(data stored in ACNUC7421 zone)

EMBL: CP001901

ID   CP001901; SV 1; circular; genomic DNA; STD; PRO; 1760939 BP.
XX
AC   CP001901; ADCA01000000-ADCA01000033;
XX
PR   Project:PRJNA37943;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 4)
XX
DE   Methanocaldococcus sp. FS406-22, complete genome.
XX
KW   .
XX
OS   Methanocaldococcus sp. FS406-22
OC   Archaea; Euryarchaeota; Methanomada group; Methanococci; Methanococcales;
OC   Methanocaldococcaceae; Methanocaldococcus; unclassified Methanocaldococcus.
XX
RN   [1]
RP   1-1760939
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Teshima H., Detter J.C., Han C., Tapia R., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Sieprawska-Lupa M., Leigh J.,
RA   Whitman W.B., Woyke T.;
RT   "Complete sequence of chromosome of Methanocaldococcus sp. FS406-22";
RL   Unpublished.
XX
RN   [2]
RP   1-1760939
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Teshima H., Detter J.C., Han C., Tapia R., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Sieprawska-Lupa M., Leigh J.,
RA   Whitman W.B., Woyke T.;
RT   ;
RL   Submitted (02-FEB-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 6d83b270e8d75b17e7b63eed2dded55e.
DR   BioSample; SAMN02598520.
DR   EnsemblGenomes-Gn; EBG00001113928.
DR   EnsemblGenomes-Gn; EBG00001113929.
DR   EnsemblGenomes-Gn; EBG00001113930.
DR   EnsemblGenomes-Gn; EBG00001113931.
DR   EnsemblGenomes-Gn; EBG00001113932.
DR   EnsemblGenomes-Gn; EBG00001113933.
DR   EnsemblGenomes-Gn; EBG00001113934.
DR   EnsemblGenomes-Gn; EBG00001113935.
DR   EnsemblGenomes-Gn; EBG00001113936.
DR   EnsemblGenomes-Gn; EBG00001113937.
DR   EnsemblGenomes-Gn; EBG00001113938.
DR   EnsemblGenomes-Gn; EBG00001113939.
DR   EnsemblGenomes-Gn; EBG00001113940.
DR   EnsemblGenomes-Gn; EBG00001113941.
DR   EnsemblGenomes-Gn; EBG00001113942.
DR   EnsemblGenomes-Gn; EBG00001113943.
DR   EnsemblGenomes-Gn; EBG00001113944.
DR   EnsemblGenomes-Gn; EBG00001113945.
DR   EnsemblGenomes-Gn; EBG00001113946.
DR   EnsemblGenomes-Gn; EBG00001113947.
DR   EnsemblGenomes-Gn; EBG00001113948.
DR   EnsemblGenomes-Gn; EBG00001113949.
DR   EnsemblGenomes-Gn; EBG00001113950.
DR   EnsemblGenomes-Gn; EBG00001113951.
DR   EnsemblGenomes-Gn; EBG00001113952.
DR   EnsemblGenomes-Gn; EBG00001113953.
DR   EnsemblGenomes-Gn; EBG00001113954.
DR   EnsemblGenomes-Gn; EBG00001113955.
DR   EnsemblGenomes-Gn; EBG00001113956.
DR   EnsemblGenomes-Gn; EBG00001113957.
DR   EnsemblGenomes-Gn; EBG00001113958.
DR   EnsemblGenomes-Gn; EBG00001113959.
DR   EnsemblGenomes-Gn; EBG00001113960.
DR   EnsemblGenomes-Gn; EBG00001113961.
DR   EnsemblGenomes-Gn; EBG00001113962.
DR   EnsemblGenomes-Gn; EBG00001113963.
DR   EnsemblGenomes-Gn; EBG00001113964.
DR   EnsemblGenomes-Gn; EBG00001113965.
DR   EnsemblGenomes-Gn; EBG00001113966.
DR   EnsemblGenomes-Gn; EBG00001113967.
DR   EnsemblGenomes-Gn; EBG00001113968.
DR   EnsemblGenomes-Gn; EBG00001113969.
DR   EnsemblGenomes-Gn; EBG00001113970.
DR   EnsemblGenomes-Gn; EBG00001113971.
DR   EnsemblGenomes-Gn; EBG00001113972.
DR   EnsemblGenomes-Gn; EBG00001113973.
DR   EnsemblGenomes-Gn; EBG00001113974.
DR   EnsemblGenomes-Gn; EBG00001113975.
DR   EnsemblGenomes-Gn; EBG00001113976.
DR   EnsemblGenomes-Gn; EBG00001113977.
DR   EnsemblGenomes-Gn; EBG00001113978.
DR   EnsemblGenomes-Gn; EBG00001113979.
DR   EnsemblGenomes-Gn; EBG00001113980.
DR   EnsemblGenomes-Gn; EBG00001113981.
DR   EnsemblGenomes-Gn; EBG00001113982.
DR   EnsemblGenomes-Gn; EBG00001113983.
DR   EnsemblGenomes-Gn; EBG00001113984.
DR   EnsemblGenomes-Gn; EBG00001113985.
DR   EnsemblGenomes-Gn; EBG00001113986.
DR   EnsemblGenomes-Gn; EBG00001113987.
DR   EnsemblGenomes-Gn; EBG00001113988.
DR   EnsemblGenomes-Gn; EBG00001113989.
DR   EnsemblGenomes-Gn; EBG00001113990.
DR   EnsemblGenomes-Gn; EBG00001113991.
DR   EnsemblGenomes-Gn; EBG00001113992.
DR   EnsemblGenomes-Gn; EBG00001113993.
DR   EnsemblGenomes-Gn; EBG00001113994.
DR   EnsemblGenomes-Gn; EBG00001113995.
DR   EnsemblGenomes-Gn; EBG00001113996.
DR   EnsemblGenomes-Gn; EBG00001113997.
DR   EnsemblGenomes-Gn; EBG00001113998.
DR   EnsemblGenomes-Gn; EBG00001113999.
DR   EnsemblGenomes-Gn; EBG00001114000.
DR   EnsemblGenomes-Gn; EBG00001114001.
DR   EnsemblGenomes-Gn; EBG00001114002.
DR   EnsemblGenomes-Gn; EBG00001114003.
DR   EnsemblGenomes-Gn; EBG00001114004.
DR   EnsemblGenomes-Gn; EBG00001114005.
DR   EnsemblGenomes-Gn; EBG00001114006.
DR   EnsemblGenomes-Gn; EBG00001114007.
DR   EnsemblGenomes-Gn; EBG00001114008.
DR   EnsemblGenomes-Gn; EBG00001114009.
DR   EnsemblGenomes-Gn; EBG00001114010.
DR   EnsemblGenomes-Gn; EBG00001114011.
DR   EnsemblGenomes-Gn; EBG00001114012.
DR   EnsemblGenomes-Gn; EBG00001114013.
DR   EnsemblGenomes-Gn; EBG00001114014.
DR   EnsemblGenomes-Gn; EBG00001114015.
DR   EnsemblGenomes-Gn; EBG00001114016.
DR   EnsemblGenomes-Gn; EBG00001114017.
DR   EnsemblGenomes-Gn; EBG00001114018.
DR   EnsemblGenomes-Gn; EBG00001114019.
DR   EnsemblGenomes-Gn; EBG00001114020.
DR   EnsemblGenomes-Gn; EBG00001114021.
DR   EnsemblGenomes-Gn; EBG00001114022.
DR   EnsemblGenomes-Gn; EBG00001114023.
DR   EnsemblGenomes-Gn; EBG00001114024.
DR   EnsemblGenomes-Gn; EBG00001114025.
DR   EnsemblGenomes-Gn; EBG00001114026.
DR   EnsemblGenomes-Gn; EBG00001114027.
DR   EnsemblGenomes-Gn; EBG00001114028.
DR   EnsemblGenomes-Gn; EBG00001114029.
DR   EnsemblGenomes-Gn; EBG00001114030.
DR   EnsemblGenomes-Gn; EBG00001114031.
DR   EnsemblGenomes-Gn; EBG00001114032.
DR   EnsemblGenomes-Gn; EBG00001114033.
DR   EnsemblGenomes-Gn; EBG00001114034.
DR   EnsemblGenomes-Gn; EBG00001114035.
DR   EnsemblGenomes-Gn; EBG00001114036.
DR   EnsemblGenomes-Gn; EBG00001114037.
DR   EnsemblGenomes-Gn; EBG00001114038.
DR   EnsemblGenomes-Gn; EBG00001114039.
DR   EnsemblGenomes-Gn; EBG00001114040.
DR   EnsemblGenomes-Gn; EBG00001114041.
DR   EnsemblGenomes-Gn; EBG00001114042.
DR   EnsemblGenomes-Gn; EBG00001114043.
DR   EnsemblGenomes-Gn; EBG00001114045.
DR   EnsemblGenomes-Gn; EBG00001114046.
DR   EnsemblGenomes-Gn; EBG00001114047.
DR   EnsemblGenomes-Gn; EBG00001114048.
DR   EnsemblGenomes-Gn; EBG00001114049.
DR   EnsemblGenomes-Gn; EBG00001114050.
DR   EnsemblGenomes-Gn; EBG00001114051.
DR   EnsemblGenomes-Gn; EBG00001114052.
DR   EnsemblGenomes-Gn; EBG00001114053.
DR   EnsemblGenomes-Gn; EBG00001114054.
DR   EnsemblGenomes-Gn; EBG00001114055.
DR   EnsemblGenomes-Gn; EBG00001114056.
DR   EnsemblGenomes-Gn; EBG00001114057.
DR   EnsemblGenomes-Gn; EBG00001114058.
DR   EnsemblGenomes-Gn; EBG00001114059.
DR   EnsemblGenomes-Gn; EBG00001114060.
DR   EnsemblGenomes-Gn; EBG00001114061.
DR   EnsemblGenomes-Gn; EBG00001114062.
DR   EnsemblGenomes-Gn; EBG00001114063.
DR   EnsemblGenomes-Gn; EBG00001114064.
DR   EnsemblGenomes-Gn; EBG00001114065.
DR   EnsemblGenomes-Gn; EBG00001114066.
DR   EnsemblGenomes-Gn; EBG00001114067.
DR   EnsemblGenomes-Gn; EBG00001114068.
DR   EnsemblGenomes-Gn; EBG00001114069.
DR   EnsemblGenomes-Gn; EBG00001114070.
DR   EnsemblGenomes-Gn; EBG00001114071.
DR   EnsemblGenomes-Gn; EBG00001114072.
DR   EnsemblGenomes-Gn; EBG00001114073.
DR   EnsemblGenomes-Gn; EBG00001114074.
DR   EnsemblGenomes-Gn; EBG00001114075.
DR   EnsemblGenomes-Gn; EBG00001114076.
DR   EnsemblGenomes-Gn; EBG00001114077.
DR   EnsemblGenomes-Gn; EBG00001114078.
DR   EnsemblGenomes-Gn; EBG00001114079.
DR   EnsemblGenomes-Gn; EBG00001114080.
DR   EnsemblGenomes-Gn; EBG00001114081.
DR   EnsemblGenomes-Gn; EBG00001114082.
DR   EnsemblGenomes-Gn; EBG00001114083.
DR   EnsemblGenomes-Gn; EBG00001114084.
DR   EnsemblGenomes-Gn; EBG00001114085.
DR   EnsemblGenomes-Gn; EBG00001114086.
DR   EnsemblGenomes-Gn; EBG00001114087.
DR   EnsemblGenomes-Gn; EBG00001114088.
DR   EnsemblGenomes-Gn; EBG00001114089.
DR   EnsemblGenomes-Gn; EBG00001114090.
DR   EnsemblGenomes-Gn; EBG00001114091.
DR   EnsemblGenomes-Gn; EBG00001114092.
DR   EnsemblGenomes-Gn; EBG00001114093.
DR   EnsemblGenomes-Gn; EBG00001114094.
DR   EnsemblGenomes-Gn; EBG00001114095.
DR   EnsemblGenomes-Gn; EBG00001114096.
DR   EnsemblGenomes-Gn; EBG00001114097.
DR   EnsemblGenomes-Gn; EBG00001114098.
DR   EnsemblGenomes-Gn; EBG00001114099.
DR   EnsemblGenomes-Gn; EBG00001114100.
DR   EnsemblGenomes-Gn; EBG00001114101.
DR   EnsemblGenomes-Gn; EBG00001114102.
DR   EnsemblGenomes-Gn; EBG00001114103.
DR   EnsemblGenomes-Gn; EBG00001114104.
DR   EnsemblGenomes-Gn; EBG00001114105.
DR   EnsemblGenomes-Gn; EBG00001114106.
DR   EnsemblGenomes-Gn; EBG00001114107.
DR   EnsemblGenomes-Gn; EBG00001114108.
DR   EnsemblGenomes-Gn; EBG00001114109.
DR   EnsemblGenomes-Gn; EBG00001114110.
DR   EnsemblGenomes-Gn; EBG00001114111.
DR   EnsemblGenomes-Gn; EBG00001114112.
DR   EnsemblGenomes-Gn; EBG00001114113.
DR   EnsemblGenomes-Gn; EBG00001114114.
DR   EnsemblGenomes-Gn; EBG00001114115.
DR   EnsemblGenomes-Gn; EBG00001114116.
DR   EnsemblGenomes-Gn; EBG00001114117.
DR   EnsemblGenomes-Gn; EBG00001114118.
DR   EnsemblGenomes-Gn; EBG00001114119.
DR   EnsemblGenomes-Gn; EBG00001114120.
DR   EnsemblGenomes-Gn; EBG00001114121.
DR   EnsemblGenomes-Gn; EBG00001114122.
DR   EnsemblGenomes-Gn; EBG00001114123.
DR   EnsemblGenomes-Gn; EBG00001114124.
DR   EnsemblGenomes-Gn; EBG00001114125.
DR   EnsemblGenomes-Gn; EBG00001114126.
DR   EnsemblGenomes-Gn; EBG00001114128.
DR   EnsemblGenomes-Gn; EBG00001114129.
DR   EnsemblGenomes-Gn; EBG00001114130.
DR   EnsemblGenomes-Gn; EBG00001114131.
DR   EnsemblGenomes-Gn; EBG00001114132.
DR   EnsemblGenomes-Gn; EBG00001114133.
DR   EnsemblGenomes-Gn; EBG00001114134.
DR   EnsemblGenomes-Gn; EBG00001114135.
DR   EnsemblGenomes-Gn; EBG00001114136.
DR   EnsemblGenomes-Gn; EBG00001114137.
DR   EnsemblGenomes-Gn; EBG00001114138.
DR   EnsemblGenomes-Gn; EBG00001114139.
DR   EnsemblGenomes-Gn; EBG00001114140.
DR   EnsemblGenomes-Gn; EBG00001114141.
DR   EnsemblGenomes-Gn; EBG00001114142.
DR   EnsemblGenomes-Gn; EBG00001114143.
DR   EnsemblGenomes-Gn; EBG00001114144.
DR   EnsemblGenomes-Gn; EBG00001114145.
DR   EnsemblGenomes-Gn; EBG00001114146.
DR   EnsemblGenomes-Gn; EBG00001114147.
DR   EnsemblGenomes-Gn; EBG00001114148.
DR   EnsemblGenomes-Gn; EBG00001114149.
DR   EnsemblGenomes-Gn; EBG00001114150.
DR   EnsemblGenomes-Gn; EBG00001114151.
DR   EnsemblGenomes-Gn; EBG00001114152.
DR   EnsemblGenomes-Gn; EBG00001114153.
DR   EnsemblGenomes-Gn; EBG00001114154.
DR   EnsemblGenomes-Gn; EBG00001114155.
DR   EnsemblGenomes-Gn; EBG00001114156.
DR   EnsemblGenomes-Gn; EBG00001114157.
DR   EnsemblGenomes-Gn; EBG00001114158.
DR   EnsemblGenomes-Gn; EBG00001114159.
DR   EnsemblGenomes-Gn; EBG00001114160.
DR   EnsemblGenomes-Gn; EBG00001114161.
DR   EnsemblGenomes-Gn; EBG00001114162.
DR   EnsemblGenomes-Gn; EBG00001114163.
DR   EnsemblGenomes-Gn; EBG00001114164.
DR   EnsemblGenomes-Gn; EBG00001114165.
DR   EnsemblGenomes-Gn; EBG00001114166.
DR   EnsemblGenomes-Gn; EBG00001114167.
DR   EnsemblGenomes-Gn; EBG00001114168.
DR   EnsemblGenomes-Gn; EBG00001114169.
DR   EnsemblGenomes-Gn; EBG00001114170.
DR   EnsemblGenomes-Gn; EBG00001114171.
DR   EnsemblGenomes-Gn; EBG00001114172.
DR   EnsemblGenomes-Gn; EBG00001114173.
DR   EnsemblGenomes-Gn; EBG00001114174.
DR   EnsemblGenomes-Gn; EBG00001114175.
DR   EnsemblGenomes-Gn; EBG00001114176.
DR   EnsemblGenomes-Gn; EBG00001114177.
DR   EnsemblGenomes-Gn; EBG00001114178.
DR   EnsemblGenomes-Gn; EBG00001114179.
DR   EnsemblGenomes-Gn; EBG00001114180.
DR   EnsemblGenomes-Gn; EBG00001114181.
DR   EnsemblGenomes-Gn; EBG00001114182.
DR   EnsemblGenomes-Gn; EBG00001114183.
DR   EnsemblGenomes-Gn; EBG00001114184.
DR   EnsemblGenomes-Gn; EBG00001114185.
DR   EnsemblGenomes-Gn; EBG00001114186.
DR   EnsemblGenomes-Gn; EBG00001114187.
DR   EnsemblGenomes-Gn; EBG00001114188.
DR   EnsemblGenomes-Gn; EBG00001114189.
DR   EnsemblGenomes-Gn; EBG00001114190.
DR   EnsemblGenomes-Gn; EBG00001114191.
DR   EnsemblGenomes-Gn; EBG00001114192.
DR   EnsemblGenomes-Gn; EBG00001114193.
DR   EnsemblGenomes-Gn; EBG00001114194.
DR   EnsemblGenomes-Gn; EBG00001114195.
DR   EnsemblGenomes-Gn; EBG00001114196.
DR   EnsemblGenomes-Gn; EBG00001114197.
DR   EnsemblGenomes-Gn; EBG00001114198.
DR   EnsemblGenomes-Gn; EBG00001114199.
DR   EnsemblGenomes-Gn; EBG00001114200.
DR   EnsemblGenomes-Gn; EBG00001114201.
DR   EnsemblGenomes-Gn; EBG00001114202.
DR   EnsemblGenomes-Gn; EBG00001114203.
DR   EnsemblGenomes-Gn; EBG00001114204.
DR   EnsemblGenomes-Gn; EBG00001114205.
DR   EnsemblGenomes-Gn; EBG00001114206.
DR   EnsemblGenomes-Gn; EBG00001114207.
DR   EnsemblGenomes-Gn; EBG00001114208.
DR   EnsemblGenomes-Gn; EBG00001114209.
DR   EnsemblGenomes-Gn; EBG00001114210.
DR   EnsemblGenomes-Gn; EBG00001114211.
DR   EnsemblGenomes-Gn; EBG00001114212.
DR   EnsemblGenomes-Gn; EBG00001114213.
DR   EnsemblGenomes-Gn; EBG00001114214.
DR   EnsemblGenomes-Gn; EBG00001114215.
DR   EnsemblGenomes-Gn; EBG00001114216.
DR   EnsemblGenomes-Gn; EBG00001114217.
DR   EnsemblGenomes-Gn; EBG00001114218.
DR   EnsemblGenomes-Gn; EBG00001114219.
DR   EnsemblGenomes-Gn; EBG00001114220.
DR   EnsemblGenomes-Gn; EBG00001114221.
DR   EnsemblGenomes-Gn; EBG00001114222.
DR   EnsemblGenomes-Gn; EBG00001114223.
DR   EnsemblGenomes-Gn; EBG00001114224.
DR   EnsemblGenomes-Gn; MFS40622_R0001.
DR   EnsemblGenomes-Gn; MFS40622_R0002.
DR   EnsemblGenomes-Gn; MFS40622_R0003.
DR   EnsemblGenomes-Gn; MFS40622_R0004.
DR   EnsemblGenomes-Gn; MFS40622_R0005.
DR   EnsemblGenomes-Gn; MFS40622_R0006.
DR   EnsemblGenomes-Gn; MFS40622_R0007.
DR   EnsemblGenomes-Gn; MFS40622_R0008.
DR   EnsemblGenomes-Gn; MFS40622_R0009.
DR   EnsemblGenomes-Gn; MFS40622_R0010.
DR   EnsemblGenomes-Gn; MFS40622_R0011.
DR   EnsemblGenomes-Gn; MFS40622_R0012.
DR   EnsemblGenomes-Gn; MFS40622_R0013.
DR   EnsemblGenomes-Gn; MFS40622_R0014.
DR   EnsemblGenomes-Gn; MFS40622_R0015.
DR   EnsemblGenomes-Gn; MFS40622_R0016.
DR   EnsemblGenomes-Gn; MFS40622_R0017.
DR   EnsemblGenomes-Gn; MFS40622_R0018.
DR   EnsemblGenomes-Gn; MFS40622_R0019.
DR   EnsemblGenomes-Gn; MFS40622_R0020.
DR   EnsemblGenomes-Gn; MFS40622_R0021.
DR   EnsemblGenomes-Gn; MFS40622_R0022.
DR   EnsemblGenomes-Gn; MFS40622_R0023.
DR   EnsemblGenomes-Gn; MFS40622_R0024.
DR   EnsemblGenomes-Gn; MFS40622_R0025.
DR   EnsemblGenomes-Gn; MFS40622_R0026.
DR   EnsemblGenomes-Gn; MFS40622_R0027.
DR   EnsemblGenomes-Gn; MFS40622_R0028.
DR   EnsemblGenomes-Gn; MFS40622_R0029.
DR   EnsemblGenomes-Gn; MFS40622_R0030.
DR   EnsemblGenomes-Gn; MFS40622_R0031.
DR   EnsemblGenomes-Gn; MFS40622_R0032.
DR   EnsemblGenomes-Gn; MFS40622_R0033.
DR   EnsemblGenomes-Gn; MFS40622_R0034.
DR   EnsemblGenomes-Gn; MFS40622_R0035.
DR   EnsemblGenomes-Gn; MFS40622_R0036.
DR   EnsemblGenomes-Gn; MFS40622_R0037.
DR   EnsemblGenomes-Gn; MFS40622_R0038.
DR   EnsemblGenomes-Gn; MFS40622_R0039.
DR   EnsemblGenomes-Gn; MFS40622_R0040.
DR   EnsemblGenomes-Gn; MFS40622_R0041.
DR   EnsemblGenomes-Gn; MFS40622_R0042.
DR   EnsemblGenomes-Gn; MFS40622_R0043.
DR   EnsemblGenomes-Gn; MFS40622_R0044.
DR   EnsemblGenomes-Tr; EBT00001705084.
DR   EnsemblGenomes-Tr; EBT00001705085.
DR   EnsemblGenomes-Tr; EBT00001705086.
DR   EnsemblGenomes-Tr; EBT00001705087.
DR   EnsemblGenomes-Tr; EBT00001705088.
DR   EnsemblGenomes-Tr; EBT00001705089.
DR   EnsemblGenomes-Tr; EBT00001705090.
DR   EnsemblGenomes-Tr; EBT00001705091.
DR   EnsemblGenomes-Tr; EBT00001705092.
DR   EnsemblGenomes-Tr; EBT00001705093.
DR   EnsemblGenomes-Tr; EBT00001705094.
DR   EnsemblGenomes-Tr; EBT00001705095.
DR   EnsemblGenomes-Tr; EBT00001705096.
DR   EnsemblGenomes-Tr; EBT00001705097.
DR   EnsemblGenomes-Tr; EBT00001705098.
DR   EnsemblGenomes-Tr; EBT00001705099.
DR   EnsemblGenomes-Tr; EBT00001705100.
DR   EnsemblGenomes-Tr; EBT00001705101.
DR   EnsemblGenomes-Tr; EBT00001705102.
DR   EnsemblGenomes-Tr; EBT00001705103.
DR   EnsemblGenomes-Tr; EBT00001705104.
DR   EnsemblGenomes-Tr; EBT00001705105.
DR   EnsemblGenomes-Tr; EBT00001705107.
DR   EnsemblGenomes-Tr; EBT00001705108.
DR   EnsemblGenomes-Tr; EBT00001705109.
DR   EnsemblGenomes-Tr; EBT00001705110.
DR   EnsemblGenomes-Tr; EBT00001705111.
DR   EnsemblGenomes-Tr; EBT00001705112.
DR   EnsemblGenomes-Tr; EBT00001705113.
DR   EnsemblGenomes-Tr; EBT00001705114.
DR   EnsemblGenomes-Tr; EBT00001705115.
DR   EnsemblGenomes-Tr; EBT00001705116.
DR   EnsemblGenomes-Tr; EBT00001705117.
DR   EnsemblGenomes-Tr; EBT00001705118.
DR   EnsemblGenomes-Tr; EBT00001705119.
DR   EnsemblGenomes-Tr; EBT00001705120.
DR   EnsemblGenomes-Tr; EBT00001705121.
DR   EnsemblGenomes-Tr; EBT00001705122.
DR   EnsemblGenomes-Tr; EBT00001705123.
DR   EnsemblGenomes-Tr; EBT00001705124.
DR   EnsemblGenomes-Tr; EBT00001705125.
DR   EnsemblGenomes-Tr; EBT00001705126.
DR   EnsemblGenomes-Tr; EBT00001705127.
DR   EnsemblGenomes-Tr; EBT00001705128.
DR   EnsemblGenomes-Tr; EBT00001705129.
DR   EnsemblGenomes-Tr; EBT00001705130.
DR   EnsemblGenomes-Tr; EBT00001705131.
DR   EnsemblGenomes-Tr; EBT00001705132.
DR   EnsemblGenomes-Tr; EBT00001705133.
DR   EnsemblGenomes-Tr; EBT00001705134.
DR   EnsemblGenomes-Tr; EBT00001705135.
DR   EnsemblGenomes-Tr; EBT00001705136.
DR   EnsemblGenomes-Tr; EBT00001705137.
DR   EnsemblGenomes-Tr; EBT00001705138.
DR   EnsemblGenomes-Tr; EBT00001705139.
DR   EnsemblGenomes-Tr; EBT00001705140.
DR   EnsemblGenomes-Tr; EBT00001705141.
DR   EnsemblGenomes-Tr; EBT00001705142.
DR   EnsemblGenomes-Tr; EBT00001705143.
DR   EnsemblGenomes-Tr; EBT00001705144.
DR   EnsemblGenomes-Tr; EBT00001705145.
DR   EnsemblGenomes-Tr; EBT00001705146.
DR   EnsemblGenomes-Tr; EBT00001705147.
DR   EnsemblGenomes-Tr; EBT00001705148.
DR   EnsemblGenomes-Tr; EBT00001705149.
DR   EnsemblGenomes-Tr; EBT00001705150.
DR   EnsemblGenomes-Tr; EBT00001705151.
DR   EnsemblGenomes-Tr; EBT00001705152.
