESEYDTFGVGHSSTSISAALGMALAAKQRGERRTVIAIIGDGAL
FT                   GAGMAFEALNHAGSMDIDLVVILNDNEMSISPPVGAISNHLARLLSGKLYTSVREGSKH
FT                   ALAGMPQLRHLVGRWEEHMKGMLMPSTLFEELGFNYIGPVDGHDMDGLLRTLRNIKDMP
FT                   GQRLLHIVTKKGRGFEPAEGQPVIYHGVTPFDRQTGQLLKAKGAGPTYTQIFGGWLHDT
FT                   AAADPRLVGITPAMCEGSGLTAFSKRFPERYFDVGIAEQHAVTLAAGLACEGLKPVVAI
FT                   YSSFLQRAYDQLVHDVALQNLDVTFAVDRGGLVGADGATHAGGFDLSFCRPIPNLVIMT
FT                   PSNENECRRMLRTAYEYEGPALVRYPRGGGPGVAIDPNAPALPIGRGEIVREGSRIALL
FT                   AFGPLVKTALEAAEVFDATVADMRFVKPLDAALILDLAARHEILVTLEENAIAGGAGSG
FT                   VAELLSEQGVVRRCLHLGLPDRYIDHAEHHEQLASVGLDAPGIIASLQAELERHEHAG"
FT   gene            506767..508152
FT                   /locus_tag="Alvin_0438"
FT   CDS_pept        506767..508152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0438"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: tgr:Tgr7_0936 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; SMART: Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61397"
FT                   /db_xref="GOA:D3RNB3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB3"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADC61397.1"
FT                   /translation="MLQIHNSLTRQKAPFQPIEPGKVRMYVCGMTVYDYCHLGHARVLV
FT                   VFDVVYRYLRALGYDVTYIRNITDIDDKIIRRANENGEPFQALTERFIQAMREDSEALG
FT                   VLPPTDEPRATAHIGEILAMVQTLIDKGLAYVADNGDVYYAVSRFPDYGKLSGKDPADL
FT                   RAGSRVEIGESKRDPLDFALWKAAKPGEPAWDSPWGPGRPGWHIECSAMSTCCLGNHFD
FT                   IHGGGADLQFPHHENEIAQSEGATGEPFVNVWMHNGFVRVNEEKMSKSLGNFFTVREIL
FT                   RLYRPEEVRYFILTSHYRSPLNYDDSALQKARAALTRLYTALRGLPEAAPAEGEAFRAR
FT                   FQAAMDDDFNTPEALAVLFELAREINRLRSDGSDQAAAHGALLRELGAALGLLQDDPER
FT                   YLRGGADADGPSDAEIEAMIAQRRAARANRDWAEADRLREALTAAGIVLEDGPQGTTWR
FT                   RAG"
FT   gene            508363..508746
FT                   /locus_tag="Alvin_0439"
FT   CDS_pept        508363..508746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0439"
FT                   /product="transmembrane region and signal peptide
FT                   prediction"
FT                   /note="KEGG: mgm:Mmc1_0336 transmembrane region and signal
FT                   peptide prediction"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61398"
FT                   /db_xref="GOA:D3RNB4"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB4"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_0336"
FT                   /protein_id="ADC61398.1"
FT                   /translation="MNKNLSRFAAVGLPLILVALTGCNRSPEVSFAQDVQPILKKHCVE
FT                   CHLPNGQGHTASGFLVESYDTLMKGTKFGPVVVPGDALSSSLYRLVAGEVDASIRMPHG
FT                   KDPLPAAEIAVVENWIAQGAKNN"
FT   sig_peptide     508363..508461
FT                   /locus_tag="Alvin_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.818 at
FT                   residue 33"
FT   gene            509008..509298
FT                   /locus_tag="Alvin_0440"
FT   CDS_pept        509008..509298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0440"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; SMART: chaperonin Cpn10;
FT                   KEGG: tgr:Tgr7_0438 chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61399"
FT                   /db_xref="GOA:D3RNB5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB5"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADC61399.1"
FT                   /translation="MNIRPLHDRVVVRRMEEERLSAGGIVIPDSATEKPIQGEIIAVGH
FT                   GKILDNGSVRALDVKVGDRVLFGKYSGTEVKLDGKEFLVMREEDIMAVVEG"
FT   gene            509374..511014
FT                   /locus_tag="Alvin_0441"
FT   CDS_pept        509374..511014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0441"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: tgr:Tgr7_0439 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61400"
FT                   /db_xref="GOA:D3RNB6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB6"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADC61400.1"
FT                   /translation="MSAKDVKFGGDARVRMMEGVNILANAVKVTLGPKGRNVVLEKSFG
FT                   APTVTKDGVSVAKEIELKDKFENMGAQMVKEVASKTSDIAGDGTTTATVLAQAMVREGL
FT                   KAVAAGMNPMDLKRGMDKAVEAATEELKKLSKPCTETKAIAQVGTISANSDDSIGTIIA
FT                   EAMEKVGKEGVITVEDGTSLQNELDVVEGMQFDRGYLSPYFINNQQSQSAELDAPYILL
FT                   HDKKISNIRDLLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTIRGIVKVCAVKAPGF
FT                   GDRRKAMLQDIAILTGATVISEEVGLSLEKATLNDLGTAKRVQVGKDETTIIDGAGSEI
FT                   DIKARCEQIRAQVEETSSDYDREKLQERLAKLAGGVAVIKVGAATEIEMKEKKARVEDA
FT                   LHATRAAVEEGIVPGGGVALVRAIAAVKDLKGANHDQDVGIAIARRAMEEPLRQIVANA
FT                   GEEPSVILHKVAEGTGNFGYNAANGEYGDMVEMGILDPTKVTRSALQNACSVAGLMITT
FT                   EAMIADEPKDDAPAMPGGGMGDMGGMGMM"
FT   gene            complement(511096..511770)
FT                   /locus_tag="Alvin_0442"
FT   CDS_pept        complement(511096..511770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61401"
FT                   /db_xref="GOA:D3RNB7"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB7"
FT                   /inference="similar to AA sequence:KEGG:Daro_2990"
FT                   /protein_id="ADC61401.1"
FT                   /translation="MDRSIVLSILGAAVLGFVGMLLLMPDPIEDEIARLPWLIEQDADG
FT                   RTQVFGFTLGATTLAEVRQVFREDGEVNLFRTLGPSGTLAAEVYFEQIHLERLRADFVL
FT                   TLDVDQTTLAAMYERGLRISQTGSGSQKVKLDPSDTERLAERPIRAIVYLPKARLDAAL
FT                   IEQRFGTPSRRLTESETGIVHWLYPKRGLDIGRDPNGRVVMQYVNPADFGAILEPLTTS
FT                   LD"
FT   gene            complement(511789..512169)
FT                   /locus_tag="Alvin_0443"
FT   CDS_pept        complement(511789..512169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0443"
FT                   /product="protein of unknown function DUF498"
FT                   /note="PFAM: protein of unknown function DUF498; KEGG:
FT                   mmb:Mmol_1535 protein of unknown function DUF498"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61402"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB8"
FT                   /inference="protein motif:PFAM:PF04430"
FT                   /protein_id="ADC61402.1"
FT                   /translation="MKFSEADAGSGYLIEGYGSGWIGLSGRRYTRSLILTPTQIIDHWG
FT                   PATAADLTREHLTAIADLKPRVVLIGTGAQPALLDPALYLSLIERGIGVEVMTTGAACR
FT                   TYNILMAEGREVVAGLILDTNA"
FT   gene            512318..513733
FT                   /locus_tag="Alvin_0444"
FT   CDS_pept        512318..513733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0444"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutamyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; KEGG: tgr:Tgr7_1579 glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61403"
FT                   /db_xref="GOA:D3RNB9"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNB9"
FT                   /inference="protein motif:TFAM:TIGR00464"
FT                   /protein_id="ADC61403.1"
FT                   /translation="MTVRTRFAPSPTGYLHVGGARTALFCYLYARKHGGQFVLRIEDTD
FT                   LERSTAESVNAILEGMTWLGLDYDEGPFYQTQRFDRYNQIIDELLDKGLAYRCDCPKER
FT                   LEKLRVDQMARKQKPRYDGCCRHKQVDPSQPHVIRFKNPADGVVIVDDLIRGRMPFANE
FT                   ELDDLIIRRSDGTPTYNLSVVVDDADMEITHVIRGDDHINNTPRQINILRALGFEPPRY
FT                   AHVPMILGDDGARLSKRHGAVSVISYRDMGYLPEALLNYLVRLGWSHGDQEIFSIEQMI
FT                   ELFDISDVNKAASSFNTSKLDWLNQQYLQQAEPARVARLLSPHMGRLDIDPSTGPDLVD
FT                   VVKAQAARAKTLVELAEISAFCYRDFEEFDEGSAKKHLRLVAREPLEKLRAAFELMAFE
FT                   DWTPEQLKHVVEGVAEELQLNLGKVAQPLRVAIVGRAASPGIEETLMLVGKEATLRRID
FT                   KALGYIAARGGEA"
FT   gene            513851..514447
FT                   /locus_tag="Alvin_0445"
FT   CDS_pept        513851..514447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0445"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   ana:all1618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61404"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC0"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADC61404.1"
FT                   /translation="MPAAATVPAIDVDDYLVGEQQSDIRHEYIAGQVFAMAGASETHNR
FT                   IAGNLFFHLRAATRGTPCGVFIGDMKVRVAAHDVFYYPDVLLTCASEDAEPFYKTAPCL
FT                   IAEVLSPTTELTDRREKLIVYRALASLRYYILIAQDCRRVEVYSRDEAGEWRHQVYEHG
FT                   GEIVFDCPPLHPCLTLDDFYEDVVLATPPAPVDPH"
FT   gene            514499..514942
FT                   /locus_tag="Alvin_0446"
FT   CDS_pept        514499..514942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_2614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61405"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61405.1"
FT                   /translation="MMSFKEFLAENGIDYFVIEVPEEFVPEIALLNEGKWVDSGKKDYM
FT                   QRVDAENPSIKQRRHVHIAKSKHINNKNMQASWNDDGTKHDKKTFNSKIGSISTVQDIA
FT                   RQALGLKNDFKLEEAAKAPNLLLQLNEALDIGVTPVLFIAKLA"
FT   gene            complement(515012..515560)
FT                   /locus_tag="Alvin_0447"
FT   CDS_pept        complement(515012..515560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpd:BURPS668_A0886 RhtX/FptX family
FT                   siderophore transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61406"
FT                   /db_xref="GOA:D3RNC2"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61406.1"
FT                   /translation="MSTALLLFGWMSLTGLVGWRAVWLGRWTSRLALVLILLTLLVSEF
FT                   WRQVVNALLSQEAPLLAGPEAAYVSVWILVLLPILRRRLDARALGATLLSGLTAAAAFG
FT                   LALDSAPLIAAGFASAGLQLEAFGRLALMLVVHACLAGAGLAMRQLMDAERTNPTHEQF
FT                   HWEYAAVYAGLISMHHAIA"
FT   gene            complement(515557..516570)
FT                   /locus_tag="Alvin_0448"
FT   CDS_pept        complement(515557..516570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0448"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1264 histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61407"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61407.1"
FT                   /translation="MASIGSPPQAPRPIPRLAPRLAAPALLAVLVGVLWGLMQVPGRSA
FT                   ETGGLGDSAEAHQAVEAWETLWSELGERGVAALSPSASDSSRRSAGDTVFMRYRNLWGR
FT                   IDDEARLAFQLAALSGDPVRKLALIEPLTQAEEPLIRFRAHLERARLQRRLQDFESARI
FT                   AARAALAVPELPERLRSDAWFILADSAWEQDRLDEAETALNAAIAGDPGFWEARRLRLE
FT                   VLARRLAGPRQRGAVCLDRTRRMIEDLGALPALAEDQTQFRDLADRFARQGTPSHVALA
FT                   LIAGLGYRWSGDTERARATLASAERLRGRLPDGCERLILERVSGLLGPALAPEKRP"
FT   gene            complement(516554..517192)
FT                   /locus_tag="Alvin_0449"
FT   CDS_pept        complement(516554..517192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psa:PST_3799 thiosulfate sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61408"
FT                   /db_xref="GOA:D3RNC4"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61408.1"
FT                   /translation="METDGPTPSAFLDIATNLLAILLIVTLFALTAPRQRDEGASQLPA
FT                   RPSAGPRFVEPQRERFPPFSRFYFVLADRVAVWDQEAVVAALAAAPDTRSGATWQGRFV
FT                   WRPEPLVTRDIDTFQLEFRLDREAILSRSPPWSAEQTERLVDELAQDAARDRIAPVFIV
FT                   HPDGLETFVPLYERLQATGQRFRWFTQRPDEPVLIGRHVAQFTHYGLYW"
FT   gene            complement(517182..517658)
FT                   /locus_tag="Alvin_0450"
FT   CDS_pept        complement(517182..517658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0450"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_3121 protein TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61409"
FT                   /db_xref="GOA:D3RNC5"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61409.1"
FT                   /translation="MRRRPSMPLMPELNLLPFLDLVLAFVGILIVVFALQAPNRPETGR
FT                   PLAIDDLIVCQADGAVTLHAGPEAEPIVYRETELDALLARLAAQGDGVRNLVFALTQDC
FT                   FGTRRAFEDAFSRFTSRLDPRAETRRAFRLSFRPLSTAPEALPRLLTEWRGHGD"
FT   gene            complement(517658..518446)
FT                   /locus_tag="Alvin_0451"
FT   CDS_pept        complement(517658..518446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0451"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   cyt:cce_1738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61410"
FT                   /db_xref="GOA:D3RNC6"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC6"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADC61410.1"
FT                   /translation="MPPPTQSSLDLDQAVGLFSERQIARPLIVAVLITLALYPTLMHFL
FT                   EPDTLPDWIGRYLGNGYCRFMLALFVASALYAVLQYLGLQSERRALIGRDTPDQDGRQS
FT                   VRSRLQDWIDFLSGREHADAERVPAALRRWHDRTRAHEDSVHLSDYVLLVRGQQHQHNF
FT                   APIGFAIWVLPMLGFIGTVLGITQAIGGLADSVAVTAVDGGGLGGVLGGLQFAFDTTFV
FT                   GLVLVIPLMLALLVLRARAQTLDMLYYRRLLDRLVPDAAD"
FT   gene            complement(518447..518848)
FT                   /locus_tag="Alvin_0452"
FT   CDS_pept        complement(518447..518848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61411"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61411.1"
FT                   /translation="MIGSVWPAALSLALWLSAVAAPATADTTPGSEPTTHSDPERAAFQ
FT                   ARLDDIRRLLGRLDDLESQLIAQAEQALDRADAARSHDERARQERLYGEIGARIAELRA
FT                   TRRDIAHQLQALEQALDGAVTSQPTRPDR"
FT   sig_peptide     complement(518771..518848)
FT                   /locus_tag="Alvin_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 26"
FT   gene            complement(518845..519468)
FT                   /locus_tag="Alvin_0453"
FT   CDS_pept        complement(518845..519468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61412"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61412.1"
FT                   /translation="MMKKTSALLLAGLLTLAGSAGLAQTADQPDMGRLFNKVNSVAAQL
FT                   QENLSGLEANIQASRDSIEKGGEVLDAMLESVKRVNASMDEDSEIWTELDALLELWEQR
FT                   RQETLTKSESNPAFLPIAQAWQSRLDTGRELRNQISTERANSLALMRAIESDRDIVLAY
FT                   YELGQADKAIESLQKVSANLTSLNENMQAIVKTASDAQQVPIAP"
FT   sig_peptide     complement(519391..519468)
FT                   /locus_tag="Alvin_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.847 at
FT                   residue 26"
FT   gene            complement(519482..520180)
FT                   /locus_tag="Alvin_0454"
FT   CDS_pept        complement(519482..520180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0454"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_1365 chromosome segregation protein
FT                   SMC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61413"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61413.1"
FT                   /translation="MPDRFIPTRLRLRPGLLLCALLLSAPGWAQEGQYSARNPNRSNPT
FT                   VILEAEMSNIRASSAQLGARIQTAMEKLEEVARLTSEQEKEAQVDSLFFTLRDEVYGVL
FT                   NKLDLNSDFADALNRAKEGTIVLKSWYERQPPDYPNREQSIAQLERAIQEYDIVDERLN
FT                   QSRTLAQEKLSTIMRQHRVILQEMKIGKVLEAIAAARSVVEGLNDITQAMTVVEQKTQQ
FT                   SLQASVPIAN"
FT   sig_peptide     complement(520091..520180)
FT                   /locus_tag="Alvin_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(520227..521552)
FT                   /locus_tag="Alvin_0455"
FT   CDS_pept        complement(520227..521552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0455"
FT                   /product="stress protein"
FT                   /note="PFAM: stress protein; KEGG: nml:Namu_0654 stress
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61414"
FT                   /db_xref="GOA:D3RND0"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/TrEMBL:D3RND0"
FT                   /inference="protein motif:PFAM:PF02342"
FT                   /protein_id="ADC61414.1"
FT                   /translation="MKTLPKGANAPLSSAGTVRIELCWPPSRDTLDVVCFAVGADGRIP
FT                   SDDWFVFYNQLQAPGGVVVLSTPAAGRAEIQVQPERLPAGVDRLVIAAALSHGAFRDLI
FT                   GARLTATPAAGEPLAFELTEAGDEQALIFAELYRHGAGWKLRAVGQGFRGGLQPLAEHF
FT                   GVAVADEDTTSETPIPPPIEPSPSAPTPPRPIPLESTPPPEPRRRRSRRLTRLLTLSVL
FT                   LAAATGAVWFFKPAWLALPGELWTDLRDRLAYGAPPTTTLEAPQPATPAGVGTETPPSR
FT                   SRPTSMRYQAPTCPWDDTQVFERYHALGENYVRILQRVEHSNKLLGKWRQELRRSTDAC
FT                   PTTFVDGNRQEIEQLSQLPVSAWMEEATKLNGCAGLMIKRLDKELNQESRPILIQRLVR
FT                   EADRARNLESDLTDIARDLAYLRNKTARLLDGFQENIEACGH"
FT   gene            complement(521668..521979)
FT                   /locus_tag="Alvin_0456"
FT   CDS_pept        complement(521668..521979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0456"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   tbd:Tbd_1307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61415"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:D3RND1"