DR   EnsemblGenomes-Tr; EBT00001705153.
DR   EnsemblGenomes-Tr; EBT00001705154.
DR   EnsemblGenomes-Tr; EBT00001705155.
DR   EnsemblGenomes-Tr; EBT00001705156.
DR   EnsemblGenomes-Tr; EBT00001705157.
DR   EnsemblGenomes-Tr; EBT00001705158.
DR   EnsemblGenomes-Tr; EBT00001705159.
DR   EnsemblGenomes-Tr; EBT00001705160.
DR   EnsemblGenomes-Tr; EBT00001705161.
DR   EnsemblGenomes-Tr; EBT00001705162.
DR   EnsemblGenomes-Tr; EBT00001705163.
DR   EnsemblGenomes-Tr; EBT00001705164.
DR   EnsemblGenomes-Tr; EBT00001705165.
DR   EnsemblGenomes-Tr; EBT00001705166.
DR   EnsemblGenomes-Tr; EBT00001705167.
DR   EnsemblGenomes-Tr; EBT00001705168.
DR   EnsemblGenomes-Tr; EBT00001705169.
DR   EnsemblGenomes-Tr; EBT00001705170.
DR   EnsemblGenomes-Tr; EBT00001705171.
DR   EnsemblGenomes-Tr; EBT00001705172.
DR   EnsemblGenomes-Tr; EBT00001705173.
DR   EnsemblGenomes-Tr; EBT00001705174.
DR   EnsemblGenomes-Tr; EBT00001705175.
DR   EnsemblGenomes-Tr; EBT00001705176.
DR   EnsemblGenomes-Tr; EBT00001705177.
DR   EnsemblGenomes-Tr; EBT00001705178.
DR   EnsemblGenomes-Tr; EBT00001705179.
DR   EnsemblGenomes-Tr; EBT00001705180.
DR   EnsemblGenomes-Tr; EBT00001705182.
DR   EnsemblGenomes-Tr; EBT00001705183.
DR   EnsemblGenomes-Tr; EBT00001705184.
DR   EnsemblGenomes-Tr; EBT00001705185.
DR   EnsemblGenomes-Tr; EBT00001705186.
DR   EnsemblGenomes-Tr; EBT00001705187.
DR   EnsemblGenomes-Tr; EBT00001705188.
DR   EnsemblGenomes-Tr; EBT00001705189.
DR   EnsemblGenomes-Tr; EBT00001705190.
DR   EnsemblGenomes-Tr; EBT00001705191.
DR   EnsemblGenomes-Tr; EBT00001705192.
DR   EnsemblGenomes-Tr; EBT00001705193.
DR   EnsemblGenomes-Tr; EBT00001705194.
DR   EnsemblGenomes-Tr; EBT00001705195.
DR   EnsemblGenomes-Tr; EBT00001705196.
DR   EnsemblGenomes-Tr; EBT00001705197.
DR   EnsemblGenomes-Tr; EBT00001705198.
DR   EnsemblGenomes-Tr; EBT00001705199.
DR   EnsemblGenomes-Tr; EBT00001705200.
DR   EnsemblGenomes-Tr; EBT00001705201.
DR   EnsemblGenomes-Tr; EBT00001705202.
DR   EnsemblGenomes-Tr; EBT00001705203.
DR   EnsemblGenomes-Tr; EBT00001705204.
DR   EnsemblGenomes-Tr; EBT00001705205.
DR   EnsemblGenomes-Tr; EBT00001705206.
DR   EnsemblGenomes-Tr; EBT00001705207.
DR   EnsemblGenomes-Tr; EBT00001705208.
DR   EnsemblGenomes-Tr; EBT00001705209.
DR   EnsemblGenomes-Tr; EBT00001705210.
DR   EnsemblGenomes-Tr; EBT00001705211.
DR   EnsemblGenomes-Tr; EBT00001705212.
DR   EnsemblGenomes-Tr; EBT00001705213.
DR   EnsemblGenomes-Tr; EBT00001705214.
DR   EnsemblGenomes-Tr; EBT00001705215.
DR   EnsemblGenomes-Tr; EBT00001705216.
DR   EnsemblGenomes-Tr; EBT00001705217.
DR   EnsemblGenomes-Tr; EBT00001705218.
DR   EnsemblGenomes-Tr; EBT00001705219.
DR   EnsemblGenomes-Tr; EBT00001705220.
DR   EnsemblGenomes-Tr; EBT00001705221.
DR   EnsemblGenomes-Tr; EBT00001705222.
DR   EnsemblGenomes-Tr; EBT00001705223.
DR   EnsemblGenomes-Tr; EBT00001705224.
DR   EnsemblGenomes-Tr; EBT00001705225.
DR   EnsemblGenomes-Tr; EBT00001705226.
DR   EnsemblGenomes-Tr; EBT00001705227.
DR   EnsemblGenomes-Tr; EBT00001705228.
DR   EnsemblGenomes-Tr; EBT00001705229.
DR   EnsemblGenomes-Tr; EBT00001705230.
DR   EnsemblGenomes-Tr; EBT00001705231.
DR   EnsemblGenomes-Tr; EBT00001705232.
DR   EnsemblGenomes-Tr; EBT00001705233.
DR   EnsemblGenomes-Tr; EBT00001705234.
DR   EnsemblGenomes-Tr; EBT00001705235.
DR   EnsemblGenomes-Tr; EBT00001705236.
DR   EnsemblGenomes-Tr; EBT00001705237.
DR   EnsemblGenomes-Tr; EBT00001705238.
DR   EnsemblGenomes-Tr; EBT00001705239.
DR   EnsemblGenomes-Tr; EBT00001705240.
DR   EnsemblGenomes-Tr; EBT00001705241.
DR   EnsemblGenomes-Tr; EBT00001705242.
DR   EnsemblGenomes-Tr; EBT00001705243.
DR   EnsemblGenomes-Tr; EBT00001705244.
DR   EnsemblGenomes-Tr; EBT00001705245.
DR   EnsemblGenomes-Tr; EBT00001705246.
DR   EnsemblGenomes-Tr; EBT00001705247.
DR   EnsemblGenomes-Tr; EBT00001705248.
DR   EnsemblGenomes-Tr; EBT00001705249.
DR   EnsemblGenomes-Tr; EBT00001705250.
DR   EnsemblGenomes-Tr; EBT00001705251.
DR   EnsemblGenomes-Tr; EBT00001705252.
DR   EnsemblGenomes-Tr; EBT00001705253.
DR   EnsemblGenomes-Tr; EBT00001705254.
DR   EnsemblGenomes-Tr; EBT00001705255.
DR   EnsemblGenomes-Tr; EBT00001705256.
DR   EnsemblGenomes-Tr; EBT00001705257.
DR   EnsemblGenomes-Tr; EBT00001705258.
DR   EnsemblGenomes-Tr; EBT00001705259.
DR   EnsemblGenomes-Tr; EBT00001705260.
DR   EnsemblGenomes-Tr; EBT00001705261.
DR   EnsemblGenomes-Tr; EBT00001705262.
DR   EnsemblGenomes-Tr; EBT00001705263.
DR   EnsemblGenomes-Tr; EBT00001705264.
DR   EnsemblGenomes-Tr; EBT00001705265.
DR   EnsemblGenomes-Tr; EBT00001705266.
DR   EnsemblGenomes-Tr; EBT00001705267.
DR   EnsemblGenomes-Tr; EBT00001705268.
DR   EnsemblGenomes-Tr; EBT00001705269.
DR   EnsemblGenomes-Tr; EBT00001705270.
DR   EnsemblGenomes-Tr; EBT00001705271.
DR   EnsemblGenomes-Tr; EBT00001705272.
DR   EnsemblGenomes-Tr; EBT00001705273.
DR   EnsemblGenomes-Tr; EBT00001705274.
DR   EnsemblGenomes-Tr; EBT00001705275.
DR   EnsemblGenomes-Tr; EBT00001705276.
DR   EnsemblGenomes-Tr; EBT00001705277.
DR   EnsemblGenomes-Tr; EBT00001705278.
DR   EnsemblGenomes-Tr; EBT00001705279.
DR   EnsemblGenomes-Tr; EBT00001705280.
DR   EnsemblGenomes-Tr; EBT00001705281.
DR   EnsemblGenomes-Tr; EBT00001705282.
DR   EnsemblGenomes-Tr; EBT00001705283.
DR   EnsemblGenomes-Tr; EBT00001705284.
DR   EnsemblGenomes-Tr; EBT00001705285.
DR   EnsemblGenomes-Tr; EBT00001705286.
DR   EnsemblGenomes-Tr; EBT00001705287.
DR   EnsemblGenomes-Tr; EBT00001705288.
DR   EnsemblGenomes-Tr; EBT00001705289.
DR   EnsemblGenomes-Tr; EBT00001705290.
DR   EnsemblGenomes-Tr; EBT00001705291.
DR   EnsemblGenomes-Tr; EBT00001705292.
DR   EnsemblGenomes-Tr; EBT00001705293.
DR   EnsemblGenomes-Tr; EBT00001705294.
DR   EnsemblGenomes-Tr; EBT00001705295.
DR   EnsemblGenomes-Tr; EBT00001705296.
DR   EnsemblGenomes-Tr; EBT00001705297.
DR   EnsemblGenomes-Tr; EBT00001705298.
DR   EnsemblGenomes-Tr; EBT00001705299.
DR   EnsemblGenomes-Tr; EBT00001705300.
DR   EnsemblGenomes-Tr; EBT00001705301.
DR   EnsemblGenomes-Tr; EBT00001705302.
DR   EnsemblGenomes-Tr; EBT00001705303.
DR   EnsemblGenomes-Tr; EBT00001705304.
DR   EnsemblGenomes-Tr; EBT00001705305.
DR   EnsemblGenomes-Tr; EBT00001705306.
DR   EnsemblGenomes-Tr; EBT00001705307.
DR   EnsemblGenomes-Tr; EBT00001705308.
DR   EnsemblGenomes-Tr; EBT00001705309.
DR   EnsemblGenomes-Tr; EBT00001705310.
DR   EnsemblGenomes-Tr; EBT00001705311.
DR   EnsemblGenomes-Tr; EBT00001705312.
DR   EnsemblGenomes-Tr; EBT00001705313.
DR   EnsemblGenomes-Tr; EBT00001705314.
DR   EnsemblGenomes-Tr; EBT00001705315.
DR   EnsemblGenomes-Tr; EBT00001705316.
DR   EnsemblGenomes-Tr; EBT00001705317.
DR   EnsemblGenomes-Tr; EBT00001705318.
DR   EnsemblGenomes-Tr; EBT00001705319.
DR   EnsemblGenomes-Tr; EBT00001705320.
DR   EnsemblGenomes-Tr; EBT00001705321.
DR   EnsemblGenomes-Tr; EBT00001705322.
DR   EnsemblGenomes-Tr; EBT00001705323.
DR   EnsemblGenomes-Tr; EBT00001705324.
DR   EnsemblGenomes-Tr; EBT00001705325.
DR   EnsemblGenomes-Tr; EBT00001705326.
DR   EnsemblGenomes-Tr; EBT00001705327.
DR   EnsemblGenomes-Tr; EBT00001705328.
DR   EnsemblGenomes-Tr; EBT00001705329.
DR   EnsemblGenomes-Tr; EBT00001705330.
DR   EnsemblGenomes-Tr; EBT00001705331.
DR   EnsemblGenomes-Tr; EBT00001705332.
DR   EnsemblGenomes-Tr; EBT00001705333.
DR   EnsemblGenomes-Tr; EBT00001705334.
DR   EnsemblGenomes-Tr; EBT00001705335.
DR   EnsemblGenomes-Tr; EBT00001705336.
DR   EnsemblGenomes-Tr; EBT00001705337.
DR   EnsemblGenomes-Tr; EBT00001705338.
DR   EnsemblGenomes-Tr; EBT00001705339.
DR   EnsemblGenomes-Tr; EBT00001705340.
DR   EnsemblGenomes-Tr; EBT00001705341.
DR   EnsemblGenomes-Tr; EBT00001705342.
DR   EnsemblGenomes-Tr; EBT00001705343.
DR   EnsemblGenomes-Tr; EBT00001705344.
DR   EnsemblGenomes-Tr; EBT00001705345.
DR   EnsemblGenomes-Tr; EBT00001705346.
DR   EnsemblGenomes-Tr; EBT00001705347.
DR   EnsemblGenomes-Tr; EBT00001705348.
DR   EnsemblGenomes-Tr; EBT00001705349.
DR   EnsemblGenomes-Tr; EBT00001705350.
DR   EnsemblGenomes-Tr; EBT00001705351.
DR   EnsemblGenomes-Tr; EBT00001705352.
DR   EnsemblGenomes-Tr; EBT00001705353.
DR   EnsemblGenomes-Tr; EBT00001705354.
DR   EnsemblGenomes-Tr; EBT00001705355.
DR   EnsemblGenomes-Tr; EBT00001705356.
DR   EnsemblGenomes-Tr; EBT00001705357.
DR   EnsemblGenomes-Tr; EBT00001705358.
DR   EnsemblGenomes-Tr; EBT00001705359.
DR   EnsemblGenomes-Tr; EBT00001705360.
DR   EnsemblGenomes-Tr; EBT00001705361.
DR   EnsemblGenomes-Tr; EBT00001705362.
DR   EnsemblGenomes-Tr; EBT00001705363.
DR   EnsemblGenomes-Tr; EBT00001705364.
DR   EnsemblGenomes-Tr; EBT00001705365.
DR   EnsemblGenomes-Tr; EBT00001705366.
DR   EnsemblGenomes-Tr; EBT00001705367.
DR   EnsemblGenomes-Tr; EBT00001705368.
DR   EnsemblGenomes-Tr; EBT00001705369.
DR   EnsemblGenomes-Tr; EBT00001705370.
DR   EnsemblGenomes-Tr; EBT00001705371.
DR   EnsemblGenomes-Tr; EBT00001705372.
DR   EnsemblGenomes-Tr; EBT00001705373.
DR   EnsemblGenomes-Tr; EBT00001705374.
DR   EnsemblGenomes-Tr; EBT00001705375.
DR   EnsemblGenomes-Tr; EBT00001705376.
DR   EnsemblGenomes-Tr; EBT00001705377.
DR   EnsemblGenomes-Tr; EBT00001705378.
DR   EnsemblGenomes-Tr; EBT00001705379.
DR   EnsemblGenomes-Tr; EBT00001705380.
DR   EnsemblGenomes-Tr; MFS40622_R0001-1.
DR   EnsemblGenomes-Tr; MFS40622_R0002-1.
DR   EnsemblGenomes-Tr; MFS40622_R0003-1.
DR   EnsemblGenomes-Tr; MFS40622_R0004-1.
DR   EnsemblGenomes-Tr; MFS40622_R0005-1.
DR   EnsemblGenomes-Tr; MFS40622_R0006-1.
DR   EnsemblGenomes-Tr; MFS40622_R0007-1.
DR   EnsemblGenomes-Tr; MFS40622_R0008-1.
DR   EnsemblGenomes-Tr; MFS40622_R0009-1.
DR   EnsemblGenomes-Tr; MFS40622_R0010-1.
DR   EnsemblGenomes-Tr; MFS40622_R0011-1.
DR   EnsemblGenomes-Tr; MFS40622_R0012-1.
DR   EnsemblGenomes-Tr; MFS40622_R0013-1.
DR   EnsemblGenomes-Tr; MFS40622_R0014-1.
DR   EnsemblGenomes-Tr; MFS40622_R0015-1.
DR   EnsemblGenomes-Tr; MFS40622_R0016-1.
DR   EnsemblGenomes-Tr; MFS40622_R0017-1.
DR   EnsemblGenomes-Tr; MFS40622_R0018-1.
DR   EnsemblGenomes-Tr; MFS40622_R0019-1.
DR   EnsemblGenomes-Tr; MFS40622_R0020-1.
DR   EnsemblGenomes-Tr; MFS40622_R0021-1.
DR   EnsemblGenomes-Tr; MFS40622_R0022-1.
DR   EnsemblGenomes-Tr; MFS40622_R0023-1.
DR   EnsemblGenomes-Tr; MFS40622_R0024-1.
DR   EnsemblGenomes-Tr; MFS40622_R0025-1.
DR   EnsemblGenomes-Tr; MFS40622_R0026-1.
DR   EnsemblGenomes-Tr; MFS40622_R0027-1.
DR   EnsemblGenomes-Tr; MFS40622_R0028-1.
DR   EnsemblGenomes-Tr; MFS40622_R0029-1.
DR   EnsemblGenomes-Tr; MFS40622_R0030-1.
DR   EnsemblGenomes-Tr; MFS40622_R0031-1.
DR   EnsemblGenomes-Tr; MFS40622_R0032-1.
DR   EnsemblGenomes-Tr; MFS40622_R0033-1.
DR   EnsemblGenomes-Tr; MFS40622_R0034-1.
DR   EnsemblGenomes-Tr; MFS40622_R0035-1.
DR   EnsemblGenomes-Tr; MFS40622_R0036-1.
DR   EnsemblGenomes-Tr; MFS40622_R0037-1.
DR   EnsemblGenomes-Tr; MFS40622_R0038-1.
DR   EnsemblGenomes-Tr; MFS40622_R0039-1.
DR   EnsemblGenomes-Tr; MFS40622_R0040-1.
DR   EnsemblGenomes-Tr; MFS40622_R0041-1.
DR   EnsemblGenomes-Tr; MFS40622_R0042-1.
DR   EnsemblGenomes-Tr; MFS40622_R0043-1.
DR   EnsemblGenomes-Tr; MFS40622_R0044-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00062; HgcC.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01122; sR39.
DR   RFAM; RF01125; sR4.
DR   RFAM; RF01139; sR2.
DR   RFAM; RF01152; sR1.
DR   RFAM; RF01311; sR8.
DR   RFAM; RF01326; CRISPR-DR13.
DR   RFAM; RF01358; CRISPR-DR39.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001901.
DR   SILVA-SSU; CP001901.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086483
CC   Source DNA and organism available from William B. Whitman
CC   (whitman@uga.edu)
CC   Contacts: William B. Whitman (whitman@uga.edu)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Methanocaldococcus sp FS406-22
CC   GOLD Stamp ID         :: Gi02050
CC   Greengenes ID         :: 179917
CC   Isolation Site        :: Deep-sea hydrothermal vent from Pacific
CC                            Ocean Axial volcano on the Juan de Fuca
CC                            Ridge
CC   Latitude              :: 23.366667
CC   Longitude             :: -44.933333
CC   Cell Shape            :: Coccus-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 90C
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Deep sea, Hydrothermal vent, Marine
CC   Phenotypes            :: Piezophile
CC   Energy Source         :: Lithotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1760939
FT                   /organism="Methanocaldococcus sp. FS406-22"
FT                   /strain="FS406-22"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:644281"
FT   gene            49..711
FT                   /locus_tag="MFS40622_0001"
FT   CDS_pept        49..711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0001"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: H+transporting two-sector ATPase C subunit;
FT                   KEGG: mja:MJ0221 V-type ATP synthase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68702"
FT                   /db_xref="GOA:D3S6P2"
FT                   /db_xref="InterPro:IPR000245"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P2"
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /protein_id="ADC68702.1"
FT                   /translation="MVDPLILGAVGAGLAVGIAGLGSGIGAGITGASGAGVVAEDPNKF
FT                   GTAIVFQALPQTQGLYGFLVAILILFVFKTVSPWAMFAAGLAVGLAGLSAIGQGIAASA
FT                   GLGAVAEDNSIFGKAMVFSVLPETQAIYGLLIAILLLVGVFKGNAGAETVAALGAGFAV
FT                   GFAGLSGIGQGITAAGAIGATARDPDAMGKGLVLAVMPETFAIFGLLIAILIMLMIK"
FT   gene            775..1386
FT                   /locus_tag="MFS40622_0002"
FT   CDS_pept        775..1386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0002"
FT                   /product="H(+)-transporting two-sector ATPase E subunit"
FT                   /note="PFAM: H+transporting two-sector ATPase E subunit;
FT                   KEGG: mja:MJ0220 H+-transporting ATP synthase, subunit E
FT                   (AtpE)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68703"
FT                   /db_xref="GOA:D3S6P3"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P3"
FT                   /inference="protein motif:PFAM:PF01991"
FT                   /protein_id="ADC68703.1"
FT                   /translation="MGVDKIKAKILEDAKAEANKIISEAEEEKAKILEKAKEEAEKRKA
FT                   EILKKGEKEAEMTKSRIISEAKLEAKKKLLEAKEEIIEMAINKLKEELVKLPEQPEYKD
FT                   KLVNLIKDGAVSLGGGELIVRLNSRDMELIEDSTLWNLEKEIESITKKVTVLKKGDPVD
FT                   IIGGCIIETADGLKSLDNSLEAIFNRNLNVIRARITEKLF"
FT   gene            1403..2602
FT                   /locus_tag="MFS40622_0003"
FT   CDS_pept        1403..2602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0003"
FT                   /product="ATP synthase A1, C subunit"
FT                   /note="TIGRFAM: ATP synthase A1, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C (AC39) subunit; KEGG:
FT                   mja:MJ0219 V-type ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68704"
FT                   /db_xref="GOA:D3S6P4"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P4"
FT                   /inference="protein motif:TFAM:TIGR02923"
FT                   /protein_id="ADC68704.1"
FT                   /translation="MAMDIETLLNLEKLYSVIMTYFDNPLTLLIVIATVIIVLIVIVWI
FT                   TKMVIDLAPYAYVNARIRSKEAKLLDDAKLNELIESGSLEELVGLLEDTDYGQYVVEVM
FT                   NELKDPVAVEKALDMYLADLYGLIYRMSPDSAKKVLKVFAKKFDIKNIKTLIRAKFVGL
FT                   SAEETYALLIPLGNIPVEKLKELAEVKTVEEVVRGLDGTEYFKILQEELSNYDQTSNII
FT                   GFELALDRYYLESLRKTIMTEGKEEDLFREFVGTIIDVENLKVILKGKADGLSAEELSK
FT                   YVTLTGYELADWKLKDLMSAGGIEGVLSGLEGTSYADVLAEAMEEFEKTKSIYAFEKAL
FT                   DKFVLEKGKKLSTRKPFGVGPIIGLIVSKELEVKNLKAIIKGKIENLKPEEIRNLLVTL
FT                   "
FT   gene            2612..2908
FT                   /locus_tag="MFS40622_0004"
FT   CDS_pept        2612..2908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0004"
FT                   /product="Vacuolar H+transporting two-sector ATPase F
FT                   subunit"
FT                   /note="PFAM: Vacuolar H+transporting two-sector ATPase F
FT                   subunit; KEGG: mja:MJ0218 V-type ATP synthase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68705"
FT                   /db_xref="GOA:D3S6P5"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P5"
FT                   /inference="protein motif:PFAM:PF01990"
FT                   /protein_id="ADC68705.1"
FT                   /translation="MKVGVVGDRETAIGFRLAGLTDVYEVKNDEEAVKAINELANNENI
FT                   AFIIITERIAESIKDKLKNINKVIVEIPDKHGKLERIDPVKELIRKAIGVSMK"
FT   gene            2942..4705
FT                   /locus_tag="MFS40622_0005"
FT   CDS_pept        2942..4705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0005"
FT                   /product="ATP synthase, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: mja:MJ0217 V-type ATP synthase subunit A;
FT                   TIGRFAM: ATP synthase, A subunit; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68706"
FT                   /db_xref="GOA:D3S6P6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P6"
FT                   /inference="protein motif:TFAM:TIGR01043"
FT                   /protein_id="ADC68706.1"
FT                   /translation="MPVVGKIIKIAGPVVVAEGMKGAQMYEVVKVGEEKLTGEIIQLHD
FT                   DKAVIQVYEETSGIKPGEPVVGTGAPLSVELGPGMLRAMYDGIQRPLTAIEEKTGSIFI
FT                   PRGVDVPALPRDIKWEFKPVVNEGAYVEEGDIIGTVDETPSIVHKILVPIGVKGKIVEI
FT                   KEGKFTVEETVAVVEMENGERKEITMMQKWPVRKPRPYKEKLPPEIPLITGQRVEDTFF
FT                   TLAKGGTAAIPGPFGSGKTVTQHQLAKWSDADVVVYIGCGERGNEMTEVIEEFPHLKDI
FT                   RTGNKLMDRTVLIANTSNMPVAAREASVYTGITIAEYFRDMGYGVLLTADSTSRWAEAM
FT                   REISGRLEEMPGEEGYPAYLASRLAQFYERAGRVITLGQDNRQGFVCIVGAVSPPGGDF
FT                   SEPVTSNTLRIVKVFWALDANLARRRHFPAINWLQSYSLYIDDVTEWWNANTGPDWRQL
FT                   RDEAMGLLQKEAELQEIVQLVGPDALPDRERVILEVARMLREDFLQQDAFDEVDTYCPP
FT                   MKQYLMLKIIMTFYQEALKAVERGVEPAKILKVSVKQDIARMKYIPHDEFINVKSKEIM
FT                   EKVKNELGSLN"
FT   gene            4752..6149
FT                   /locus_tag="MFS40622_0006"
FT   CDS_pept        4752..6149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0006"
FT                   /product="ATP synthase, B subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: mja:MJ0216 V-type ATP synthase subunit B;
FT                   TIGRFAM: ATP synthase, B subunit; PFAM: H+transporting
FT                   two-sector ATPase alpha/beta subunit central region;
FT                   H+transporting two-sector ATPase alpha/beta subunit domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68707"
FT                   /db_xref="GOA:D3S6P7"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005724"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P7"
FT                   /inference="protein motif:TFAM:TIGR01041"
FT                   /protein_id="ADC68707.1"
FT                   /translation="MATAASAIEYSSVKSIAGPLLIVEGVEGAAYGEIVEVICPDGEKR
FT                   MGQVLEAREGLAVVQVFEGTTGLSTKDTKVRFTGRTAKIGVSMEMLGRIFNGAGKPIDG
FT                   GPEIVPEKELDINGYPLNPVSRKVPSDFIQTGISTIDGMNTLVRGQKLPIFSGSGLPHN
FT                   QLAAQIARQAKVRGEGEKFAVVFAAMGITSEEANFFMEEFRKTGALERAVVFINLADDP
FT                   AIERILTPRIALTVAEYLAYEKDMHVLVILTDMTNYCEALREISAARNEVPGRRGYPGY
FT                   MYTDLATIYERAGRVKGRTGTITQIPILTMPDDDITHPIPDLTGYITEGQIVLSRELHR
FT                   KGIYPPVDVLPSLSRLAGNGQGPGKTREDHKKVVNQAYAAYAEGRSLRDLVAVVGEEAL
FT                   TDRDRAYLKFADEFEDKFVRQGKDEDRSIEETLDLLWELLAILPEEELKRIDRELIEKY
FT                   HPKYRKK"
FT   gene            6271..6735
FT                   /locus_tag="MFS40622_0007"
FT   CDS_pept        6271..6735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0007"
FT                   /product="dual specificity protein phosphatase"
FT                   /note="PFAM: Dual specificity protein phosphatase; KEGG:
FT                   mja:MJ0215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68708"
FT                   /db_xref="GOA:D3S6P8"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P8"
FT                   /inference="protein motif:PFAM:PF00782"
FT                   /protein_id="ADC68708.1"
FT                   /translation="MGKCRHNGEVSIFGVRPASFPNFPFHLMDKIGGFIILDELWLMKW
FT                   CEIIEHPMRIPTLYVPIEDYGIPTVEDMDLIVDFIKYHTSKGKEVVVSCIGGHGRTGTV
FT                   LAVWAGLNGVENPIEYVRERYCECAVETEEQEEFVEYYLEIRKKNSQIIS"
FT   gene            complement(6738..7115)
FT                   /locus_tag="MFS40622_0008"
FT   CDS_pept        complement(6738..7115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0008"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="TIGRFAM: hydrogenase nickel insertion protein HypA;
FT                   PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   mja:MJ0214 hydrogenase expression/formation protein (HypA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68709"
FT                   /db_xref="GOA:D3S6P9"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6P9"
FT                   /inference="protein motif:TFAM:TIGR00100"
FT                   /protein_id="ADC68709.1"
FT                   /translation="MHELSYATAMLEAILNSVKKEEEKGKKIKKVTEINLEVGELTFIN
FT                   VEQLKFAFEVIAEGTVCEGAKINVEFIKPKCKCLDCGYEGEPEILDEFEVYCPKCKSIR
FT                   LKLSGGKEFNIKNATVEYEEE"
FT   gene            complement(7197..7475)
FT                   /locus_tag="MFS40622_0009"
FT   CDS_pept        complement(7197..7475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0009"
FT                   /product="protein of unknown function DUF59"
FT                   /note="PFAM: protein of unknown function DUF59; KEGG:
FT                   mja:MJ1129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68710"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q0"
FT                   /inference="protein motif:PFAM:PF01883"
FT                   /protein_id="ADC68710.1"
FT                   /translation="MVTKEDVLNALKTVADPHMGISIVDMGLVRDVEVDDEGNVKFKII
FT                   PTNPYCMSVMAMAFQAKEAVKSLEGVKNVEVTVEGHVMEKDINEMLK"
FT   gene            complement(7566..9173)
FT                   /locus_tag="MFS40622_0010"
FT   CDS_pept        complement(7566..9173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0010"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mja:MJ1130 O-sialoglycoprotein
FT                   endopeptidase/protein kinase; TIGRFAM:
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22 glycoprotease; RIO-like kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68711"
FT                   /db_xref="GOA:D3S6Q1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR009220"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022449"
FT                   /db_xref="InterPro:IPR022495"
FT                   /db_xref="InterPro:IPR034680"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q1"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADC68711.1"
FT                   /translation="MICLGLEGTAEKTGVGVVTSDGEILFNKTVMYKPPKQGINPREAA
FT                   DHHAETFPKLIKEAFEVVDKNEIDLIAFSQGPGLGPSLRVTATVARTLALTLKKPIIGV
FT                   NHCIAHIEIGKLTTEAEDPLTLYVSGGNTQVIAYVSKRYRVFGETLDIAVGNCLDQFAR
FT                   YINLPHPGGPYIEELAKKGEKLIDLPYTVKGMDIAFSGLLTAAMRAYDAGERLEDICYS
FT                   LQEYAFSMLTEITERALAHTNKGEVMLVGGVAANNRLREMLKAMCKGQNVEFYVPPKEF
FT                   CGDNGAMIAWLGLLMHKNGRWMSLDETEIIPNYRTDMVEVNWIKDIKGKERKIPEHLIG
FT                   KGAEADIKKDKYLDFDVIIKERVKKSYRDERLDEKIRKSRTAREARYLAMVKDFGIPAP
FT                   YIFDVDLDNKRIMMSYINGKLAKDVIEDNLHIAYKIGEIVGKLHKNDVIHNDLTTSNFL
FT                   YDKDLYIIDFGLGKISNLDEDKAVDLIVFKKAVLSTHNEKFEEIWERFLKGYKSVYDRW
FT                   ESILDLMKDVERRARYVE"
FT   gene            complement(9377..10618)
FT                   /locus_tag="MFS40622_0011"
FT   CDS_pept        complement(9377..10618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0011"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; KEGG: mvu:Metvu_0046
FT                   transposase, IS605 OrfB family"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68712"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q2"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADC68712.1"