FT                   /inference="protein motif:PFAM:PF08895"
FT                   /protein_id="ADC61415.1"
FT                   /translation="MLIRFETPAYATITMFGDVAVTLIKLMGHSGNVPGALLAEDVPAA
FT                   LERLKRAVAEHPHATLDTAMPNPRKGDESPHVSLAHRALPLIELLTAAAREGENVMWE"
FT   gene            522129..523802
FT                   /locus_tag="Alvin_0457"
FT   CDS_pept        522129..523802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0457"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /note="TIGRFAM: glutaminyl-tRNA synthetase; PFAM:
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, catalytic
FT                   domain; Glutamyl/glutaminyl-tRNA synthetase, class Ic,
FT                   anti-codon binding domain; KEGG: pmy:Pmen_2572
FT                   glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61416"
FT                   /db_xref="GOA:D3RND2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:D3RND2"
FT                   /inference="protein motif:TFAM:TIGR00440"
FT                   /protein_id="ADC61416.1"
FT                   /translation="MTDAAESPRTHFIRQIAEADLASGKHDRIVTRFPPEPNGYLHIGH
FT                   AKSIVLNFGLAESLGGICNLRFDDTNPHKENLEFVEAIQNDVRWLGFDWDDRLYFASDY
FT                   FERLYGFAVELIEKGLAYVCDLSAEEMREYRGTLTEPGRDSPWRERPVAENLDLFARMR
FT                   AGEFPDGSRTLRAKIDMASPNINLRDPVLYRIKHGVVHHQTGTAWCLYPTYDYTHPLSD
FT                   ALEGVTHSLCTLEFEDHRPLYDWVIANVSAPSRPRQIEFSRLNLEYTVMSKRRLTDLVG
FT                   EAHVDGWDDPRMPTLAGLRRRGYTPAAIRVFCERIGITKSDNRVEMAMLENAIREDLDA
FT                   NAPRRLAVLNPLKVVLTNYPEDRTESIELANHPKDPELGTRTLPFARELYIDRADFEET
FT                   PPKGFKRLVPGGEVRLRGAYVIRCDEVVKNADGEIVELRCWADLDTLGKNPEGRKVKGV
FT                   IHWVSAEQAVAAEVRLYDRLFNVPMPGAGGSDYRADLNPESRRVLTGAMLEPNLRGVLP
FT                   GERFQFEREGYFVADPDSTSERPVFNLTVGLRDTWGKSQS"
FT   gene            complement(523814..525889)
FT                   /locus_tag="Alvin_0458"
FT   CDS_pept        complement(523814..525889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0458"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: asa:ASA_2981 GGDEF domain-containing protein;
FT                   TIGRFAM: diguanylate cyclase; PAS sensor protein; PFAM:
FT                   NMT1/THI5 like domain protein; GGDEF domain containing
FT                   protein; PAS fold domain protein; SMART: GGDEF domain
FT                   containing protein; PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61417"
FT                   /db_xref="GOA:D3RND3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3RND3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC61417.1"
FT                   /translation="MSIRCKISNCARSTWYSLLFACALAQAGEPAQALETVSLQFKWSH
FT                   AFQFAGYYAALEQGYYREAGLDVRLLEAVPGLDPLESVLSGQAQYGVGTSSLLLARAAG
FT                   QPVVVLAVVFQHSPLVLVARQDLTRPGTQGIHDLVGKRVMIEPQSDELVAYLKQEGIRL
FT                   DRLVQVPHSFEPKDLIAGQIDAMSAYVTNELYYLEDAGMAYQTYTPRSVGIDFYGDNLF
FT                   TTEQELKKHPQRVRAFREASLRGWQYAMEHPVEIADLILAKYSKQHPRAFYLFEAERMV
FT                   PLLRTDLIEVGYMNRGRWRHIAATYADLGLLPRDYALDGFLYEPDSRPDLTKLYIALAL
FT                   LTLVSVIAVYVARINRRLGLALDEKSRSEERHRIIFQTTASAGVVWREGFVVTDWNRQA
FT                   EAVFGWKREEVLGRSFIDFMVPISDRERLTPHLGRLIRENVLPHGINDNLTRDGRVITC
FT                   EWFNAWLPERPGEPREVVSLANDISERQRLENEIRQLAFFDALTRLPNRRLLLDRLGRV
FT                   LAALRRDGGHGALMFLDLDNFKPLNDSYGHAVGDLLLVEVARRLCECVREMDTVARFGG
FT                   DEFVVLLGNLDDDQGLARNHAERLARKILDRVGEPYRLARAQVETAIEHRCTASLGVAV
FT                   FNEAADEEDILRRADTAMYAAKGEGRNRIAVDAGLPGEAPDREAASHVDRRASHAG"
FT   gene            526040..526765
FT                   /locus_tag="Alvin_0459"
FT   CDS_pept        526040..526765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0459"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   mca:MCA3092 uracil-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61418"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D3RND4"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ADC61418.1"
FT                   /translation="MTLDWPARISPKTLNHTMTTGLPNTKNELDTRQAALLTLHAELET
FT                   CCRCPKMYGPAVHSESVLSPVMLIGQAPGTREIEQLKPFCWTAGKTLFNWFAPLGLDET
FT                   AFRARILMSAVCRCFPGKNPKGGDRVPDRDEVARCERWWRGELELLRPRLLLPVGKLAI
FT                   AQLMPVPRLNDVIGRQWSYRSPEGWEADVIPLPHPSGASTWFKMEPGRTLLAQALDLIA
FT                   VHPAWRAVLDAEPDQAARA"
FT   gene            complement(526799..527485)
FT                   /locus_tag="Alvin_0460"
FT   CDS_pept        complement(526799..527485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0460"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   mei:Msip34_1095 6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61419"
FT                   /db_xref="GOA:D3RND5"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D3RND5"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ADC61419.1"
FT                   /translation="MPDTSPDFQSFASAEQVAETTTRRLLAAAERAIAERGRFQIVLAG
FT                   GRTPLAVYRRLVDRPADWARWHVFFGDERCLPADDPERNSLAARAVWLDRVPIPPDNIH
FT                   PIRAELGAGPAAARYAGLIRDRLPFDLVLLGLGEDGHTASLFPDHAIRDAALVMPVHDA
FT                   PKPPPDRVSLTPLALGSSRAILILVTGRGKHEALARWRAGADLPVSRIVTSGRLEVLMD
FT                   AEAAGD"
FT   gene            527598..528599
FT                   /locus_tag="Alvin_0461"
FT   CDS_pept        527598..528599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0461"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: maq:Maqu_1888 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61420"
FT                   /db_xref="GOA:D3RNR0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC61420.1"
FT                   /translation="MKILLVDDSKSARYALRLQLQKQGAEVEMAESAEAAFETLKGELP
FT                   DAILMDHMMPGLNGFEALEVIRDDPRTAAIPVIMCTSHEEPEFVATAQKKGVFGILPKS
FT                   AAPELLPEMMARLQAELSTAVRTPAPTPAPAPVAEKPAAPPPGLSEDAIIRLFESRLEE
FT                   RLPRLLSPMVDELRRDLSEVVLSETRRLIEERQAAEQSARQAVPTMADLQAISTRLATE
FT                   TLPDLIKRALQTERVQLQEWVDKRVGESLAQTTASEAQERSDADEIARKAVAMARRESK
FT                   EAVEAALATAQQSIQSLEQRLPSLGPIYALIVLAIVLGLGAAGAVYSLLAPM"
FT   gene            528624..529109
FT                   /locus_tag="Alvin_0462"
FT   CDS_pept        528624..529109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0462"
FT                   /product="protein of unknown function DUF785"
FT                   /note="PFAM: protein of unknown function DUF785; KEGG:
FT                   pca:Pcar_2309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61421"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR1"
FT                   /inference="protein motif:PFAM:PF05618"
FT                   /protein_id="ADC61421.1"
FT                   /translation="MPDSESSSSDLILGWREWLALPELGLPAIKAKVDTGARTSTLHAF
FT                   YVDTFRRDGRLYARFGVHPLQQRADLVIHGEAPVIDRRQVSDSGGHREERYVIETRLAL
FT                   AGQVWPIELTLTNRETMLFRMLLGRTAINGRALVDPEKSFLTGQVQRPWESYGVTDR"
FT   gene            529106..530563
FT                   /locus_tag="Alvin_0463"
FT   CDS_pept        529106..530563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0463"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: tgr:Tgr7_1012 protein of
FT                   unknown function DUF404"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61422"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR2"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADC61422.1"
FT                   /translation="MSIDWNDYACEGFYDELVEAPGQARDCVDGLLQDLEDLGHDELVA
FT                   RQEAADVAIKEMGITFTVYSEEGGAIDRTWPFDIIPRIIPQSEWTRVEAGLRQRVQALN
FT                   LFIDDLYHDQRIIADGVFPADVLAKSVNFRPQCVGVNPPLGIWAHICGSDLVRDGDGTL
FT                   YVLEDNLRVPSGVSYMLENRLVAKRVFPELFEHYAPLPVDDYPSQLFDTLAALSPRPAD
FT                   YPEVVVLTPGIYNSAYFEHAYLAQQMGCELVEGRDLFVDDDDCVYMRTVDGAARVDVIY
FT                   RRVDDLFLDPEAFRPDSSLGVPGLLRAWKAGKVALANAPGAGVADDKVVYAFVPEIIRY
FT                   YLDADPIIPNVPTYRCMDPESLAYTLEHMEELVVKPANESGGYGMLVGPASTKAERERF
FT                   AELIKKDPRNYIAQPALKLSTVPTIIGRTLEPRHVDLRPFILSADRQQVTMGGLTRVAM
FT                   RKGSLVVNSSQGGGSKDTWILPDCTKE"
FT   gene            530577..531593
FT                   /locus_tag="Alvin_0464"
FT   CDS_pept        530577..531593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0464"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   hch:HCH_00984 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61423"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR3"
FT                   /inference="protein motif:PFAM:PF04168"
FT                   /protein_id="ADC61423.1"
FT                   /translation="MLSRVAENIYWLSRYVERAENTARIVSVNANLLLDLPRGIAPGWR
FT                   PLIDITGANALFEEHYKDYGERQVVRFLIGDERNTGSILSALGAARENCRTIRDFVPRE
FT                   SWELLNELYLHARDDLSKGLTKGGRHVYLKSLIQGVQTMAGMLSGTMLHDQGYDFLHLG
FT                   RFIERADMTTRLIDVRSANLLPEETTELRPFETIQWISVLKSLTGYQAYRRSEQVRVQR
FT                   DPVLRFLLQHPAFPRSVGYCLESLRKSLEKLPRNESTLRVTGRLKRTLEGVAPERLDQR
FT                   QLHAFLDEFQIGIGELHGEIARTWFPPVPELESPSQSQSQSQVQTTAKTDDKEERGR"
FT   gene            531590..531880
FT                   /locus_tag="Alvin_0465"
FT   CDS_pept        531590..531880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0465"
FT                   /product="VirB2 type IV secretion fmaily protein"
FT                   /note="KEGG: acr:Acry_3521 VirB2 type IV secretion fmaily
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61424"
FT                   /db_xref="GOA:D3RNR4"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR4"
FT                   /inference="similar to AA sequence:KEGG:Acry_3521"
FT                   /protein_id="ADC61424.1"
FT                   /translation="MNVASLPAILLTLAGWTLTALSAAAMLSGPYDGRTCQTDCVQTLF
FT                   FSGLATGVLGLILGIVGLRFATGRRLSQVSLWLAGPLCAIFAALFLIGNLA"
FT   sig_peptide     531590..531667
FT                   /locus_tag="Alvin_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.442 at
FT                   residue 26"
FT   gene            complement(531884..533203)
FT                   /locus_tag="Alvin_0466"
FT   CDS_pept        complement(531884..533203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0466"
FT                   /product="ribonuclease BN"
FT                   /note="TIGRFAM: ribonuclease BN; PFAM: ribonuclease BN;
FT                   protein of unknown function UPF0074; KEGG: noc:Noc_1636
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61425"
FT                   /db_xref="GOA:D3RNR5"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR5"
FT                   /inference="protein motif:TFAM:TIGR00765"
FT                   /protein_id="ADC61425.1"
FT                   /translation="MTPNTSLQTRLEALLWGQNPRQLPRWKAQAIRLGRLVHAVARDLT
FT                   QGNLTLYAMSLVYTTLLSLVPLLAVSFSVLKGFGVHNQIEPLLANALEPLGESGVEITQ
FT                   QLIGFVDRMQVGVLGALGVGMLFYTVVSLIQKIEQSFNHVWRVDEVRPFAQRFTQYLSV
FT                   LTIGPVLFFSAVGVSASLGGNPLLRSVLDYEPVSWLMELARLVAPYLMISATFAFIYRF
FT                   VPNTQVRLVSALIGGLVAGLLWQSVGALFAHFMAGSTQYTAIYSSLAILILLMIWIYLG
FT                   WLILLVGSSLAFYHQHPELLDSPEREPEPSPRRRERLALSIAARIARAHLAAEPPLDRE
FT                   TLAKAARQPARTIQTTLDLLEQAGYIVRTAEAPAGYVLTRPPEAIAVLDILERVRQWGE
FT                   HRVVAADRPVEPAIAAIESRIETALAESLKDLSLRDLAAE"
FT   gene            533494..539703
FT                   /locus_tag="Alvin_0467"
FT   CDS_pept        533494..539703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0467"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /note="KEGG: ttj:TTHA0180 DNA polymerase III alpha subunit;
FT                   TIGRFAM: DNA polymerase III, alpha subunit; PFAM: DNA
FT                   polymerase III alpha subunit; PHP domain protein; nucleic
FT                   acid binding OB-fold tRNA/helicase-type; SMART:
FT                   phosphoesterase PHP domain protein; Hedgehog/intein hint
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61426"
FT                   /db_xref="GOA:D3RNR6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR6"
FT                   /inference="protein motif:TFAM:TIGR00594"
FT                   /protein_id="ADC61426.1"
FT                   /translation="MDPTFVHLHLHSEYSLVDGLVRIKPLVKTVAAAGMPAVAVTDQGN
FT                   LFSLVRFYKAAVGAGVKPIAGADLWVRNPEDANHPHRLVLLAQDEPGYRNLTRLISRGF
FT                   VEGQHLGVAQVERDWILEAHQGLIALSGGPRGDVAEALLKGRDAIAEQRLDAWLSVFED
FT                   RYYLELMRTGRALEGELIESSVDLAIRRGVPVVATNDVRFLAAGDFEAHEARVCIHQGR
FT                   TLDDPRRPRDYSEEQYLRTPAEMAELFADLPEALENTVEIAKRCNLELKLGKNYLPVFP
FT                   VPEGMTTDSFFAEQSRRGLEWRLERILDRDAPDYAERRRVYEERLETELAVIIQMGFPG
FT                   YFLIVADFIQWAKDNGIPVGPGRGSGAGSLVAYALKITDLDPIEHELLFERFLNPERVS
FT                   MPDFDIDFCMEGRDRVIDYVARKYGREAVSQIITFGTMAAKAVVRDVGRVMGHPYGFVD
FT                   KIAKMVPFELGMTLEKALKESEDLKRAYDQDEEVRAILDMARKLEGLTRNAGKHAGGVV
FT                   IAPTVLTDFAPLYCEPGGANLVTQYDKDDVEQVGLVKFDFLGLRTLTIIDWALKTINAG
FT                   RAAKGEPPLDIERIDPRDQEAFDLLKRCETTAVFQLESRGMKELIKKLQPDCFDEITAL
FT                   VALFRPGPLQSGMVDDFIERKHGRAEVAYPHPDLEPILKPTYGIILYQEQVMQIAQVLA
FT                   GYSLGGADILRRCLAGSTEVVDAATGRRVTLSEIAAAPEVWIGREVFALDLKTQKIVHQ
FT                   PIDAVYHNGVQEVFEVTTRTGRRIQATATHLFYTLMGWKPLGAFQPGDRIGLAGTLPIE
FT                   HGCGITDAQIKLTAYLLGDGHLSTRKPANCYFCNSDPALIADFNRCVAELFGRSAPVDY
FT                   QLHPGRQSVGYVRVGCLSEFNAWIDSHIQRAHSHDKVIPDWVDALSRDQLRLFIGTLWS
FT                   TDGTFDTSIGHADYTSTSRRMIEQLQHLLLRLGIVALFNIKTIQYQGQPHRSYRAQITG
FT                   REEMLKFYDRIQPFLSRRKQDKAEICYRMIRDKARNQSKHTIPAEVIGLIANAKYASGM
FT                   TWAEIDQAVGMRPGTMSSGLNFKIPPRRALARHRVLNFATAFKSDELRAIADSEVFWDV
FT                   IESIRPLGQMEVFDLTIPKHHNFIANDFIAHNCMGKKKPEEMAKQRDTFEQGALARGID
FT                   GQLSSHVFNLIEYFSGYGFNKCIVGETLVADPATGERRKVKEIYRNGIASVASLMPDHR
FT                   MGRSSVVQVMENGIKPVFRLRTSLGKTLRATGNHPLLTASGWKRLDELKEGDRIASPSR
FT                   LPIEGQERWSEHELITLGWVLSEGNTCHPSGFYFYNKDEVARDDFLAAASAFPDTQPTV
FT                   RLRPERADTWCVYVGTGRDTRIRVGGGYSFTPRSGARLWLEDLGMIGHKAPDKHFPASV
FT                   FRLDNACLAVLLGRLWSGDGYIASTSGKDMIPYLASASQRLAGETQHLLLRLGIVSRLT
FT                   EKRFAYKDGRIGYTLHLVGRRSIEAFVQVIGPHLVGRDVQLNALRDYLAQTPADRESVD
FT                   TLPPEVKDSVRCHKEASGLTWDQIAERSGVCVKEFYGTPKTHKKGFRRATIRKLADFFG
FT                   ADDLRQAANAEIFWERIVAIEPDGAAMTYDLEVDHTHNFVADDIIVHNSHSAAYALVSY
FT                   QTLWLKAHYPAAFMAAVLSADMDNTDKVVTLIDECRTMKLRVDPPAINRSDYHFTIADD
FT                   KTVVYGLGAVKGVGESAIEAMLEARRAGGSFRDLWDFCGRIDLQRVNRRVLESLIRAGA
FT                   LDELGPNRATLMAHLPLALKAAEQYHSTRAAGQVDLFGALEPSGPPTPDPQLARETLAD
FT                   WEDEQRLQGEKETLGLYLTGHPIDRYEDELKAMGGARIARLLETDRELGRRDRRDREKR
FT                   TVVGLVVGVRHGKTQRGRMGSVVLDDRTGRIEATVFSELYEQARHLLVADQILSITGAL
FT                   NFDEFRDAWSLRADSVRTFEDARATAADHLLLTLDLSDPAVHARGPERVEELRAVLLAH
FT                   RDTARETSVPIRLIYRRPGAVGELMLGSAWRVRPADALLKQLRQLLGAESVRVSYERPV
FT                   QQAAMSELQSPPRLRVVS"
FT   gene            complement(539747..540382)
FT                   /pseudo
FT                   /locus_tag="Alvin_0468"
FT                   /note="hypothetical protein"
FT   gene            541115..541675
FT                   /locus_tag="Alvin_0469"
FT   CDS_pept        541115..541675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0469"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: sun:SUN_0924 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61427"
FT                   /db_xref="GOA:D3RNR7"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR7"
FT                   /inference="similar to AA sequence:KEGG:SUN_0924"
FT                   /protein_id="ADC61427.1"
FT                   /translation="MDIQLKIAGSSEIDEVLKLHYRYQIDSIAKEDKSDGFVTTSFTKD
FT                   QMVDLINKENGLFIAKKGGAVVAYVMAASWEFWSAWPMFAFMINELPNLEYKGQMLSVE
FT                   NSYQYGPICIDKSVRGTGVLEAIFEFAKNKMSERYPILVTFVNKANERSYQAHKRKLGL
FT                   DVIHQFEFNSNSYYEMACKTNEA"
FT   gene            complement(542028..542447)
FT                   /locus_tag="Alvin_0470"
FT   CDS_pept        complement(542028..542447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0470"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   apt:APA01_13190 translation peptide chain release factor
FT                   class I"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61428"
FT                   /db_xref="GOA:D3RNR8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR8"
FT                   /inference="protein motif:PFAM:PF00472"
FT                   /protein_id="ADC61428.1"
FT                   /translation="MLQITPTVFIPDAELSERFIRAPGPGGQNVNKVASAVQLRFDAAR