FT                   /translation="MVNIMQVTRVLTINLTRKLTKEQWVILNHLTYSASKLWNVANYQI
FT                   IQGNIKLSELEKKLKDNFWYKNLHSQSAQAVLQKLKIVWVNFFKQHTKRPRFQPKDGHF
FT                   LVKWKKDGFKIIGNMLRLSLSKQTRKYLKERHGIESKYLWVGLPKALPLDVVQIKEIEI
FT                   VPHDIYGQRFYVLHIIYKKEVNPVKLKEEKVMAIDLGVKNLATVVIEGEKQPLIFDGKI
FT                   LISKLRWFAKKTARIKSIIAEQGLKNCKRLARLVVKERNYVKDYIHKISRWIVDLAKEK
FT                   EVSRIVIGDLTRNFTEIDIGRKNNEKFHRIPFGKIIHMIIYKAEEYRISVMKIDESYTS
FT                   QKCSVCGVIKKSNRKYRGLYVCSNCGTVINADVNGARNILFSVVPNPIRDRDSGLGNPW
FT                   RVSLSSALLKKPLL"
FT   gene            11258..11827
FT                   /locus_tag="MFS40622_0012"
FT   CDS_pept        11258..11827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0012"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: mfe:Mefer_1616
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68713"
FT                   /db_xref="GOA:D3S6Q3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q3"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADC68713.1"
FT                   /translation="MAVCDTMEKRGTWDIGLDYKEAKNLLLKKLEHYRNKKPLYQRDKI
FT                   AYAYLLVGLIQLRNGCRVGEAIEGLIKIIQNGDKEVKVRVEKRKDNIKRLIILPEEIAP
FT                   DDLEKVRDVINNWEKSKKLVVRISTWYKDNLNINTHSLRYAFISYLGKKGVPAQLIAHI
FT                   TGHATLDMIMRYTQAKIAEEILRKLE"
FT   gene            complement(11832..12878)
FT                   /locus_tag="MFS40622_0013"
FT   CDS_pept        complement(11832..12878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0013"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: mja:MJ0205 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68714"
FT                   /db_xref="GOA:D3S6Q4"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q4"
FT                   /inference="protein motif:TFAM:TIGR00978"
FT                   /protein_id="ADC68714.1"
FT                   /translation="MKIKVGVLGATGSVGQRFVQLLAEHPMFELTALAASERSAGKKYK
FT                   DACYWFQDRDIPENIKDMIVVPTDPKHEAFEDVDIVFSALPSDLAKKFEPEFAKEGKLV
FT                   FSNASAYRMEEDVPLVIPEVNADHLELIEIQREKRGWDGAIITNPNCSTICAVITLKPI
FT                   MDKFGLEAVFIATMQAVSGAGYNGVPSMAILDNLIPFIKNEEEKMQTESLKLLGTLKDG
FT                   KVEFANFKLSASCNRVAVIDGHTESIFVKTKEGAEPEEIKEVMDKFDPLKDLNLPTYAK
FT                   PIVIREEIDRPQPRLDRNEGNGMSIVVGRIRKDPIFDVKYTALEHNTIRGAAGASVLNA
FT                   EYFVKKYL"
FT   gene            complement(12889..13326)
FT                   /locus_tag="MFS40622_0014"
FT   CDS_pept        complement(12889..13326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0014"
FT                   /product="Protein of unknown function DUF371"
FT                   /note="PFAM: Protein of unknown function DUF371; KEGG:
FT                   mja:MJ0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68715"
FT                   /db_xref="InterPro:IPR007171"
FT                   /db_xref="InterPro:IPR023131"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q5"
FT                   /inference="protein motif:PFAM:PF04027"
FT                   /protein_id="ADC68715.1"
FT                   /translation="MKLDYLGGVLMEFIIKAKGHKNVSATHKTTLEITKENYLTPTGHC
FT                   IIGIEADKSMTDFSEEFKEKLRNAKKIVVEIEVEGIKDTIIGEGHRDLILNHPTDIVIR
FT                   KSNYICPRTLMINANKSAKDINREIVKKLKEGKELIFKIIV"
FT   gene            13470..13925
FT                   /locus_tag="MFS40622_0015"
FT   CDS_pept        13470..13925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68716"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q6"
FT                   /inference="similar to AA sequence:KEGG:MJ0207"
FT                   /protein_id="ADC68716.1"
FT                   /translation="MVLYKIRRTKNTPCPSIASAVIIGYSVGLKLITGHGAQSLSNMAG
FT                   SYAGKELGIYAINNGYEFKDIKDVERFFNQLDFANVEMNEEDDEIIVKISKCNLCPKRI
FT                   CGYEFEGTACPWGGLLIGFIGETLKYNLGYQMNLKPAETCIIKLKKK"
FT   gene            complement(13927..14643)
FT                   /locus_tag="MFS40622_0016"
FT   CDS_pept        complement(13927..14643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0016"
FT                   /product="archaeoflavoprotein, MJ0208 family"
FT                   /note="TIGRFAM: archaeoflavoprotein, MJ0208 family; PFAM:
FT                   flavoprotein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0208 4Fe-4S iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68717"
FT                   /db_xref="GOA:D3S6Q7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR014073"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q7"
FT                   /inference="protein motif:TFAM:TIGR02700"
FT                   /protein_id="ADC68717.1"
FT                   /translation="MKIVWCITGAGHLLRESFHVMKKLKEEIEDLKVTTLVSRAGEEVV
FT                   KMYGLFGELYNISNGNYYEELILEREHPYSSPITGRLSLGKYDYLICSPATGNTVAKVV
FT                   NGIADSLVTNAIAQAGKGFVKSLIVPVDYKEGIVTTKLPYAIDKNKCKLCLKCINVCPN
FT                   GAIAKRDDFVEISLPKCLGCGNCKKVCPYNAIIEGKEIKMRVRKIDAENTRKLKELEDV
FT                   IVLKHPYEILEFFNVK"
FT   gene            complement(14658..15440)
FT                   /locus_tag="MFS40622_0017"
FT   CDS_pept        complement(14658..15440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0017"
FT                   /product="Protein of unknown function DUF137"
FT                   /note="PFAM: Protein of unknown function DUF137; KEGG:
FT                   mja:MJ0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68718"
FT                   /db_xref="InterPro:IPR002855"
FT                   /db_xref="InterPro:IPR038138"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q8"
FT                   /inference="protein motif:PFAM:PF02006"
FT                   /protein_id="ADC68718.1"
FT                   /translation="MQIPKTHPRYESLMKREKVIEALDKGILAKAGLIAHGRGETFDYL
FT                   IGEKTTPIALEAIKAAAAMLILAENPVISVNGNTVALAIDEVVELAKELNGKIEVNLFY
FT                   RTKERELAIKKAFEEKFKDDIETGKIKILGIDDANKQIPNLDSLRGKVSEEGLFTADVV
FT                   LVPLEDGDRAEALVNMGKKVIAIDLNPLSRTARKSTITIVDELTRALPLLIKYVREFKN
FT                   KDREELLKIVEGFDNKKNLKDMIEYIAERLKSLSLDEL"
FT   gene            15515..16609
FT                   /locus_tag="MFS40622_0018"
FT   CDS_pept        15515..16609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0018"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, beta subunit;
FT                   PFAM: ATP-grasp domain protein; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: mja:MJ0210 succinyl-CoA
FT                   synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68719"
FT                   /db_xref="GOA:D3S6Q9"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Q9"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ADC68719.1"
FT                   /translation="MKLHEYEAKNIFKKYGIPVPNSFLVSKGDDLNSIEIDREVVLKAQ
FT                   VLVGGRGKAGGILFASNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIII
FT                   DRDAKKPLIIFSTEGGVDIEEVAEKNPEKIIKYHVDVKKPFLPYVARWIVKEAKLPSNE
FT                   IGKVADVIYKLYKIFKELDATMVEINPLVITEDGNVYAADAVLHLDDDAAFRHNYEEFE
FT                   EYKNKEKLPFAYVELDGDVAVIGNGAGLTLASMDVINNLGRKPACFLDIGGGADAETVK
FT                   LALRKVLENKNVKGIFINILGGITRCDEVAKGIVEVLKEHPNIKFAVRMMGTNEDIGRK
FT                   ILEEHGIPYETSMEEAGRKLIEQL"
FT   gene            16657..17163
FT                   /locus_tag="MFS40622_0019"
FT   CDS_pept        16657..17163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0210.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68720"
FT                   /db_xref="GOA:D3S6R0"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R0"
FT                   /inference="similar to AA sequence:KEGG:MJ0210.1"
FT                   /protein_id="ADC68720.1"
FT                   /translation="MDTSIMDLVMIVIAIITIIGSFLFILHLIFKYSKIRKSIEVIKDV
FT                   KVDLFKSLEESIKKNFFLIVLGLCLYFGVLYIVTGTVRIIHILPIAVCWVGISLIYYLK
FT                   REVTAYVCKDGLLIHGFLYSWKEFKDVKIEKNYIMLTTSIQRIAIKREKDIEKILKNYL
FT                   NRWKR"
FT   gene            17160..18065
FT                   /locus_tag="MFS40622_0020"
FT   CDS_pept        17160..18065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0020"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   mja:MJ0211 UDP-glucose 4-epimerase (GalE)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68721"
FT                   /db_xref="GOA:D3S6R1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADC68721.1"
FT                   /translation="MILVTGGAGFIGSHIVDKLIENNYDVIILDNLTTGSKNNINPKAE
FT                   FVNADIRDEDLDEKINFKDVEVVIHQAAQINVRNSVENPIYDGDINVLGTINILEMIRK
FT                   YDINKIIFASSVGVYGEPNYLPVDENHTINPLSPYGLSKYVGEEYIKLYNRLYGIEYAI
FT                   LRYSNVYGERQDPKGEAGVISIFIDKMLKNENPIIFGDGNQTRDFVYVGDVAKANIMAL
FT                   NWKNEIVNIGTGKETSVNELFNIIKDEIGFKGNAIYDKPREGEIYRIYLNIKKAKSLDW
FT                   RPEVDLKEGIKRVVNWMKFK"
FT   gene            18214..18477
FT                   /locus_tag="MFS40622_0021"
FT   CDS_pept        18214..18477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0021"
FT                   /product="DNA-binding protein Alba"
FT                   /note="TIGRFAM: DNA-binding protein Alba; PFAM: Alba,
FT                   DNA/RNA-binding protein; KEGG: mfe:Mefer_0468 DNA-binding
FT                   protein Alba"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68722"
FT                   /db_xref="GOA:D3S6R2"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR013795"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R2"
FT                   /inference="protein motif:TFAM:TIGR00285"
FT                   /protein_id="ADC68722.1"
FT                   /translation="MDNVVLIGKKPVMNYVVAVLTQLTSNDEVIIKARGKAINKAVDVA
FT                   EMIRNRFIKDIKIKKIEIGTDKVKNPDGKEVNVSTIEIVLAK"
FT   gene            18579..19046
FT                   /locus_tag="MFS40622_0022"
FT   CDS_pept        18579..19046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0022"
FT                   /product="Protein of unknown function DUF54"
FT                   /note="PFAM: Protein of unknown function DUF54; KEGG:
FT                   mfe:Mefer_0467 protein of unknown function DUF54"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68723"
FT                   /db_xref="InterPro:IPR002739"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R3"
FT                   /inference="protein motif:PFAM:PF01877"
FT                   /protein_id="ADC68723.1"
FT                   /translation="MLNSVKISAIVHATEDEDKVLEAIEFFIPEDVDEEKINLDVVETQ
FT                   GYFGNPIKIVNISVEGKEAKMIFKHIMDLIKSDERNLNKLKKDLHLRVEDNKFYVRFDK
FT                   QKAYLGECRVIDGDDVIRTVFNFKIFAPKNKEEKVKETIINELGISNASDV"
FT   gene            complement(19095..19937)
FT                   /locus_tag="MFS40622_0023"
FT   CDS_pept        complement(19095..19937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0023"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   mja:MJ1127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68724"
FT                   /db_xref="GOA:D3S6R4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R4"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADC68724.1"
FT                   /translation="MDVLKNLPVTDNHIHVDDKHGYGAEKVAKIFYNAGGKVMIVLNKP
FT                   TFDGDLTKSMDILVRDVEIINKNTPVKAFGLVGVHPAELTYLMKFMSLEEAKNKIIEAL
FT                   NYAKKLVEEYDFIVGIGEVGRPHYKVDENVWETSNEILRYCMSLAKDVGCAIQIHAESS
FT                   TEEQFKEFSEMAKEVGLNPENVVKHHCGDMVLEGEKYGIFPSILASRVNEDVVKKSLRF
FT                   VMETDYIDDLKRPGVVLGIKTVPRVTRKLIEKGVLDEDKVYKIHKENIERIYNIEVRF"
FT   gene            complement(20057..21295)
FT                   /locus_tag="MFS40622_0024"
FT   CDS_pept        complement(20057..21295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0024"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; small GTP-binding
FT                   protein; PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   mfe:Mefer_0294 GTP-binding proten HflX"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68725"
FT                   /db_xref="GOA:D3S6R5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R5"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADC68725.1"
FT                   /translation="MEGEKIKRRALLILRKDSKFDRKSIEELKELAEVLYNPVKTVVQI
FT                   RKPDPKYQIGSGLVEKLAEMIKEEDIEIVIVGNLLTPSQKYNLAKKFKVEVIDKIELVL
FT                   RIFYKHARTKEAQLQVRLAELQYELPRAREKVRLAKMGEQPGFGGYGDYEVEKYYQKVK
FT                   REIANIKRKLEKLREHRKIARKSREKFDSVGLIGYTNAGKTSLLNALTGEHKESKNQVF
FT                   TTLTTTTRAIKGIKRKILVTDTVGFIDDLPPFMIEAFLSTIEESANSDLILIVVDASDD
FT                   IEEIKRKLKVNHEILSKINCKAPIITVFNKVDKITEEKKRKILEELDRYIVNPIFVSAK
FT                   YNINIDLLIEKIIENLNLSVGTIETNNPKLISYLYENTEIIEDILDEDRHIITFRAKER
FT                   DVNRILKLHKSAV"
FT   gene            complement(21420..22016)
FT                   /locus_tag="MFS40622_0025"
FT   CDS_pept        complement(21420..22016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0025"
FT                   /product="beta-lactamase domain protein"
FT                   /note="KEGG: mvu:Metvu_1080 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68726"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R6"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1080"
FT                   /protein_id="ADC68726.1"
FT                   /translation="MIKLLYKGELIRENDMIKKASSSVTFIQTKSHNIIVDTSTKDKRE
FT                   LIIEELKKLNLEPKDIDVVINTHRHYDHIENNDLFENAKIYASAQECIVECDGCKLYSN
FT                   MDEIEEFIPVEKFHDDEITILKTPGHTYGSISIVYGDYVIVGDAAPLRENILGDILPLV
FT                   IVDYRAAKGSLRRIKLLKKNIITGHDGIVYKEEFL"
FT   gene            22265..23053
FT                   /locus_tag="MFS40622_0026"
FT   CDS_pept        22265..23053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0026"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: mvu:Metvu_1079
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68727"
FT                   /db_xref="GOA:D3S6R7"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R7"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ADC68727.1"
FT                   /translation="MSRKIASIFGLLIIIAIVLGCGCTQKSETKEEVIHAYVGAGMQKP
FT                   MDEIGKMFEEKYGIKVEYDYAGSGYLYSKILATKEGDIFMPGAYFYVGELEKKGYILKY
FT                   KNFTKHIPVIVVQKENPKNITCLEDLGKPGIRVALGDDNIAIGRTFKKILQKAEKYDPG
FT                   ISEKINKNVVVKGATVKQVLLYVIEGDADAAVVWRADAIENKDKVDIIPINSKYNVIKT
FT                   VPIAILKTTKNKENAEKFYNFVLTEGKEVFKKYGFEVIED"
FT   sig_peptide     22265..22345
FT                   /locus_tag="MFS40622_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.809) with cleavage site probability 0.527 at
FT                   residue 27"
FT   gene            23082..23882
FT                   /locus_tag="MFS40622_0027"
FT   CDS_pept        23082..23882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0027"
FT                   /product="NifC-like ABC-type porter"
FT                   /note="TIGRFAM: NifC-like ABC-type porter; molybdate ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: mvu:Metvu_1078 NifC-like ABC-type porter"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68728"
FT                   /db_xref="GOA:D3S6R8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R8"
FT                   /inference="protein motif:TFAM:TIGR01581"
FT                   /protein_id="ADC68728.1"
FT                   /translation="MIQNNLKCISTVPLILFLTMLVCIIISILGRISIENLLDALESEE
FT                   VRFAVILSVKCSIVAIILALLVGIPSGYALARYNFKGKEIIDSLINLPILLPPLVLGFG
FT                   LLLLLGNTPIGNFISENIMDIVFTQNGIILAQFIIATPFIIRTTRAVFEGIDVKYEYIA
FT                   QSLGLSRVESFFKITLPLAKSGIVAGAILGWARAIGEFGATLMLAGATKMKTETLPIAI
FT                   FLNVSIGNIELALAIATIHIAIAIIVISLIKFVINLNGGKYDRC"
FT   gene            23869..24576
FT                   /locus_tag="MFS40622_0028"
FT   CDS_pept        23869..24576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0028"
FT                   /product="protein of unknown function DUF364"
FT                   /note="PFAM: protein of unknown function DUF364; KEGG:
FT                   mvu:Metvu_1077 protein of unknown function DUF364"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68729"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6R9"
FT                   /inference="protein motif:PFAM:PF04016"
FT                   /protein_id="ADC68729.1"
FT                   /translation="MIDVKEILKEFAEENNLLNEEVEIKISDTKLDTTRIKDYPLMSGK
FT                   EILLRAYFKGCCGDAFTDKPVEFKGTIRELLDRGNRPEIVATLNAVMRYLGLVDKTAHC
FT                   VGDEPEKCAKELVKYLKELKPKKIGIIGFQPAFVKEIVNAFGSENVIVSDLNPENVGKV
FT                   KYGAKIIHGKYNEELIKNSDVVLATGSTIANGTFEEIWELAKKYNKRIIFYGTTIAGMA
FT                   KVLGVERFCTLGR"
FT   gene            24579..25583
FT                   /locus_tag="MFS40622_0029"
FT   CDS_pept        24579..25583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0029"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mvu:Metvu_0863 ABC transporter releated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68730"
FT                   /db_xref="GOA:D3S6S0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC68730.1"
FT                   /translation="MLKIENLRKKLAYFTLEIDELEIDKRDYFVVLGLSGSGKTTLLEI
FT                   IAGFRKPDDGKIYLNGEDITNKPINERKIVMCHGKYLFPHLSVKDNIGIGIRDKRLREE
FT                   KVKEISKLLGIEHLLNRKPDTLSGGEQQRVALARALVVEPEVILLDEPLNALDRLTHEN
FT                   LILELKNIYENSHLTFIHVTHDFIEAIALAKRMAIIRNGKIEQFGEVDEIINNPKNEFV
FT                   ARFVGYKNFLDGKVKKEDNHYIFEGDIEIYLDKPYECGEAILAIRPEDIMLVGDGGCRY
FT                   HYKKYNLFDAKIVEVYPLSLSTVRAVLDVNGVYLTCEVMRSKAYRMGLKKGWE"
FT   gene            25705..26202
FT                   /locus_tag="MFS40622_0030"
FT   CDS_pept        25705..26202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0030"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   mvu:Metvu_0864 3-isopropylmalate dehydratase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68731"
FT                   /db_xref="GOA:D3S6S1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S1"
FT                   /inference="protein motif:TFAM:TIGR02087"
FT                   /protein_id="ADC68731.1"
FT                   /translation="MYIRGKAHKFGDDVDTDAIIPGPYLKTTDGHELARYCMAGIDENF
FT                   PKKVKEGDVIVAGENFGCGSSREQAVIAIKYCGIKAVIAKSFARIFYRNAINIGLIPII
FT                   ADTDKINDGDIVEVDLDREKIVVDENLILDCEVPKGIEREILDAGGLINYFHIRKKRKA
FT                   KV"
FT   gene            26352..27209
FT                   /locus_tag="MFS40622_0031"
FT   CDS_pept        26352..27209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0031"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: mvu:Metvu_1081 nitrogenase iron protein;
FT                   TIGRFAM: nitrogenase iron protein; PFAM: NifH/frxC-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68732"
FT                   /db_xref="GOA:D3S6S2"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S2"
FT                   /inference="protein motif:TFAM:TIGR01287"
FT                   /protein_id="ADC68732.1"
FT                   /translation="MSVYDEIAPNAKKVAIYGKGGIGKSTTTQNTAAALAYYYKLKGMI
FT                   HGCDPKADSTRMILHGKPQETVMDVLREEGEEGVTLEKIRKVGFGGILCVESGGPEPGV
FT                   GCAGRGVITAVNLMIELGGYPDDLDFLFFDVLGDVVCGGFAMPLRDGLAKEIYIVSSGE
FT                   MMALYAANNIARGILKYAEQSGVRLGGIICNSRKVDGEKELMEEFCDLLGTKLIHFIPR
FT                   DNIVQKAEFNKMTVVEFAPDHPQAHEYKKLGKKIMDNDELVIPTPLSMDQLEKLVEKYG
FT                   LLDK"
FT   gene            27300..27617
FT                   /locus_tag="MFS40622_0032"
FT   CDS_pept        27300..27617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0032"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mvu:Metvu_1082 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68733"
FT                   /db_xref="GOA:D3S6S3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S3"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADC68733.1"
FT                   /translation="MKLIKAIIRPEKVDDVIDALEKAGYPSFTKIDVVGRGKQGGLKVG
FT                   EIFYDELPKTMLLIGVNDDEVDEVVEIIKTNAYTGNFGDGKIFIQPIEEVYTIRTGAKE
FT                   L"
FT   gene            27628..28017
FT                   /locus_tag="MFS40622_0033"
FT   CDS_pept        27628..28017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0033"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mvu:Metvu_1083 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68734"
FT                   /db_xref="GOA:D3S6S4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S4"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADC68734.1"
FT                   /translation="MMKEVLAIIRPNMVSKTGKALEAVGFPAMTVIRCFGRGKEKGYID
FT                   AKLPEDVDKEKIIEEGEKLGMRMKYIPKRMISIVVDDADVPLVVGIIMKVNRTGKPGDG
FT                   KIFVLPVEEAIRIRTGEFGVEAIGN"
FT   gene            28032..29507
FT                   /locus_tag="MFS40622_0034"
FT   CDS_pept        28032..29507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0034"
FT                   /product="nitrogenase component I, alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: mvu:Metvu_1084 nitrogenase component I, alpha
FT                   chain; TIGRFAM: nitrogenase component I, alpha chain;
FT                   nitrogenase alpha chain; PFAM: oxidoreductase/nitrogenase
FT                   component 1"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68735"
FT                   /db_xref="GOA:D3S6S5"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005974"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S5"
FT                   /inference="protein motif:TFAM:TIGR01862"
FT                   /protein_id="ADC68735.1"
FT                   /translation="MPFVLLNCDKPIPERMKHTYIYDPEEEIIPACNIKTVPGDMTERG
FT                   CTFAGGRGVVGGPIKDVIHMVHGPVGCAYYTWGTRRNLSDCELHRRYCFTTDMQEADVV
FT                   YGGEKKLEKACLEAAAEFPQAKGIIIYATCTTGLIGDNLEAVARKVEEKIGKPVFACNC
FT                   PGYAGCSQSKGHHIFNTEFYRWLKKARERFPEKCLKEEEKTPYDIAIVGEYNMDWDVAV
FT                   IKPLFEKIGCRVVTVFTGNASFDDLFKLPDVKLCVVHCQRSANYIAEMIRDGFNIPRIW
FT                   VSLFGIEQTAEALRKTAEALGIPMERVEEVIKEEVEAIKPQLEFYKSKLEGKTCLVYVG
FT                   GPRTWHWVRAMKELGIKYVVACCTFAHEDDYEKLNRNFKKAGLKGVLVIDAPNELELEE
FT                   AVEKYKPDFMLTGLKERYLFRKFGIPTINSHSYEQGPYACFKGFVNFARDIYKAIYHPI
FT                   WNILKEGEKKFEEFKKKDIPPGIEHAVKENPNS"
FT   gene            29593..30987
FT                   /locus_tag="MFS40622_0035"
FT   CDS_pept        29593..30987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0035"
FT                   /product="Nitrogenase"
FT                   /EC_number="1.18.6.1"
FT                   /note="PFAM: oxidoreductase/nitrogenase component 1; KEGG:
FT                   mvu:Metvu_1085 nitrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68736"
FT                   /db_xref="GOA:D3S6S6"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S6"
FT                   /inference="protein motif:PRIAM:1.18.6.1"
FT                   /protein_id="ADC68736.1"
FT                   /translation="MGITYVEKQRAGTINPNKTCQPIGAMWATLGVHRGIPFVQGSQGC
FT                   CTYVRYTFNRHFREPATIAVASFHEDAAVYGGMRNLVEGLRNLVARYDPDLISVVTTCS
FT                   SETIGDDIEAFIRAARKKIAAEFGEEKAQLPIIPVHCPSYQASHVKGYDNAVKAFFQYF
FT                   TTGKKRDEEKADKIMIVPGFGVNPGDILEIKRILDMFGLKEGEDYSVLFDISETLYQPL
FT                   REPIKEIPYYPKGGTKVEEFEEIINAKAVFVLCRHAGGSGAVFLQRRYKIPAYYGLPIG
FT                   IKNTDDFIINIAKVTGLEIPDKLLDERGKLIDAIVDTIHYTMDKKVGIFGDPDFVIAVS
FT                   RFACEMGMKPVVVNTQTPSTTYKKDMEAIANEYDVDIEVQYSDLWDFEKSVKKIGVDLL
FT                   IGHPRGGVKIAEDLGIGLVRMGFPIYDRVGYFRWPIVGYMGSLRFFDEIVNTILDTQVP
FT                   WDQKQQ"
FT   gene            31061..31390
FT                   /locus_tag="MFS40622_0036"
FT   CDS_pept        31061..31390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68737"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S7"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1086"
FT                   /protein_id="ADC68737.1"
FT                   /translation="MIVEFKKYDEFGNIVEGDDFHCIVFYIKKKEIPHKDALLFEAVKA
FT                   ENVPGIVAKYLIDEIESGYGDPEEISDVEELKKYGVPDDIIDTIKETLKKYGINWLFKV
FT                   REAEK"
FT   gene            31457..31723
FT                   /locus_tag="MFS40622_0037"
FT   CDS_pept        31457..31723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68738"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S8"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1087"
FT                   /protein_id="ADC68738.1"
FT                   /translation="MCYGEIGTFRGFVIKEEVKVPLIEINGEIREMIIPIADNVKVGDK
FT                   IMVYNSYNFDYEFKTVSLKSIFASLFKKLNIISIKPNLSIAGV"
FT   gene            31725..31976
FT                   /locus_tag="MFS40622_0038"
FT   CDS_pept        31725..31976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0038"
FT                   /product="ATP-cone domain protein"
FT                   /note="PFAM: ATP-cone domain protein; KEGG: mfe:Mefer_0922
FT                   anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68739"
FT                   /db_xref="GOA:D3S6S9"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6S9"
FT                   /inference="protein motif:PFAM:PF03477"
FT                   /protein_id="ADC68739.1"
FT                   /translation="MDEVLAKVYITKSDGSREKFDFEIIKESLRNAGADEELVEEVIKR
FT                   IENRIHDEITTQELKMMITTVLRRLNRDVAQKYIMNHS"
FT   gene            31985..32170
FT                   /locus_tag="MFS40622_0039"
FT   CDS_pept        31985..32170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0039"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mvu:Metvu_1627 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68740"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T0"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68740.1"
FT                   /translation="MAVKINYDLCKGAECAECVDACPMEVFEVDGDKIIVAKEEDCTYC
FT                   GVCVDSCPNNAIILEE"
FT   gene            32326..32961
FT                   /locus_tag="MFS40622_0040"
FT   CDS_pept        32326..32961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68741"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T1"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0865"
FT                   /protein_id="ADC68741.1"
FT                   /translation="MKVLFLGKKLEDVDSYDVEDCLFIPFNKIDVVKYDLSIIYLPLFF
FT                   KDLTSYSANQSSIFTILKDIKVKEVLESENEPKVVVIDPYFKNISKGRILEHYLMKHLT
FT                   RDKFVVKCKEGDEVKVKDEKFSKYVDLIGEYSHIYEIEDEDGKLGIVDTLTLICDYEHW
FT                   DYEPVIETNEGEILGVRIFKNGSLYILHPPNEEFTDYKKLIEVLKEIV"
FT   gene            32958..34265
FT                   /locus_tag="MFS40622_0041"
FT   CDS_pept        32958..34265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0041"
FT                   /product="oxidoreductase/nitrogenase component 1"
FT                   /note="PFAM: oxidoreductase/nitrogenase component 1; KEGG:
FT                   mvu:Metvu_0866 oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68742"
FT                   /db_xref="GOA:D3S6T2"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T2"
FT                   /inference="protein motif:PFAM:PF00148"
FT                   /protein_id="ADC68742.1"
FT                   /translation="MNEIKVLPFKITLKKDGIPKFDKRTSPGIVTQRSCPYYGARWILA
FT                   PIKNTLHIIHSPIGCAYYGQSVRRKNYLIVSTDMQLEDVVYGGEKKLYNTIIEAHKELG
FT                   GDAVFVYVTCVSALIGDNIESICRKAEKILGVPVISIFCPGFCGYHQSKGHEIAMKALF
FT                   RLIKEGEFKKEFKDKLTVNIIGEYNVCGETKVIKDLLKKLGIEVIATFTGDCSVEDIRN
FT                   SKNAKLNLIHCRRTGKYIADYMEEKYGIPQLKVSFIGLNNTKKSIMDIAKFFGIEDKAK
FT                   EVIEEEYEKIKDELKFYMEKLKGKRVGMFMGASKIGMLTSAFKDLGMEVVSVGSQFGSF
FT                   EDYLDAYINVDDDTILVDDASKIDLELIFKHKKPDIFVGGTKEKYMAVKFGIPFLSFPQ
FT                   DFYPFTGFIGFLNFAREVYKAIYHPVWKMIEFKYET"
FT   gene            complement(34271..36358)
FT                   /locus_tag="MFS40622_0042"
FT   CDS_pept        complement(34271..36358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0042"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: mfe:Mefer_0296 DEAD/DEAH box
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68743"
FT                   /db_xref="GOA:D3S6T3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022965"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T3"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADC68743.1"
FT                   /translation="MNKVLEVLKDFGIVELRPPQKKALGRGLLDKNKNFLISIPTASGK
FT                   TLIGEMALINHLLDENKNPTGKKGIFIVPLKALASEKYEEFKSKYERYGLRIALSIGDY
FT                   DEDEDLSSYNLIITTAEKLDSLWRHKIDWIDDVSVVVVDEIHLINDETRGGTLEILLTK
FT                   LKEFNIQIIGLSATIGNPNELAEWLNAELIVDDWRPVELKKGIYKNGIIEYINGGNKEI
FT                   KAVSDNEIYNLVVDCVKEGGCCLVFCNTKKGAVNEAKKLNLKKFLTDEEKKKLKEIAEE
FT                   ILSILEPPTEMCKTLAECILNGSAFHHAGLTYQHRKIVENAFRERLIKVICATPTLSVG
FT                   INVPCRRAIVKDLTRYTNKGIRYIPIMEIQQCIGRAGRPGLDPYGEGIIVAKNDRDYLR
FT                   AYQALTQKPEPIYSKLSNQAVLRTQLLGLIATGEIRDEYDLEWFIRNTFYAHQYGNLRE
FT                   VAKNIMEVIGFLEENEFIVDFMPTELGKRVSELYIDPLSAKYIIDGLNEMKNENELYYL
FT                   YLISKTLEMMPNLRVYKSEELDLINEMEALGIKSFDIEDLEAFKTAKMLYDWINEVPED
FT                   EILKRYKIEPGILRYKVENAVWIMHALKEIAKIIGKSPDVPEKLEIRLEYGAKEDIIGL
FT                   LSIKYIGRVRARKLYNAGIRSAEDIINNPSKVASIIGEKIAKKILEELGVEYQEKEKLE
FT                   I"
FT   gene            complement(36372..36989)
FT                   /locus_tag="MFS40622_0043"
FT   CDS_pept        complement(36372..36989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0043"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: mja:MJ1123
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68744"
FT                   /db_xref="GOA:D3S6T4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADC68744.1"
FT                   /translation="MNAFDKYAEEYDRWFDENEIIYKSEIEALKRHIPKGRGLEVGVGT
FT                   GRFAKPFNIKIGVDISKEMAKIAEKRGIKVIIAKGEDLPFKDEEFDFVLINTVLEFAEN
FT                   PKKMLKEAERVLKKGGKIIIGIIDKDSFLGKIYEEKKQKSKFYKDANFLSAKEVIEMLK
FT                   ELGFKNIKATQTIFKEIDKVDKVEVKDGYGEGGFVSISAEKI"
FT   gene            complement(36976..37833)
FT                   /locus_tag="MFS40622_0044"
FT   CDS_pept        complement(36976..37833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0044"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: mja:MJ1120
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68745"
FT                   /db_xref="GOA:D3S6T5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T5"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ADC68745.1"
FT                   /translation="MKDAEINLTIEYKGKLITPNQIKLLMALHKTKSQNEASKLLNISP
FT                   SSFNIQLKRLENKLGVKLYYSSPNGTILTDTGLEILETYNSYSKRLKNHFFTVSGFVSG
FT                   EIAKILFENPIITSFDNALKLLKMGFVDILGVDDSYWIYRLGDERFLKSEIGSSDFNIF
FT                   LIAYDNFVMVSKKEFDYKNLVGVRFSSHRIVYNILKKEGIKFKVKIKTKNPFRAIELVN
FT                   EGYSLFLNESLLKYVDGDFNVEYPNFYKKTVHAINFISFGKDIEIDKKELKKIKKLGFK
FT                   YECF"
FT   gene            complement(37837..38724)
FT                   /locus_tag="MFS40622_0045"
FT   CDS_pept        complement(37837..38724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0045"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: mja:MJ1119 diaminopimelate epimerase; TIGRFAM:
FT                   diaminopimelate epimerase; PFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68746"
FT                   /db_xref="GOA:D3S6T6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T6"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADC68746.1"
FT                   /translation="MEFTKMHALGNDYIVINEFDGEKVKEEEKGNFAKKICRRGFSVGA
FT                   DGVIFIQKPTSDEYDVRFRIFNSDGSEAEMCGNGIRCFSKYVYERIMKKNPLKVETKGG
FT                   LRVSEMEIEGDEVKKIKVYMGIPKFKLKDIPMVVDGYKEDDEFLNGELKLKNPYLPKVK
FT                   LSVVNVGNPHAVIFVEDNGIDLDFVREHLDVIGKEIECHEAFPERINVHFVKVLNPNEI
FT                   RIVTWERGAGYTTACGTGTTASVIIAHKLGKTSNRVLAHLDGGDLEIEIKDDGVYMIGD
FT                   AVMVYDAKLINIGW"
FT   gene            complement(38753..39022)
FT                   /locus_tag="MFS40622_0046"
FT   CDS_pept        complement(38753..39022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0046"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG: mja:MJ1118
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68747"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T7"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ADC68747.1"
FT                   /translation="MEKMPAKILFERSIIGNKGSVIGKVKDIVFDEKVGRLVSLEVEPA
FT                   EHSPIMIEEGKNVLIPYKLVVAIKDVVVIDETNLNRANIRVTEH"
FT   gene            complement(39031..39630)
FT                   /locus_tag="MFS40622_0047"
FT   CDS_pept        complement(39031..39630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68748"
FT                   /db_xref="InterPro:IPR005245"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T8"
FT                   /inference="similar to AA sequence:KEGG:MJ1117"
FT                   /protein_id="ADC68748.1"
FT                   /translation="MDALVMAGGKGTRMGNVEKPIVKLYNKCLIDYVLSSLLKSKVKNI
FT                   FVAVSPNTPKTKEYIKSTYKDFKNIIAIDTSGNGYINDLNECIGYFSEPFLVVSSDLIN
FT                   LTSKIINSIVDYFYCIKAKNPDVEALAVMIPKEKYPNPSIDFNGLVPVGINVLSPKQGY
FT                   QKEEIMIIDELIFNINTKDDLKLAEMLLKNKDIKIQ"
FT   gene            39758..41281
FT                   /locus_tag="MFS40622_0048"
FT   CDS_pept        39758..41281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0048"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: asparagine synthase;
FT                   glutamine amidotransferase class-II; KEGG: mja:MJ1116
FT                   asparagine synthetase (AsnB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68749"
FT                   /db_xref="GOA:D3S6T9"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6T9"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADC68749.1"
FT                   /translation="MCSISGIIVKESQIPAKYAIDMMKILKHRGRDNSGLLLDDEVIYF
FT                   NNFEDVEDLEEEEMIGNLNLAHNRLAIVGRYGVQPIPNEDEDIWLVCNGEIYNYIELRE
FT                   YLKENHEFRTDSDNEVIIHLYEDEQLEELDGDYAFAIYDKSKDIVLLGRDVFGVKPLFY
FT                   VDTPNYFAFASERKALWHLLINIDGYERDLDVLNSKIKTLKPNSQLIYYLDDNKFDIIE
FT                   NFKKMELNYMKERSYEEAKEYLDRALKNAVLKRVRGLDRVGIICSGGVDSSLIAKLSSL
FT                   YCEVILYAVGTENSEDLIYAERLAKDLNLKIRKKIISEEEYERYVFKVAKAIDEVDLMK
FT                   IGVGIPIYVASEMANEDGLKVVLSGQGADELFGGYARHERIYREKGEEELKKELLKDVY
FT                   NLYKVNLERDDHCTMANGVELRVPFLDEEVVEIALSIPIEYKMSELRKRILRDVASQYL
FT                   PDYIAYRPKKAAQYGSGGEKMIYKVAKKYGFSKKKINEFLDMLKRKIVE"
FT   gene            41291..43073
FT                   /pseudo
FT                   /locus_tag="MFS40622_0049"
FT                   /product="hypothetical protein"
FT   gene            43079..43855
FT                   /locus_tag="MFS40622_0050"
FT   CDS_pept        43079..43855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0050"
FT                   /product="photosystem I assembly BtpA"
FT                   /note="PFAM: photosystem I assembly BtpA; KEGG: mja:MJ1115
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68750"
FT                   /db_xref="GOA:D3S6U0"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U0"
FT                   /inference="protein motif:PFAM:PF03437"
FT                   /protein_id="ADC68750.1"
FT                   /translation="MFEKKPLIGMIHLKPLPGSYHYNNNFDSIVDFAIKEAKKLEEANF
FT                   DAIMIENFGDAPFKKEADKITIASMAVIAKAIKEEVSLPLGINVLRNDAIGAYSIAYVV
FT                   KADFIRVNVLSGVAFTDQGIIEGKAHELAKLKKLLPSKIKIFADVHVKHAYHFIDFESS
FT                   LLDTVERGLADAVVVSGKRTGAEVDIEKLKLAKKLVDVPVIVGSGTNYNNLKILWDYAD
FT                   GFIIGTWIKRDRKAHNEIDIERAKKIVSLANKLKMC"
FT   gene            43939..44517
FT                   /locus_tag="MFS40622_0051"
FT   CDS_pept        43939..44517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68751"
FT                   /db_xref="GOA:D3S6U1"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U1"
FT                   /inference="similar to AA sequence:KEGG:MJ1114"
FT                   /protein_id="ADC68751.1"
FT                   /translation="MDMAEKVYKEGILKLKENIPQIIINLVVAGLIWVFGILVFIPIAD
FT                   MLGNPYLFGLTALKPIISAIITIALIIVLLRVTKDFGELTDGVADIIAVKLAGSRVNEE
FT                   KLKRYRRGLRGLAYLIVAIIAYLFFLPVISGITPVLAGIVLIILVLWAVVVLINIGDIF
FT                   SDEIEEGIRIATEKLEKALEKSAKNEENA"
FT   gene            44527..44754
FT                   /locus_tag="MFS40622_0052"
FT   CDS_pept        44527..44754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68752"
FT                   /db_xref="GOA:D3S6U2"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U2"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0287"
FT                   /protein_id="ADC68752.1"
FT                   /translation="MKYKTLLIHIFLLIFWISLAYFLPYYLFVFKYLQNYVMINFREIG
FT                   AIFVVILEIFVIINLVLLLMEVKKIIKEFL"
FT   gene            44838..45749
FT                   /locus_tag="MFS40622_0053"
FT   CDS_pept        44838..45749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0053"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: mja:MJ1113 N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68753"
FT                   /db_xref="GOA:D3S6U3"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U3"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ADC68753.1"
FT                   /translation="MGYHFIIICGYIILLFAFIFSAVLCKFLMKKMVNYKYGYDLHKKE
FT                   KIKVPEMGGLAVLFSNILFIPFISSIFAISIITAGIIGVVDDIAKLSPKEKLALLFISG
FT                   LIVGFLFYNNYYVDLIGVLFIALGIMIFSNLTNMLAGFNGLEIGMGIIASISLAVVLFL
FT                   DNYVLGGLLALIFSASYLGLLIYNKYPAKVFPGDVGTLPIGAFLAVLAVVYKEYIPFLI
FT                   IMMPYVIDASLKYLSAGVMSRDEHKPTTLGEDGKLYYVGGYLSLPRLILKYKPMREPHL
FT                   VAVLWVIGIFFGIIGILISLIT"
FT   gene            45749..47059
FT                   /locus_tag="MFS40622_0054"
FT   CDS_pept        45749..47059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0054"
FT                   /product="CCA-adding enzyme"
FT                   /EC_number="2.7.7.72"
FT                   /note="KEGG: mja:MJ1111 tRNA CCA-pyrophosphorylase;
FT                   TIGRFAM: CCA-adding enzyme; PFAM: tRNA
FT                   nucleotidyltransferase, substrate binding domain protein;
FT                   DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68754"
FT                   /db_xref="GOA:D3S6U4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U4"
FT                   /inference="protein motif:TFAM:TIGR03671"
FT                   /protein_id="ADC68754.1"
FT                   /translation="MVIVLTIEEILKEVLDEIKPSKEDMEKLQNKAQQIINKIWKIVKE
FT                   NNYPILEVLLVGSSARNTNLKDDYDIDIFVLFDKSVSEDELEEIGLKIGIEAIKRLNGT
FT                   YNVNYASHPYVNGEIDGYEVDIVPCYKIDFGERIISAVDRTPLHHKFLISRLNERLCDE
FT                   VRLLKAFLKSLGLYGSDVKTKGFSGYLCELLILHYGSFINLLKDAQNWRIGRKIILKDI
FT                   FEIYKDVDVKALKKFDEPFIVYDPVDLNRNVASPLSKDNFCKFIFYSREFLKNPSIEFF
FT                   KDYAKKLEKILEDREHGYRLILKIPRGDVVDDIIYPQMEKLQKSINKVITKNEFVILNS
FT                   KCFADDKYCYLYWEFLVHELPKIALREGPPIFEKERVERFLKKYDKVFIKDCKLFAYTE
FT                   RKYSHIIDLFKDIVNGNLKNISIPKYVNPRNGEIIEV"
FT   gene            47085..48545
FT                   /locus_tag="MFS40622_0055"
FT   CDS_pept        47085..48545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0055"
FT                   /product="Protein of unknown function DUF530"
FT                   /note="PFAM: Protein of unknown function DUF530; KEGG:
FT                   mja:MJ1110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68755"
FT                   /db_xref="InterPro:IPR007503"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U5"
FT                   /inference="protein motif:PFAM:PF04409"
FT                   /protein_id="ADC68755.1"
FT                   /translation="METTSNLIKNANEFLDSLNGINKKLKEIVDRINKKKIDKSELNDI
FT                   ISTLEKNLEILQDLKSKMEFLEFDSPYKNVGKLKGGYDSEGLQEIASYSTYLRRIASEK
FT                   KGILERVRHALVAHKIALAHLTEDIGNINLPPNLPLDGSYKKIMFEFPPYLVTTYKEFL
FT                   DILEPKGRGILTSYTISLIVIDKGKREFKRIKVEDKNYEKYIKEKFGNAIITSIKRNFS
FT                   KNKIIDDQYVRRVLAIGYLNAYKDEIEKAINEKIDNLLSDKEKKYLNKYLELCLLFREE
FT                   TDMSGGILDIRCMEERKLKELELKEILEKEGLYKDGEPIEPLKKAIKIKNELSKAISKD
FT                   ILIKRFSEDVFKFYLYKTPDERARSNLFPSIMITPQKGFLSWMKVEGIDCINVLDLKFK
FT                   LEEELPKYQIPLKNVGGVALYLVHDWDAVKRFNFKKKDIEDLLKKIALIEPIKEILKDK
FT                   NVDVGKLEKFGKVKKEKTKKFLDLLSGL"
FT   gene            complement(48863..49396)
FT                   /locus_tag="MFS40622_0056"
FT   CDS_pept        complement(48863..49396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0056"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: mja:MJ1109 orotate
FT                   phosphoribosyl transferase (PyrE)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68756"
FT                   /db_xref="GOA:D3S6U6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U6"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADC68756.1"
FT                   /translation="MVMFMDKKSKLIELLKASGCIKFGEFILASGKKSNYYIDIKKATT
FT                   NPEVLKLVGEIIAEQIKNEDVKVAGVELGSVPIATAVSIIAQKPLLIVRKKPKDYGTKN
FT                   KIEGELKEGDRVIIVEDVTTTGGSVLKAVKEIRENGGIVDRVFVVVDRLEGAKENLQKE
FT                   NVELIPLVTVKELQ"
FT   gene            complement(49454..50743)
FT                   /locus_tag="MFS40622_0057"
FT   CDS_pept        complement(49454..50743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0057"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   mja:MJ1597 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68757"
FT                   /db_xref="GOA:D3S6U7"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U7"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ADC68757.1"
FT                   /translation="MEYSDVPKFIRDISIKQHEWMRESIKLIASENITSLAVREACSTD
FT                   FMHRYAEGLPGKRLYQGCKYIDEVETLCIELAKDLFKAEHANVQPTSGVVANLAVFFAE
FT                   TKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEEKP
FT                   KLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLREGAEYLMG
FT                   STHKTFFGPQGGIILTTEENADKIDTHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYA
FT                   KQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIIDIESSQDIEFSASELAKMYEEAN
FT                   IILNKNLLPWDDVNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEKPEKV
FT                   REDVIEFAREYSKIHYSFDDGDGFKYLKFY"
FT   gene            51014..52045
FT                   /locus_tag="MFS40622_0058"
FT   CDS_pept        51014..52045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0058"
FT                   /product="isopropylmalate/isohomocitrate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="KEGG: mja:MJ1596 3-isopropylmalate dehydrogenase 2
FT                   (leuB2); TIGRFAM: isopropylmalate/isohomocitrate
FT                   dehydrogenase; PFAM: isocitrate/isopropylmalate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68758"
FT                   /db_xref="GOA:D3S6U8"
FT                   /db_xref="InterPro:IPR011828"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U8"
FT                   /inference="protein motif:TFAM:TIGR02088"
FT                   /protein_id="ADC68758.1"
FT                   /translation="MKVCVIEGDGIGKEVIPEAVKILNELGDFEIIKAEAGLECLKKYG
FT                   DALPEETIEKAKEADVILFGAITSPKPGEVKNYRSPIITLRKMFNLYANVRPINNFGIG
FT                   QLIGKIADYKFLDVKNIDMVIIRENTEDLYVGKERLEGDIAIAERFITRKGCERIIKFA
FT                   FEYAVKNNRKKVSCIHKANVLRVTDGLFLEVFNEIKKHYEIEADDYLVDSTALNLIKNP
FT                   EKFDVIVTTNMFGDILSDEASALIGGLGLAPSANIGEDKALFEPVHGSAPDIAGKKIAN
FT                   PMASILSVAMLFDYIGEKEKGDLIRGAVKYCLINKKVTPDLGGNLKTEEVGNEILNYIK
FT                   LKG"
FT   gene            52047..53054
FT                   /locus_tag="MFS40622_0059"
FT   CDS_pept        52047..53054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mja:MJ1595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68759"
FT                   /db_xref="GOA:D3S6U9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6U9"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ADC68759.1"
FT                   /translation="MKIRITKSLILFILSIAFILILMVYIGIYEIFQILISANPIYIIL
FT                   AVILQIAISVLLSIRWGYIIKILGYKANMKNLFLLVLMGLFINNITPSMRGGGEAFRAY
FT                   YLSKLEEIPKGLAFSTVVVERVLDTAIFLFFTLFVIGYFVVTGFEYLEYLILSWILLFS
FT                   LTAVVIYLIANKELLIKTVTKISKFICKYGSYNYDESKILKSIEEFYNSMKFFKSKRGE
FT                   EVFIAIILSVGWYVLDVLKLWLLFLSLPYLVSIVSVATVYLITLLSGVLSITPSGFGTA
FT                   DTVMILSFSAFKIPPSVAAAVTLLDRLVSYILPTVLGYVAMLIIKRELDKKKVD"
FT   gene            complement(53066..53698)
FT                   /locus_tag="MFS40622_0060"
FT   CDS_pept        complement(53066..53698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0060"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: mja:MJ1594 phosphoserine phosphatase (SerB);
FT                   TIGRFAM: phosphoserine phosphatase SerB; HAD-superfamily
FT                   hydrolase, subfamily IB (PSPase-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68760"
FT                   /db_xref="GOA:D3S6V0"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V0"
FT                   /inference="protein motif:TFAM:TIGR00338"
FT                   /protein_id="ADC68760.1"
FT                   /translation="MERKKLILFDFDSTLVNNETIDEIAKEAGVEEEVKKITKEAMEGK
FT                   LNFEQSLRKRVSLLKDLPIEKVEKAIERITPTEGAEETIKELKNRGYVVAVVSGGFDIA
FT                   VNKIKEKLGLDYAFANKLIIKDGKLTGEVEGEVLKENAKGEILEKIAKIEGIKLEDTVV
FT                   VGDGANDLSMFKKAGLKIAFCAKPILKEKADICIEKRDLREILKYVK"
FT   gene            complement(53699..54013)
FT                   /locus_tag="MFS40622_0061"
FT   CDS_pept        complement(53699..54013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: RGD1562785, RGD1562785_predicted; similar to
FT                   hypothetical protein 4932412H11"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68761"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68761.1"
FT                   /translation="MALKVIKTTENLVIIEGLSESRILKIYVVIFGNKKCIEENVAELI
FT                   KLEFGKNINADKNSIKNFLKSINLKRNGLKKLIEKAKIENLEASFNNLIYVIKELERGD
FT                   "
FT   gene            complement(53994..54338)
FT                   /locus_tag="MFS40622_0062"
FT   CDS_pept        complement(53994..54338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68762"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68762.1"
FT                   /translation="MMLVTENPVDNFIAFVITGDGRWEQVILKSIAKRYNGKDKIIYFP
FT                   KNHYKIYGEDVKKTGLWCLDFLKLEKEKLNIFDKCKNLLVLIDKEHIHKTEDIINKLNS
FT                   LNVFDGIKSY"
FT   gene            complement(54346..55356)
FT                   /locus_tag="MFS40622_0063"
FT   CDS_pept        complement(54346..55356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bhy:BHWA1_02262 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68763"
FT                   /db_xref="GOA:D3S6V3"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68763.1"
FT                   /translation="MLINEIKSIKEFRGIKKLKESIKLDKFNILIGKNNSGKTAILESL
FT                   FLFPHPRRVYKLANNRSVLDFISSGRNGIKSLVYKYEGTAELEFDINLDNKFYKWKINI
FT                   ESDGIVNVFKDNKKCVRVEGKFLEFLIDNQKPAVSDNIEKVPIDNLEIVYFPYDTTFIK
FT                   TLDNFLSNNEQKILKENIHTKVAEAISKVLDERFTEIVLKKDGWYLRREDASYIHVNDM
FT                   GDGVKKVVRTMLILELLKPKLILWDDFDTAMHPSMIKNLLSYLSKGDWQVVISTHSIDV
FT                   LYYMLDLEDVDDIQVIALKKDERDILGHRTFTIDDIEDIIDANLDPRYVCQNFDI"
FT   gene            complement(55393..55644)
FT                   /locus_tag="MFS40622_0064"
FT   CDS_pept        complement(55393..55644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0064"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase,