FT                   SSALPEDVRRRLVQLAGRRADQDGVITIEAHRFRERERNREDARERLAGLIRQALHRPK
FT                   RRIATKPTRASRERRLQTKQVQSRRKQQRRRPVDD"
FT   gene            542597..543193
FT                   /locus_tag="Alvin_0471"
FT   CDS_pept        542597..543193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0471"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3639 FAD linked oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61429"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61429.1"
FT                   /translation="MFGALTSENLFHDGVAMMAFRHSTFETITTSMVVRILAVGWLGLS
FT                   LPVQADDWGARLSDGSGVEVDASTHRAWRLEDGRRTPLWDGVHRLEDGSVVIVRDGVAV
FT                   PNPAMLETWSEAPPRQPREAGRESDVCRELVRRVCGEGEGDNAACAGGEPCRLARDLLK
FT                   MSAESLPLEAEIQAESSVGTQCREAMTNPFFAPCR"
FT   gene            543239..543793
FT                   /locus_tag="Alvin_0472"
FT   CDS_pept        543239..543793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vok:COSY_0906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61430"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS0"
FT                   /inference="similar to AA sequence:KEGG:COSY_0906"
FT                   /protein_id="ADC61430.1"
FT                   /translation="MALRIKSHWKDDARARSLPEIASALAYIAWRIALDKAINLHCERF
FT                   VYRDDAQRLAVIQEYLVFLVQIADRLAHAELDEAERRTLIVEFAKKLFGHVQDNSQDLL
FT                   GPGDYGGPFIALLDTRSGEYAEFQFAGDGPSYAFLRHLGHEIQCVMGESEANRWVIDQV
FT                   MDKDGWDAYKHFARAYHNLFE"
FT   gene            543996..544361
FT                   /locus_tag="Alvin_0473"
FT   CDS_pept        543996..544361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_4960 sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61431"
FT                   /db_xref="GOA:D3RNS1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61431.1"
FT                   /translation="MVLKIGGDMLALDAAIRRQIETEARKLTDRFPGEPIEAQVNVQEE
FT                   FDQLHGHRVRCELSAKLGAGRQVVVREARKVASEAISEVFTAARRNVRRLRCQSVLALA
FT                   PAPKTVVARTGAQIATR"
FT   gene            544483..545412
FT                   /locus_tag="Alvin_0474"
FT   CDS_pept        544483..545412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0474"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   ppd:Ppro_0490 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61432"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADC61432.1"
FT                   /translation="MKVAIIGGTGFVGLYITRHLLAAGHVPRLLVRPGSESKVERPESC
FT                   EIVHGDVSDPSSLVECVRGCDAVIYLIGILREFPAQGITFEALQYQGVVDTIAAAQENC
FT                   VGRFVLMSANGIRPDGTAYQRTKYRAEQALKDSGLRWTIFRPSVIFGDAEGRMEFCSQL
FT                   KKDIINSPLPAPLFHAGLLPTKAGLFELAPVSIEDVADAFVLALSESRTESQTYSLCGP
FT                   ERLSWKAILSTIAAASGRTKLMVPAPALAIKAAAGLFDRFPWFPISRDQIRMLMEGNVC
FT                   TENDGFARLGLTPTHFGVDQLGYLARGD"
FT   gene            complement(545431..546687)
FT                   /locus_tag="Alvin_0475"
FT   CDS_pept        complement(545431..546687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0475"
FT                   /product="MOFRL domain protein"
FT                   /note="PFAM: MOFRL domain protein; KEGG: tgr:Tgr7_0931
FT                   hydroxypyruvate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61433"
FT                   /db_xref="GOA:D3RNS3"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS3"
FT                   /inference="protein motif:PFAM:PF05161"
FT                   /protein_id="ADC61433.1"
FT                   /translation="MTLLHAPRHALLELLAVALDAVDGAHAVRRALMARPIAGPVWIAA
FT                   IGKAAESMTLGALDVLGDACRGGMLVTKPGHADPGRLRGLGIEVHFGGHPLPDAGSLAA
FT                   GERLLANLDDLPAETRLLFLLSGGASALIEAPIAGLELAELRAINAWLLASGLPIDAMN
FT                   RVRQSVSRLKAGGLLRHLGGRPVRQLAISDVPGDTPGVIGSGPLVPRPDLGDQVGRLVL
FT                   PDWLAGRVARGLAERGTLPEHGPEMELVATLSLAKAAVVKASESRGWHVRLHPDPIEGE
FT                   AADQGRALARTLIDGAPGLHVWGGETTVRLPAHPGRGGRNQHLALAAAIELAGRDDVWL
FT                   LSAGTDGGDGPTEDAGALVDGGTLERAEFGGIGFDARTGLERADSGRFLEASGDLIRTG
FT                   PTGTNVMDLILGYKAPSTR"
FT   gene            546849..547091
FT                   /locus_tag="Alvin_0476"
FT   CDS_pept        546849..547091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0476"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61434"
FT                   /db_xref="GOA:D3RNS4"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61434.1"
FT                   /translation="MNLCPKCDRPLWPFAMILTITSVIAFLTWLILGLSAIEPWQRLLV
FT                   TLIAFIAVGATLLHYVVSCLRRHCRHGHPVVQGRS"
FT   gene            complement(547098..547778)
FT                   /locus_tag="Alvin_0477"
FT   CDS_pept        complement(547098..547778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0477"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   tgr:Tgr7_1410 peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61435"
FT                   /db_xref="GOA:D3RNS5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS5"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADC61435.1"
FT                   /translation="MKLLAIDTSNETCSAALLVDRSVVQELTLAPRRHGELILGMMQRL
FT                   LEQAGLELRDLDALAFGCGPGSFTGIRIATSVIQGAAFGAELPVVPVSTLAAMAQGQFR
FT                   REGQRRLLTALDARMDEVYWGCYEIGERDLAELGGAEQVCAPDRVTRPTGDGWQGVGPG
FT                   WGVHGEILSRRVGPALSGMNPDGVCEAQDIALLAAAELTAGHWVPAEQALPVYLRDQVT
FT                   RAPA"
FT   gene            complement(547784..548710)
FT                   /locus_tag="Alvin_0478"
FT   CDS_pept        complement(547784..548710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0478"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_0620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61436"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61436.1"
FT                   /translation="MLSFDAQSIPSPLAIRECTRPRFDTDLDALKDWLASLRTRGVRQA
FT                   GPALVLTLENLRKAELSASRRLTVLSLLKAPVLKTCAGLPKPYAGEATATETAPGLTME
FT                   QRLGRLMFVNLDRALHQLDKEHPVPSERQQHKRLWLIRNLFRFANRQIRYAILWKAALP
FT                   AGTWRDLHELHLYLSSRRSNSLWDLDAQRPTVGEFDQEIEYKTLLLLGLAAKLKDAAPQ
FT                   SEYFMDGLPAWAAQTRLEDPHTRLGRLRLFTVEVSADEPPRQLQGSLDMAFRGWVLQPP
FT                   YPYLHELESGPFGLGAFGGRPLGLETF"
FT   gene            complement(548868..549854)
FT                   /locus_tag="Alvin_0479"
FT   CDS_pept        complement(548868..549854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0479"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: cyh:Cyan8802_1113
FT                   PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61437"
FT                   /db_xref="GOA:D3RNS7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS7"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADC61437.1"
FT                   /translation="MAKYHIYGIGNALVDMEYEVTPEDLGILGIDKGVMTLVDEHQQLS
FT                   IMEHLKAHHPQRGSGGSAANSIIAFSQFGGKGFYSCKVADDELGHFYMKDLIEGGVDTN
FT                   HHTEKDQGHTGRCVVLVTPDSDRTMCTFLGVSGNLSTKELVEEALCDSDWFYTEGYLVT
FT                   SDSARAASIEAKRIAEAAGVRTAISLSDPNMVKFFKPGLLEMIGSGVDLLFANEFEAMG
FT                   MAGSDDLHQAVDYLKTIARHFSITRGPKGALVWDGRALIEIDPVEVEAVDTVGAGDMFA
FT                   GAFLYGLSQGWTHQRAGDLASAASAKLVTSLGPRITAEETRNILKAF"
FT   gene            549967..550449
FT                   /locus_tag="Alvin_0480"
FT   CDS_pept        549967..550449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_PB0000194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61438"
FT                   /db_xref="GOA:D3RNS8"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61438.1"
FT                   /translation="MKRKMNLLMIIGLVGTPIAGTQFGLDYGRAIWGAPQVEWTPIEMA
FT                   LPLEQTSGNFQLLLDNEPLADHLARNSLTALGSEGLAYFVTPQMVRVRLNNWPQIQAWK
FT                   AHLLHMGVYSALGLGVSLTCLIVGLVEFFRQTPVPRRRPPEAQVARPVRRRDPGVF"
FT   sig_peptide     549967..550041
FT                   /locus_tag="Alvin_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.585 at
FT                   residue 25"
FT   gene            complement(550459..552195)
FT                   /locus_tag="Alvin_0481"
FT   CDS_pept        complement(550459..552195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0481"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC"
FT                   /note="KEGG: hna:Hneap_1293 ABC transporter, CydDC cysteine
FT                   exporter (CydDC-E) family, permease/ATP-binding protein
FT                   CydC; TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydC; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61439"
FT                   /db_xref="GOA:D3RNS9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNS9"
FT                   /inference="protein motif:TFAM:TIGR02868"
FT                   /protein_id="ADC61439.1"
FT                   /translation="MNELRRLWQLFQPYRTWMLVGTLAAILTLLANVTLMAAAGWFLTA
FT                   MAAAGAAGVAMNYFTPAALIRGSAMIRTAGRYGERLVNHEATFRLIASLRVWFYQHLEP
FT                   LAPARLQQYHSGDLLSRIRADIDALDNLYVRVLVPVAVANVSIVLFTIFLLFYHPLLAL
FT                   SGLTFLVLAGVGLPIWSQARGLAPGRRIAEDEAALRTAVIDGVQGLAELTLYGAAERQA
FT                   RHIDSLSRRLIADQTRLSSDHGLTQAAVGLCASLSLWVLLWIAIPLVDDGRLMPPQLAM
FT                   LALFTLASFEAVAPLPQAFQMLGRTLAAAHRLFAIVDTEPAVAEPSPPSPRPERFDIEF
FT                   ADVRFSYPDAPRPAVSGIRLQVPQGTRAAVIGATGSGKSTLFNLLLRFWAPDSGSIRVG
FT                   GHDILDFHGDDLRRHIAVVSQHTHLFDATIRENLLIANPDAPQAAIEAACRVAQIHDFI
FT                   AELPEGYDTWVGETGVRLSGGQGRRIAVARALLKDAPILLLDEPTEGLDAATERDLMQA
FT                   LDTLMVGRTVLLITHRPAGLDWVDQVLVLDQGRELARGDVSVIPQAMQAALLPLRAEAE
FT                   TR"
FT   sig_peptide     complement(552052..552195)
FT                   /locus_tag="Alvin_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.419 at
FT                   residue 48"
FT   gene            complement(552192..553970)
FT                   /locus_tag="Alvin_0482"
FT   CDS_pept        complement(552192..553970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0482"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="KEGG: afr:AFE_1388 ABC transporter, CydDC cysteine
FT                   exporter (CydDC-E) family, permease/ATP-binding protein
FT                   CydD; TIGRFAM: ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD; PFAM:
FT                   ABC transporter related; ABC transporter transmembrane
FT                   region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61440"
FT                   /db_xref="GOA:D3RNT0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT0"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ADC61440.1"
FT                   /translation="MSVNAWLKSQRPLAGAALMRAIWLNTANGLLAVAQAWALAVTLDA
FT                   VIFNDAGLSEVQPWLWGLLALFGARALIVWLAERSAFQAAAQVRATLRDRIHRHLQRLG
FT                   PAYLSGQRSGALVETLTKGIDDLEGYYARFVPAMTLVMILPLAILTAVMPMDWLAGLVL
FT                   LFTAPLIPLFMILIGSGAEVRNQRQWKQLARMSAHFLDVIQGLTTLKLFGASRREVAII
FT                   ARVSDDYRHSTMQVLRVAFLSSAVLEFFASVGVAIVAVLIGFRLYGLAVPVPAWIPIPD
FT                   VTYLQGFFVLMLAPEFYAPLRNLGTQYHARMGAVAAAEQLIQVLDTEPTRIDPGTEPLA
FT                   AARPLGVRFEDVRFSYEPGREALDGLSFAIPPGQRIALVGTSGAGKTTVVNLLLGFLVP
FT                   TGGRILIGEQALAEIDLEDWRRHLAWVPQQPRLFQGTIADNIRLGQPEAELDAVREAAR
FT                   RARAAEFIDALPLGYDSPVGERGAGLSGGQIQRIALARAFLRDAPLVILDEATANLDPE
FT                   SERLVQEGIDELALDRTLLVIAHRLNTVRRADRILVLDRGRIVEQGTHDELADAAGLYA
FT                   RMIAAHSPSRPGSEPA"
FT   gene            554296..556467
FT                   /locus_tag="Alvin_0483"
FT   CDS_pept        554296..556467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0483"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="TIGRFAM: catalase/peroxidase HPI; PFAM: Haem
FT                   peroxidase; KEGG: tau:Tola_0995 catalase/peroxidase HPI"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61441"
FT                   /db_xref="GOA:D3RNT1"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT1"
FT                   /inference="protein motif:TFAM:TIGR00198"
FT                   /protein_id="ADC61441.1"
FT                   /translation="MDTNATTAGKCPVMHGGHTAAGSSNMDWWPKALNLDILHQHDTKT
FT                   NPLDPDFDYREAVKTLDFEAVKKDLHALMTDSQDWWPADWGHYGGLMIRMAWHAAGTYR
FT                   IADGRGGASTGNQRFAPINSWPDNVNLDKARRLLWPIKRKYGNALSWADLIVLAGTVAY
FT                   ESMGLKTFGFAFGREDIWHPEKDIYWGSEKEWLAPSDNPNSRYSGERDLDNPLAAVMMG
FT                   LIYVNPEGVDGQPDPLKTAHDVRVTFARMAMNDEETVALTAGGHTVGKAHGNGDAKLLG
FT                   PEPEGAGVEDQGLGWLNKTARGIGRDAVTSGIEGAWTTHPTRWDNGYFHLLLDYEWELK
FT                   KSPAGAWQWEPIDIKEEDKPVDVEDPSIRRNPIMTDADMAMKMDPEYRKISERFRQDPE
FT                   YFAETFARAWFKLTHRDLGPRTRYIGPYVPQEDLIWQDPVPAGRTDYDVAAVKARIAAS
FT                   GLSVSDMVATAWDSARTFRGSDNRGGANGARIRLAPQKDWEGNEPARLARVLSVLEPIA
FT                   AETGASVADVIVLAGTVGIEQAARAAGFDVQVPFAPGRGDATAEMTDVESFEVLEPLHD
FT                   GYRNWLKRDYVVSAEEMLLDRTQLMGLTAPEMTVLVGGLRVLGANHGGSRHGVFTDRVG
FT                   ALTNDFFVNLTDMAYSWVPTADNLYEIRDRKSGAVRWTATRVDLVFGSNSILRAYAEVY
FT                   AQDDNKEKFVRDFVAAWTKVMNADRFDLA"
FT   gene            complement(557183..558877)
FT                   /pseudo
FT                   /locus_tag="Alvin_0484"
FT                   /note="hypothetical protein"
FT   gene            complement(559154..562342)
FT                   /locus_tag="Alvin_0485"
FT   CDS_pept        complement(559154..562342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0485"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: dar:Daro_3006 PAS; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; response regulator receiver; Hpt domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; response regulator receiver; Hpt
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61442"
FT                   /db_xref="GOA:D3RNT2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012437"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT2"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADC61442.1"
FT                   /translation="MSTTPRARSLDTSTPGWETPVHLFVCASLFTEARAALSGALEGTH
FT                   LRLHPFPARCGSPPVTAVELDRRIASVPSHEPLIWIGGCCLAPLMREHKRDRNIARKTK
FT                   SADALGFHRLDQCFHLLTDPAWIDEWLAEGAYLCTPGWLAAWPRHLARLGLADRDLART
FT                   LFGESTRHLLLLDTGHDPRAAEHLAALAEHLALPARRERVGLGYLRLSLIQLAAQASHR
FT                   AEHRLNTSRLAAARQQLAETAMAMDLVGRLSVADGERGVIGQILEIFTALFAPTQCFYL
FT                   PCAELRANRPETLGDTPTPESFAEARDFALERGTIRATASGHGFLLRLQHETETLGVFL
FT                   IDGLAMTRHLRKYQNLALQMAGLCAMAVQRAQSIQLLSQSETRYRSLFESMSEGFALHE
FT                   IILDDRGHPIDYRFLDVNRAFETLTGLKRADLIGRRVREAIPGIEGHWIKRYGEVALHG
FT                   QVMRFEQFDNVLGRHFQVHAYSPRVGTFAVIFSDVTEQRQAEHELFEYREHLETLVASR
FT                   TAELALAKQEAERANQAKSLFLANMSHEIRTPMNAIIGLTHLLGREISVPAQRDRLLKI
FT                   DGAAKHLLSVINDILDISKIEAGKLELQTSDFSPRVLLDQVSALIAEQVQSKGLDYRVD
FT                   AGPLPVVLHGDATRLRQALLNYLGNALKFTERGRIQLQARLLEDGNEDALISFEVIDTG
FT                   IGIPEEMQGRLFTLFEQGDGSPIRRYGGTGLGLAITRRIAELMGGSAGVESVPGQGSRF
FT                   WFTARLLKRPDRELGSLEGQPSIIDALETLAREFRGARLLAVEDNPINQEVLLELLGQA
FT                   NLVADLAENGRRAVELAGQRRYRLVLMDVQMPEMDGLEATRRIRRLPGWGEVPILAMTA
FT                   NVLGQERRACLDAGMNDHIAKPVEPVIFYESLLHWLSSPGSRAAQEGTERASGAPGAVE
FT                   SPETRPEPSEQQDWLYAIAGLDADFGLRCVGGKRELYVRMLHKLVDGHRDDMVHLRAHL
FT                   AAGAREEAQRLAHTLKGAAGTLGAVELQRAAAELERVIRSGAVLSGDELEMAELAGQVD
FT                   QALGGLAERLSKPD"
FT   gene            complement(562371..563477)
FT                   /locus_tag="Alvin_0486"
FT   CDS_pept        complement(562371..563477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0486"
FT                   /product="Uroporphyrinogen decarboxylase (URO-D)"
FT                   /note="PFAM: Uroporphyrinogen decarboxylase (URO-D); KEGG:
FT                   mbu:Mbur_0957 uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61443"
FT                   /db_xref="GOA:D3RNT3"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT3"
FT                   /inference="protein motif:PFAM:PF01208"
FT                   /protein_id="ADC61443.1"
FT                   /translation="MTVPNQEGPPPSAPTPDQPVAPMTSMQRVLTALGQREPDRVPLFL
FT                   FPVMQGARELGLSIEEYFARPEQVAEGQWRLRAKLGHDCLYNFHYAAIEIEAWGGSTLF
FT                   RADGPPNAGAPIVRDPEDIRRLSVPRIEDSPSLQRVLTATRLMAEQARGEVPIIGVVMS
FT                   PFSLPVMQLGFERYLILMHERPDLFERLMQLNERFCVDWANAQVEAGANAICYFDPVSS
FT                   TTITTREFFLATGREIARRTLAQIKAPAAMHFASGRILPRVPDLLDTGAAVIGVSSHED
FT                   LGALKHAAQGRLSLLGNLNGIAMRHWTPEQAESAVRDAIRAAGHGGGFILADNHGEIPW