FT                   purS; PFAM: phosphoribosylformylglycinamidine synthetase
FT                   PurS; KEGG: mja:MJ1593 phosphoribosylformylglycinamidine
FT                   synthase subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68764"
FT                   /db_xref="GOA:D3S6V4"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V4"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADC68764.1"
FT                   /translation="MYKATVTIKLKKGVLNPEGRTIQRALNFLGFNNVKEVQTYKMIDI
FT                   IMEGESEEKVKEEVEEMCKKLLANPVIHDYEIKVEKIE"
FT   gene            complement(55758..56486)
FT                   /locus_tag="MFS40622_0065"
FT   CDS_pept        complement(55758..56486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0065"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: mja:MJ1592
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68765"
FT                   /db_xref="GOA:D3S6V5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V5"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADC68765.1"
FT                   /translation="MEIKLEEILKKQPLYSGKAKSIYEIDDDKVLIEFRDDITAGNGAK
FT                   HDVKQGKGYLNALISSKLFEVLEENGVETHYIKYIEPRYMVAKKVEIIPIEVIVRNIAA
FT                   GSLCRRYPFEEGKELPFPIVQFDYKNDEYGDPMLNEDIAVALGLATREELNKIKEIALK
FT                   VNEVLKKLFDEKGIILVDFKIEIGRDKDGNLLVADEISPDTMRLWDKETRDVLDKDVFR
FT                   KDLGDVIAKYRIVAERLGLL"
FT   gene            complement(56708..57748)
FT                   /locus_tag="MFS40622_0066"
FT   CDS_pept        complement(56708..57748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:57701..57703,aa:Sec)
FT                   /locus_tag="MFS40622_0066"
FT                   /product="selenide, water dikinase"
FT                   /note="Contains selenocysteine; TIGRFAM: selenide, water
FT                   dikinase; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: mja:MJ1591m
FT                   selenophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68766"
FT                   /db_xref="GOA:D3S6V6"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V6"
FT                   /inference="protein motif:TFAM:TIGR00476"
FT                   /protein_id="ADC68766.1"
FT                   /translation="MAEKIKLTELVKLHGUACKLPSTELEFLVKGIVTDEDLSDKDILV
FT                   GLGDDASIIKRDGLVIAKTVDVFTPIVDDPYLQGKIAACNSTSDIYAMGLLDIVGVLAI
FT                   VGIPEKLPIHIVREMLKGFQDFCRENKTSIVGGHTILNPWPLIGGAVTGVGREEEVLTK
FT                   AGAKEGDILILTKPLGTQTAMALSRIPEEFKDLINISEDERDYIINKAIELMTTSNRYA
FT                   LMALRKAEERVGDKIANALTDITGFGILGHSNEMAKNSRVLIEINTLPCIKRTPELSRM
FT                   FGHALLDGYGAETAGGLLISAKKEYKDDLIDELERAKCYAFEVGRVVKKGEGKAVLSKD
FT                   VKVIEI"
FT   gene            57885..58604
FT                   /locus_tag="MFS40622_0067"
FT   CDS_pept        57885..58604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0067"
FT                   /product="Nucleotidyltransferase, predicted"
FT                   /note="PFAM: Nucleotidyltransferase, predicted; KEGG:
FT                   mja:MJ0002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68767"
FT                   /db_xref="GOA:D3S6V7"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V7"
FT                   /inference="protein motif:PFAM:PF10127"
FT                   /protein_id="ADC68767.1"
FT                   /translation="MEIPIFVVISGSDLYGIPNPSDVDIRGVHILDKELFIKNCLYKSR
FT                   EGEVINKMFGKCDFVSFELGKFLRELLKPNANFIEIALSDKVLYSSKYHEDVKEIAHNC
FT                   ICKKLYHHWKGFAKHLQKSSEKENYENPKTLLYILRAYYQGILCLERGEFKPDFGSFKC
FT                   LDCYDEEIVSYLFECKVDKKPIDDNYKEKIKNHFCELDLLLDESYKNSNIRDKPSEIAK
FT                   IKAIELYKKLYFEDVRG"
FT   gene            58601..59728
FT                   /locus_tag="MFS40622_0068"
FT   CDS_pept        58601..59728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0068"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mfe:Mefer_0825 aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68768"
FT                   /db_xref="GOA:D3S6V8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V8"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADC68768.1"
FT                   /translation="MISNRCKNIKPSAIREIFNLATSDCINLGIGEPDFDTPKHIVEAA
FT                   KKALDEGKTHYSPNNGIPELREEISNKLMKDYGLDVDKDNIIVTCGASEALMLSIMTLV
FT                   DRGDEVLAPNPSFVSYFSLTEFAEGKIKSISLDENFDIDLEQVKESITKKTKLIIFNSP
FT                   ANPTGKVYDKETIKGLAEIAEDYNLIIVSDEVYDKIIYDKKHYSPMQFTDRCILINGFS
FT                   KTYAMTGWRIGYLVVSDELNKELDLINNMIKIHQYSFACATTFAQYGALAALRGSQKCV
FT                   EEMVNEFRRRRDLIYNGLKDIFKVNKPEGAFYIFPDVSEYGDGVEVAKKLIENKVLCVP
FT                   GIAFGENGANYIRFSYATKYEDIERALEIIKGIFG"
FT   repeat_region   60125..60376
FT                   /rpt_unit_range=60125..60156
FT                   /note="CRISPRS"
FT   gene            complement(60829..62094)
FT                   /locus_tag="MFS40622_0069"
FT   CDS_pept        complement(60829..62094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0069"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: mja:MJ1133 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68769"
FT                   /db_xref="GOA:D3S6V9"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6V9"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADC68769.1"
FT                   /translation="MREIINKLDPIIIEKAHKKFGVSRILKKYDGRPVYIKDVDGFEVV
FT                   GNLCSRETLSKIFGVKKEEFTFFMLNAMEKEKEGKLKINNKLKEKYIVESPEKIKDWPI
FT                   PIYYEKDAGAYITSGVVVVNDKDYGYNLSIHRILVKDDYLVIRMVEQRHLHFLYTKAIK
FT                   EKGYLDVAIVIGVHPAVLLAGSTSADITFDELKFAAALLGGEIDVFELDNGLLVPEAEF
FT                   IIEGKILAEMDDEGPFVDITGTYDIVRKQPIIKIEKLYRKEKPVFHALLPGGIEHKTLM
FT                   GMPQEPRILKGVRNTVPTVKNVVLTEGGCCWLHAVVQIEKRTEGDGKNAILAAFASHPS
FT                   LKHVVVVDDDINIFDINDVEYAIATRVQGDKDIVIIPGAKGSSLDPSSDLKNKLTAKVG
FT                   IDATMSLIKGREHFERAKIPDE"
FT   gene            62174..62521
FT                   /locus_tag="MFS40622_0070"
FT   CDS_pept        62174..62521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0070"
FT                   /product="Protein of unknown function UPF0058"
FT                   /note="PFAM: Protein of unknown function UPF0058; KEGG:
FT                   mja:MJ1132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68770"
FT                   /db_xref="InterPro:IPR002753"
FT                   /db_xref="InterPro:IPR036519"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W0"
FT                   /inference="protein motif:PFAM:PF01893"
FT                   /protein_id="ADC68770.1"
FT                   /translation="MHKEQLMKLHQFFVYVVKEIMDDNLENIDNECKKLLEIYEMLDIR
FT                   PHHIHRLKSEQKAAILLLSACVASYLANNMDNVPKNLAKKLEENAFKHLNSCKKNIIIL
FT                   EEDENNDKKEV"
FT   gene            62540..63472
FT                   /locus_tag="MFS40622_0071"
FT   CDS_pept        62540..63472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0071"
FT                   /product="GMP synthase, large subunit"
FT                   /EC_number="6.3.5.2"
FT                   /note="KEGG: mfe:Mefer_0289 GMP synthase, large subunit;
FT                   TIGRFAM: GMP synthase, large subunit; PFAM: GMP synthase
FT                   domain protein; tRNA methyl transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68771"
FT                   /db_xref="GOA:D3S6W1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR026598"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W1"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADC68771.1"
FT                   /translation="MFNPQKFIEEAVEEIKQQIKDRRAIIALSGGVDSSVAAVLTHKAI
FT                   GNNLTAVFVDTGLMRKGEREEVERTFRDKLGLNLIVVDAKDRFLEALKGVTDPEEKRKI
FT                   IGKLFIDVFEEVAEEIKAEVLVQGTIAPDWIETQGKIKSHHNVALPHGMVLEVVEPLRE
FT                   LYKDEVRLLAKELGLPDSIVYRQPFPGPGLAVRVLGEVTEEKLNICREANAIVEEEIKK
FT                   ANLDKDLWQYFAVVLDCKATGVKGDEREYNWIVALRMVKSLDAMTAHVPELPFDLLKRI
FT                   SKRITSEIPNVARVVFDITDKPPATIEFE"
FT   gene            complement(63700..65115)
FT                   /locus_tag="MFS40622_0072"
FT   CDS_pept        complement(63700..65115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0072"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="TIGRFAM: amidophosphoribosyltransferase; PFAM:
FT                   glutamine amidotransferase class-II;
FT                   phosphoribosyltransferase; KEGG: mja:MJ0204
FT                   amidophosphoribosyltransferase (PurF)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68772"
FT                   /db_xref="GOA:D3S6W2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W2"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADC68772.1"
FT                   /translation="MCGIFGVYSYEKLNVAKRIYYGLFALQHRGQEGAGIATSDGKNIH
FT                   YYKNIGLVTDVFRNETLQNLFGYIGIGHVRYSTTGGKAVENCQPFVVKSSFGNIAIAHN
FT                   GDLVNSDELRRELEMKGHIFTSSTDSEVIAQLLVRELLKTSDKIEAIKNTLKKLVGAYS
FT                   LLIMFNDSLIAVRDPWGFKPLCIGRDESNIYISSEDCALTTLDAEFIRDVEPGEIIEIK
FT                   NGEMISHKLDYDVSEYNPVDINVPCIYKGATTCMFEYVYFARPDSTIDGISVYKVRKRI
FT                   GKILAKEHPVDADVVSPIPDSGVAFALGFSEESGIPYYEGLIKNRYVGRTFILPSQNER
FT                   ELAVRLKLSPVKSVLEGKRVVLVDDSIVRGTTSRRIVNMVRKAGAKEVHLRIGSPKIIS
FT                   PCYYGIDMATKKELIASNKTEEEIGKAIGVDSIGYLSLEGLVKAIGRKDLCLACVTGEY
FT                   PTEVKFEKILGRE"
FT   gene            complement(65215..66267)
FT                   /locus_tag="MFS40622_0073"
FT   CDS_pept        complement(65215..66267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0073"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein; KEGG: mja:MJ0203
FT                   phosphoribosylaminoimidazole synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68773"
FT                   /db_xref="GOA:D3S6W3"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W3"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADC68773.1"
FT                   /translation="MVTYKDAGVDISHEDRVIKALVSQITFKRTDIKPAELGLHYAGAV
FT                   EFGDYYLVLSTDGVGSKMIVAEMANKFDTVGIDMIAMNVNDAICIGAEPIALVDYLAVG
FT                   HITEEIAEQIGKGLNEGAKEANINIVGGETATLPDMIKGIDLAGTVLAIVKKDEIITGK
FT                   DVKPGDVIVGLRSSGIHSNGLSLARKVFFDIAKLGINDKLSYGKTVAEELLTPTKIYVK
FT                   PVLEMVRDKDIKVKGLAHITGGSFRKLKRLNDRVTYYIDNLPEPLPIFKEIQRLGNVPD
FT                   EEMFRTFNMGIGFCVIVDEEDADKVIKIANKYNIPAQIIGRVVDSLEVNGNKIVGKAVV
FT                   KYNDKHIILE"
FT   gene            complement(66279..67289)
FT                   /locus_tag="MFS40622_0074"
FT   CDS_pept        complement(66279..67289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0074"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; SMART: AAA ATPase; KEGG: mja:MJ0625
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68774"
FT                   /db_xref="GOA:D3S6W4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W4"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ADC68774.1"
FT                   /translation="MKFYNREKELQYLKTYCQLEPNSILFVYGPKSSGKSTVMRRVIKE
FT                   LEDSDIVFFYYNLREHATYSKEEFLEVFFEKDRMKYVKNNLILDLKVFKIGIEENYDFS
FT                   KLSLNDVFKKIKASINAVIEDGKKPVLIIDELQKLKNIYFNGGKSLLNELFNLFVSLTK
FT                   MEHLCHVICITSDTLFIEEIYQNSTLENTSKYYLIDWLSEEAIRNILKEEGFSEEEINY
FT                   CLKYLSLPYEIVDLIENKKLGLSVEETIKQWINIERDKILYLISTQKEFEMKRLVNTLK
FT                   LFKDKIKIDISEIIKNNLMDEAKFLIKNEILFYDVINGIVKLTSIKKWYAIKEII"
FT   gene            complement(67399..68277)
FT                   /locus_tag="MFS40622_0075"
FT   CDS_pept        complement(67399..68277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0075"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   mja:MJ0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68775"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W5"
FT                   /inference="protein motif:PFAM:PF01937"
FT                   /protein_id="ADC68775.1"
FT                   /translation="MKIKPECAICIIRQVVDVANEITDDEREQFRLIKNTMEVIKDVYG
FT                   ENAVPAWMGTVVHRYLKRISNNSDPYKNLKDKANKIALQYLDKVREMSNIDDELERLRK
FT                   KVLATIAGNVIDFGAYSTGIDIERLIEDTLNKDLKIDNSKELLNDLKNKDIKKVLYICD
FT                   NAGEIIFDRVLIEEIKNYDKEIVAVVKGKPILNDATLEDAKIAKIDEIAKVITTGSDII
FT                   GIILEECSEEFLKEFETADLIIAKGMGNYESLTEYEDKIDKPIYYILKAKCKPVAENIG
FT                   VNVGDNVLLRK"
FT   gene            68338..68820
FT                   /locus_tag="MFS40622_0076"
FT   CDS_pept        68338..68820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0076"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   mja:MJ0201 lipoprotein B (LppB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68776"
FT                   /db_xref="GOA:D3S6W6"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W6"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADC68776.1"
FT                   /translation="MINFEIFKEFLLNLIKDYGYFGIFLVGFSEPIFQPFPTEIFIAAG
FT                   LLAGLDWKLVWLISTIACNFGAIITYYLAKRYGEKLMLKLFDEEKIKKGTLYLKKWGIL
FT                   GVIVASFTPIPFEVICWVCGSFEMPFERYMIAVFLSRLIRHGMVILPFILKDHIHF"
FT   gene            68898..69143
FT                   /locus_tag="MFS40622_0077"
FT   CDS_pept        68898..69143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0077"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: mja:MJ0200 hydrogenase expression/formation protein
FT                   (HypC)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68777"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W7"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ADC68777.1"
FT                   /translation="MCLAIPCRVVEIIEEDGEKYAIAEYKGVRQKAKLTLLDKEVKIGD
FT                   YILIHTGYALEVLSEEDAKLSLEAWEELFKALEEMG"
FT   gene            complement(69183..69371)
FT                   /locus_tag="MFS40622_0078"
FT   CDS_pept        complement(69183..69371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0078"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mfe:Mefer_0480 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68778"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W8"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68778.1"
FT                   /translation="MAVTIDYNLCKGAECAECVNNCPMEVFEIEGDRVVVAREEDCTYC
FT                   GVCEDVCPTGAVKVEPE"
FT   gene            complement(69459..70403)
FT                   /locus_tag="MFS40622_0079"
FT   CDS_pept        complement(69459..70403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0079"
FT                   /product="Enolase-like protein"
FT                   /note="PFAM: Enolase-like; KEGG: mja:MJ0198 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68779"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6W9"
FT                   /inference="protein motif:PFAM:PF03952"
FT                   /protein_id="ADC68779.1"
FT                   /translation="MTNVIIEKINAKEVFKGAKIKVMITTITNISIGYDIIEVDNPEEA
FT                   IADVENVIAPELIGYPATDIDFIDALICETSVNNPIVAMGVSISIARAASNSLDIPLFK
FT                   FLGGALTTELPIVASGILVDKDKNELIPIVMADSIEDIVNLYLKLTDILSQDYSIVNID
FT                   GAYTCKNIFNEIPRIRNLIDEIKEDEDLDILLGLSSKKEIVKDKDLSQIDYLEVEEPAE
FT                   FDGFLCTGSIYEESDFVKVYPYEMGTITEMYYYINYIMDKGLYPVIFGNNSSFAHIAVS
FT                   FKVPFLRASLSSNVLNEVWNIERTIMNPNIRRF"
FT   gene            complement(70504..70677)
FT                   /locus_tag="MFS40622_0080"
FT   CDS_pept        complement(70504..70677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0080"
FT                   /product="RNA polymerase Rpb6"
FT                   /note="PFAM: RNA polymerase Rpb6; KEGG: mja:MJ0197
FT                   DNA-directed RNA polymerase, subunit K (RpoK)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68780"
FT                   /db_xref="GOA:D3S6X0"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X0"
FT                   /inference="protein motif:PFAM:PF01192"
FT                   /protein_id="ADC68780.1"
FT                   /translation="MKLTKFEIARILGARSLQISNGAYITIETECDSSLKIAYEEIKQG
FT                   KVPLKPIRPVKA"
FT   gene            complement(70702..70778)
FT                   /locus_tag="MFS40622_R0001"
FT                   /note="tRNA-Pro2"
FT   tRNA            complement(70702..70778)
FT                   /locus_tag="MFS40622_R0001"
FT                   /product="tRNA-Pro"
FT   gene            complement(70799..71017)
FT                   /locus_tag="MFS40622_0081"
FT   CDS_pept        complement(70799..71017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0081"
FT                   /product="RNA polymerase, N/8 Kd subunit"
FT                   /note="PFAM: RNA polymerase, N/8 Kd subunit; KEGG:
FT                   mja:MJ0196 DNA-directed RNA polymerase subunit N"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68781"
FT                   /db_xref="GOA:D3S6X1"
FT                   /db_xref="InterPro:IPR000268"
FT                   /db_xref="InterPro:IPR020789"
FT                   /db_xref="InterPro:IPR023580"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X1"
FT                   /inference="protein motif:PFAM:PF01194"
FT                   /protein_id="ADC68781.1"
FT                   /translation="MFPIRCFSCGNVIAEVFEEYKERILKGENPKDVLDDLGIKKYCCR
FT                   RMFISYRIGEDGREIIDEIIAHDERYL"
FT   gene            complement(71077..71487)
FT                   /locus_tag="MFS40622_0082"
FT   CDS_pept        complement(71077..71487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0082"
FT                   /product="ribosomal protein S9P"
FT                   /note="TIGRFAM: ribosomal protein S9P; PFAM: ribosomal
FT                   protein S9; KEGG: mfe:Mefer_0484 ribosomal protein S9P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68782"
FT                   /db_xref="GOA:D3S6X2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR019958"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X2"
FT                   /inference="protein motif:TFAM:TIGR03627"
FT                   /protein_id="ADC68782.1"
FT                   /translation="MGKIVITVGKRKRAIARAVAREGKGRIRINKIPIELIEPKYKRMK
FT                   LMEPILLAGEEVISQMDIDVTVKGGGVMGQMDAARTAIGKAIVEFTGSKELRDKFLAYD
FT                   RTLLVSDARRTEPHKPSRSTKGPRAKRQKSYR"
FT   gene            complement(71497..71910)
FT                   /locus_tag="MFS40622_0083"
FT   CDS_pept        complement(71497..71910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0083"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: mja:MJ0194 50S ribosomal protein L13P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68783"
FT                   /db_xref="GOA:D3S6X3"
FT                   /db_xref="InterPro:IPR005755"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X3"
FT                   /inference="protein motif:TFAM:TIGR01077"
FT                   /protein_id="ADC68783.1"
FT                   /translation="MTVIDAEGAILGRLASEVAKRVLRGEEIVIVNAEKVVITGNKDWI
FT                   IKTYQEEREKKNVANPRRFGPKFPRRPDDILRRTIRKMLPYKKPKGREAFKRVKVYVGN
FT                   PKNLTVDEKISHKLNTNKYITLAELSKHLGAKF"
FT   gene            complement(71925..72284)
FT                   /locus_tag="MFS40622_0084"
FT   CDS_pept        complement(71925..72284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0084"
FT                   /product="ribosomal protein L15"
FT                   /note="PFAM: ribosomal protein L15; KEGG: mja:MJ0193 50S
FT                   ribosomal protein L18e"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68784"
FT                   /db_xref="GOA:D3S6X4"
FT                   /db_xref="InterPro:IPR000039"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR022947"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X4"
FT                   /inference="protein motif:PFAM:PF00256"
FT                   /protein_id="ADC68784.1"
FT                   /translation="MKKITATNPRLVRLIEMLKQESYKNQAKIWKDIARRLAKPRRRAE
FT                   VNLSKINRYTKEGDVVLVPGKVLGAGKLEHKVVVAAFAFSETAKKLIKEAGGEAITIEE
FT                   LIKRNPKGSNVKIMA"
FT   gene            complement(72359..72934)
FT                   /locus_tag="MFS40622_0085"
FT   CDS_pept        complement(72359..72934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0085"
FT                   /product="RNA polymerase insert"
FT                   /note="PFAM: RNA polymerase insert; RNA polymerase
FT                   dimerisation; SMART: RNA polymerase RpoA/D/Rpb3-type; KEGG:
FT                   mja:MJ0192 DNA-directed RNA polymerase, subunit D (RpoD)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68785"
FT                   /db_xref="GOA:D3S6X5"
FT                   /db_xref="InterPro:IPR001514"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X5"
FT                   /inference="protein motif:PFAM:PF01000"
FT                   /protein_id="ADC68785.1"
FT                   /translation="MITIKEKKKTRIGEEFIFSLKAPISFSNAIRRIMISEVPTYAIED
FT                   VYIYENSSSMDDEILAHRLGLIPIKGKPLIESEVITFTLEKEGPCTVYSSDLKSENGEV
FT                   AFKNIPIVKLGRGQKIKIECEAVPGIGKTHAKWQPCNAVYKQVAEDEVEFFVETFGQME
FT                   AEEILEEAVKILKNKAESFLQQLELIEQ"
FT   gene            complement(72946..73335)
FT                   /locus_tag="MFS40622_0086"
FT   CDS_pept        complement(72946..73335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0086"
FT                   /product="ribosomal protein S11P"
FT                   /note="TIGRFAM: ribosomal protein S11P; PFAM: ribosomal
FT                   protein S11; KEGG: mvu:Metvu_1635 ribosomal protein S11P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68786"
FT                   /db_xref="GOA:D3S6X6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X6"
FT                   /inference="protein motif:TFAM:TIGR03628"
FT                   /protein_id="ADC68786.1"
FT                   /translation="MAETKKEKWGIVHIYSSYNNTIIHATDITGAETIARVSGGMVTRN
FT                   QRDEGSPYAAMQAAFKLAEILKERGIENIHIKVRAPGGSGQKNPGPGAQAAIRALARAG
FT                   LRIGRIEDVTPVPHDGTTPKKRFKK"
FT   gene            complement(73351..73911)
FT                   /locus_tag="MFS40622_0087"
FT   CDS_pept        complement(73351..73911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0087"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: mja:MJ0190 30S ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: RNA-binding S4 domain protein;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68787"
FT                   /db_xref="GOA:D3S6X7"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR022802"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X7"
FT                   /inference="protein motif:TFAM:TIGR01018"
FT                   /protein_id="ADC68787.1"
FT                   /translation="MGDPRRRFKKTYETPNHPWIKERIEREKELCRKYGLRRKREVWKA
FT                   ETILRKYRRQARRLISDRTEQGAKEAVQLFNVLKKYGILKVENPTLDDVLSLTVEDILE
FT                   RRLQTLVFRKGLARTPRQARQLIVHGHIAVNGRVVTAPSYMVTVEEEDKISYAKNSPFN
FT                   DENHPERAKIVGLTEETQASETE"
FT   gene            complement(73967..74419)
FT                   /locus_tag="MFS40622_0088"
FT   CDS_pept        complement(73967..74419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0088"
FT                   /product="ribosomal protein S13P"
FT                   /note="TIGRFAM: ribosomal protein S13P; PFAM: ribosomal
FT                   protein S13; KEGG: mja:MJ0189 30S ribosomal protein S13P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68788"
FT                   /db_xref="GOA:D3S6X8"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019977"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X8"
FT                   /inference="protein motif:TFAM:TIGR03629"
FT                   /protein_id="ADC68788.1"
FT                   /translation="MQNSEFKYLIRVSRTDLDGNKKLIMALQDIYGVGEAMARAVIRVT
FT                   KLDPNKLAGYLTEEEVKKIEEVLADPAKFGIPSWMFNRRKDYVTGEDKHVIESDLMIIK
FT                   QEDINRLKRIRCYRGIRHELGLPCRGQRTRSTFRRGQTVGVSRRKK"
FT   gene            complement(74488..74576)
FT                   /locus_tag="MFS40622_R0002"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(74488..74576)
FT                   /locus_tag="MFS40622_R0002"
FT                   /product="tRNA-Ser"
FT   gene            74826..75647
FT                   /locus_tag="MFS40622_0089"
FT   CDS_pept        74826..75647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0089"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease; CBS
FT                   domain containing protein; KEGG: mja:MJ0188
FT                   inosine-5'-monophosphate dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68789"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR016427"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6X9"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADC68789.1"
FT                   /translation="MKIFVMGVIMSVKVSEYMTKKVVTVSKDNTVKDVIKLLRETGHNS
FT                   FPVVENGKLIGIVSVHDIVGKDDNEKVENVMTKREDMVVTTPDANIMDVGRIMFRTGFS
FT                   KLPVVDEENNLVGIISNMDVIRSQIEKTTPKKLENIIKTYKNLGYNLKVEKKEVDVNKL
FT                   KPTQNKIHADELIGRMYELKKGLAEPIIAIKTKRGDYYILVDGHHRAVAAYKMGVPKLD
FT                   AYVIYLDTDKKLGIEKTAEIMNLKSLEDVKIVDTGEGNSVKVIEYNKNSMG"
FT   gene            75650..76087
FT                   /locus_tag="MFS40622_0090"
FT   CDS_pept        75650..76087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0090"
FT                   /product="Protein of unknown function DUF509"
FT                   /note="PFAM: Protein of unknown function DUF509; KEGG:
FT                   mja:MJ0187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68790"
FT                   /db_xref="InterPro:IPR013926"
FT                   /db_xref="InterPro:IPR036504"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y0"
FT                   /inference="protein motif:PFAM:PF04416"
FT                   /protein_id="ADC68790.1"
FT                   /translation="MIIRGIKGAKINNEIFNLGLKFQILNANLVATKKHILHAINQAKT
FT                   KKPIARNFWMEILVRASGQRQIHEAIKIIGAKDGDVCVVCEDEETFRKIHELIGGEIDD
FT                   SVLEINEEKERLIREVFNIRGFGNLVERVLEKIALIELKKE"
FT   gene            76098..77306
FT                   /locus_tag="MFS40622_0091"
FT   CDS_pept        76098..77306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0091"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.35"
FT                   /note="KEGG: mja:MJ0186 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68791"
FT                   /db_xref="GOA:D3S6Y1"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y1"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ADC68791.1"
FT                   /translation="MKVIEGGVTAPKGFKANGYKEGKYGVAIIISEKEAVGAGTFTTNK
FT                   VVAHPVVLSRELIKNRDKFRAIVANSGNANCFTKDGMKDAKEMQRLVAELFNIKEDEVL
FT                   VASTGVIGRKMDMSIIKDRINKVYNLIKEGNSSINAAKAIMTTDTKPKEIAVEFEVNGK
FT                   IVRVGGIAKGAGMIAPNMLHATMLCFITTDIEIDKKSLTDVLQRVVDKTFNNISVDGDT
FT                   STNDTVFILANGLSGVNYNECKEEFENALLYVCRELAKMIVKDGEGATKFMEVVVKGAK
FT                   TMDDAIKASKAIVNSLLVKTAVFGGDPNWGRIVAAVGYSGADFNPEVVDVILSNYKDEV
FT                   YLVKDGIPLADEGTEELKKAEEIMKSDEIKIVVDLKMGEFENVCYGCDLSYEYVRINAE
FT                   YTT"
FT   gene            complement(77386..77844)
FT                   /locus_tag="MFS40622_0092"
FT   CDS_pept        complement(77386..77844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0092"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: mja:MJ0180 30S ribosomal protein
FT                   S19P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68792"
FT                   /db_xref="GOA:D3S6Y2"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005713"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y2"
FT                   /inference="protein motif:TFAM:TIGR01025"
FT                   /protein_id="ADC68792.1"
FT                   /translation="MASARRRRIKKKKQVISKKIEFRYRGYTLEELQQMPLREFAKLLP
FT                   ARQRRTLLRGLTPQQKKLAMKIKKARRLLNKGKEPRIIRTHCRDFVITPDMVGLTFGVY
FT                   NGKEFVEVKVTPEMIGHYLGEFSLTRKPVQHGAPGMGATRSSMFVPIK"
FT   gene            complement(77911..78639)
FT                   /locus_tag="MFS40622_0093"
FT   CDS_pept        complement(77911..78639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0093"
FT                   /product="ribosomal protein L2"
FT                   /note="PFAM: ribosomal protein L2; KEGG: mja:MJ0179 50S
FT                   ribosomal protein L2P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68793"
FT                   /db_xref="GOA:D3S6Y3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="InterPro:IPR023672"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y3"
FT                   /inference="protein motif:PFAM:PF00181"
FT                   /protein_id="ADC68793.1"
FT                   /translation="MGKRLISQRRGRGTPTYTCPSHKRRGEAKYRRFDELEKKGKVLGK
FT                   IIDILHDPGRSAPVAKVEYETGEEGLLVVPEGVKVGDIIECGVSAEIKPGNILPLGAIP
FT                   EGIPVFNIETVPGDGGKLVRAGGCYAHILTHDGERTYVKLPSGHIKALHSMCRATIGVV
FT                   AGGGRKEKPFVKAGKKYHAMKAKAVKWPRVRGVAMNAVDHPFGGGRHQHTGKPTTVSRK
FT                   KVPPGRKVGHISARRTGVRK"
FT   gene            complement(78698..78958)
FT                   /locus_tag="MFS40622_0094"
FT   CDS_pept        complement(78698..78958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0094"
FT                   /product="ribosomal protein L23"
FT                   /note="TIGRFAM: ribosomal protein L23; PFAM: Ribosomal
FT                   protein L25/L23; KEGG: mja:MJ0178 50S ribosomal protein
FT                   L23"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68794"
FT                   /db_xref="GOA:D3S6Y4"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="InterPro:IPR019985"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y4"
FT                   /inference="protein motif:TFAM:TIGR03636"
FT                   /protein_id="ADC68794.1"
FT                   /translation="MDAFDVIKAPVVTEKTVRMIEEENKLVFYVDRRATKEDIKRAMKE
FT                   LFDVEVEKVNTLITPKGEKKAYVKLKEGYDASKIAASLGIY"
FT   gene            complement(78987..79745)
FT                   /locus_tag="MFS40622_0095"
FT   CDS_pept        complement(78987..79745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0095"
FT                   /product="50S ribosomal protein L4P"
FT                   /note="TIGRFAM: 50S ribosomal protein L4P; PFAM: ribosomal
FT                   protein L4/L1e; KEGG: mja:MJ0177 50S ribosomal protein L4P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68795"
FT                   /db_xref="GOA:D3S6Y5"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR019970"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y5"
FT                   /inference="protein motif:TFAM:TIGR03672"
FT                   /protein_id="ADC68795.1"
FT                   /translation="MKAVVYNLNGEAVKEIDLPAVFEEEYRPDLIKRAFLSAFTARLQP
FT                   KGSDPMAGMRTSAKNIGKGHGRARVDRVPQGWAARVPQAVGGRRAHPPKVEKILWERVN
FT                   KKERIKAIKSAIAATANPELVKERGHIFETENLPIVVESSFEELQKTKDVFAVFEKLGI
FT                   SSDVIRAKNGIKIRAGKGKMRGRRYKKPRSILVVVGDKCNAILASRNLPGVDVITAKDL
FT                   GIIHLAPGGVAGRLTVWTESALEKLKERFE"
FT   gene            complement(79788..80795)
FT                   /locus_tag="MFS40622_0096"
FT   CDS_pept        complement(79788..80795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0096"
FT                   /product="ribosomal protein L3"
FT                   /note="TIGRFAM: ribosomal protein L3; PFAM: ribosomal
FT                   protein L3; KEGG: mja:MJ0176 50S ribosomal protein L3P"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68796"
FT                   /db_xref="GOA:D3S6Y6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019928"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y6"
FT                   /inference="protein motif:TFAM:TIGR03626"
FT                   /protein_id="ADC68796.1"
FT                   /translation="MGLNINRPRRGSLAFSPRKRAKRPVPRIRSWPEEETVRLQAFPVY
FT                   KAGMSHAFIKEDNPKSPNAGQEIFTPITILEAPPINVCAIRVYGRNERNYLTTLTEVWA
FT                   DNLDKELERKIKLPKKEDRKTVEDLEALKDKIEDVRVLVHTNPKLTCLPKKKPEILEIR
FT                   IGGKDIEERLNYAKEILGKQLNITDVFQEGELVDTIGVTKGKGFQGQVKRWGVKIQFGK
FT                   HARKGVGRHVGSIGPWQPKMVMWSVPMPGQMGYHQRTEYNKRILKIGNNGDEITPKGGF
FT                   LHYGVIRNNYVVLKGSVQGPAKRLIVLRRAIRPQEPLIKVPEITYISTTSKQGK"
FT   gene            81119..81721
FT                   /locus_tag="MFS40622_0097"
FT   CDS_pept        81119..81721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0097"
FT                   /product="Translin"
FT                   /note="PFAM: Translin; KEGG: mja:MJ0175 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68797"
FT                   /db_xref="GOA:D3S6Y7"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y7"
FT                   /inference="protein motif:PFAM:PF01997"
FT                   /protein_id="ADC68797.1"
FT                   /translation="MDELNYLINYLANKDSVREEILKLSREITRDCAMLIRKIHKSDDK
FT                   DEFKDKLNEISEKIKKLNGLATFPEFVGYLSTPQQEFVEALSLYMIKFDNKIPSFKELD
FT                   FIKEENYILGLADVIGELRREVLEAMKNDNLAEVERYFKFMEDLYEFLMNFDYYHVVDN
FT                   LRRKQDISRGILEKTHGDIVMFIENLKLRKELKKLQL"
FT   gene            complement(81722..82765)
FT                   /locus_tag="MFS40622_0098"
FT   CDS_pept        complement(81722..82765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0098"
FT                   /product="translation factor pelota"
FT                   /note="TIGRFAM: translation factor pelota; PFAM: eRF1
FT                   domain 1 protein; eRF1 domain 2 protein; eRF1 domain 3
FT                   protein; KEGG: mja:MJ0174 cell division protein pelota
FT                   (PelA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68798"
FT                   /db_xref="GOA:D3S6Y8"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y8"
FT                   /inference="protein motif:TFAM:TIGR00111"
FT                   /protein_id="ADC68798.1"
FT                   /translation="MKIIEEIPQKQIIKLMPENLDDLWVLYNIIEEGDKVFAVTERRVQ
FT                   DKGDVIRADRGAKRKMFLGIEVKNVEFDENTKRVRILGTIIHGPDDVPLGSHHTIEIKP
FT                   FDELSIEKNWKKWQIERIKEAIESSKRPKVLVVVMDDEEADIFEVRDYSIKEICSIKSH
FT                   TSKKLDYKINEELKKEYYHEIAKVLMEYDVDNILVAGPGFAKNSFYNFISSQYPELKNK
FT                   IVVESISTTSRAGLNEVIKRGIINRIYAESRVAKETQLIEKLLEEIAKKGLAVYGIDEV
FT                   KKALEYSAIDTLLVSDSLVRNHEIEKIIDTTEEMGGKVVIVSSEHDAGKQLKALGGIAG
FT                   LLRFPIE"
FT   gene            complement(82931..83356)
FT                   /locus_tag="MFS40622_0099"
FT   CDS_pept        complement(82931..83356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0099"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="TIGRFAM: DNA-binding protein, Tfx family; PFAM:
FT                   sigma-70 region 4 domain protein; KEGG: mja:MJ0173 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68799"
FT                   /db_xref="GOA:D3S6Y9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004645"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR018384"
FT                   /db_xref="InterPro:IPR029291"
FT                   /db_xref="InterPro:IPR036657"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Y9"
FT                   /inference="protein motif:TFAM:TIGR00721"
FT                   /protein_id="ADC68799.1"
FT                   /translation="MVLCMVEDSFLTETQIKVLKLRKKGLTQEEIAKMLGTSRANISMI
FT                   EKRAKENIKKAYNTIKIYNRIMAPLSIEIEEGTDVLDIPDIVFKKADEEGIKVRYNTLE
FT                   LIELIKENASEFIEKRTVKKKFKIYILENGDLDVGGS"
FT   gene            83430..84077
FT                   /locus_tag="MFS40622_0100"
FT   CDS_pept        83430..84077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0100"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: mja:MJ0172 protein-L-isoaspartate
FT                   O-methyltransferase; TIGRFAM: protein-L-isoaspartate
FT                   O-methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68800"
FT                   /db_xref="GOA:D3S6Z0"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z0"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADC68800.1"
FT                   /translation="MNLEEQKKAVIERLIREGYIKSKRVIDALLKVPREEFVPEHLKEY
FT                   AYVDKPLEIGYGQTISAIHMVGMMSELLDLKPGMKVLEIGTGCGYHAAVTAEIVGEDGL
FT                   VVSIERIPELAEKAERTLRKLGYDNVIVIVGDGTLGYEPLAPYDRIYTTAAGPKIPEPL
FT                   IKQLKDGGKLLMPIGRYLQKLVLAEKRGNEIIVKDCGPVAFVPLIGREGFYG"
FT   gene            84214..85935
FT                   /locus_tag="MFS40622_0101"
FT   CDS_pept        84214..85935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0101"
FT                   /product="DNA ligase I, ATP-dependent Dnl1"
FT                   /EC_number="6.5.1.1"
FT                   /note="KEGG: mja:MJ0171 DNA ligase (lig); TIGRFAM: DNA
FT                   ligase I, ATP-dependent Dnl1; PFAM: ATP dependent DNA
FT                   ligase; DNA ligase domain protein; ATP dependent DNA ligase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68801"
FT                   /db_xref="GOA:D3S6Z1"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z1"
FT                   /inference="protein motif:TFAM:TIGR00574"
FT                   /protein_id="ADC68801.1"
FT                   /translation="MLWKDVCEIFNKIEKTTKRLEKRDYFIKLIDMVKEKGKPEDLKKI
FT                   CYMAIGRVYPEYDERELGIGEKLLINAVTSIGINKDELLEKIKETGDIGLAIEQLKSKI
FT                   KQASLFFQPLTVDEVYETLKRVGEIEGEGSQKKKLRLISSLFLRASPIECRYLARLILE
FT                   DMRIGMNVPTILDSLSVYFNVPKEKLEKIYAITNDIGLLAEKLLMGDLESEDLKLKLFR
FT                   PIKPMLAQLTPSIEEALLEMGRAQFETKYDGARVQIHKDGNKVKIYSRRLEDVTNALPE
FT                   IVEAVKNINVDKLIVEGECVAIDKQTGKPRPFQDILRRFRRKYDIGKMMKEINLRVYLF
FT                   DILYKDGVSFIDEEFEKRRKVLEEIVGYENDWRTERERIEKELKSDKIIDISYKLVTND
FT                   ANEAKEFYNWSLSIGHEGVMIKNLKAPYTPGSRVRTMYKFKPTLESLDVVITKAKRGMG
FT                   KRKDWYGSFEICVRDEEGNLYPIGHVGTGLTEADLEMLKEEIDKIVIRDLGEEVEVEPK
FT                   IVIEVAYEEIQKSDKYPCGYALRFPRVVRFRFDKGVNDINTVEDVERIYEIQRGRK"
FT   gene            86018..87073
FT                   /locus_tag="MFS40622_0102"
FT   CDS_pept        86018..87073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0102"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mja:MJ0170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68802"
FT                   /db_xref="GOA:D3S6Z2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z2"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ADC68802.1"
FT                   /translation="MEIFGNSIYNIAVFIVITLLGIFIGKIVDKIVRNYLKKIADKTKT
FT                   KLDDIILESIDLPIIIIVVTVFFYFGLKFLILPDYIFKLANEAIKVVVILSATYFAVKF
FT                   IDGIFEHYLIPLTEKTETELDEHIIKPLKKVVKILTILLGLLTALSSVGYDVTALLAGL
FT                   GVGGLALALAMQDTIKNFIAGILILIDKPFSLGHWVKVENVEGIVEEIGIRSTRIRTFD
FT                   YTLITIPNSELLDSAIENLTVRDRRRVLMTIGLTYDTPVEKIKKAKEIIKEIVENHPAT
FT                   LPPYRVHFMEYGDWSLNLRIEYFVRNMGFDYFLNAVDEINLKIKEEFEKKGIEMAFPTY
FT                   TVYLEKDKNNN"
FT   gene            complement(87070..87852)
FT                   /locus_tag="MFS40622_0103"
FT   CDS_pept        complement(87070..87852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0103"
FT                   /product="cell division ATPase MinD"
FT                   /note="TIGRFAM: cell division ATPase MinD; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; KEGG: mja:MJ0169 cell division
FT                   inhibitor MinD"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68803"
FT                   /db_xref="GOA:D3S6Z3"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z3"
FT                   /inference="protein motif:TFAM:TIGR01969"
FT                   /protein_id="ADC68803.1"
FT                   /translation="MIITIASGKGGVGKTTTSASLAVALAKLGKKVLAIDGDISMANLG
FT                   ILFNMEKKKPSLHEVLSGEADVKDAIYKHKTGVYVLPTSLSLEGYKKSDIDLLPDVVNE
FT                   VADDFDYVIIDAPAGLNREMATHLAIADKLLLVVTPEMFSIIDAVRLKESAEMAGTPLM
FT                   GVVLNRVGRDFGEMGKDEIEMLIKGKVLVEVPEDENVRSAALKKMSVIEYRQSSPASQA
FT                   YMKLASIIAGVPIYMEEKIKIVKKESFIDKIKRLFRMY"
FT   gene            88096..88299
FT                   /locus_tag="MFS40622_0104"
FT   CDS_pept        88096..88299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0104"
FT                   /product="Transcription factor CBF/NF-Y/histone domain
FT                   protein"
FT                   /note="PFAM: Transcription factor CBF/NF-Y/histone domain
FT                   protein; SMART: TATA box binding protein associated factor
FT                   (TAF); KEGG: mvu:Metvu_1660 transcription factor
FT                   CBF/NF-Y/histone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68804"
FT                   /db_xref="GOA:D3S6Z4"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR004823"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z4"
FT                   /inference="protein motif:PFAM:PF00808"
FT                   /protein_id="ADC68804.1"
FT                   /translation="MAELPVAPFERILKKAGAERVSRAAAEYLAEAVEEIALEIAKEAV
FT                   ELAKHAKRKTVKVEDIKLALKK"
FT   gene            88343..88699
FT                   /locus_tag="MFS40622_0105"
FT   CDS_pept        88343..88699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sab:SAB2204c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68805"
FT                   /db_xref="GOA:D3S6Z5"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68805.1"
FT                   /translation="MNLLPIYFGVVSWIIIFLTFSYMLNNPKVSYSILKSNKRIIIYTC
FT                   LAYFIIQMGFCAIEGYVSFLAIVCCVIFTLILGYALNKCINKQYKTSMQSSERGISILA
FT                   ALDTIVSIIFDLIK"
FT   gene            88817..89308
FT                   /locus_tag="MFS40622_0106"
FT   CDS_pept        88817..89308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0106"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   mja:MJ0167 molybdenum cofactor biosynthesis protein (MoaB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68806"
FT                   /db_xref="GOA:D3S6Z6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z6"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ADC68806.1"
FT                   /translation="MHKRIKDIKYAVVTVSDSRYNDLIKGKEIDDKSGNLLKKELNAKI
FT                   YTIIPDNKDMIKGIVEHIVEFFDVDCIVFTGGTGIAKRDVTVEALKEIIEKELEGFKII
FT                   FQKLSYEEVGFSTMLSRAMAGIYKGKVIYALPGSVNACKTALKIIKEETGHILGHLREG
FT                   "
FT   gene            89310..90077
FT                   /locus_tag="MFS40622_0107"
FT   CDS_pept        89310..90077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0107"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="PFAM: Protein of unknown function DUF516; KEGG:
FT                   mja:MJ0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68807"
FT                   /db_xref="GOA:D3S6Z7"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z7"
FT                   /inference="protein motif:PFAM:PF04414"
FT                   /protein_id="ADC68807.1"
FT                   /translation="MKFLLIASNKDLASKNIANHIKEYFDVFETDKELLALTDADLERA
FT                   DYYIFLSKHKSIANKPALTVHTPGNLTENNDFGGNPKEICPCDAVLNTLLLKNIYKNYK
FT                   TYYENQKIGEFDVSFEVVHHSPTDLKAPTVFVEIGSSEREWVLKEAGEIIAKSVLETID
FT                   AIKSKNYDKKVRAIGFGGGHYAPKFTKLALEGKYYFGYLVPKYASVSEDVLNQLISKME
FT                   VDKALIDWKGCRGEDKRRYIEFFEKEGIEWERI"
FT   gene            90105..90887
FT                   /locus_tag="MFS40622_0108"
FT   CDS_pept        90105..90887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0108"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: mja:MJ0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68808"
FT                   /db_xref="GOA:D3S6Z8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z8"
FT                   /inference="protein motif:PFAM:PF00731"
FT                   /protein_id="ADC68808.1"
FT                   /translation="MRKNLRDLLLSFKNGEIGLDEIEKQIKLNYFEEIEERLKLDINRQ
FT                   FRTGVPEVVYGKGKDVEEIIKATLKLAEKNGIALATKIEDIKKLSDKIEKYDLKNYNIK
FT                   INKKAKTLIIKNKNYDIRKIGKVGILTAGTSDIPVAEEAKDTLEVMGVEAITSYDVGIA
FT                   GIHRLFPALKRMIEENVCCIIVVAGMEGALPSVVASMVDIPVIGVPTSTSYGIKITPLL
FT                   TMLHSCSPGIAVVNIDNGFGAGVFAGLIAKAIYKYLKQ"
FT   gene            90929..92092
FT                   /locus_tag="MFS40622_0109"
FT   CDS_pept        90929..92092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0109"
FT                   /product="Protein of unknown function DUF2226"
FT                   /note="PFAM: Protein of unknown function DUF2226; KEGG:
FT                   mja:MJ0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68809"
FT                   /db_xref="InterPro:IPR019249"
FT                   /db_xref="UniProtKB/TrEMBL:D3S6Z9"
FT                   /inference="protein motif:PFAM:PF09987"
FT                   /protein_id="ADC68809.1"
FT                   /translation="MIKVVDGELIRTLTDGNLDDLVTEVNVGYILILVKEGNKLHEGYI
FT                   FVEDGEIVGSYYTDNESTEIFGNKEKILELLNYENKVIELYRYNKDKINLMKWLYPEIF
FT                   VVKKTKEEKETKKEEREDKEEKYLNIKLDIPLDVPLESNTKDFQRYLEDNKYIVVNVYK
FT                   KTSGKFENGYIIYKGKTPIAAAYECDFGVLLGKDAYEKVEQLLKDENAIIDVYEYNERK
FT                   TNVLLEIYPQMKIVDEEQSTEKEEIQKDIEEFVKEEELEEAKELSREELLKKLGIKEPD
FT                   DTWIETILEDMFRPSEEELNELKEKLENEIVNRIKMMEGVDDVKTNLKVKWENGRYYLF
FT                   GDVNVKRKRILGIIKKDIDPSIVKFEIDKIIRKFLSRYTSRISINVE"
FT   gene            92113..92667
FT                   /locus_tag="MFS40622_0110"
FT   CDS_pept        92113..92667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0110"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG: mja:MJ0163
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68810"
FT                   /db_xref="GOA:D3S700"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D3S700"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ADC68810.1"
FT                   /translation="MDGTIIFLILFIVGVGIGVGLYYYKEKEKKKTYRLIEMEIIENLK
FT                   ELKPYVAPDEGREYTKEFDLVEIALSYDIEDIIVVNDEGLVIASTLKDADEIGASASGI
FT                   FEYIKKFYSNIKKVVIFKDDSYMYIFPLKLYDENLYVIIESKIALEVVEEKEILRKICE
FT                   VLKKYFVEVEEIENETPLLNI"
FT   gene            complement(92682..93947)
FT                   /locus_tag="MFS40622_0111"
FT   CDS_pept        complement(92682..93947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0111"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="PFAM: RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   mja:MJ0162 putative mRNA 3'-end processing factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68811"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3S701"
FT                   /inference="protein motif:PFAM:PF07521"
FT                   /protein_id="ADC68811.1"
FT                   /translation="MVLLKFHGGCQQIGMSCVEVETQKGRVLLDCGMSPDTGEIPKVDD
FT                   KVIDAVIVSHAHLDHCGAIPFYKFKKIYCTHPTADLMFITWRDTLNLTKAYKEEDIQYA
FT                   MENIECLNYYEERQITENIKFKFYNAGHILGSASIYLEADGKKILYTGDINEGVSRTLL
FT                   PADTDIDEIDVLIIESTYGSPLDIKPARKTLEKQLIEEIAETIENGGKVIIPVFAIGRA
FT                   QEILLIINNYMRSGGLKEVPIYTDGSLIHATAVYMSYINWLNPKIKNMVENRINPFGEI
FT                   KKADENLVFNKEPCIIVSTSGMVQGGPVLKYLKLLKDPKNKLILTGYQAEGTLGRELEE
FT                   GAKEIQPFKNKIPIRGKVVKIEFSAHGDYNSLVRYIKKIPKPEKAIVMHGERYQSLSFA
FT                   MTIWKTLKIPTFVPVRGTILPI"
FT   gene            94245..94751
FT                   /locus_tag="MFS40622_0112"
FT   CDS_pept        94245..94751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0112"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="KEGG: mja:MJ0161 acetolactate synthase 3 regulatory
FT                   subunit; TIGRFAM: acetolactate synthase, small subunit;
FT                   PFAM: Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68812"
FT                   /db_xref="GOA:D3S702"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D3S702"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADC68812.1"
FT                   /translation="MEHRHVISALVLNKPGVLQRISGLFTRRGFNISSITVGITENSQI
FT                   SRVTIVVNGDDKILEQVIKQLNKLIDVIKVSELDEKKSVQRELCLIKIYAPTESAKSQV