FT                   QVPDAVLTTISQAVARWGRYPLADDHIH"
FT   gene            complement(563474..564151)
FT                   /locus_tag="Alvin_0487"
FT   CDS_pept        complement(563474..564151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0487"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; KEGG:
FT                   cbe:Cbei_0708 cobalamin B12-binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61444"
FT                   /db_xref="GOA:D3RNT4"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT4"
FT                   /inference="protein motif:PFAM:PF02310"
FT                   /protein_id="ADC61444.1"
FT                   /translation="MPPCSTHCGRSLMSSSDALLQALLTLNRLQAQELLAAARAEHAPL
FT                   EVIERLIRPALEEIGQLWEGGDCALSQIYMSGRICEELLEDLLGEVLADDPPAPENAPP
FT                   RLAIAVLEDYHLLGKQIVRTVLRAAGYQVHDYGRQDVETLVELVRSDGIEVLLISTLML
FT                   PAALRVRALVERLRAVAPNVRVVVGGAPYRFDDQLWREVGADAVGLSAGDILAILERLE
FT                   VKP"
FT   gene            564272..564356
FT                   /locus_tag="Alvin_R0011"
FT                   /note="tRNA-Leu1"
FT   tRNA            564272..564356
FT                   /locus_tag="Alvin_R0011"
FT                   /product="tRNA-Leu"
FT   gene            564450..565352
FT                   /locus_tag="Alvin_0488"
FT   CDS_pept        564450..565352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0488"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: tgr:Tgr7_0128
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61445"
FT                   /db_xref="GOA:D3RNT5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT5"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ADC61445.1"
FT                   /translation="MSVPELKVQIPSPTRWRDRLYNYYLLVRLHRPIGIFLLMWPALWA
FT                   LWLAGAGQPHWSVVLIFVLGVVLMRSAGCAINDYADRHFDGHVARTNQRPLATGQVTPR
FT                   EAIGVFMVLSLIAFALVLQLNWQTIALSFVALALTFVYPFMKRFTHVPQLFLGAAFGWA
FT                   IPMAFAAITGTIPFYAWVLFVATLIWALIYDTQYAMVDREDDLKIGIKSTAILFGRWDR
FT                   LTIGLLQILMLGLLVWIGEETGRGVFYQIGLLAAAALAVYQQYLIRQRDPSLCFQAFLN
FT                   NNYFGMAVFIGLVLDYAVA"
FT   gene            complement(565353..565904)
FT                   /locus_tag="Alvin_0489"
FT   CDS_pept        complement(565353..565904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0489"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   tmz:Tmz1t_0670 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61446"
FT                   /db_xref="GOA:D3RNT6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT6"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADC61446.1"
FT                   /translation="MKLDPQTYAAVAGRAECLATADDMDAALDRMAADLTARLADKDPL
FT                   VLCVMTGATVVAGLLLPRLDFQLRLDYIHASRYQGATRGGELGWRHRPSEAIRGEHVLV
FT                   LDDILDEGITLEQIVRACQEDGAASVTTAVLVEKEREHACEADVVGIRVPDRYLYGYGL
FT                   DYKNYFRNAPGIYAVADVDF"
FT   gene            complement(565901..566983)
FT                   /locus_tag="Alvin_0490"
FT   CDS_pept        complement(565901..566983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0490"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: nmu:Nmul_A1761 beta-hexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61447"
FT                   /db_xref="GOA:D3RNT7"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR022956"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT7"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ADC61447.1"
FT                   /translation="MPLGPIMLDLAGTALDAEDRELLRHPAVGGVILFARNYESPEQLA
FT                   ALTAAIHAVREPALLIGVDQEGGRVQRFRDGFTRLPPAGRLGRLHRERPAQARAVCESI
FT                   AWLMAAELRAVGVDFSFAPVLDLDRGISRVIGDRGFSPDAQAVGELASSWMRGARQAGM
FT                   ASVGKHFPGHGGVEADSHTELPRDERPFVDLELEDLAPFRRLIDQGLEAMMPAHVIYPC
FT                   IDPRPAGFSPVWLRQILRQQLGFQGVIFSDDLNMEAAGAGGDHVERAQAAVAAGCDMLL
FT                   ICNNRPAAVATLAAFRDHRDPATSLRLLRMRGRKPLDRVRLHESPEWHRALGHIAELES
FT                   HDSLELPLEDPTTPEPRTKP"
FT   gene            567244..569163
FT                   /locus_tag="Alvin_0491"
FT   CDS_pept        567244..569163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0491"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="5.6.1.1"
FT                   /note="KEGG: mca:MCA1848 cell division protein FtsH;
FT                   TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61448"
FT                   /db_xref="GOA:D3RNT8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT8"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADC61448.1"
FT                   /translation="MNAKILNILLWIAVTFWLVMMLNSLTTSEQIEARNLSYSQFLQEL
FT                   SSGAVQEVTIQDETIKGVRSDGSRFETYDPGDPGLVGDLLKHDVVIRAKPPEQPSVFMQ
FT                   LVAAWLPFIVLAGIWIWFMRRSSGGGTGGLFNFGKSRARQHAEGEVRVTLRDVAGVEEA
FT                   KEEVGELVDFLRNPQKFSNLGGRIPRGVLMVGPPGTGKTLLARAIAGEAKVPFFSISGS
FT                   DFVEMFVGVGASRVRDLFEQAKKSAPCIIFIDEIDAVGRKRGAGLGGGHDEREQTLNQL
FT                   LVEMDGFTGSEGVIVIAATNRADVLDPALLRPGRFDRQVVVGLPDLAGRAAILEVHMRK
FT                   VPIAEDVDARTIARGTPGFSGADLANLVNEAALFAARSGREDVGMDMFEKAKDKIMMGA
FT                   ERRSIVMSESEKKLTAYHEAGHAIVGRLVPEHDPVHKVSIIPRGRALGVTLFLPERDRY
FT                   SMSKRQLESQISSLFGGRLAEEMIFGPEQVTTGASNDIERATDIARNMVTRFGLSDTMG
FT                   PLAYAEDEGEVFLGRSVTQQRQVSPETALAIDQAVRDIIDRNYQRTKQILEEQLDKLHT
FT                   MAEALLTYETIGKDQIDDIMAGRPMRVPDEHGGGRPTTKTDGGSGATQGKGAPGQPPIA
FT                   IGGV"
FT   gene            complement(569275..569505)
FT                   /locus_tag="Alvin_0492"
FT   CDS_pept        complement(569275..569505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61449"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNT9"
FT                   /inference="similar to AA sequence:KEGG:MCA0044"
FT                   /protein_id="ADC61449.1"
FT                   /translation="MFLKHRATGKLVEVLSQRDLLNPMHAVVIGRYHAGEELQDPERFE
FT                   KADLAFTSDEALPRCWTDVHYRDESAHHAYR"
FT   gene            complement(569598..569837)
FT                   /locus_tag="Alvin_0493"
FT   CDS_pept        complement(569598..569837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0493"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: mca:MCA0260
FT                   toluene-tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61450"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU0"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ADC61450.1"
FT                   /translation="METEAVAQRIRAGLPGAEVQVTGDGEHFEAVVVSDAFEGLSLIKR
FT                   ERLVMETVREQVASGELHALSIKARTPAQQAAQG"
FT   gene            complement(569869..571449)
FT                   /locus_tag="Alvin_0494"
FT   CDS_pept        complement(569869..571449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0494"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   mca:MCA1990 peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61451"
FT                   /db_xref="GOA:D3RNU1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU1"
FT                   /inference="protein motif:TFAM:TIGR00503"
FT                   /protein_id="ADC61451.1"
FT                   /translation="MTELLEQLSKRRTFAIISHPDAGKTTLTEKLLLFGGAIQLAGTVK
FT                   GRKAARHATSDWMELEKERGISVTSSVMQFPYGEAIVNLLDTPGHEDFSEDTYRTLTAV
FT                   DSALMVIDVAKGVEERTIKLMDVCRLRDTPILTFVNKLDREGRDTIEILDEIESVLKIQ
FT                   CAPVTWPIGMGKRFKGVYDLRTGRTHLFTAQHGGKVVEGEIIEGLYNPRMDEVLGDQAQ
FT                   ELREELELVEGASHPLDLDAYLAGRQTPVFFGSAINNFGVRELLDAFVSYAPPPRARET
FT                   RQRTVDPGESAFTGFVFKIQANMDPAHRDRVAFMRVCSGSYKKGMKMRHARIGKSIQVA
FT                   NAITFQADERRHVEEAWPGDIIGLHNHGTIQIGDTFTEGEDLKYEGIPYFAPELFRRVV
FT                   LRDPLRMKALQKGVLQLSEEGATQSFRPLKNNDLILGAVGVLQFDVAAYRLKAEYGVDA
FT                   VVEAVSVKTARWIQCDDPKILERFKEKCYEHLALDGDDQLVYLAPTMVNLSLAEERWPE
FT                   VRFLATREL"
FT   gene            complement(571512..572918)
FT                   /locus_tag="Alvin_0495"
FT   CDS_pept        complement(571512..572918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0495"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: maq:Maqu_0490 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61452"
FT                   /db_xref="GOA:D3RNU2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU2"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ADC61452.1"
FT                   /translation="MSDSNSSAKPWAGRFNAPTDAFVEAFTASVDFDRRLYRYDIQGSI
FT                   AHATMLARQGILTEAERDAIVTGLERVRARIDAGEFAWSIPLEDVHMNVESALTADIGD
FT                   AGKKLHTGRSRNDQVATDVRLWLRDEIDTIRTEIVRLQTALLDLAEREADTILPGFTHL
FT                   QVAQPITFGHHMLAWFEMLERDRERLADCRRRMNVLPLGAAALAGTTYPIDRHYTAELL
FT                   GFDRPAENSLDAVSDRDFAIEFTADAAILMMHLSRFSEELILWSSAQFGFVELSDSFCT
FT                   GSSIMPQKKNPDVPELVRGKSGRIFGHLMGLLTLMKSQPLAYNKDNQEDKEPLFDTVDN
FT                   LKGSLKVYADMMAHVTCNRDRMRAAAKQGFSTATDLADYLVRRGIPFRDAHEIVGKAVA
FT                   LGVREGRDLAELTLAELRQFSDAIGEDVFAVLTLEGSVAARDHIGGTAPAQVRAAIARG
FT                   RRRLNGAGES"
FT   gene            573011..573781
FT                   /locus_tag="Alvin_0496"
FT   CDS_pept        573011..573781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0496"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: hna:Hneap_1047
FT                   UBA/ThiF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61453"
FT                   /db_xref="GOA:D3RNU3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU3"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADC61453.1"
FT                   /translation="MTDDDLLRYSRQILLPQFGIEGQERLRESSVLVVGLGGLGSPVAL
FT                   YLAAAGVGRLLLADFDRVDLSNLQRQILHTTDRIGLAKTESARRALQAIAPNVELIPVE
FT                   VPLTSETLPELVGDVDLVVECSDNFATRFAVNAACRAACVPLVSGAAIRLEGQVTAFSG
FT                   QPGGPCYRCLYPDEGTIDETCTANGVLAPLVGIIGSVQAAEAIKILTGLGVPLFGRLLL
FT                   LDASRMEWREVRLRPDPACPVCAESAGISAPTAP"
FT   gene            573792..574301
FT                   /locus_tag="Alvin_0497"
FT   CDS_pept        573792..574301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vok:COSY_0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61454"
FT                   /db_xref="GOA:D3RNU4"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61454.1"
FT                   /translation="MSIHCDVSPNEIKQANIPHELFLSNLVGNHILMAVALGGIFGSAP
FT                   WAMMIVPLVSFGILGYTLWRARQSRRRDSWYVMCHWQVCARRSRIFMAMLGLLLVVAGL
FT                   GWLGYANGLMIKEAAIALVIGIGILPMMVTLLVLVMIESDALYHANQAKLPAWVMARFP
FT                   RPDACP"
FT   gene            574364..575101
FT                   /locus_tag="Alvin_0498"
FT   CDS_pept        574364..575101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0498"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="KEGG: tgr:Tgr7_1751 methylthioadenosine
FT                   phosphorylase; TIGRFAM: methylthioadenosine phosphorylase;
FT                   PFAM: purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61455"
FT                   /db_xref="GOA:D3RNU5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU5"
FT                   /inference="protein motif:TFAM:TIGR01694"
FT                   /protein_id="ADC61455.1"
FT                   /translation="MGLLAIIGGSGFTSLPSLTQIESKPVETPYGATSAPVTRGRLAER
FT                   EVLFLPRHGPSHHLPPHRINYRANLWALRASGADRVIGLAAVGGITPSFGPCVLAVPDQ
FT                   IIDYTHGREHTIHDGITGGVDHIDFTEPYCESLRQVLISACARVGEAVVPRGTYAATQG
FT                   PRLESAAEIQRHERDGCDMVGMTGMPEAGLARELDLCYASLAFVVNWAAGKSGNVITMK
FT                   EIEENLALCVERVLTVLETVAAD"
FT   gene            575192..576025
FT                   /locus_tag="Alvin_0499"
FT   CDS_pept        575192..576025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10507 gene product from transcript
FT                   GH10507-RA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61456"
FT                   /db_xref="GOA:D3RNU6"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61456.1"
FT                   /translation="MASSEEKSSSRSGLGWFPKLILWAAVIGFGYVYLSSVDREGGGTT
FT                   ASSMLDSIAKLSPVSLSSLPGFSDKEESAADPVEVAQGDEALKTEAAKPVAQTESAAFA
FT                   RSLANDKPEPSAEAPKSVPQPPVSYATAALKVPAESASVPAEAPAPAPAPVAPTVSATA
FT                   EPPASAPVAAAPSMPAPSAAQPAPMSPSVMPAPGERAPMTRMPASEWMAQREQQRAEMM
FT                   AQYEAMRREADERMRQYWGQMREAMPMHGVPYAHPGYAPGYMPGYAPGVYGPPVR"
FT   gene            576352..576807
FT                   /locus_tag="Alvin_0500"
FT   CDS_pept        576352..576807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0500"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   pag:PLES_51311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61457"
FT                   /db_xref="GOA:D3RNU7"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU7"
FT                   /inference="protein motif:PFAM:PF02576"
FT                   /protein_id="ADC61457.1"
FT                   /translation="MQPADSQLTLLARRVVEPLGYELVGVEYFQKGGGATLRVYIDHER
FT                   GITLDDCTAVSHQLSGVLDVEDPISDQYDLEVSSPGLDRPLVFPEHFERFAGSRVRIRL
FT                   SEKIEGRRKLEGVLLGVVPGGVALRADERDWEIPLTSIDSARLIPEF"
FT   gene            576885..578384
FT                   /locus_tag="Alvin_0501"
FT   CDS_pept        576885..578384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0501"
FT                   /product="NusA antitermination factor"
FT                   /note="TIGRFAM: transcription termination factor NusA;
FT                   PFAM: NusA domain protein; RNA binding S1 domain protein;
FT                   KEGG: hha:Hhal_1750 transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61458"
FT                   /db_xref="GOA:D3RNU8"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU8"
FT                   /inference="protein motif:TFAM:TIGR01953"
FT                   /protein_id="ADC61458.1"
FT                   /translation="MSKEILNVVEAVSNEKDVPEGVIFEAIEAALASATRKKHGGEIDV
FT                   RVTIDRKTGSYRTFRRWEIVSDPESGMLEAPARQITASAAAILEPELSIGDFMEEEIES
FT                   ELFGRIAAQTAKQVIVQKVRDAERAKIVDAFASRQGQLVTGIVKKAERGTILLDLGNNA
FT                   EALVPRDHVIPRESVRPGDRLRGYLYDVRSEQKGPQLFVSRTAPELLIELFKLEVPEVG
FT                   EGLIEILGAARDPGVRAKIAVRTRDPRIDPVGACVGMRGSRVQAVSNELNGERVDIILW
FT                   DENPAQFVINAMSPADVVSIVIDEEARSMDVAVKEENLAQAIGRFGQNVRLATQLSGWE
FT                   LNVMNEKDAAAKSEQEARRSAQVFMDQLGIDEGLATLLVEEGFSSVDEVAYVPLDEMRA
FT                   IDELDDETIELLRERANDVLVTRAIATEEVDEVGGMSLSALEGMDEALVEVLAERGIAT
FT                   LDDLADLAVDDLMEIEGMDEERAARLIMKAREPMFANAPEE"
FT   gene            578403..581174
FT                   /locus_tag="Alvin_0502"
FT   CDS_pept        578403..581174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0502"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; translation initiation factor IF-2 domain
FT                   protein; elongation factor Tu domain 2 protein; Initiation
FT                   factor 2 associated domain protein; KEGG: tgr:Tgr7_1003
FT                   translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61459"
FT                   /db_xref="GOA:D3RNU9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNU9"
FT                   /inference="protein motif:TFAM:TIGR00487"
FT                   /protein_id="ADC61459.1"
FT                   /translation="MSEVTVKQLASTVGIPVERLLTQLKDAGISAGDADSKLTEQEKVQ
FT                   LLAYLRRSHGKDEGEADGGPGQVTIKRKSVSELRVPQAAAPRSNTPNSRPAPAARGGGK
FT                   TVSVEVRRKRTYVKRADEPATGTTPAPRRQSNDRSRAGRERAAATSAVIDESRRRAALE
FT                   AMRAEQEARRLAEQEEQERRAREEEARLEEERRQAAEARRRAEEEARQQAEREAAERQA
FT                   RGVTEEPSAEATAEAGEAETETPARRAEAAKPKKAAKKAAEPVEKEKEKEKDRPAKKVV
FT                   RKETAPVRVRDIAVAGRGEYEDIDGPGGGRGPRRRKKSSKPQLQDKHAFQKPTAPVVRE
FT                   VEIPEAITVAELANRMSVKASVVVKELFKQGMMVTINQNLDRDTAILVVEEMGHKAVVA
FT                   DERDAEGTLLDEMQEQEGQFEALPRPPVVTIMGHVDHGKTSLLDYIRRTRVASGEAGGI
FT                   TQHIGAYHVETDKGTVSFLDTPGHAAFSAMRARGAKVTDIVILVVAADDGVMPQTVEAI
FT                   HHARAAGVPLIVAINKMDKPEANPDKVMQELTQYEVLTEEWGGDTMMVKVSAKAGLGID
FT                   ELLDAILLQAEVLELKAPVEGPARGAIVESSLDKGRGPVATVLVQSGTLKRGDIIVSGG
FT                   EYGRVRAMFDESGSPVESAGPSIPVQVLGLSGTPNAGDDVITVSDERRAREVAEFRAAR
FT                   SRQNRFDEQRGVSLDQLFTQLKDGEQKAVNLILKADVQGSLEALRESLLKLTNDEVKVA
FT                   IVASGVGGITESDANLAVTSNAILLGFNVRADAAARRVVEEKGLDLRYYSIIYELIDEV
FT                   KQAISGLLSPIVTEEIIGLAEVRDVFRSSKFGAVAGCMVVEGVIKRNNPIRVLRNNVVV
FT                   YEGALESLRRFKDDVAEVKHGMECGIGVKNYNDVQPGDQIEVFERTEKARVL"
FT   gene            581171..581554
FT                   /locus_tag="Alvin_0503"
FT   CDS_pept        581171..581554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0503"