FT                   IQYTSIFRGNVVDLSPESLIVEITGSEDKINAFIDLVKPLGIKEMARTGITALARGPKI
FT                   LKPKS"
FT   gene            94771..96180
FT                   /locus_tag="MFS40622_0113"
FT   CDS_pept        94771..96180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0113"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; GatB central domain protein;
FT                   Asn/Gln amidotransferase; KEGG: mja:MJ0160
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68813"
FT                   /db_xref="GOA:D3S703"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D3S703"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADC68813.1"
FT                   /translation="MNDDVKMKCGLEIHVQIDTKSKLFCNCSTNYLDAEPNTNVCPVCL
FT                   GLPGAKPLPPNKKAIEVAIMVAKMLGCKIVVDKDIYFQRKHYDYPDLPSGYQRTSTPIG
FT                   VDGEFMGIGIHEVHLEEDPGQYNPSLGIVDYNRSGTPLIEIVTKPDIKSPEEAREFLKQ
FT                   LMTLFRYLGCLRGEGTMRADVNISIEYMGVQGNRVEVKNINSIKGVYKVLKYEVIRQKN
FT                   IIKRGGEVKRETRAFLESQMITKAMRSKETAEDYRYIPDPDIQPIVISEEWVKEIVEKM
FT                   PETPLAKKKRFVEEYGIDEEDAKVLVSDLDMAEMFEEVVKSLGVNKENVDLAVTWIRNE
FT                   LRRSLQYHKVDLYESGVKAEHIVELIKLIKEGVISQKIAKEIVDLLVINRGKKMPKEIV
FT                   EELGLTVIKDEDALIKAVEEAIKNNPKAVEDYLNGKKEALNFLMGQVMRLTRGRAEPKR
FT                   VIELLKEKLDK"
FT   gene            96246..97865
FT                   /locus_tag="MFS40622_0114"
FT   CDS_pept        96246..97865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0114"
FT                   /product="Protein of unknown function DUF128"
FT                   /note="PFAM: Protein of unknown function DUF128;
FT                   Ribonuclease R winged-helix domain protein; KEGG:
FT                   mja:MJ0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68814"
FT                   /db_xref="InterPro:IPR002846"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036984"
FT                   /db_xref="InterPro:IPR038982"
FT                   /db_xref="UniProtKB/TrEMBL:D3S704"
FT                   /inference="protein motif:PFAM:PF01995"
FT                   /protein_id="ADC68814.1"
FT                   /translation="MADLDRKLIEILDILSKSKEPVGAKIIAKELNKRGYKIGERAVRY
FT                   HLKLLDGMKLTKKVGYAGRVITERGLEELEKANISYRLGSIYSNILEKTISANYRFGYV
FT                   VINRCQVYADFNDVLKIIKSVYESGLAVGDRVGIIDREKFVEINTLCSLNFDNILLQNG
FT                   IFPLHICAGVVKYEDGKPVEFKEIINYKSTSIDPLRAFIEKKETDVIGIIENGEGYLPA
FT                   NFRYFGIEFLERFESILEKDELKCIISYGTENVLGLDVGDDKVGVALIGGLTPIAPFVE
FT                   NNYCVEICPMSSIVRLESLHKVKKNPRDIVTKKANIRIKTALSKMFNAMAKVTYDIDEA
FT                   DGNVVVNTAFIEKKYTDEALDLLKEAYKKGLGISDRFGIVEEEDKIKIQTVCAVTLDGI
FT                   FLRNSVPVIPRYGGILEITEDKERFIDIIGYNGSSLDPHEVFFNFVDCEKTFLAGFREV
FT                   HRVAREKLEEVLKKLNWNGIKAIGEPNNELYGIGVNKDMCGVVTIGGINPLVLLKENEI
FT                   PIELKAMHEVVRFSDLNSYKEI"
FT   gene            complement(97987..99111)
FT                   /locus_tag="MFS40622_0115"
FT   CDS_pept        complement(97987..99111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0115"
FT                   /product="pyridoxal phosphate enzyme"
FT                   /note="TIGRFAM: pyridoxal phosphate enzyme; KEGG:
FT                   mja:MJ0158 selenocystein synthase (SelA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68815"
FT                   /db_xref="GOA:D3S705"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR020033"
FT                   /db_xref="UniProtKB/TrEMBL:D3S705"
FT                   /inference="protein motif:TFAM:TIGR03576"
FT                   /protein_id="ADC68815.1"
FT                   /translation="MLSDYEEFLRLEKARKIILEILNKKGRDALYDLSGLSGGFLIDEK
FT                   DKALLNTYIGSSYFAEKVNEYGLKHLGGNEKDKCVGFNRTSSAILATILALKPKKVIHY
FT                   LPELPGHPSIERSCKIVNAEYFESDNVDEILNKIDKDTLVIITGSTMDLKVVELENFKK
FT                   VIDTAKNKEAIVFVDDASGARVRLLFNQPPALKLGADLVATSTDKLMEGPRGGLLAGKK
FT                   ELVDKIYIEGTKFGLEAQPPLLAGMYRALKNFSLERVKKAFERAKNFDLSKVEKLNAEL
FT                   KTIDDNINIVYERTPTGFVIKRVHKDDATNIKKLIEIGFNLLEKFGIITITVAGMPGAS
FT                   KSLRIDLTSKDAERIDDSYIINAIIESIKLAFKK"
FT   gene            complement(99177..99458)
FT                   /locus_tag="MFS40622_0116"
FT   CDS_pept        complement(99177..99458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0116"
FT                   /product="Protein of unknown function DUF2098"
FT                   /note="PFAM: Protein of unknown function DUF2098; KEGG:
FT                   mja:MJ0157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68816"
FT                   /db_xref="InterPro:IPR017099"
FT                   /db_xref="InterPro:IPR019209"
FT                   /db_xref="UniProtKB/TrEMBL:D3S706"
FT                   /inference="protein motif:PFAM:PF09871"
FT                   /protein_id="ADC68816.1"
FT                   /translation="MDEVNIKVGDYVVYINTGTKGRVVDIKKDENGDVWIVLDNNLMYR
FT                   PHLLRVIDKSKIKERKEDISEVVKKLEKEELEEGKLIDIDLGDACGAG"
FT   gene            99804..101277
FT                   /locus_tag="MFS40622_R0003"
FT   rRNA            99804..101277
FT                   /locus_tag="MFS40622_R0003"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            101345..101420
FT                   /locus_tag="MFS40622_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            101345..101420
FT                   /locus_tag="MFS40622_R0004"
FT                   /product="tRNA-Ala"
FT   gene            101520..104520
FT                   /locus_tag="MFS40622_R0005"
FT   rRNA            101520..104520
FT                   /locus_tag="MFS40622_R0005"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            complement(104693..106105)
FT                   /locus_tag="MFS40622_0117"
FT   CDS_pept        complement(104693..106105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0117"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   beta subunit"
FT                   /EC_number="2.3.1.169"
FT                   /note="KEGG: mja:MJ0156 acetyl-CoA decarbonylase/synthase
FT                   complex subunit beta; TIGRFAM: CO dehydrogenase/acetyl-CoA
FT                   synthase complex, beta subunit; PFAM: CO
FT                   dehydrogenase/acetyl-CoA synthase complex beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68817"
FT                   /db_xref="GOA:D3S707"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR023432"
FT                   /db_xref="InterPro:IPR038571"
FT                   /db_xref="UniProtKB/TrEMBL:D3S707"
FT                   /inference="protein motif:TFAM:TIGR00316"
FT                   /protein_id="ADC68817.1"
FT                   /translation="MFDDIPVSVGPMNEGERVRGPDMYVELAGPKSYGFELVKVVDKAD
FT                   DKVEIIGKDIDEMEEGSRNPFAIIVEVSGKNLEEDLEGVLERRIHEFFNYIEGVMHLNQ
FT                   RDQVWIRINKDSFKKGLRLEHVGKVVQRLFKAEFPFIEKCDVIIITDPEKVKEELEKAR
FT                   KIYNKRDERTKALHEEDVDVFYGCVMCQSFAPTHVCVITPDRPSLCGSINYLDARAAAK
FT                   IDPNGPIFEIPKGECLDEKLGIYTGVNEVVRERSQGTVEEVTLHSALEKPCTSCGCFEA
FT                   VAFYIPEVDGFGIAHRGFKGETPMGIPFSTLAGQCSGGKQVPGFVGISIAYMKSPKFLQ
FT                   GDGGWERVVWLPKELKERVKDAIPPELYDKIATEEDVKTTDELIKFLKEKGHPCAERIG
FT                   AEVVEEVVEEEEEEVEEEMEEVEGIEVPTMTLPGTFAGLPPGIKIVLYNAVIKAEKIVI
FT                   MKEEPEKKKKKK"
FT   gene            complement(106128..106583)
FT                   /locus_tag="MFS40622_0118"
FT   CDS_pept        complement(106128..106583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0118"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0155 formate dehydrogenase,
FT                   iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68818"
FT                   /db_xref="GOA:D3S708"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S708"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68818.1"
FT                   /translation="MNPKIIVLNPEKCTKCYDCINICKEIHGESRIRKIDGIPIFCMQC
FT                   ENAPCKEICPVDAIYLKEGIPIVDKERCIACGMCAIACPIGAIFIKNKVAHKCTLCLDV
FT                   DRITPACIEACKDKALLLVSEETLDIMKEEKRKKILKILREEAKEKL"
FT   gene            complement(106585..107025)
FT                   /locus_tag="MFS40622_0119"
FT   CDS_pept        complement(106585..107025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0119"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   epsilon subunit"
FT                   /note="TIGRFAM: CO dehydrogenase/acetyl-CoA synthase
FT                   complex, epsilon subunit; PFAM: CO dehydrogenase beta
FT                   subunit/acetyl-CoA synthase epsilon subunit; KEGG:
FT                   mja:MJ0154 acetyl-CoA decarbonylase/synthase complex
FT                   subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68819"
FT                   /db_xref="GOA:D3S709"
FT                   /db_xref="InterPro:IPR003704"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D3S709"
FT                   /inference="protein motif:TFAM:TIGR00315"
FT                   /protein_id="ADC68819.1"
FT                   /translation="MDERFIAYIPTAGSNVAHAEVTSPTIVKMMIKRAKKPILILGEYL
FT                   EDEEKELINELIKKYNLKTIKTPEEMNLMAIMKFLASSDYDLALFTGITYYYLAQAATH
FT                   LKQFSNVVTISIDKYYQPNTLYSFPNLSKEEYLDYLRKLLEG"
FT   gene            complement(107069..109390)
FT                   /locus_tag="MFS40622_0120"
FT   CDS_pept        complement(107069..109390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0120"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   epsilon subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="KEGG: mja:MJ0153 acetyl-CoA decarbonylase/synthase
FT                   complex subunit alpha; TIGRFAM: CO dehydrogenase/acetyl-CoA
FT                   synthase complex, epsilon subunit; PFAM: Prismane; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68820"
FT                   /db_xref="GOA:D3S710"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR004460"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S710"
FT                   /inference="protein motif:TFAM:TIGR00314"
FT                   /protein_id="ADC68820.1"
FT                   /translation="MGNNVEMDIKKLLTPLVKMKNANISMSIKFGEAEGEEEWEPMGPT
FT                   PMPKIPTLRHWDFKLLERYPPFYMPICDLCCLCTFGKCDLSRGKKGACGLNIKAQQARI
FT                   VLIACCIGAACHAGHSRHLVHHLIEKLGRDYPIDLGNEIEVEAPIARTVTGIKPKTLGD
FT                   LEKILDYCEEQITHLLSAAHTGQEGNYLDFESKALHAGMIDDLAREAGDIAQIVAYNMP
FT                   KGDEDAPLIELGFGCIDKSKPVILCIGHNVVPGSYILEYLEDNNMEDEVEVCGICCTAI
FT                   DITRVSDKPKVVGPLSRQLMFVRSGVADVVIVDEQCIRTDILEEVLKTGAVLIATNEKM
FT                   CLGLEDVSHMDEDEIIGYILRNRAALLLDEEKVGKVAVELAKIVAKERKDKKTLPNLNE
FT                   VVELAKQCTECGWCNRNCPNAFKVKEAMVLAKQGNFEGFIDLYKRCYGCGRCEAICPRN
FT                   LPIVSMTTKVGEAYYKDLKFKIRAGRGPIKDVEIRSVGAPIVFGDIPGVVALVGCSNHP
FT                   NGEEEVAMIAKEFLERKYIVVATGCAAMAIGMWKDKDGKTLYEKYPGEFRAGGLVNCGS
FT                   CLSNCHITGAAIKIANIFAKVPLRGNYAEVADYILNKVGAVGVAWGAMSQKAAAIATGV
FT                   NRWGIPVILGPHGAKYRRLYLSNGEKFKVKDKKTGEILEIEPVPEHLIVTAENVKECIC
FT                   MIPKLCMRPNDNPKGRANKIYHYVDVYEKYFGRMPPDLEKFVRTEKDIPFMMKDKIMAY
FT                   LEEKGWKPLEKYPQDPTILY"
FT   gene            complement(109638..111911)
FT                   /locus_tag="MFS40622_0121"
FT   CDS_pept        complement(109638..111911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0121"
FT                   /product="CO dehydrogenase/acetyl-CoA synthase complex,
FT                   beta subunit"
FT                   /EC_number="2.3.1.169"
FT                   /note="KEGG: mja:MJ0152 bifunctional acetyl-CoA
FT                   decarbonylase/synthase complex subunit alpha/beta; TIGRFAM:
FT                   CO dehydrogenase/acetyl-CoA synthase complex, beta subunit;
FT                   PFAM: CO dehydrogenase/acetyl-CoA synthase complex beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68821"
FT                   /db_xref="GOA:D3S711"
FT                   /db_xref="InterPro:IPR004461"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR023432"
FT                   /db_xref="InterPro:IPR038571"
FT                   /db_xref="InterPro:IPR041350"
FT                   /db_xref="UniProtKB/TrEMBL:D3S711"
FT                   /inference="protein motif:TFAM:TIGR00316"
FT                   /protein_id="ADC68821.1"
FT                   /translation="MCNTFEYLKIHLYGEMMVVSNIIEGGKTVLKLTKDILEKEDENLK
FT                   VSYPGTNYNLPIIYGLLGKKIETVKDLKELINSLEIKDEETLENALDVGVVTLICAETI
FT                   EALKYAKSDKPYKEPYVGFIPDDILRGLGVPLVEGKIPAILVVIGKVGDKEKLKKLIDD
FT                   IKKRNILALLVGDIVKEMDEAGIEYGLDKLLVPVGEEITSAIHAANLAIRAPLIFGGIE
FT                   PGKADEIIDYLKNRVPAVVVALGPLDNITLAAGAGCIKAGVPVITNNEVPVIEKALESS
FT                   DIDNIVENALKMKGVEVKVVEFDIPVSVGPMNEGERVRGPDMYVELAGPKSYGFELVKV
FT                   VDKADDKVEIIGKDIDEMEEGSRNPFAIIVEVSGKNLEEDLEGVLERRIHEFFNYIEGV
FT                   MHLNQRDQVWIRINKDSFKKGLRLEHVGKVVQRLFKAEFPFIEKCDVIIITDPEKVKEE
FT                   LEKARKIYNKRDERTKALHEEDVDVFYGCVMCQSFAPTHVCVITPDRPSLCGSINYLDA
FT                   RAAAKIDPNGPIFEIPKGECLDEKLGIYTGVNEVVRERSQGSVEEMALHSALINPCTSC
FT                   GCFEAIVFYIPEVDGFGVAHRNFRGETPFGLPFSTLAGQCSGGKQVPGFVGISIAYMKS
FT                   PKFLQGDGGWERVVWLPKELKERVKDAIPPELYDKIATEEDVKTTDELIKFLKEKGHPI
FT                   VKKTEDVVEEVEEKEEKEEEIKVVEEEKEGIEVGELIAKLAKEGGIQIIMKNVKIVINL
FT                   NVKK"
FT   gene            complement(112143..112589)
FT                   /locus_tag="MFS40622_0122"
FT   CDS_pept        complement(112143..112589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0122"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type; KEGG: mja:MJ0151
FT                   transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68822"
FT                   /db_xref="GOA:D3S712"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S712"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADC68822.1"
FT                   /translation="MLDRIDLKILKILNENARKSFREIGRELGISEGTVRNRVKRLTEK
FT                   GIITGFHASINPKNLGFEVVAILGLYIKPSKVEETLDKLKELDEIVELYQTTGEYDAVC
FT                   IAILKDIESLGNFLAEKIYPLVNVNGCKVTLVLRTFKDGSKMPI"
FT   gene            complement(112594..113100)
FT                   /locus_tag="MFS40622_0123"
FT   CDS_pept        complement(112594..113100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0123"
FT                   /product="4-vinyl reductase 4VR"
FT                   /note="PFAM: 4-vinyl reductase 4VR; KEGG: mja:MJ0150
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68823"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="UniProtKB/TrEMBL:D3S713"
FT                   /inference="protein motif:PFAM:PF02830"
FT                   /protein_id="ADC68823.1"
FT                   /translation="MDKELLHKKIKKDIEDLINNNPSERALGNLIPLSIFQAVRIGVLT
FT                   AGCGIEAIIYNIGKDIGREVISRYVDKSNLLESFAEILKKARIGILEVKKVEEDEMILI
FT                   LRDCISCHNVPNVGTTLCHFEAGLIAGTLEKKLRRKVNVIEIKCCGKGDEYCEFLVKIE
FT                   DKLYW"
FT   gene            113182..113358
FT                   /locus_tag="MFS40622_0124"
FT   CDS_pept        113182..113358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68824"
FT                   /db_xref="GOA:D3S714"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:D3S714"
FT                   /inference="similar to AA sequence:KEGG:MJ0149"
FT                   /protein_id="ADC68824.1"
FT                   /translation="MLRDIAFEFFIMIALGIFIGYIIAEYTDNNLWIVVFLLFGIFCAF
FT                   GRLFKMIKEYEKR"
FT   gene            113355..114365
FT                   /locus_tag="MFS40622_0125"
FT   CDS_pept        113355..114365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0125"
FT                   /product="rRNA pseudouridine synthase"
FT                   /note="KEGG: mja:MJ0148 H/ACA RNA-protein complex component
FT                   Cbf5p; TIGRFAM: rRNA pseudouridine synthase; PFAM:
FT                   pseudouridylate synthase TruB domain protein; DKCLD domain
FT                   protein; PUA domain containing protein; SMART: PUA domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68825"
FT                   /db_xref="GOA:D3S715"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR004802"
FT                   /db_xref="InterPro:IPR012960"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR026326"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:D3S715"
FT                   /inference="protein motif:TFAM:TIGR00425"
FT                   /protein_id="ADC68825.1"
FT                   /translation="MILLEKTQEKKANKGEELIVKEKAETNWDYGCNPYERKIEDLIKY
FT                   GVVVIDKPRGPTSHEVSTWVKKILKLDKAGHGGTLDPKVTGVLPVALERATKTIPMWHI
FT                   PPKEYICLMHLHRDASEEDILRVFKEFTGRIYQRPPLKAAVKRRLRIRKIHELELLDKE
FT                   GKDVLFRVKCQSGTYIRKLCEDLGEALGTSAHMQELRRVKSGCFEEKDAVYLQDLVDAY
FT                   VFWKEDGDEEELRRVIKPMEYGLSHLKKVVVKDSAVDAICHGADVYVRGIAKLSKGIGK
FT                   GETVLVETLKGEAVAVGKALMNTKEILNADKGIAVDVERVYMDRGTYPRMWKRKK"
FT   gene            114414..115346
FT                   /locus_tag="MFS40622_0126"
FT   CDS_pept        114414..115346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0126"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-component;
FT                   KEGG: cby:CLM_1793 2-hydroxyglutaryl-CoA dehydratase,
FT                   D-component"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68826"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D3S716"
FT                   /inference="protein motif:PFAM:PF06050"
FT                   /protein_id="ADC68826.1"
FT                   /translation="MRVGITAIVPPEIIYSTNHIPLDLNNFVPQSNVHPKNKLCAWTAS
FT                   WRELILEDKIKINKLIVVAGGDCQNSLVDAEKIELKKKIPTHYFFYQFGDKEHFENEIK
FT                   KLIDFLGGDVDKDILREVYKIKKLAKKVDELCYKDKINGKDAFYTTISASDLKGNPNAY
FT                   KKEIENLLNNEENVEYRYRIALIGIPPIFSDFYEYLNEINVHCVYNELPYEFVRMGGDS
FT                   IKSIVDTYSTYTFANHITKRIKIIKRELKKRKVDGIIHYTQMCCHHKLEDEILREFIDY
FT                   PMLTIEGDIPQKTPEQVKLRIEAFIEMLG"
FT   gene            115352..116029
FT                   /locus_tag="MFS40622_0127"
FT   CDS_pept        115352..116029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0127"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG: tdn:Suden_0272
FT                   CoA enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68827"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D3S717"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ADC68827.1"
FT                   /translation="MGIDVGSTHIKIADGKSFKKYPIIKLNEILKKYNNDDVFATGYFR
FT                   KRFKNHITEITAAIYGVDKEIDVIIDVGGQDTKIINTKTLEFVMNDKCGAGTGLFLQTI
FT                   AMYLNVPIEDFGKYYSKDPLKLNNTCAVFSISEIINYLVNGYSIKDIIASVNYTIAKKI
FT                   ANMNPYECETIALIGGVAENKAFVKYFKEVTEKDVYIPKNPQFINAIGARKYGIEHSAK
FT                   NNL"
FT   gene            115995..116567
FT                   /locus_tag="MFS40622_0128"
FT   CDS_pept        115995..116567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0128"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pmi:PMT9312_1100 SSU ribosomal protein S18P alanine
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68828"
FT                   /db_xref="GOA:D3S718"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3S718"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADC68828.1"
FT                   /translation="MELNTQQKIIFEIYDLYKRFELMINNNRSKTKKQIEKIKNEIIVK
FT                   DINDVSYVDRVQEILLNYREIWGFVHKSSIKQWITTSKTISVAGMFHKDNLIGVMVYGE
FT                   KPSYLKINYIAVNKRFKDNSLGGYFISFLEKKAKKLQKKKIYAEVPGDNEGGLGFFIKN
FT                   GFIIEGILKNHTRGGKDLVLMAKYLEG"
FT   gene            116570..117496
FT                   /locus_tag="MFS40622_0129"
FT   CDS_pept        116570..117496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cma:Cmaq_1724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68829"
FT                   /db_xref="GOA:D3S719"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D3S719"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68829.1"
FT                   /translation="MVEFFASLTISAGEIKKMVELLKKHEPKKWVFENVIFTPLVSSES
FT                   TIKEIRNLKRKYKTTVMFDSGGYYVQQEKFEISQLFSFLREFYRTNKWGDWYVLPDSPP
FT                   VSSDAVDTAWGKVYETVYFAKSFAEEFNGKMEKKFIPVVQGVNRDMIHYCVKNYADLNV
FT                   RRIGFGSFGTCGKRNQINRLTKDSLENLRYLSRLAKEYGFELHAFGIGGGSSVNKIRDY
FT                   VDSFDSSSWDKAGGFGDIFFPNSRTINITGKSPRTSSKNYIGYKYLIEKFRNGHKCYFC
FT                   EDLSKLKEYKIYRSLHNIIVLYEMVKE"
FT   gene            117493..118233
FT                   /locus_tag="MFS40622_0130"
FT   CDS_pept        117493..118233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68830"
FT                   /db_xref="UniProtKB/TrEMBL:D3S720"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68830.1"
FT                   /translation="MKGSYHIQHNAKPEIIRKLIEYNPNAKKSELKKAFPEIKSSIIDD
FT                   NYTIMNKLINVKDKNEIENILKMDDEMFNNYLHYKLYSSKLPIGWSYRCVINILYEEYN
FT                   GKKINYNDIEQKVKEKAFDEELGGISFSSNSVRGAINFIRSLSPSPIDDNNVFNLRDYC
FT                   QPHLLLWGVDYLYKKQWGEDYGSLMLLDEEKVEELSKFCLIKDDILDDYLKELDFMYDF
FT                   VEISIKAFGRYVRLKRTWNFSDIL"
FT   gene            118247..118756
FT                   /locus_tag="MFS40622_0131"
FT   CDS_pept        118247..118756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S721"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68831.1"
FT                   /translation="MDYITLINYIKRNYSSKFLTDSQKEAYNKLKKFLLFDNVVNLYGK
FT                   SGVGKTFLGWVFAKDNNFIYFKTEEEFKKYKTTRKMNVIIDNGELNDGRNIRRLISLKA
FT                   NKAIYISKGETLDYSVKLTLNWRDVEHVLENISPIIEKNKNIYIDNFFDSDLNLWKVFK
FT                   VMTYGY"
FT   gene            118746..122546
FT                   /locus_tag="MFS40622_0132"
FT   CDS_pept        118746..122546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Viral A-type inclusion protein repeat"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68832"
FT                   /db_xref="UniProtKB/TrEMBL:D3S722"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68832.1"
FT                   /translation="MDISLLEYIINKSPVIDTYSAENLINEPNLVVDKYESHLKTYIKV
FT                   DDEEFDKRFIREIKKGKTVKGYISAPYGYGKTSKALSLWDYCKKNNILAIPPFKFDGKL
FT                   DTIMDAVYGWTRYVYKLKYPEYLDKIEKIYRKYKGLSIEKEIEYLMKNRNLTENEAKEI
FT                   VYDLLNRGKLIVSITPKDLMNFLKEMNEIIKEHFEGMAIFVDEVQGIKNMEIINNLRNF
FT                   IFELSINNIGLGILFIIPDYQEEDLNIRAGDLIDRLRKDGFYLNLVNIYSVNFAEDLWK
FT                   KYGELLQFNPYDIITEDCLRSIGEISSREDLGKGPRTVIGAFKCACMKYKEKFEPYTVF
FT                   DFINDILNGEIKFIHQKFLDALNEGLSLKKVDSDKKRKVIKLVGAFPRGISEEKIKDYG
FT                   LYDEYEELSRFYYGTEIVYALEGYTLKGLLKGETATYVEQHIRKFRSIFNESWEGEMID
FT                   AFITYILPEIFPRKKGSQIMGWRIDEKYPIVGGYYHQLTGTFNPKYPFRTIGVYSLRYD
FT                   TNEKENTLVDVEFRFILDKNCKNNDLVIDYRNGEVIFRFNVLKKVGEDKLPGDLKKLQQ
FT                   YVKPQEVTPMFMLCLLNYFDKIKEKEDEYAKHESEINALKSILIRYLKRFLFSDDLVEK
FT                   YNLRKRQEKIVEEVFNRICEYKFRDYSTLIHSPNWHKDLERYRILLNSLSISKRRGEEF
FT                   ETTKKKLVSILTGSKNPNVAGFKEECEYGKWKDLINLKHWGKDEKIRVELKKHPLEEMI
FT                   LKEFIEKWIQPISVDEIVSYGMSLGYIPEEVEEILKILESRRYIEINKGYVFKSREITN
FT                   TDVLNKFDEVENLAKKVVTLYMKYGKNVPNILVKHSKREEIKQQTDPDLLYKELEIIES
FT                   WEKSLKEYLKTIENEIKNDKEELINKVLKIGEKIDDLKNKIDNIKEEIIKTHYSLGGIV
FT                   RHLEEQIKITKKKCNKISKDLLILKEKINSTRDLEPLAECLNEAKKTFKNLNYEYEDVL
FT                   TKYNKFKSWLGILRKLEELYEKIDVYRDYIDIKEEHDKFNELIEDIIQGFAREGADYLD
FT                   MDRDVEEDIKLIDENIKKKERNLRNEFNKIQEEIRTKMNILAQTLKPLNIQHYSYREAF
FT                   SIEDRETAYQNLVRNVKSYIKEVVDKLNDQVNHLKAEVELRLNNNENYISKLKAIGEEV
FT                   ENIDIEVIDKDNLMESVEEIKSKILDIWENLEKVRKEIKREIIERSKSEKSEEEIKIIE
FT                   ILNKYGEIPIEKLSKYLNMDIEGTLKWLLKMENVEIIVRKK"
FT   gene            122498..123448
FT                   /locus_tag="MFS40622_0133"