FT                   /product="ribosome-binding factor A"
FT                   /note="TIGRFAM: ribosome-binding factor A; PFAM:
FT                   ribosome-binding factor A; KEGG: pfs:PFLU5252
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61460"
FT                   /db_xref="GOA:D3RNV0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV0"
FT                   /inference="protein motif:TFAM:TIGR00082"
FT                   /protein_id="ADC61460.1"
FT                   /translation="MNEREFDRTERIGAEMKRALAVLVRDQVKDPRLANITVHEVRVTR
FT                   DLAHAKVYFTCFPSDEDTPAQERLLNKQLAGFLRHALAQEVRLRAMPQLHFVYDESIAQ
FT                   GQHLSDLIEQAVAKDRPATEEEH"
FT   gene            581559..582476
FT                   /locus_tag="Alvin_0504"
FT   CDS_pept        581559..582476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0504"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; tRNA
FT                   pseudouridine synthase B; KEGG: tgr:Tgr7_1005 tRNA
FT                   pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61461"
FT                   /db_xref="GOA:D3RNV1"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV1"
FT                   /inference="protein motif:TFAM:TIGR00431"
FT                   /protein_id="ADC61461.1"
FT                   /translation="MGRRRNSGRPVTGILLLDKPLGLSSNEALQRVKRYYRAAKAGHTG
FT                   SLDPLATGLLPCCLGDSTKFSAFLLDADKRYRVRVRLGETTATGDAEGEVLERAPIDGV
FT                   TEARLREVLADFLGPIDQLPPMYSAVKHQGQRLYELARQGLEVERQPRRIEIHALELLS
FT                   MELPEIELDVHCSKGTYVRTLAEDIGRELGCGAHVSALRRTGVGPYAEPDVSFVTGEQI
FT                   AALAEAEDFAALDALLLPLDSALGHCPALKLSADTAFYLGQGQAVQVPQAPTEGLVRLY
FT                   DPSSHFLGVGEIRDDGKVQPKRLI"
FT   gene            582593..582862
FT                   /locus_tag="Alvin_0505"
FT   CDS_pept        582593..582862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0505"
FT                   /product="ribosomal protein S15"
FT                   /note="TIGRFAM: ribosomal protein S15; PFAM: ribosomal
FT                   protein S15; KEGG: csa:Csal_3071 SSU ribosomal protein
FT                   S15P"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61462"
FT                   /db_xref="GOA:D3RNV2"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV2"
FT                   /inference="protein motif:TFAM:TIGR00952"
FT                   /protein_id="ADC61462.1"
FT                   /translation="MTMTAADKKKVVDEYARGERDTGSPEVQVALLTARILELTDHFKE
FT                   HKQDHHSRRGLVRMVNSRRKLLDYLKRKDLDRYRDLIARLGLRR"
FT   gene            583058..585157
FT                   /locus_tag="Alvin_0506"
FT   CDS_pept        583058..585157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0506"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="KEGG: tgr:Tgr7_1007 polyribonucleotide
FT                   nucleotidyltransferase; TIGRFAM: polyribonucleotide
FT                   nucleotidyltransferase; PFAM: 3' exoribonuclease;
FT                   Exoribonuclease, phosphorolytic domain 2; Polynucleotide
FT                   phosphorylase, phosphorolytic RNA-binding,
FT                   bacterial/organelle-type; K Homology, type 1, subgroup; RNA
FT                   binding S1 domain protein; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61463"
FT                   /db_xref="GOA:D3RNV3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV3"
FT                   /inference="protein motif:TFAM:TIGR03591"
FT                   /protein_id="ADC61463.1"
FT                   /translation="MIPTPIVKEFQFGNQTVRLETGEIARQADGAVLVNMDDTVVLVTV
FT                   VVDKRPGAERDFLPLTVEYQEKTYAAGRIPGGFFRREGRPSEGEILTARLIDRPIRPLF
FT                   VEGFCNEVQIIATVKSLNPAVNPEVPALIGASAALALSGAPFNGPIAAARVGYKNGEYI
FT                   LNPALTGLNPDSDLDLVVAGTDKAVLMVESEARGLSEEIMLGAVLFGHEQMQVVIQAIR
FT                   ELAAEAGKPAMDWTPHAVNPVLTEAVRLAGGDAIAAAYRIKEKQARYTALGAARTAIVE
FT                   QLCAGETPAWTESQVKAAIEALESTTVRESILAGEPRIDGRDTKTVRPITIRTGVLPRT
FT                   HGSALFTRGETQAMVITTLGTERDSQIIDALEGERREHFMLHYNFPPFCVGEIGRVGSP
FT                   KRREIGHGRLAKRGVLAVMPSIEEFPYSVRVVSEITESNGSSSMASVCGTSLALMDAGV
FT                   PIKAPVAGVAMGLIKEGERFAVLTDIMGDEDHLGDMDFKVAGTADGINALQMDIKIEGI
FT                   TREIMEIALAQAKEGRLHILGEMNKVIDSHRVEMSEHAPRIIEIKIHPEKIRDVIGKGG
FT                   SVIRAITEETGATIDINDDGVVKIFSVVKAAGEEAKRRIRLITADVEVGKVYEGKVARL
FT                   MDFGAFVTILPGRDGLVHISQICEERVQSVSDKLKEGDVVRVKVLEVDKQGRIRLSMKA
FT                   VEPGE"
FT   gene            585335..585748
FT                   /locus_tag="Alvin_0507"
FT   CDS_pept        585335..585748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0507"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="PFAM: transcription elongation factor GreA/GreB
FT                   domain protein; KEGG: net:Neut_2081 GreA/GreB family
FT                   elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61464"
FT                   /db_xref="GOA:D3RNV4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV4"
FT                   /inference="protein motif:PFAM:PF01272"
FT                   /protein_id="ADC61464.1"
FT                   /translation="MSSQPKIILSSLDAERLENLIESLPRNAFPGMDELEAELARAEVV
FT                   DPREMPPNVVSMNSTVRFRVMSTNEAFTLTLVYPKDMDASGGKISILAPVGSALLGLSS
FT                   GDEIEWPKPGGGVLRVRIEEVTYQPERAGEYFR"
FT   gene            585830..587305
FT                   /locus_tag="Alvin_0508"
FT   CDS_pept        585830..587305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0508"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: glo:Glov_0647 protein of
FT                   unknown function DUF404"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61465"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV5"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADC61465.1"
FT                   /translation="MLKSFQAGGTRWSDAQAERPAAAYHEFYRDDFQPREHYLPLWKHI
FT                   QRAGQRGLALKAREAHLALHNEGVTFTLYSDQESGIERVWPFDILPRLVTAGEWTPIEA
FT                   GLKQRIRALDRFIHDVYHEQCILKDGVVPPELIYRGRDLCRDILDVDPPGGVYIHISGV
FT                   DLIRDESGRYLVLEDNLRTPSGVSYMIENRLIERRILPEFFQRYRVRPVEHYPERLLQR
FT                   LRQLSPRGAADAVVVVLTPGIFNSAYFEHSFLAREMGVELAEGRDLVCRNDRVYLKTTL
FT                   GLRQVDVIYRRIDDDYLDPLVFRPDSLLGVPGIIRAWRAGHVALVNAPGTGIADDKAVY
FT                   AYVPDIIRYYLGEEPILPSVPTYQMTDPQDRDYVLDNLERMVIKAVSESGGREMLMGPT
FT                   STAGQRDDFTRRIQADPRRYIAQPVIQLSRHICYLDGELESRHLDLRPFVLHGGDEIEV
FT                   IPGGLTRVALTKGSLVVNSSQGGGSKDTWVLAD"
FT   gene            587320..588270
FT                   /locus_tag="Alvin_0509"
FT   CDS_pept        587320..588270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0509"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   glo:Glov_0646 protein of unknown function DUF403"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61466"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV6"
FT                   /inference="protein motif:PFAM:PF04168"
FT                   /protein_id="ADC61466.1"
FT                   /translation="MLSRIAESLYWMARHLERADNTARVLDINVVHRLAAEEGLTEEGQ
FT                   WLPLLTILGADDRYAETYPDGRVSVQRVIRLLTQAETNPGSILNCLRLARENARAARDR
FT                   ISTPVWETIDALCRTAEARLKATLPPWQAAEFHAFVHREVATVYGLAQGTMMRGEAHSF
FT                   TRFGALQERADMTARILDVRYHLLLPDPSLVGSPLDYYQWGVLLKSLSGFDAYRRLYQA
FT                   GVRPVDVIDFVILNPDFPRSLVYCVSRLERSLERIGQRPEGEVGACLERLRAHLAGVGA
FT                   ADIMAQGLHEYLDAFLTALLELSDALTRDYFNHDV"
FT   gene            complement(588308..588730)
FT                   /locus_tag="Alvin_0510"
FT   CDS_pept        complement(588308..588730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0510"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein
FT                   DNA-binding domain protein; KEGG: pmx:PERMA_0919 repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61467"
FT                   /db_xref="GOA:D3RNV7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV7"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ADC61467.1"
FT                   /translation="MSSTESTIRFTVSLPKTLLDELDRRLVNKGYASRSELVRDLIRER
FT                   IVEETWERGDAEVAGVLTIVYDHHQRELTQQILDIQHRQYVHVVATTHVHLDHHNCLET
FT                   IIIRGMPAEIERLSLEIGGLRGVRFAELTRASKVEH"
FT   gene            588896..590581
FT                   /locus_tag="Alvin_0511"
FT   CDS_pept        588896..590581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0511"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   mca:MCA1687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61468"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV8"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ADC61468.1"
FT                   /translation="MSTPDPTLIGRVIDIQGGRLIATLFPAEDGFPAAKTLEDESLPVG
FT                   QLGTLVEVRDRAGHILAEIARSHEEAVGTRAVKGEANAAPRQVTVRERRLELTALGEIN
FT                   GDGRLEPGVSRYPVVGASVHLIPTSRLAVLLARRTQVALELGRLSVRPALKATLEPTAL
FT                   FGRHLAILGQSGAGKSWTLSSLMQRVVKTMPHAHIILLDLHGEYGWKRPDGTTEGIFPP
FT                   GTARYLDARELEIPYWLLTYSELVDLFVDRADANASLQIAFLRETVYALRKQSNQHAGI
FT                   DRLSVDSPVYFPIDELYQRFKKANEEKLEFGKVKGPLFGAFDDFLVRFLSLYNDGRYDF
FT                   FMHPRKNKSSASLEGLLRDFVGLGEPKRQVTVIDLSPVPVDLRPVISAQIGRLAYEFNY
FT                   WNPRRHEFPLLLVCEEAHQYIPRESDTRFVGTRRSMERIAKEGRKYGVTLCIVSQRPTE
FT                   LSETVLAQCGNYLCLRISNADDQEYVRRLLPEGAKNLADRLASLRRGEVLAVGDAALLP
FT                   TRIQVDRPDPPPSSSDAPFSQSWMEGPEDLDVNDIIDRWWRQVR"
FT   gene            590578..591060
FT                   /locus_tag="Alvin_0512"
FT   CDS_pept        590578..591060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_3420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61469"
FT                   /db_xref="GOA:D3RNV9"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNV9"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_3420"
FT                   /protein_id="ADC61469.1"
FT                   /translation="MNDENSRRRVWLWLGLGSILGLGAILVIVQAVWPVLYPSASHVAP
FT                   LDLRCDLRAGPCESRFGGGRVRFGIEPRTLPVAAPLRLEVELSGLTAEAVEVDFVGVEM
FT                   YMGFNRVALESLGEGRYAGHGMIPVCTSERMTWEARVLIHTPDGLLAAPFRFESAP"
FT   sig_peptide     590578..590673
FT                   /locus_tag="Alvin_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.712) with cleavage site probability 0.700 at
FT                   residue 32"
FT   gene            complement(591082..591840)
FT                   /locus_tag="Alvin_0513"
FT   CDS_pept        complement(591082..591840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0513"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsq:Rsph17025_3433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61470"
FT                   /db_xref="GOA:D3RNW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC61470.1"
FT                   /translation="MTTPLIELQRVRFDYHDRTVLRELDFRLAPGDRVALIGSNGAGKT
FT                   TLLHLLVGLKRPSAGRILAFGCERASERDFHQVRARVGLLFQDSDDQLFCPTVLEDVAF
FT                   GPLNLGRSPEQARADALETLEHLGLADFAERITYRLSAGEKRLVALATVLAMRPEVLLL
FT                   DEPTNGLDEATAERLIAHLDGLEQAMILVSHDWPFLARLATRAVRLVEGRLVDAILHSH
FT                   AHAHRHSHPHPHAADELTGTHTGLEHRHPH"
FT   gene            complement(591884..592657)
FT                   /locus_tag="Alvin_0514"
FT   CDS_pept        complement(591884..592657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0514"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   rpe:RPE_1968 cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61471"
FT                   /db_xref="GOA:D3RNW1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW1"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADC61471.1"
FT                   /translation="MTAAPIPHLAGSGWIVARDPRLRVGAALAFALITVGLDHPGSTAT
FT                   ALGLALGLALAAGLKARDLVRRLLALEGFMLILVLTLPFTTPGASWFELGSLRASTAGR
FT                   DLALMILLKANAVVLALMALVGTLEPVALGQALGRLGVPDKLTHLLLMTIRQIHLIHAE
FT                   FIRLRQAMRARAFVPRTDRHTWRAYGWLMGMLLVRSLARAERLMDAMRCRGFRGRLYRL
FT                   DTPHWQPGDTLAALSLMILLGALAWLDHDLGLPGV"
FT   gene            complement(592654..593277)
FT                   /locus_tag="Alvin_0515"
FT   CDS_pept        complement(592654..593277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_1969 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61472"
FT                   /db_xref="GOA:D3RNW2"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW2"
FT                   /inference="similar to AA sequence:KEGG:RPE_1969"
FT                   /protein_id="ADC61472.1"
FT                   /translation="MSRTASVWLLLLALMSQPALAHKLKVFAQTEGDWIRGRAYFVGGA
FT                   GAGGARVEIQDSEGRVLAELTPADDGSFAYRTLAPVEHRLVARTGDGHSAQWTIAGETR
FT                   QGAFSPPADPRDDSGPPPTQPPADAPAPTAPLDHAPVAPQTIDPALIGAIEQALARQTH
FT                   PLAERLNTLEERVRFQDVLGGIGYILGLTGLALWWRCRRAGERA"
FT   sig_peptide     complement(593212..593277)
FT                   /locus_tag="Alvin_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(593270..593890)
FT                   /locus_tag="Alvin_0516"
FT   CDS_pept        complement(593270..593890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0516"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: dvl:Dvul_1936 cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61473"
FT                   /db_xref="GOA:D3RNW3"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW3"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ADC61473.1"
FT                   /translation="MAHIPEGVLTAPVLIAGGLVSVGLLAVALRRLDYDHLPRAAVLSA
FT                   ALFVSSLISVPLGPTSVHLLLNGLMGLLLGWTAVPAILVALALQAAFFGFGGPLVLGVN
FT                   TLNMALPALVCALVLAPALGRVRPARRAWIGFAAGFLGVMLTGGLVAATLVLSGEPFRP
FT                   AAQVLLLTYPPLALVEGLVTATIVGFLQRVAPEMLSTGARSHV"
FT   gene            complement(593916..594689)
FT                   /locus_tag="Alvin_0517"
FT   CDS_pept        complement(593916..594689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0517"
FT                   /product="Nickel transport complex, NikM subunit,
FT                   transmembrane"
FT                   /note="PFAM: Nickel transport complex, NikM subunit,
FT                   transmembrane; KEGG: rpc:RPC_1952 ABC-type Co2+ transport
FT                   system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61474"
FT                   /db_xref="GOA:D3RNW4"
FT                   /db_xref="InterPro:IPR019613"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW4"
FT                   /inference="protein motif:PFAM:PF10670"
FT                   /protein_id="ADC61474.1"
FT                   /translation="MHNPRPLRHFAWLALLGTLSAQAHFQELIPSTDLVTEPGESEIRL
FT                   DLTFTHPMERGPAMAMGRPVQFGVLTPAGREDLLATLTTRTQDDQPAYSARYRIGQPGD
FT                   HVFFVEPAPYWEPAEGVMIVHYTKVVVDGFGGGEGWDAEVGFPVEITPLTRPYGLWTGN
FT                   LFSGVVKRNGRPVPFAEVEVEWHNDGSVTAPADAFVTQVVKADAQGVFAYAMPRAGWWG
FT                   FAALLEGERPMKNPEGEEVPVETGALIWVHARDMK"
FT   sig_peptide     complement(594618..594689)
FT                   /locus_tag="Alvin_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.917 at
FT                   residue 24"
FT   gene            complement(594768..595130)
FT                   /locus_tag="Alvin_0518"
FT   CDS_pept        complement(594768..595130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100011973"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61475"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61475.1"
FT                   /translation="MAKQFQKTSVQFDSDLDAILDRVYGKTSDSTFDPARAAIPPSFTR
FT                   NDQGSKELKEALAELRNRRERAQGSMRLLQMQEEIDYLRERIGLLRDLGNQIDHLHQRI
FT                   AAEGDQGHSSMLSAAG"
FT   gene            complement(595254..596714)
FT                   /locus_tag="Alvin_0519"
FT   CDS_pept        complement(595254..596714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0519"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: hypothetical
FT                   protein LOC690110"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61476"
FT                   /db_xref="GOA:D3RNW6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW6"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADC61476.1"
FT                   /translation="MDKTETAQPDSSSQTAATTDTDGATSPAQASGGAERSTNAGEVLQ
FT                   RYLKAQATQISRIVASLNQYRQDVQKLEVSLIARIGDVDDDRRHAATRLQRTLQTQRDD
FT                   LDERLKRHGSLMAMLLLLFSLLVAGTLVFFLFKLNATQEAFETQMTDLKKTLEQIDVSS
FT                   RQEPDPQTRAQLDRLSAALAEISKSIERLDEEAPPGLDLDLRLQPEPKSEPEPAPEPKP
FT                   QPESAPEPATEPESTPESAPAPDPSSDPETPPSTESESESAPASEPESERPAEAAPTPP
FT                   EPVTPPSEPETESAPAPESVTELEQTADTLTLDETGSALEAPDISADDAEPSPVPTAAP
FT                   ETESGESAPDRPVTAPEPTPAPEAAIAPDAQTDQTDTAVDGLRSSSLATHPVQVGDRPF
FT                   TVQLIGFHSLEALEGFAADHVLPVVYYYRQETYQGRPWFVLIHSLHETQEAAEAVVARL
FT                   PPALANLNIWIRRLKSDTELIEVRRLGS"
FT   gene            complement(596854..597747)
FT                   /locus_tag="Alvin_0520"
FT   CDS_pept        complement(596854..597747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0520"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   nmu:Nmul_A0510 peptidase S1C, Do"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61477"
FT                   /db_xref="GOA:D3RNW7"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW7"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ADC61477.1"
FT                   /translation="MSAAPSHAPPTTDSAGRIGRKIHWATLLLAGSLLTACVTGPSPTG
FT                   TDSARFDPTSLIKAGPIPGSQGYPTLAPLLRRVTPAVVNITVDSRIPREEHPFLDDPDF
FT                   RHFLDRMGLPIPEIDPSERRRSQGSGVIVDAARGYVMTNDHLLKDATRIQVTLKDRRTF
FT                   EARRLGADSGSDLAILKIPPVSLRPLPLGDSDRLEVGDFVLAIGNPFGLGQTATLGIVS
FT                   AVGRSGVGGSRLGKLIQTDASINPGNSGGPLVNLAGEVVGINTALIGPTGGNVGIGFAV
FT                   PSNRARAALRAVTGRR"
FT   gene            complement(597760..598989)
FT                   /locus_tag="Alvin_0521"
FT   CDS_pept        complement(597760..598989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0521"
FT                   /product="peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /note="PFAM: peptidase S13 D-Ala-D-Ala carboxypeptidase C;
FT                   KEGG: tcx:Tcr_0793 peptidase S13, D-Ala-D-Ala
FT                   carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61478"
FT                   /db_xref="GOA:D3RNW8"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW8"
FT                   /inference="protein motif:PFAM:PF02113"
FT                   /protein_id="ADC61478.1"
FT                   /translation="MLSGARQPQPLTQMTAHRPHRLVLIAALWLGLAHTALADDPVAQV
FT                   RALPQASLLVKERGQDRIAYQAETARIPASTMKLLTAYAALETWGRDHRFHTDVFQDAS
FT                   GWLWVKGAADPYLVSEELDRLVAALKRQGVRRVAGIGLDDSLFDPDVEIAGRSSSSNPY
FT                   DAPVTALAANFNTLNLIREGERIRSAEPQTPLTATGERLGRSGAAGKQRINLREREIAL
FT                   RYFGELLAAKLRAADIEVGDPQRIAPTPSDAKRILRHANSRTLAEMVAPMLEYSSNFVA
FT                   NALFLRLAAPDGQGRISMTQAKRTMTDFAQRRFGWTAFKIDDGAGLSRANRLSARQLVE
FT                   LLDAFAPYRDLMPQQDDDPNVRAKTGTLRGISSYAGYVRRGGAWEPFALLIEQPVAYDL
FT                   RRRVASQLAR"
FT   sig_peptide     complement(598873..598989)
FT                   /locus_tag="Alvin_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.919 at
FT                   residue 39"
FT   gene            complement(599057..599725)
FT                   /locus_tag="Alvin_0522"
FT   CDS_pept        complement(599057..599725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0522"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="KEGG: spl:Spea_1804 dethiobiotin synthase; TIGRFAM:
FT                   dethiobiotin synthase; PFAM: Cobyrinic acid ac-diamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61479"
FT                   /db_xref="GOA:D3RNW9"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNW9"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADC61479.1"
FT                   /translation="MSGFFITGTDTGCGKTEITLGLMAALQARGQRVLGMKPVASGCDQ
FT                   HPEGLRNADAERIQAQGTHAVPYALVNPYAFARPIAPHVAAAEVGISIELDRIRAAHTE
FT                   LTRQADWVLVEGVGGWRVPLGPDCFVGDIPRVLDLPVILVVGLKLGCLNHALLTAESIQ
FT                   SSGLQLAGWIANQVDPDMLAPEANLETLQTLIQAPCLGLAPWMAEPDAETIAACLHMGR
FT                   "
FT   gene            complement(599722..600597)
FT                   /locus_tag="Alvin_0523"
FT   CDS_pept        complement(599722..600597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0523"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11; KEGG: tgr:Tgr7_3013 biotin
FT                   biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61480"
FT                   /db_xref="GOA:D3RNX0"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX0"
FT                   /inference="protein motif:TFAM:TIGR02072"
FT                   /protein_id="ADC61480.1"
FT                   /translation="MHPIDKTRARLSFERAAADYDSVAVLQREIADRMLGRLDYIRLAP
FT                   QRILDLGAGTGYAIDPLARRYPKARVLALDFAHGMLLQARRRGSWWRRPLCVCADAESL
FT                   PLADGAVDLIVSNAALQWCNDLERTFSECRRVLRPGGLLLFTTFGPDTLKELRAAWSQV
FT                   DEHTHVSPFLDMHDIGDALVRARFADPVMDADRLTLTYDDVQGLMRDLKTLGARNATDA
FT                   RPRALTGRARLAALADAYETHRRDGRLPASYEVLYGHAWAPEPAEHRQTGGEVAIPLSA
FT                   IGGRRRAVEP"
FT   gene            complement(600630..601415)
FT                   /locus_tag="Alvin_0524"
FT   CDS_pept        complement(600630..601415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0524"
FT                   /product="bioH protein"
FT                   /note="TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase
FT                   fold; KEGG: tbd:Tbd_0321 BioH"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61481"
FT                   /db_xref="GOA:D3RNX1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX1"
FT                   /inference="protein motif:TFAM:TIGR01738"
FT                   /protein_id="ADC61481.1"
FT                   /translation="MSNQSAPPHTPTPETTADLVLLHGWGMNSAIWNGVPEPTWNGLTQ
FT                   HRIDLPGHGDSPFPTGRDDLWGWAEACLDAAPERAVWVGWSLGGLIALAAALHAPKRVA
FT                   GLILLTATPRFTQATDWTPAMPEATLAQFHDGLLADPSGTLNRFLALQTRGSDTARETL
FT                   RTLKQELAARPEPKPAALALGLDLLREEDLRPQLPDIRCPTLWLFGQHDTLVPARVAER
FT                   IELLMPEARVETIAGAAHAPHISHPHETGRAIRTFLDAL"
FT   gene            complement(601600..602778)
FT                   /locus_tag="Alvin_0525"
FT   CDS_pept        complement(601600..602778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0525"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: mca:MCA1126 8-amino-7-oxononanoate synthase;
FT                   TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61482"
FT                   /db_xref="GOA:D3RNX2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX2"
FT                   /inference="protein motif:TFAM:TIGR00858"
FT                   /protein_id="ADC61482.1"
FT                   /translation="MERPPSSRTNPETELRPRLDALKAQSLYRRRRLQDSPQQPQARVD
FT                   GRPMLSFCGNDYLGLANHPEVIAALRDGAERWGVGSGAAHLVNGHSRAHQALEEALAAF
FT                   TGRPRALLFSTGYMANLGVISALAGRTDTVFEDRLNHASLLDGALLSRARLRRYPHADA
FT                   QALKRLIDSDPARLIVTDGVFSMDGDLAPLPELATIARDSGAWLMVDDAHGLGVLGHEG
FT                   RGSLDHFGLGPEDVPILMGTLGKAFGTFGAFVAGSEELIETLIQSARSYIYTTATPPAL
FT                   AEATLASLAITRREHWRRERLTEWIERFRTGATRIGLNLMDSPTPIQPILAGSAEQALA
FT                   WSAALEAAGLLVTAIRPPTVPEGTARLRITLSAAHTADDIDRLLAALARLPT"
FT   gene            complement(602789..603832)
FT                   /locus_tag="Alvin_0526"
FT   CDS_pept        complement(602789..603832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0526"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: tgr:Tgr7_0131 biotin synthase; TIGRFAM: biotin
FT                   synthase; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: biotin and thiamin
FT                   synthesis associated; Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61483"
FT                   /db_xref="GOA:D3RNX3"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX3"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADC61483.1"
FT                   /translation="MSQIHTTAFQSPPALRHDWSLDEIEAILDQPFNDLLFTAQSVHRA
FT                   HFDPNTIQVSTLLSIKTGACPEDCGYCGQSARHATDVEPERILPLDTVLEAARTAKSQG
FT                   ATRFCMGAAWRNPTDRHLEQVIAMVEGIHALGLETCVTLGMLTAEQARRLKDAGLDYYN
FT                   HNLDTSPEFYGQVISTRTYQDRLDTLEHIRAVGLKTCSGGILGMGESRRDRASMLRQLT
FT                   NLPAHPESVPINLLVQVEGTPLFGVDALDPFEFVRVVAAARIIMPRSHVRLSAGRSEMS
FT                   DELQALCFLAGANSIFYGERLLTAPNAESDRDRRLFERLGLAFEQVEAERTEPGACHKT
FT                   TEHKIRL"
FT   gene            604013..604729
FT                   /locus_tag="Alvin_0527"
FT   CDS_pept        604013..604729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0527"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: tgr:Tgr7_0129
FT                   competence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61484"
FT                   /db_xref="GOA:D3RNX4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX4"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADC61484.1"
FT                   /translation="MWKLGFGGDRSLLDSLFPPTCLLCGAPGEQGRDLCAGCALDLPYN
FT                   LRACARCARPFLVPLPDGAICGDCERRPPPFDACLTAFRYEGAVPFLITGAKFRGRLNA
FT                   ARLLGQCLAEQARESADDWPEALVPVPLHPRRQRTRGYNQALEIARVTGRALSLPVEPR
FT                   LVARTRATPPQTELTARARRRNIRGAFKAVEALTGRHLAIVDDVMTTGGTVSELSQVLI
FT                   DAGAVRVDVWAVARTL"
FT   gene            complement(604744..605985)
FT                   /locus_tag="Alvin_0528"
FT   CDS_pept        complement(604744..605985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0528"
FT                   /product="Protein of unknown function DUF2279, periplasmic
FT                   lipoprotein"
FT                   /note="PFAM: Protein of unknown function DUF2279,
FT                   periplasmic lipoprotein; KEGG: nmu:Nmul_A2261 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61485"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX5"
FT                   /inference="protein motif:PFAM:PF10043"
FT                   /protein_id="ADC61485.1"
FT                   /translation="MRVLLKSLLWITGLGLVAALVLGLALALDRRPLVAEPSPPSPAEQ
FT                   TWAADWLAKQRRHHGRAASSNRLELTEPQANLLLNALLGRSGQGQAQVRLGAGRASLAL
FT                   SLKLPLDQLDGYLNLELELTEDDPLPRVESARIAGLPIPGSLAQALVEQALQALDRSQM
FT                   VHEVRFTPERLTLDYDWHPNMVERFSGGMIASDELPRVLAAQDAIIRYAAAQPGRKPLP
FT                   LSDLLTHLLQETADDTDPIAGHRALILALAAYVNGQSIRAPDDDSTEPRARPRLVLLRG
FT                   RVDLSQHFMTSAALAVQGTDTLSSLVGWYKEMSDANGGSGFSFADMTANRAGIRFARLA
FT                   TESASSARWLQSVARAGLREDDVMPRIDSLPEGLSQARFEDRLGTDKRREYQRLIEQID
FT                   RHIESRGLYRQPSG"
FT   sig_peptide     complement(605902..605985)
FT                   /locus_tag="Alvin_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.723 at
FT                   residue 28"
FT   gene            complement(606014..606244)
FT                   /pseudo
FT                   /locus_tag="Alvin_0529"
FT                   /note="hypothetical protein"
FT   gene            complement(606244..606429)
FT                   /pseudo
FT                   /locus_tag="Alvin_0530"
FT                   /note="hypothetical protein"
FT   gene            606697..607935
FT                   /locus_tag="Alvin_0531"
FT   CDS_pept        606697..607935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0531"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; KEGG: dal:Dalk_4503 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61486"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX6"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ADC61486.1"
FT                   /translation="MLSTTIVRAIMAHCAPIYPDSRSPRVLCSAGLLFATLTVPAEAGS
FT                   VAYSYDTLGRLTKAGYANGVVITYSYDAAGNRASMAVTGGSAAASMVAAADARVPDTLL
FT                   ATASPVAAPPVAIDLDAGGEDPGLYGWNDLSDTPEQTVSALFTGDGLDRLLHVQGYAID
FT                   SSETVGLWLNGTLLGYLSSAADGLWSTPSLWLLPATLQQPGDNLIELRARTPDVVWGVT
FT                   RLALAAFGSAWGNQEGLPAGDLTHPEGIELHLFSADPQAEAGRLLELAGWDIGHDDEVA
FT                   ITLNGAPLVDLPAGAAGAWGATYHLWLEPAALSAGDNRLLISEQYGPLEPWGVRFERVL
FT                   AGQASLGTGLPDQTPADQRPDGIRLLLPAAATQTLQALRFFDVTRDQDLSLRLDSLRQT
FT                   PIAVTGAQTWGAA"
FT   gene            608089..614217
FT                   /pseudo
FT                   /locus_tag="Alvin_0532"
FT                   /note="hypothetical protein"
FT   gene            612669..614000
FT                   /locus_tag="Alvin_0533"
FT   CDS_pept        612669..614000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0533"
FT                   /product="transposase IS4 family protein"
FT                   /note="KEGG: app:CAP2UW1_0233 transposase IS4 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61487"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX7"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_0233"
FT                   /protein_id="ADC61487.1"
FT                   /translation="MGWASEELASIDLGDTRRDRRAIHLIERLAEHPTASIPGACNGWA
FT                   ETQAAYRFLGSERYDWLDILEPHRQCTQRRMAAYPVVLCLQDTTELDFNGQTIKGLGPL
FT                   SYEAQRGMYLHPTYAVTPEREPLGVLDAWMWAREPKDADGQRPGGPESVRWKEGYERVA
FT                   DLARELPDTRLVYVADREADILDLMVRARDLATPADWLLRAKHNRALPGGEGQKLWGRV
FT                   LDTEPLGEVRFTVPPGRGRTARTVRQELYAQRVSLSDRRQGHLEVTGVIAREIEAPKGV
FT                   KPIEWRLLTNRRADTLEAVVELIEWYRARWEIELLFLVLKEGCRVEALQLGTVERLERA
FT                   FALFLVVGWRIARLMRLGRTVPDLEASLLLEPEEWQAAYILAKKPVPKQPPRLNDVLRL
FT                   IARQGGFLGRKGDGEPGVKTIWLGLQRIRDVAAGIKFARESHDL"
FT   gene            614428..614787
FT                   /pseudo
FT                   /locus_tag="Alvin_0534"
FT                   /note="hypothetical protein"
FT   gene            614793..615296
FT                   /locus_tag="Alvin_0535"
FT   CDS_pept        614793..615296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_3107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61488"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX8"
FT                   /inference="similar to AA sequence:KEGG:BBta_3107"
FT                   /protein_id="ADC61488.1"
FT                   /translation="MNPDQHKLILRFATHEVSEADFLQSFDNASDGSTLALQLLHEAID
FT                   GRDTEEVELALIVGFRFGIDERHLSALLNLEPANWHQRHEDVVSALGDIRSTEAVPALY
FT                   HATQWIPDYLDFDENRALAVKAIWSLGNIAGKEAEACLEKLASDPDAILRDTAREQLKR
FT                   RHCV"
FT   gene            complement(615293..615871)
FT                   /locus_tag="Alvin_0536"
FT   CDS_pept        complement(615293..615871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO4954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61489"
FT                   /db_xref="InterPro:IPR025633"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNX9"
FT                   /inference="similar to AA sequence:KEGG:SCO4954"
FT                   /protein_id="ADC61489.1"
FT                   /translation="MPENSVRAIFDDKTIRVYQAYRADIALPALAAGRFVPPFKMDRMT
FT                   WIKPSFGWMMYRSGYASKPGQEFVLGIDITRDGFEWALAHATLSSFKPSVHPSYEVWKA
FT                   DIESKPVRVQWDPERDWKLQPIRGVRAVQIGLSREAIKYYARDWIVKIEDVTPLVKKAS
FT                   QAIIMPPDLPSALERPYPLPADLAYICCD"
FT   gene            complement(615898..616260)
FT                   /locus_tag="Alvin_0537"
FT   CDS_pept        complement(615898..616260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0537"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   nmu:Nmul_A2650 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY0"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADC61490.1"
FT                   /translation="MEALSNPVRLIVTAGQEADITQGAALIEGFVTEAVIADKGYDSDA
FT                   LVAAIEATGAQAIIPPRRHRHTKRQVDWHRYKARNLVERFFNRLKPFRRVATRYDKLAN
FT                   RYNAFLHLACAYIWLL"
FT   gene            complement(616281..616652)
FT                   /locus_tag="Alvin_0538"
FT   CDS_pept        complement(616281..616652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0538"
FT                   /product="IS298, transposase OrfA"
FT                   /note="KEGG: nmu:Nmul_A2018 IS298, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61491"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY1"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A2018"
FT                   /protein_id="ADC61491.1"
FT                   /translation="MDRRMLSDEQWARIADFLPGKPTDKGGRAVDNRWFVEAVLYMART
FT                   GCPWRDLPKELGNWHSVYVRFARWETYGVWHRVAEALQGEADMEELFIDATIVRAHQHA
FT                   AGAPKKTVAIRRSVARAGA"
FT   gene            616801..618072
FT                   /pseudo
FT                   /locus_tag="Alvin_0539"
FT                   /note="hypothetical protein"
FT   gene            618473..619060
FT                   /pseudo
FT                   /locus_tag="Alvin_0540"
FT                   /note="hypothetical protein"
FT   gene            complement(619453..619683)
FT                   /pseudo
FT                   /locus_tag="Alvin_0541"
FT                   /note="hypothetical protein"
FT   gene            complement(619699..621030)
FT                   /locus_tag="Alvin_0542"
FT   CDS_pept        complement(619699..621030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0542"
FT                   /product="transposase IS4 family protein"
FT                   /note="KEGG: app:CAP2UW1_0233 transposase IS4 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61492"
FT                   /db_xref="GOA:D3RNY2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR003201"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR014737"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY2"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_0233"
FT                   /protein_id="ADC61492.1"
FT                   /translation="MGWASEELASIDLGDTRRDRRAIHLIERLAEHPTASIPGACNGWA
FT                   ETQAAYRFLGSERYDWLDILEPHRQCTQRRMAAYPVVLCLQDTTELDFNGQTIKGLGPL
FT                   SYEAQRGMYLHPTYAVTPEREPLGVLDAWMWAREPKDADGQRPGGPESVRWKEGYERVA
FT                   DLARELPDTRLVYVADREADILDLMVRARDLATPADWLLRAKHNRALPGGEGRKLWAHV
FT                   LETKPLGTVRFTRPPGRGRQAREVRQQLYARGVTLSDRRHGHLEVTCVIAREMEAPKGV
FT                   KPIEWRLLTNRTAETLATVVELIEWYRARWEIERLFLVLKEGCRVEALQLGTVARLERA
FT                   FALFLVVGWRIARLMRLGRTVPDLEASLLFEPEEWQATYILAKKPVPKSPPRLNDVLRL
FT                   IARQGGFLGRKGDGEPGVKTIWLGLQRIRDVAAGIKYARESHDL"
FT   gene            complement(621212..622099)
FT                   /locus_tag="Alvin_0543"
FT   CDS_pept        complement(621212..622099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0543"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; SMART: transglutaminase
FT                   domain protein; KEGG: tgr:Tgr7_1016 transglutaminase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61493"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY3"
FT                   /inference="protein motif:PFAM:PF08379"
FT                   /protein_id="ADC61493.1"
FT                   /translation="MRYKVQHVTRYDYADPVSLCHSIAHLKPIDTRAQRCLSTSLRVDP
FT                   WPAVSREHEDFFGNRVSYFSIQQAHRALEVTAVSEVEIMPVPTPPPERTTPWELVLERL
FT                   YDRGDGLMSDARIFTLPSPQVPLDDEARAFAAVSFTPGRPILEATLDLMTRIHREIEYD
FT                   PTATTVATPVAEVMRQRRGVCQDFAHIAISGLRGLGLAARYVSGYLETLPPPGQVKLQG
FT                   ADASHAWFSVLVPDHGWIDFDPTNDCIPVEQHITTAIGRDFQDVTPLRGIFYGGGQHDL
FT                   SVAVDVNRIDEAVG"
FT   gene            complement(622096..624681)
FT                   /locus_tag="Alvin_0544"
FT   CDS_pept        complement(622096..624681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0544"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF403; protein of unknown function
FT                   DUF407; KEGG: tgr:Tgr7_1015 protein of unknown function
FT                   DUF404"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61494"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY4"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ADC61494.1"
FT                   /translation="MSPPELASLPDQPGLVDAYAPLPDCYDEMRTPEGEVRAHWQYLLD
FT                   ALRTLGPAGIEERWGESRRLIRDNGVTYNPHGDPRGMSRPWELDLLPLLIRSDEWAELE
FT                   RGLIQRAELLNLILRDLYGPRDLVRLELIPAELIDGHPGYLLPCRGVDCIGGRPLVHYA
FT                   ADLTRRPDGRWQVISDRTQTPLGAGYALENRVVLSRVLPSVFRDSHVHRLAGFFRSMRR
FT                   TLTRLAPQHGEEPRVVVLTPGPRNEAYFEHAYLANYLGYTLVQGADLSVRDGALWLRTL
FT                   GRLERIDAVLRRLDDVWCDPLELREDSLLGIPGLVQAARLGNVTLANALGSGVLEHPAL
FT                   KAFLPALCQHLLGEELALSDTPTWWCGDPESRVRVLDDLDRLIVRPVHPALDPTPIQPG
FT                   TLAPEARARLVRAIETHPRRYIAQEPVVPATAPALIGRQLEPRPTTLRTFLIAEEEGYA
FT                   VMPGGLGRVHSTPEAALPLSGQLGGLGKDVWVLASEPERQETLLPLSEITPAVVQESAV
FT                   SSRVADNLFWIGRYAERAEGLVRLLRVTIFKYAERSDYPLSPASSSCLRALLEALTQQT
FT                   QTFPGFLGPGAEERLNDPVPELLALISDRSLVGSLPQTLEALGQAAYSVRDRLSADTWR
FT                   IIGDIEALQASLADHPPRVLSQALDELDPLVTSLVAFSGLTQENMTHNEGWHFLETGRR
FT                   LERGATTASLLRSTLVPVAGEADENMLIEAVLGVTDSTITYRRRYRGGTRVGALLDLVF
FT                   QDEGNPRALAYQLAMLGRLVTELPRGDLAVGRTPAEKLALKSLTDIRLAEINQLIQVDE
FT                   TGQQRARLAEMLADLNLQLAALSDAITAQYFRHEEQPHSLLSRVAEVPV"
FT   gene            complement(624757..625659)
FT                   /locus_tag="Alvin_0545"
FT   CDS_pept        complement(624757..625659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0545"
FT                   /product="protein of unknown function DUF815"
FT                   /note="PFAM: protein of unknown function DUF815; SMART: AAA
FT                   ATPase; KEGG: eba:ebA4101 AAA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61495"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY5"
FT                   /inference="protein motif:PFAM:PF05673"
FT                   /protein_id="ADC61495.1"
FT                   /translation="MTLTPALTDRLDRIIDQLERLLPPTSAPADWSAQAFRWRREAGRG
FT                   WLQPVRAPHRLALTDLRCLERQATEIERNTRQFLAGRGANNVLLWGARGTGKSSLVKAI
FT                   FNAYRDAGLRLIEVDKDDLVALPDILDLIRDRPERFILFCDDLSFEASESGYKALKAAL
FT                   EGSIASTPENLLIYATSNRRHLLPEFHADNRDSRIQDGELHHGEAVEEKISLSDRFGLW
FT                   ISFHPFGQAQYLEVVRHWVERLAPTETPRTESDWEPIERAALQWALRRGARGGRTAWQF
FT                   ARDWAGRGALDVMAHPETR"
FT   gene            complement(625721..631291)
FT                   /locus_tag="Alvin_0546"
FT   CDS_pept        complement(625721..631291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0546"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="KEGG: gsu:GSU2758 excinuclease ABC family protein;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61496"
FT                   /db_xref="GOA:D3RNY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY6"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADC61496.1"
FT                   /translation="MTDFIRLRGVRQNNLKNLDLDLPLGELIVVTGVSGSGKSSLAFDT
FT                   LHAEGQRRYVETFSPYARQFLDRMDRPAADRIEGIPPAIAIDQVNPVRTSRSTVGTMTE
FT                   LNDHLKLLFARAGRLFCHGCGRPVVRDTPESIWESLATSALDARTLIVFDVAVPEALGV
FT                   EAVKSMLAQQGYVRLLREGTDAIAVIQDRLRLTPENRGRAIEALETALARGHGRVRVHP
FT                   VDAEGAALDPWRFSSDLHCAHCDIAYQEPTPNLFSFNSPLGACETCRGFGRTIGIDWGL
FT                   VIPDTSKSLLDGAIKPIQSDSYAEVQEDLIRFAHQRGLPTDVPWRDLTDDDRAWIIEGD
FT                   GDWEAGVWYGLRRFFDWLEGRSYKMHVRVLLSRYRSYDLCPSCRGARLKDAALDWRLGD
FT                   WALAERILEPSQRFRHARTRMRDDAWAMLPGLNLHDLLCLPLSRCREFFDALRLDGALD
FT                   QALDQLLGEIRARLGYLCEVGLGYLTLDRQSRTLSGGEVQRINLTTALGTALVNTLFVL
FT                   DEPSIGLHPRDMDRVVSVLQRLRDRGNSLVVVEHDPQVMRAADRIIDIGPGPGEHGGRI
FT                   VFQGTPRELLDAPESLTGGYLAGRLQVAPPRRPHPPPDDPARWLRVRGARAHNLKGLDV
FT                   AIPLDRLVVITGVSGSGKSTLVHEVLYRAFCQLKGRPDETPGAHEAIEGHERITDVLLL
FT                   DQSSIGRTSRSNPASYVGAFDVIRKRFAESPLAKERGYTAGSFSFNSGNGRCPTCGGNG
FT                   FEHLEMQFLADVYLRCPECNGRRYRDSLLEVRIGGDGEHPYSIADVLEMTVTEALDVFA
FT                   DDGQLKRALEPLQAVGLGYLRLGQPVPTLSGGEAQRLKLAGHLAKSARHKARDGGLLFL
FT                   LDEPTTGLHFADIAVLLRAFRHLIDQGHSLVVIEHNLDVIDAADWLIDLGPEGGESGGE
FT                   LVCAGTPDQVVEHPGSHTGRALRAYRAESLAISDASGRYESKPAKGTEIQAFSPAPNHI
FT                   EIRQAREHNLKDLTLSIPRERLTVITGVSGSGKSTLAFDILFAEGQRRYLESLNAYARQ
FT                   FVQPAARADVDAVLGLPPTVAIEQRTSRGGAKSTVGTLTEIHHYLRLLYVKLGIQHCPD
FT                   CAVPIEPMTRETILSRLQHDRAGEQVMLLVPLVSGRKGLYKDLAARFERLGFPLLRVDG
FT                   ELLETARWPTLDRFREHRIDLPLGPIAITPEAESELRERLDQALEFGKGQVRVVRLVGE
FT                   TWDTETPYSTERACHACGRAFPEPDPRLFSYNSPHGWCPDCLGTGLKLPGFDAEQTGEE
FT                   AQWLEQPDGTTREPCPTCRGARLRPEALAVRFREHSIAELSARTIESAADWLDALQLDA
FT                   REQAIARDLIAEVRERLGFLAEVGLGYLSLDRAAPTLSGGEAQRIRLAAQLGSNLRGVC
FT                   YVLDEPTIGLHPRDNRLLLDTLSRLEGKGNTVIVVEHDEETIRRAEHVIDLGPGAGIQG
FT                   GAIVAQGTADELIANPESITGRFLGRPRGRSRPPRPVDDQTDWLQISGANLNNLRDLDV
FT                   RLPLGRLVCVTGVSGSGKSTLVREVLVGSLKTLLAGDRPATKRRARRADLVGCRALDGW
FT                   QRLSRVLEVDQTPIGKTPRSCPATYVGFWDAVRKLFAATPESRLLGWTPARFSFNTGAG
FT                   RCPACEGQGLRKLEMSFLPDVRLTCEVCGGSRFDRETREIRYRGLDIGQVLALCIDAAV
FT                   EVFANHPAIAHPLRLLQDIGLGYLTLGQPSPTLSGGEAQRIKLVTELAKARPGTDGLTS
FT                   RPTLYVLDEPTVGLHMADVERLIAVLHRLVDAGHSVLVIEHNLDLIAESDWVLDLGPEG
FT                   GADGGRILAAGPPERLIEDSDGATARALREHVSAGARPPTT"
FT   gene            complement(631405..631683)
FT                   /locus_tag="Alvin_0547"
FT   CDS_pept        complement(631405..631683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0547"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mei:Msip34_0385 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61497"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY7"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADC61497.1"
FT                   /translation="MDTDTVTCRPGCAACCIAASITSPIPGMPHGKPADVACVQLNPDL
FT                   TCRLFGRPERPRVCGSLKPSLAMCGTDRLHALAHLAELERLTQPLSV"
FT   gene            complement(631685..632584)
FT                   /locus_tag="Alvin_0548"
FT   CDS_pept        complement(631685..632584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0548"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: avn:Avin_07440 phosphatidylserine
FT                   decarboxylase proenzyme; TIGRFAM: phosphatidylserine
FT                   decarboxylase; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61498"
FT                   /db_xref="GOA:D3RNY8"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY8"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ADC61498.1"
FT                   /translation="MSRTLANRLFIALQHLIPQRWLSERMYRLARLQWPPLKRLIIRRF
FT                   ARTYRIDMSLAQEPDLDAYPSFNAFFTRALRPDARPLDPDPAAILCPVDGAISQIGPIE
FT                   SGRLIQAKGRDYSVESLLALAPGELHPFEGGRFATIYLSPRDYHRIHMPLDGRLDQMIH
FT                   VPGRLFSVNAVTAAGVPNLFARNERLVCRFETEIGPVAMILVGAIFVGGIETVWAGEVT
FT                   PPHSGLEPQRWDYEVDDQCIRLERGAEMGRFNLGSTVILLLPPGQAEWESGLTPGDVVR
FT                   LGQRIGTRLDAKAAGHGH"
FT   gene            complement(632682..633284)
FT                   /locus_tag="Alvin_0549"
FT   CDS_pept        complement(632682..633284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sal:Sala_2979 electron transport protein
FT                   SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61499"
FT                   /db_xref="GOA:D3RNY9"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61499.1"
FT                   /translation="MFLRNRHGLGVRLIFALGAMALFVLGYQWGNQQQFGHAEPARIHG
FT                   VLIQPPGEIPEFSLRDPFGRPVGRADLAEGWTLLAFGDLADASGQRAAQRLIETRNRLA
FT                   DQPPLIASLRLILIQTSERLELARDFARLSPALRPLAGPPESIAPLRDALGLTSEVVPA
FT                   LFVIGPDARLLAILPETESGAGMAEDIETLIATQARP"
FT   sig_peptide     complement(633204..633284)
FT                   /locus_tag="Alvin_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.606 at
FT                   residue 27"
FT   gene            complement(633297..634484)
FT                   /locus_tag="Alvin_0550"
FT   CDS_pept        complement(633297..634484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0550"
FT                   /product="Serine--pyruvate transaminase"
FT                   /EC_number="2.6.1.51"
FT                   /note="PFAM: aminotransferase class V; KEGG: noc:Noc_2128
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61500"
FT                   /db_xref="GOA:D3RNZ0"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ0"
FT                   /inference="protein motif:PRIAM:2.6.1.51"
FT                   /protein_id="ADC61500.1"
FT                   /translation="MTIRSFNPPVRTLMGPGPADVHPRVLAALARPTIGHLDPAFVGMM
FT                   DEVKDLLRTAFRTQNALTMPVSAPGSAGMETCFVNLVEPGDEVVVCINGVFGGRMKENV
FT                   ERAGGVPIVVQGTWGRAVDPDQVADTLARHPNARLLAFVQAETSTGAQSDARALAEIAR
FT                   RHDCLTIVDAVTALGGSPLEVDAWGLDAVYSGSQKCLSCVPGLAPVTFNERALDKIRAR
FT                   QTKVQSWFLDLNLVMGYWSGEQKRSYHHTAPVNALYALHESLVMLAEEGVEAAWKRHAH
FT                   HHLALRAGLETLGLELIVPESERLPQLNSVAVPAGIDEAALRARLLSRYNLELGAGLGD
FT                   LAGKVWRIGLMGYSSRPANILLCLGAMASELDTMGYRADAGAAIAAARAVLDQAA"
FT   gene            complement(634601..635398)
FT                   /locus_tag="Alvin_0551"
FT   CDS_pept        complement(634601..635398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0551"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: aeh:Mlg_0970 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61501"
FT                   /db_xref="GOA:D3RNZ1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ1"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADC61501.1"
FT                   /translation="MSEMLFDPLFQLPLLTGLLLAGLLPVLGALAMLRDEWLAALGLAH
FT                   LASASALLGQVLGVPALIGATLGALGGGAIKTFLAARGNIAYGFMILAGWSATLLIGAN
FT                   TALGEQLARSLVEGQLYFAGIAELAAGLLLLALCIRYLPRLMRPVLRARFFPRYETANR
FT                   LAAWRWHLGLDLLTAGGLAIGTLTLGLMGTFALVLVPAWIAFRLAPSWRWTLIGASLTG
FT                   VVGYLLAFVAALELDQPFGPVLVGGLLGPALLTGWLGRPARFG"
FT   gene            complement(635395..636033)
FT                   /locus_tag="Alvin_0552"
FT   CDS_pept        complement(635395..636033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0552"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hha:Hhal_0491 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61502"
FT                   /db_xref="GOA:D3RNZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC61502.1"
FT                   /translation="MCAPDPRPLLQLDALVAGYARPVVGPVSLWLARGEVLGLWGPNGT
FT                   GKSTLLKAIGRSARVFSGCIELESGATLAHLDQQPVRLPAMPVTGRELLRAAGARPEEP
FT                   ERTGRLPDVLAPLLKRRIDRLSGGQYQLLWVWSALATGADLVLLDEPTNNLDPANRAAL
FT                   IEILGRERDGRGVLIVSHDHDFLERVCSRLLEARDTGLVEVRTARGPGS"
FT   gene            complement(636102..636995)
FT                   /locus_tag="Alvin_0553"
FT   CDS_pept        complement(636102..636995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0553"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   aeh:Mlg_0972 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61503"
FT                   /db_xref="GOA:D3RNZ3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ3"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADC61503.1"
FT                   /translation="MSFRILIVLMGLCLMGNAPAAPLDVVATSPSLGALVRAVAGERLE
FT                   PTILAGPERDLHQLQAKPSMMRALRDADLVVAIGAELEVGWLPAAIAGAANPAIQPGRD
FT                   GYFEAAAQVELLDVGGPADRALGDVHPVGNPHVDLDPVRMARIAAALAERLARLDPAGA
FT                   EIYRSGAAVFAQAVEQRVADWRARLAGAPGVLLYHRDAIYLLDRFGVPLLGTIESTPGV
FT                   PPSGQDLLDLTAKLKGRAGVVIQAPYQSPQAPAKLARDLGWRLERLPLAPPLEADGTGY
FT                   LEHIERWVEAIAAARP"
FT   gene            complement(637021..638565)
FT                   /locus_tag="Alvin_0554"
FT   CDS_pept        complement(637021..638565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0554"
FT                   /product="phosphate-selective porin O and P"
FT                   /note="PFAM: phosphate-selective porin O and P; KEGG:
FT                   aeh:Mlg_0973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61504"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ4"
FT                   /inference="protein motif:PFAM:PF07396"
FT                   /protein_id="ADC61504.1"
FT                   /translation="MRPSILAAGLATALTVPAAAVEASSAAEIAELKSMLEQMRTQYER
FT                   RIQDLEDRLAQAERRSARAPAPATPAATDPAISQPMRAPSVGASAPAATAPRLPDFRGT
FT                   LSSGTAFNPQISVILNGNYYNDGIDGSGAALVGQALQPSGGLAHDHDHDHAQDADHGHS
FT                   HGGLNNGFNFSEAELSFSATVDPYFDAAAHLAVMDEGDVHLEEAWLQTRALPHGLRVKA
FT                   GKFLSDFGYANKQHPHAWDFVDQNLAYLNLLGEHGLQDMGVQLTWLPELPVYTLLGVEA
FT                   LQGDQERFGATLSDEDQERLGLDATEDGPRLWTLFAKVAPDLGLDHALQFGVSYARNTQ
FT                   HQEVHAHTHAGEDEVHENALAGEADLWGVDLVYKYDGSGPHGQGDFKFQTEYLRSIKDL
FT                   DIQSSPHPEIIGSRRTFTTDGVYAQALYGFAPRWTAGVRYDVVGLTNAVSGDAQLDYGS
FT                   SDRWSLNLTWNLSEFSQLRAQYARNDILVAENERERFDAFYLQFLMSLGSHGAHAF"
FT   sig_peptide     complement(638503..638565)
FT                   /locus_tag="Alvin_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.834 at
FT                   residue 21"
FT   gene            638887..639171
FT                   /locus_tag="Alvin_0555"
FT   CDS_pept        638887..639171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecd:ECDH10B_2804 CP4-57 prophage; protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61505"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61505.1"
FT                   /translation="MQHLDVRPSADSLVHLGSDVLRDRLSDLIRRYAHQATADLAEAVV
FT                   AHIDALYLRPDFRLDPAEQCAYRRFARHWHWLAARHGQGAGRADVCLPA"
FT   gene            639227..640198
FT                   /locus_tag="Alvin_0556"
FT   CDS_pept        639227..640198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pla:Plav_0183 hemin-degrading family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61506"
FT                   /db_xref="GOA:D3RNZ6"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61506.1"
FT                   /translation="MSAPILSSTLAFRPRQADAWLDLVPEPSSPLRLTGHWTELLWDLA
FT                   CLDPLWVETRLSGIRLRQRMQLQAIHIDEGIGLARGESFRLHVLLNTWHALVQRPESVE
FT                   RRFQDLAIEARDRSELLSLSVDAQTHPFALQTLIRAYRIEEGRVMPLSRPDVRQSGLSA
FT                   HMHTLARWREQGRQDVEIADLAECCGWLNLTPARLRAQGRARLAAAELIPCFLETVADQ
FT                   SLMTRVTMGTAGAVQRFDGCLHTYRQCADGWIELSGEGVRLRLDPESIDSAWVVERLGS
FT                   DGRRHQLRLYDESGRALLLMEDLVPAGGAPSPIWRLLVNALF"
FT   gene            complement(640256..643351)
FT                   /locus_tag="Alvin_0557"
FT   CDS_pept        complement(640256..643351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0557"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   abo:ABO_2630 AcrB/AcrD/AcrF family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61507"
FT                   /db_xref="GOA:D3RNZ7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ7"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADC61507.1"
FT                   /translation="MDLTGYTLRNRTVSWMVVLLLIGGGVSAFLGLGRLEDPAFTIKEA
FT                   MILTSYPGASSLEVEEEVTLPLEEALQQLPYVDHITSTSSDGYSQIEVQMRSIYRKAAL
FT                   AQIWDEMRRKINDATGRLPPGVQAPQIIDDFGDVYGVFLAVTGSGYRYDELDDYVDFLR
FT                   RELIVVPGVSKVSVGGTREEQVFIEVDRAKLAATGFGLSDIEALLRDQNLVGDAGDIRV
FT                   GTESVRARSRSDNGDGLSRLRDLLVGQVDGQVVYLRDVARVTLGYTEPPSHLYRFDGQP
FT                   ALGVGISFRAGVNVVEVGQAIEARLAALAPERPLGIAITSIYNQPAAVAQSVDTFLVGL
FT                   AQAVGIVVAVLLFTMGLRPGILMSGVLLLTILGTFILMGITGIELHRISLGALIIALGM
FT                   LVDNAIVITEGILIGVKRGLTRVEAAMRIVSHTRWPLLGATLIAITAFAPIGLSPDVSG
FT                   EFTGSLFWVLLISLLLSWVLAITLTPFFSVLMFREQPAAKDGEVFAPADPYAGVFYRLY
FT                   RKILRLCLRFRWGTMALMIAALLAAVLGFGQVKNAFFPASSLPMFMVDYWLPQGSDIRA
FT                   VEADVAQLEAELLAFPAVRHVTATIGRGAERFMLTYAPELSYPSYAQLIVEVDDFDSVA
FT                   PTIEALDHRLREGYPQAFTRIQRFEIGPSTKAKLEARLIGPDPEVLRDRADAIIAILEA
FT                   EPGAINVRHDWRERTKVYQPVLNEAEARRLGITRQNLDQALAMTTDGVRIGLYRWGSRL
FT                   LPIVMRPPETERDRVEQLEDILVYSPVKQAYVNVGQLVLGAELVWEDALIKRRDRKRTL
FT                   VVQADPAPGLMPSKLHASVRNAIEAVPLPPGYALEWGGEYEAQQEANVAVFAFVPLGVL
FT                   IMIVLTVLLFGSAKQTLVVWITVPLSLIGVTVGLLSTGAPFSFMALLALISLIGMQLKN
FT                   GIVLVEEIKRLREEEGEDWRPAIVEAAVSRVRPVTMAALTTILGMLPLLADVFFKPMAV
FT                   TIMFGLGFATVLTLFVVPVLFALFYGVSDRPAPDGGATDCLV"
FT   gene            complement(643357..644466)
FT                   /locus_tag="Alvin_0558"
FT   CDS_pept        complement(643357..644466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0558"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ilo:IL0466 RND efflux system membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61508"
FT                   /db_xref="GOA:D3RNZ8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADC61508.1"
FT                   /translation="MSIRRSRFLWPLIPLLASLLLGGCSDPNPSTAPAGEPSPRPAKIV
FT                   PVEPSGIAAIRTYPGTVEARNKADLSFRVQGQLVELPAEPGLRVRRGDLLARLDAAVYQ
FT                   NVLAEREAQLALAEVRYDQARTLRAKDLASQLELDQSRAELEVARALRNAARDQVAYTR
FT                   LTAPFDGMIARVSVENHQTVEARSPVLQLQDNDRLEVHFSVPESLVSQLMRIRDPKALQ
FT                   DYCGRVHFARHPEETFRACHKEFEATPDPLTRTYPVVFTLDPIDAFTVLPGMTVSIELD
FT                   FTRFLRAEARTGLSIPVEALFEHEGATWVWRVDEDMRARRTAVTPARLAGDRVLIAEGL
FT                   ESGDRVIAAGVGFVREGMQVRPFVKERGL"
FT   gene            complement(644507..645103)
FT                   /locus_tag="Alvin_0559"
FT   CDS_pept        complement(644507..645103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0559"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pna:Pnap_4172
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61509"
FT                   /db_xref="GOA:D3RNZ9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3RNZ9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADC61509.1"
FT                   /translation="MDTRHNILTAAAVLFARNGYDKVSMRDIAGAVGIRAPALYNHFPD
FT                   KEHLYLESIAHVLQGKAEALARAIAGAAPAWTRLERYVACLARIFTEDPDALRLIQREV
FT                   LNGDDARLRTLTDQVFQTPFQDMLDLIQELGPGRDAHLLAISVMALVLDHIELACLRPL
FT                   LPGYRPEHDDPEVLARHVCTLLRAGLVDAAPSAPR"
FT   gene            645323..645922
FT                   /locus_tag="Alvin_0560"
FT   CDS_pept        645323..645922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tga:TGAM_0320 D-3-phosphoglycerate
FT                   dehydrogenase, putative (SerA)"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61510"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC61510.1"
FT                   /translation="MASQAVRASIQGQPFNDVLNELHAHTFSGAPGESDPFTLSELDRE
FT                   FIAYALAIYYQCDHCQQYHGRVIERLFKESDAKPWAWQAEFVKIVLFLRTSRQSVSEVE
FT                   WQGWVEAWRRFATRLHYRHPGFACNIAYAIGISRADENLMELAFESLTRHYPDGETLLG
FT                   VIRDIDRVVVFMKAATSKNRTDPIVRRQLKTCGVHI"
FT   gene            646063..647925
FT                   /locus_tag="Alvin_0561"
FT   CDS_pept        646063..647925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0561"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: mca:MCA1868 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase RecQ; ATP-dependent DNA
FT                   helicase, RecQ family; PFAM: RQC domain; DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; HRDC
FT                   domain protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; HRDC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61511"
FT                   /db_xref="GOA:D3RP01"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP01"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ADC61511.1"
FT                   /translation="MGESAREILSRIFGYDRFRGAQAEIIEHLIGGGDALVLMPTGGGK
FT                   SLCYQIPALIRPGTAIVVSPLIALMQDQVEALRQLGVRAAFLNSSLDLDEARAVERALR
FT                   NGTLDLLYVAPERLLTERCLSLLDSIEIALFAIDEAHCVSQWGHDFRPEYIQLEQLHAR
FT                   WPQVPRIALTATADAPTRNEIVARLRLESARRFVSSFDRPNIRYRIVEKTNPRRQLLDF
FT                   LRREHPESAGIVYCLSRRRVEETAVYLESEGFRALPYHAGLPSEMRREHQARFLREDGL
FT                   IMVATIAFGMGIDKPDVRFVAHLDLPKSLESYYQETGRAGRDGLPADAWMAYGLSDLVT
FT                   LRRLIEESEAEERFKRIELHKLDAMLGLCETTNCRRQVLLNYFGEPLEQPCGNCDTCLE
FT                   PVETWDGTEAARKALSCIYRTGQRFGSAYLADVLLGKSNERIRRFGHDRVSTFGIGQSV
FT                   DGRPMTADQWRSVYRQLVAAGLVSVDVEGHGSLRLTEASRPLLRGECGIQLRRDPERKR
FT                   TGDRTRAPRAAAPSDPEAADLWQALRAHRFALAQEQDVPAYIIFNDATLRAMLEQRPRT
FT                   LIEMGRLPGVGETKLARFGEGFLRVIAEHAARQGGPSASQATGE"
FT   gene            complement(647983..648873)
FT                   /locus_tag="Alvin_0562"
FT   CDS_pept        complement(647983..648873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0562"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   tgr:Tgr7_3240 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61512"
FT                   /db_xref="GOA:D3RP02"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP02"
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /protein_id="ADC61512.1"
FT                   /translation="MSKKHPIVAVTGSSGAGTTTVKRAFEHIFHRDNISAAVIEGDSFH
FT                   SYDRATMKAEMAAFAKRGESLSHFGPVANRFDLLEELFREYGETGCGKKRYYIHSDEEA
FT                   RQLNARLGTSLNPGEFTPWEDLPAGTDLLFYEGLHGLVVTEDSNVAQHVDLGVGVVPIV
FT                   NLEWIQKIHRDNLERGYSAEAIVDTIMRRMPDYIRYITPQFSLTDINFQRVPTVDTSNP
FT                   FIARDIPTPDESFVIIRFKDPKKLQIDFPYLLSMIHDSFMSRRNSMVVPGGKMGFAMEI
FT                   ILQPIIERMMDARRV"
FT   gene            complement(649071..650750)
FT                   /locus_tag="Alvin_0563"
FT   CDS_pept        complement(649071..650750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0563"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: tmz:Tmz1t_1329 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   histidine kinase HAMP region domain protein; SMART: GGDEF
FT                   domain containing protein; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61513"
FT                   /db_xref="GOA:D3RP03"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP03"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC61513.1"
FT                   /translation="MPPESDHAHASPAGPDSGRPGPIRRRFGLRAHLALVLLTVALLPL
FT                   LTLYWAERHQIQAEALELTHQTLNLIADVQQRRINLELRRLEDLTRLVSSRTQMRLSLA
FT                   AYARDGDPKHLELIARSLADAVGSTPDLRGIWIRDPSGRTLTQATRDGTLANAIDMAGL
FT                   PRQAPAPILFRRFETQKPEIWLNGPLVLNESVIGSVHLLVRMENILALLEDFDNQYPGG
FT                   ETVLLLCSGTPETFAWSARAGVWNPETAASDPLNDLLRNLAQDADPARTSIVPSTATHG
FT                   SLIYTLRALALDCFRLLVHTSPDKITRSARKHIMLLVYITFSLILLALGAAVILAHVIA
FT                   NPIHAITNGMYRLSQGDYHTRIPEQGWGELSRLTLAFNETAASLQRAIQARLRSERELA
FT                   TLANTDALTGLNNRRRFMELLTQHFDRTRHPANNGALLYLDLDGFKPINDHYGHDAGDA
FT                   VLRIVAERLRRVVREQDHLGRLGGDEFAVLLDRLEPGFEPESVARRLDETLSQPMTIQG
FT                   QQLRIGCSLGLVHITPDSTPSRLLKDADAAMYRAKAGKPSRG"
FT   gene            complement(650900..651598)
FT                   /locus_tag="Alvin_0564"
FT   CDS_pept        complement(650900..651598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0564"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   E subunit; PFAM: RnfA-Nqr electron transport subunit; KEGG:
FT                   noc:Noc_1170 electron transport complex RsxE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61514"
FT                   /db_xref="GOA:D3RP04"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP04"
FT                   /inference="protein motif:TFAM:TIGR01948"
FT                   /protein_id="ADC61514.1"
FT                   /translation="MSTPQSYGSILSGGVWSNNQMLVALLGLCPLLATTTSATNGLGMG
FT                   LATLVVIVCSNGTVSLVRNLVRPEIRIPVFVLVIASFVTLVELIMQAFFYDLYQVLGLF
FT                   ISLIVVNCMIIGRAEAFASKNRVDRALFDGLAVGLGATLVLTTLGGLREFVGQGTLFHQ
FT                   ADLLLGDWAKAISLSLGEDFQGALIAILPPGAFIGLGLMIALKNLIDQRAKRRAAARAV
FT                   PAVRTDPSPA"
FT   gene            complement(651598..652254)
FT                   /locus_tag="Alvin_0565"
FT   CDS_pept        complement(651598..652254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0565"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="KEGG: noc:Noc_1171 electron transport complex,
FT                   RnfABCDGE type, G subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, G subunit; PFAM: FMN-binding
FT                   domain protein; SMART: FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61515"
FT                   /db_xref="GOA:D3RP05"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP05"
FT                   /inference="protein motif:TFAM:TIGR01947"
FT                   /protein_id="ADC61515.1"
FT                   /translation="MITKAKSILLSGVVLGAFAIGGVSLVAVTHGSVGERIADNQYQAM
FT                   KRKLDTILPAEQINNDPLQDSLRVSARDLLGADATQVYRARHDESPVAVVLEPVVPDGY
FT                   AGPIKLLVSVLHDGTLGGVRVVSHHETPGLGDKIEEAKSDWVLDFTGKSLTNPPLEKWA
FT                   VKRDGGEFDQFTGATITPRSIVNAVRDTLLYVQQQGEALYQPIETETATIEGGQG"
FT   sig_peptide     complement(652174..652254)
FT                   /locus_tag="Alvin_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.413 at
FT                   residue 27"
FT   gene            complement(652251..653291)
FT                   /locus_tag="Alvin_0566"
FT   CDS_pept        complement(652251..653291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0566"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   D subunit; PFAM: NQR2 and RnfD family protein; KEGG:
FT                   tgr:Tgr7_2629 electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61516"
FT                   /db_xref="GOA:D3RP06"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP06"
FT                   /inference="protein motif:TFAM:TIGR01946"
FT                   /protein_id="ADC61516.1"
FT                   /translation="MPQSIISSPHVPRVNRVDRVMLEVLLALIPGILVMTWFFGWGTLI
FT                   NIVLAVSFAVAAETAVMLLRGRSPWVALRDLSAVVTAVLFALSVSPTLPWWLTLLGMLF
FT                   AIVLVKQLYGGLGYNPFNPAMAAYVFLLISYPVAMTTWLAPAGLAEHHLSFMESLRLIL
FT                   SGTLPTGFEWDALSSATPLDEMRGKLDLGQTLDQIGQSRTWGWLGGRGWEWVGVAFLLG
FT                   GVYLLWRRIITWHIPVSMLLGLTVAAALFWAIDPQTHPTPLFHLFSGAAMLGAFFIATD
FT                   PVTACTTKKGQLVFGASIGIIVYVIRSWGGYPDAVAFAVLLMNIAAPTIDYYTQPRVFG
FT                   HGSART"
FT   gene            complement(653336..655042)
FT                   /locus_tag="Alvin_0567"
FT   CDS_pept        complement(653336..655042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0567"
FT                   /product="sulfate transporter"
FT                   /note="TIGRFAM: sulfate transporter; PFAM: sulphate
FT                   transporter; Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: slo:Shew_0497 putative sulfate
FT                   transporter YchM"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61517"
FT                   /db_xref="GOA:D3RP07"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP07"
FT                   /inference="protein motif:TFAM:TIGR00815"
FT                   /protein_id="ADC61517.1"
FT                   /translation="MFSALRHSLAQKPSRPEIQANVLAGLTVGVIALPLSMALAIASGV
FT                   PPQYGLYTAIVAGIVIALTGGSAVNVSGPTAAFVVVLLPIVQEFGLGGLLLSGLMAGFI
FT                   LVAMGFGRLGKLIEIVPYPVIVGFTSGIGVVIATFQIKDFLGLEIESLHGHYLEIVSVI
FT                   LHALHSIDWRETLIGILTLAVLLVWPRVRSRIPGHLVALLIGSLAAWMLTLFIPGFQVD
FT                   TIGSRFSFEIDGVTGSGIPPILPTFDWPWNLPGADGTPIGLSFELIRLLFPAAITIAIL
FT                   GALESLLCAVIADGMSEKKHDPNDELIGQGIGNILAPLFGGIPATAAIARTTANVKSGG
FT                   SLPLASVVHGLFILFAILLLAPILSHIPMASMAALLLMVAWNMSEAKHFARTVRIAPRD
FT                   DVLVLVSCFLLTVLLDMTIAVGVGMGLAAALFIRRTVSLTQTAVIESHNADQSVPENVV
FT                   VYDINGPLFFGSAQKALRNIVLVRPNTRVVVLDMSEVTLLDMSAIVAMESIVADLKRKQ
FT                   IGLVINNLHPRMIMKLRRAGVRKQSGQIAFARTLHESFEAARRMLQPPADP"
FT   gene            complement(655067..656653)
FT                   /locus_tag="Alvin_0568"
FT   CDS_pept        complement(655067..656653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0568"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   C subunit; PFAM: Respiratory-chain NADH dehydrogenase
FT                   domain 51 kDa subunit; Soluble ligand binding domain; KEGG:
FT                   tgr:Tgr7_2628 electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61518"
FT                   /db_xref="GOA:D3RP08"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP08"
FT                   /inference="protein motif:TFAM:TIGR01945"
FT                   /protein_id="ADC61518.1"
FT                   /translation="MAIALKPKSTSQRRLWRFHGGIHIPDQKALSNERAIERPPLAERL
FT                   WVPLQQHIGAPGRPLVAVGDTVLKGQMIAEPTGFISAPVHAPTSGRVIAIEPHPVPHPS
FT                   GLSAPCALIEPDGLETWAELPPPLADYPQLDPALIRERIRWAGVVGMGGASFPTSVKLT
FT                   PGTDREIQTLIINGAECEPYITCDDRLMRERAAHILEGVRIMHHLLRVRTVLIGIEDNK
FT                   PEAISAMQLALAATDMGGYTEIVPIPTLYPSGGEKQLIRILTGKEVPTSGIPAQIGIVC
FT                   QNVGTAAAVADAVLEGKPLIARVVTVTGRAIAEPRNLEVPVGTPIEHLIAQCGGYRETP
FT                   RKLVCGGPMMGFELRESATPITKATNCVLALAPEEAPDPGPALACIRCGRCAEVCPTRL
FT                   LPQQMYWNARAKDLDRVQDYNLFDCIECGCCAQVCPSHIPLVQYYRYAKTEIWAREQEK
FT                   RKSEQARARHAAKQARLERQEQEKQARLRKQKEALAAPKPEADGEDPKKALIEAARQRA
FT                   AARKTSETVQD"
FT   gene            complement(656668..657237)
FT                   /locus_tag="Alvin_0569"
FT   CDS_pept        complement(656668..657237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Alvin_0569"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   B subunit; PFAM: Fe-S cluster domain protein; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   tgr:Tgr7_2627 electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Alvin_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADC61519"
FT                   /db_xref="GOA:D3RP09"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3RP09"
FT                   /inference="protein motif:TFAM:TIGR01944"
FT                   /protein_id="ADC61519.1"
FT                   /translation="MLAAILALAALAAFFGVLLGYSAIRFRVEGDPIADQIDSLLPQTQ
FT                   CGQCGHPGCRPYAEALAKGEDEINKCLPGGEALVLALADLLGREPVAMDIKEKAPSVAF
FT                   IDPELCIGCTRCIQACPVDAIIGAAKQLHAVLNSECTGCELCVEPCPVACITMRPIRED
FT                   IQRWRWPYPARQPVASDIAAPLRDAA"
FT   sig_peptide     complement(657175..657237)
FT                   /locus_tag="Alvin_0569"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.882 at
FT                   residue 21"
FT   gene            complement(657326..657907)
FT                   /locus_tag="Alvin_0570"
FT   CDS_pept        complement(657326..657907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_t