FT   CDS_pept        122498..123448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0133"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68833"
FT                   /db_xref="GOA:D3S723"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:D3S723"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68833.1"
FT                   /translation="MVIKNGKCRNNCKEEIKKIKTPCYLKIKHKLSLLFFDFEEISYDD
FT                   FWSMIDDPNIEIEYKKYVILDKFDDRLPIYEIDHNPFTGELNKILKEKYHLIENYIKTQ
FT                   KDVKEIIISKVNKRTPKTVVLYLIDGLSYVDYVEAQIPYEGEPIFVNGETSTKNGLMNI
FT                   IYGKNNIPIAKELQKFGYRCFGQTYWNRKNELTDILFRYFNEKYIFHSDEEIYNVINKY
FT                   RSSKKYIQIYRGGLDEYAHKLRDISKKSIINKIKEIFEDINKLNDILNNIKEPYLVVIT
FT                   SDHGIKWNFEDPHKKGNHKELTFETCFVPLIIIEG"
FT   gene            123450..124610
FT                   /locus_tag="MFS40622_0134"
FT   CDS_pept        123450..124610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0134"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   mac:MA0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68834"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR008900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S724"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ADC68834.1"
FT                   /translation="MLFIGREKLKDRLGNDIYIDASKSHAIFICGKRGSGKSYTLGVLV
FT                   EELQEKYPDYLKIIIDPMGIFWTMVEPNEEQEEELWDWNLYAEGYPVKLIVPGEIEERF
FT                   DEDVIRELENRGIEFKKLLLNPSDISAEGWCDLFNLNINEMMGIALYRAIDNIEKDFFT
FT                   IDDIIYEVERDTKSKESTKEALINRLNMAKKWGIFSDEYIPIEDIFERNAINVIDLSVI
FT                   ESGRYGLRDLIVSIIAKYLFNQRLKARKKEMLNLQSKMPKVWLFIDEAHNFIPSGKSTL
FT                   SKEILIRWAKEGRQPGLNLVIATQQPSAIDNEVLSQCDIIFAHKVTNREDINALNKLNQ
FT                   EYMGKELKVYIKDLNKGECVFIDDEKEFLKIIKIRPRKSKHGGGEK"
FT   gene            124667..125761
FT                   /locus_tag="MFS40622_0135"
FT   CDS_pept        124667..125761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0135"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; SMART: AAA ATPase; KEGG:
FT                   mfe:Mefer_0251 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68835"
FT                   /db_xref="GOA:D3S725"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3S725"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ADC68835.1"
FT                   /translation="MKFFNREKEIKEILSILEGEPNLIYFIYGSINSGKTTLIKHIIEN
FT                   RLNDNYKVFYINFRTYLISEKREFIEAIFTTKKDDFFEKIKDKSEVLNLITKGAKILTG
FT                   IPIPEIEFDKLFEEKINDVFQYLNSLLLAVKKSGKKPILILDELQMIKDVVLNGQKYLL
FT                   KELFQFLVSLTKEQHLCHVFCLSSDSLFIEYVYNAGELEGRADYILVDDFDKQTALKFI
FT                   DFLARENNMELSDEDKELIYSYVGGKPILIIKVFDKLKTERKLKDILDTILKEEAQKLR
FT                   YFLKDLDYIKPKVNIEDEVIEIKKEDIIEALRLFKDNYEISDDKIPKPVYIYLIKRNIL
FT                   FLDPIEGTLKPQSFLIWNAIKRIL"
FT   gene            125902..126102
FT                   /locus_tag="MFS40622_0136"
FT   CDS_pept        125902..126102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0136"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0146 2-ketoglutarate ferredoxin
FT                   oxidoreductase, subunit delta (KorD)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68836"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S726"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68836.1"
FT                   /translation="MKIEINENFCKGCDICIVVCPRGVFEKSKKLNKKGVYPPIPVNAE
FT                   KCTKCNLCILQCPDQAISIEE"
FT   gene            126228..127034
FT                   /locus_tag="MFS40622_0137"
FT   CDS_pept        126228..127034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0137"
FT                   /product="GTP cyclohydrolase IIa"
FT                   /EC_number="3.5.4.29"
FT                   /note="PFAM: GTP cyclohydrolase III; KEGG: mfe:Mefer_0498
FT                   GTP cyclohydrolase IIa"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68837"
FT                   /db_xref="GOA:D3S727"
FT                   /db_xref="InterPro:IPR007839"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D3S727"
FT                   /inference="protein motif:PRIAM:3.5.4.29"
FT                   /protein_id="ADC68837.1"
FT                   /translation="MIQITVIQIDNYGPWTVTPNPRRESDLQALQSRLYADLNLMFGAH
FT                   KGLVFYTRFDNLIAITNGIDLITHKRIQESIRNRYPFTVSMVIASAETPYEAQKLATET
FT                   LQEYGSAQDENRKEVLDVANELVVDGYVQIAHIDINNITGTLTDIVSAYDTYLNVNKVK
FT                   LALMEELLKHNALLFFIGGDNFMSPSNGMNEEDFLDIFNRINKKYKIELKAGIGIGRTA
FT                   EDASNLADIGLEKIRGKLVDKNVCTLKQDDFLEQNITTGRLCGLQR"
FT   gene            127044..127820
FT                   /locus_tag="MFS40622_0138"
FT   CDS_pept        127044..127820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0138"
FT                   /product="TIM-barrel protein"
FT                   /note="TIGRFAM: TIM-barrel protein; KEGG: mja:MJ0144
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68838"
FT                   /db_xref="GOA:D3S728"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR005270"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037347"
FT                   /db_xref="UniProtKB/TrEMBL:D3S728"
FT                   /inference="protein motif:TFAM:TIGR00736"
FT                   /protein_id="ADC68838.1"
FT                   /translation="MNKKIEELNELDKKVVLAPMAGITDGDFCKKFKDLFAIVTIGGYN
FT                   LDTATYKASREIEKRGRKEFSINLEEFNNYIIEQIKKARESNALVSVNVRFVNVEEAYD
FT                   KLLTIAKHADVIELNCHCRQKEITSLGIGQELMKNKNLLKEFLTKMKELNKPIFLKIRL
FT                   NYIPLKELIDNLNYVRDYFDGLHVDCFYPGKPYADLNSLKTLAEEFSDKVIIGNNSIDS
FT                   LEKAKEMLRYSDFVSVARTVLKGNVKWIKELNERDI"
FT   gene            complement(127817..128995)
FT                   /locus_tag="MFS40622_0139"
FT   CDS_pept        complement(127817..128995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0139"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: mja:MJ0143 glutamyl-tRNA reductase; TIGRFAM:
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68839"
FT                   /db_xref="GOA:D3S729"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D3S729"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ADC68839.1"
FT                   /translation="MIILKADYKKYNVSELEKLRMDEEKFYETFDNAILLQTCNRVEII
FT                   FDADSLEEIKGIENIDLEKFDILFGDEAIEHLFRVASGLESMIVGENQILGQLKNAYLK
FT                   AKEKGKISKKLEKIILKAIHTGQRARVETKINEGGVSIGSAAVELAEKIFGLEGKNVLL
FT                   IGAGEMANLVIKALKEKNIKAIIVANRTYEKAEKLAKELGGMAIKFDKLEEALRYADIV
FT                   ISATGAPHPILNKERLKNAGKTIIIDIANPRDTTDDIRELPDIFLFTIDDLKLVAEENL
FT                   KKRKGEIPKVEMIICEEMEQLKELLDKMKFETAIKELGQYIENVRKKEVEKAKKILKNK
FT                   NKSVEEVLEDFSKALCKRIIYDIIKIFENVEDKEVFECLAKEFKKLGSKNKN"
FT   gene            complement(128976..129400)
FT                   /pseudo
FT                   /locus_tag="MFS40622_0140"
FT                   /product="hypothetical protein"
FT   gene            complement(129384..129683)
FT                   /locus_tag="MFS40622_0141"
FT   CDS_pept        complement(129384..129683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0141"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: mja:MJ0141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68840"
FT                   /db_xref="GOA:D3S730"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D3S730"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADC68840.1"
FT                   /translation="MEIIEIIKEFKKDILTILKDKLDRVILFGSYARGDYDEESDVDIL
FT                   ILVKEMPTLKEKEKIIKIASRYSLKYDILISPIIYKKTIRTSFIDEVESYGIEI"
FT   gene            complement(129670..130299)
FT                   /locus_tag="MFS40622_0142"
FT   CDS_pept        complement(129670..130299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0142"
FT                   /product="siroheme synthase"
FT                   /note="TIGRFAM: siroheme synthase; KEGG: mja:MJ0140
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68841"
FT                   /db_xref="GOA:D3S731"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3S731"
FT                   /inference="protein motif:TFAM:TIGR01470"
FT                   /protein_id="ADC68841.1"
FT                   /translation="MINLLPVLLSFEGKKVAVFGCGSVGKRRAKKILKSGGIVDIYSKE
FT                   FDEEIKKLKENNKNLNLIEIDVESLDDEELKNIIMGYDFIVTAINDKINKRIVRLAKEL
FT                   NKFVNSSTKTEGVNFIIPAYTEVDEVIFSIYTKGKSPLIAKHIRIFVENYLKSTDINMM
FT                   AYMREFLKETIPKQRDREKILKKIFEDKKFREELKRLIEKWENGNH"
FT   gene            complement(130292..131794)
FT                   /locus_tag="MFS40622_0143"
FT   CDS_pept        complement(130292..131794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0143"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; cobalamin
FT                   B12-binding domain protein; deoxyribonuclease/rho
FT                   motif-related TRAM; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: mja:MJ1620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68842"
FT                   /db_xref="GOA:D3S732"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D3S732"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADC68842.1"
FT                   /translation="MKALIIDCLASGDGKRILARDVIGAGPRTVKGILQNEGVEAKITP
FT                   VEDLDIKDAKKYNLIFISAMTSDFKCVKKLVERIRLKTNSKIIVGGPIANDINLLEKVE
FT                   ADISIVGEGEITIRELIKKDFDAEDVKGTTYWDYNEDELKINPLREILTDLKLITPSTE
FT                   IKDYKNYFSARVYVEVVRGCSNFKRPLLLCTNKKCNLCENGTLKCPLNINPGCGFCSVP
FT                   SVFGYARSRDEEDILKEVESLLEEGVKRIVLSAPDFLDYERGERLINPNFPEPNYEAIE
FT                   SLLSNCKDLADKYNANILIENIKANLFDERVAEIFSKYLKTPIYIGCESGDKEHCRLLG
FT                   RPATPDDVLKAVKIAKKYNLKAQVYLIYGLPGENKDTAKNTVNFMHKIKPYIDKITVYK
FT                   FRPLPMSAFQNFKPNITKHSLLIRETANKINLEIKKKYVGKVLEVIISERHFRNKRDAI
FT                   GYLPDSGLMVVVKDGAKFIGKTKKVKIIKAYEKYLEGKIIGD"
FT   gene            131902..132615
FT                   /locus_tag="MFS40622_0144"
FT   CDS_pept        131902..132615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0144"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: mja:MJ1619 biotin operon
FT                   repressor/biotin--[acetyl-CoA-carboxylase] ligase (BirA);
FT                   TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; biotin protein ligase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68843"
FT                   /db_xref="GOA:D3S733"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:D3S733"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ADC68843.1"
FT                   /translation="MEIIHLSEIDSTNDYAKELAKEGKRNFVVLADKQNNGKGRWGRVW
FT                   YSDEGGMYFSIVLDSKLYNPKVVNLLVPICIIETLKNYVDKELGIKFPNDIMVKVDGGY
FT                   KKLGGILAELTDDYMIIGIGINVNNQIRNEIREIAISLKEIVGKELDKVEIFNDFLKTF
FT                   ESYLEKLKNKEIDDYEILKKYKKYSITIGKQVKIFLSNNEVITGKVYDIDFDGIVLGTE
FT                   EGIERIPSGICIHVR"
FT   gene            132643..133014
FT                   /locus_tag="MFS40622_0145"
FT   CDS_pept        132643..133014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0145"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   mja:MJ1618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68844"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3S734"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADC68844.1"
FT                   /translation="MKIIKTEYDKIKPYITKDGSIIRELMHPNIYKNVKQSLAEAIVPV
FT                   GSKTLLHKHHKSEEIYYILEGKGLMTLGNEKFEVKKGDAILIPPETPHKIENIGNVPLK
FT                   ILCCSFPPYSHEDTEILEK"
FT   gene            complement(133018..133287)
FT                   /locus_tag="MFS40622_0146"
FT   CDS_pept        complement(133018..133287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0146"
FT                   /product="Protein of unknown function DUF131"
FT                   /note="PFAM: Protein of unknown function DUF131; KEGG:
FT                   mja:MJ1617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68845"
FT                   /db_xref="GOA:D3S735"
FT                   /db_xref="InterPro:IPR002849"
FT                   /db_xref="UniProtKB/TrEMBL:D3S735"
FT                   /inference="protein motif:PFAM:PF01998"
FT                   /protein_id="ADC68845.1"
FT                   /translation="MKPILIFLGIILMFIGFFMITLGMILPSSQENYKKQETEENNVEY
FT                   SGIIMIGPIPIVFGNSPGLMILSVLIAILMIVWMFLFAFGIRIK"
FT   sig_peptide     complement(133195..133287)
FT                   /locus_tag="MFS40622_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.521 at
FT                   residue 31"
FT   gene            complement(133313..133381)
FT                   /pseudo
FT                   /locus_tag="MFS40622_0147"
FT                   /product="hypothetical protein"
FT   gene            complement(133445..134932)
FT                   /locus_tag="MFS40622_0148"
FT   CDS_pept        complement(133445..134932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0148"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: mja:MJ1616 inosine-5'-monophosphate
FT                   dehydrogenase, (GuaB); TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68846"
FT                   /db_xref="GOA:D3S736"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D3S736"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADC68846.1"
FT                   /translation="MFLKKLTEARMAYTFDDVLLVPNASWVEPKDTDVSTDLAGLKLNI
FT                   PIISAAMDTVTEKEMAIALARLGGLGVIHRNMSIEEQVHQVQAVKKADEVVIKDVITVS
FT                   PDDTIGDAINVMETYSISGLPVVDNEDKLVGIITHRDVKAVEDKTKKVKDVMTKDVVCA
FT                   KEDVEEEEALELMYANRVERLPIVDDENKLIGIITLRDILKRRKYPQAARDKKGRLLVA
FT                   AACGPHDFKRAKALIEAEVDAIAIDCAHAHNMRVVENVKKFKEMLEGTDTKLIVGNIAT
FT                   KEAAEDLIKAGADVLKVGIGPGSICTTRVVAGVGVPQLTAVAEVADVAKERGVPVIADG
FT                   GIRYSGDIAKAIAAGADAVMLGSLLAGTDEAPGQLMVINGRKYKQYRGMGSLGAMTGGV
FT                   GAGADRYFQSAKSHMKHVKLVPEGVEGAVPYKGAVSEVIFQLIGGLRASMGYCGAKNLK
FT                   EMQEKARFVIITPSGQVESHPHDIIITNEAPNYPLGK"
FT   gene            135138..135902
FT                   /locus_tag="MFS40622_0149"
FT   CDS_pept        135138..135902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0149"
FT                   /product="Protein of unknown function DUF439"
FT                   /note="PFAM: Protein of unknown function DUF439; KEGG:
FT                   mja:MJ1615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68847"
FT                   /db_xref="InterPro:IPR007381"
FT                   /db_xref="UniProtKB/TrEMBL:D3S737"
FT                   /inference="protein motif:PFAM:PF04283"
FT                   /protein_id="ADC68847.1"
FT                   /translation="MTDKSSEIARFSGKGILLTPKTLEKPLLKWEKLEIILYKDKIVFE
FT                   FVDKTIEVGVEDIEDVGAELPKKVLEIAKSTLEDITYHSSIIIKSKEYGSVMVGFAPET
FT                   SIYGKAPIDNFLRKLFYILLNKKEVKILYNAGEDKDAKWEEGFLTFIKKRIKDGLISKI
FT                   EYRLVIEVLVNGDAKIYDIFSNIKDVEIEEKDVNGEIEPVLKIQQLKEGKDVISYLYTK
FT                   DKRVRLFILRYLVILLDYKHVGILRYLQETVE"
FT   gene            135903..136658
FT                   /locus_tag="MFS40622_0150"
FT   CDS_pept        135903..136658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0150"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mja:MJ1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68848"
FT                   /db_xref="GOA:D3S738"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D3S738"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADC68848.1"
FT                   /translation="MKMGVSTSLFLDTDKNLSDALEILEKRVKYVEIGCDGNLNVMLDG
FT                   NVELAQSYDLNYTLHCPITDLNLSSYREKIRKVSLDFVKDILEIATKIDAKLIVLHPGY
FT                   CVFKYDYEKALNSLIKSLKDLNNIQEEFSIQITIENMPSYDMFMFRKPDKEVIENLDEL
FT                   KITFDIGHSFLNNNIEDFLKISDMIAHIHIHDNNGEFDEHLCIGKGKINFNNFKKDLKK
FT                   INAIKMIELQNKSINDLDLCINNLRELLR"
FT   gene            136663..137430
FT                   /locus_tag="MFS40622_0151"
FT   CDS_pept        136663..137430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0151"
FT                   /product="protein of unknown function DUF105"
FT                   /note="PFAM: protein of unknown function DUF105; KEGG:
FT                   mja:MJ1613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68849"
FT                   /db_xref="InterPro:IPR002808"
FT                   /db_xref="UniProtKB/TrEMBL:D3S739"
FT                   /inference="protein motif:PFAM:PF01955"
FT                   /protein_id="ADC68849.1"
FT                   /translation="MIERVLEMDDWKAYKIPHTVEIEDDVENTKTLVIEFENRRRVLST
FT                   REGFKEVKYVGNHSIPVPFWDKVHNYKDYESQVLNKIGIKKEDIALLSTGANMDNLAVA
FT                   KEEFDEFYVVALTTAGAKHNAIRLGDEEADYIEKDFKTYKIVDGKIVPKEEVGTVNIIL
FT                   ITNANLTDGAMARAIITITEAKTNAFQELNIRSTKHPELQATGTGTDNIVVVKGFGRGV
FT                   NYTGGHTKIGEMIAKAVKRSVIEALIKQDEIKI"
FT   gene            complement(137441..138676)
FT                   /locus_tag="MFS40622_0152"
FT   CDS_pept        complement(137441..138676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0152"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: mja:MJ1612 cofactor-independent
FT                   phosphoglycerate mutase; TIGRFAM: phosphonopyruvate
FT                   decarboxylase-related protein; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68850"
FT                   /db_xref="GOA:D3S740"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR023665"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D3S740"
FT                   /inference="protein motif:TFAM:TIGR00306"
FT                   /protein_id="ADC68850.1"
FT                   /translation="MRKGKCVIFIIDGLGDRPNEEGLTPLKEAKTPTMDRIAKEGICGL
FT                   MNAIDIGVRPGSDTAHLAILGYNPYEVYTGRGPLEAYGVGLDLKEGDIAFRCNFATVDE
FT                   NFVVLDRRAGRISPEEAEELEKEIDGLEIDGVKVIFKSSKGYRGVLVLRGEGLSCRVSD
FT                   GDPHEEGVKVSEIKPLDDSEEAKRTAEILNKLLKVVYEKLNNHPINEERRKKGLPPANI
FT                   ILPRGAGVVPKIEKFYEKYKMKGACICGTGLIKGMAKMIGLDIIEVEGATGTPKTNFMG
FT                   KAKALVEALKEYDFVLVNVKGADEASHDGNYELKKEVLEKIDEMLAYVFEHINKDEVYF
FT                   VLTGDHSTPIEMKDHSADPVPIVIWGKSVRVDDVTEFNEFACAKGALHWIRGEHVMKIL
FT                   LDLTGRNEKFGA"
FT   gene            complement(138686..140095)
FT                   /locus_tag="MFS40622_0153"
FT   CDS_pept        complement(138686..140095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0153"
FT                   /product="Alpha-amylase"
FT                   /EC_number="3.2.1.1"
FT                   /note="PFAM: glycoside hydrolase family 57; KEGG:
FT                   mja:MJ1611 alpha-amylase (AmyA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68851"
FT                   /db_xref="GOA:D3S741"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3S741"
FT                   /inference="protein motif:PRIAM:3.2.1.1"
FT                   /protein_id="ADC68851.1"
FT                   /translation="MLITFNFEVHQPHRLNKEINQNGASLWEKYVDTKLNKEVFNKVAN
FT                   KCYIPTNELILELIDEYDFKVNYSITGVFIEQALEFNDYVLDLFKDLVKTGNVELIGET
FT                   YHHSLTSLFETEEEFIEDIELHRKMYKEIFGFKAKVFRNTELIYNNRIAKIAKDLGFKA
FT                   IFTEGIEKILGWRSPNYLYQSPDGMKIMLRNYRLSDDIGFRFSARDWDQYPLMADKYAM
FT                   WLASTPGEVINIYMDYETFGEHHWEETGIFEFLRYLPIEIAKHEHLEVVNVSEVVDRLE
FT                   PRGEIYVHEFATISWADTERDVSAWLGNKMQRISFEKLKDIGKFIKENAEKLKKVNKFD
FT                   EIYKMYKVLQTSDNFYYQSIKGLSDMSVHNYFSHFDTPFDAYASYLNILYDFEYYIKKE
FT                   LSKADVDKNDKWKDKQKQYEKNDETKKESLIKTNIIVANDDSSKTESIYSQNEEDKKDK
FT                   EYNTFGGFIIA"
FT   gene            complement(140120..141958)
FT                   /locus_tag="MFS40622_0154"
FT   CDS_pept        complement(140120..141958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0154"
FT                   /product="oligosaccharide amylase"
FT                   /note="TIGRFAM: oligosaccharide amylase; PFAM: glycoside
FT                   hydrolase 15-related; KEGG: mja:MJ1610 glucoamylase (cga)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68852"
FT                   /db_xref="GOA:D3S742"
FT                   /db_xref="InterPro:IPR000165"
FT                   /db_xref="InterPro:IPR006465"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D3S742"
FT                   /inference="protein motif:TFAM:TIGR01577"
FT                   /protein_id="ADC68852.1"
FT                   /translation="MGGIVGNNSLLAKIGDYGEIEYLFYPQVGYETHFFDSALAVYDKK
FT                   VKWHWDEDWDISQKYIEETNIFKTILEDDKIILTIKDFVPISHNVLIRRVYIKNKLDKK
FT                   LNFKLFFYENLRIGENPITNTVKFLEDGCIVKYNGKYIFCIGSDKKIDSFQCGNRYSKT
FT                   SAYIDIENGILKEHKESSGLLTDSAISWNIKIDEKRSLAFNIYILPQRFDGDFSIITEQ
FT                   LRIIMNNSENIKNLSMNYWKNIIGDIKRFIHPELRQNREIYSITKRALMTLLMLCDKEG
FT                   GIIAAPSLHPDYRYVWGRDGAYISVALDLFGIRNIPDRFFEFMSKIQNADGSWLQNYYV
FT                   NGKPRLTAIQIDQIGSILWAMDVHYRLSGDRTFVERYWNMIEKAANYLRLVALNFTPCF
FT                   DLWEEKFGVFAYTMGAIYAGLKCAYSMSKAVNKRDKVKDWGKTIEFLKHEVPKRFYLED
FT                   EERFAKSINPLDKTIDTSILGLSYPFNLIDVDDERMIKTAEAIEKAFKYKVGGIGRYPE
FT                   DIYFGGNPWIITTLWLSLYYRRLYNVLKEKEDNRADIYLQKSKRLFNWVMKYSFNGLFP
FT                   EQIHKELGVPMSAIPLGWSNAMFLIYVYENDNVIIP"
FT   gene            complement(141980..143044)
FT                   /locus_tag="MFS40622_0155"
FT   CDS_pept        complement(141980..143044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0155"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; SMART: AAA ATPase; KEGG: mja:MJ0147
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68853"
FT                   /db_xref="GOA:D3S743"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3S743"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ADC68853.1"
FT                   /translation="MKFFNREKEIKEILSILEGEPNLIYFIYGSINSGKTTLIKHIIEN
FT                   RLNDNYKVFYINFRTYLISEKREFIEAIFTTKKDDFFEKIKDKSEVLNLITKGAKILTG
FT                   IPIPEIEFGKLFEEKINDAFQYLNSLLLAVKKSGKKPILIFDELQMIKDVVLNGQKYLL
FT                   KELFQFLVSLTKEQHLCHVFCLSSDSLFIEYVYNAGELEGRAKYILVDDFDKETTLKFI
FT                   DFLSKEILNKKLSDEDKELIYNYVGGKPLYIYNVIDEMRYRELKEILNSMLRDETQKLK
FT                   YFLEDVKEEDEELYKKVVKALKLFKDNYEVEDTAINKKIREFLIRNNVLFLNPQKGTLK
FT                   PQSFLIWNAINRLL"
FT   gene            complement(143068..143280)
FT                   /locus_tag="MFS40622_0156"
FT   CDS_pept        complement(143068..143280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0156"
FT                   /product="Protein of unknown function DUF2582"
FT                   /note="PFAM: Protein of unknown function DUF2582; KEGG:
FT                   mja:MJ1608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68854"
FT                   /db_xref="InterPro:IPR019707"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3S744"
FT                   /inference="protein motif:PFAM:PF10771"
FT                   /protein_id="ADC68854.1"
FT                   /translation="MEDMWGKIGETAGKIYHLLEGGEKSLSQIEKILRKEGYNSNVVKM
FT                   AIGWLAREDKIFVLKDDKKWVIKLK"
FT   gene            complement(143374..144546)
FT                   /locus_tag="MFS40622_0157"
FT   CDS_pept        complement(143374..144546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0157"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: mja:MJ1607 LPS biosynthesis
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68855"
FT                   /db_xref="GOA:D3S745"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3S745"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC68855.1"
FT                   /translation="MKIAMITWEYPPRIVGGLAIHCKGLAEGLVRNGHEVDVITVGYDL
FT                   PEYENISGVNVYRVKPITHPHFLTWATFMAEEMEKKLGILGIDKYDVIHCHDWMTHFVG
FT                   ANLKHICRMPYIQSIHSTEIGRCGGLYSDDSRAIHTMEYLSTYESCQVITVSKSLKEEI
FT                   CSIFNTPEDKVKVIYNGINPWEFDINLSWEEKTNFRRSIGVQDDEKMILYVGRLTYQKG
FT                   VEYLIRAMPKILERHNAKLVIAGSGDMRSYLEDLCYQLGVRHKVVFLGFVNGDMLKKLY
FT                   KSADIVVIPSVYEPFGIVALEAMAAGTPVVVSSVGGLMEIIQHEVNGVWVYPKNPDSIA
FT                   WGVDRVLSDWGFKEYIVNNAKKDVYEKYSWDNIAKETVNVYKIAMEMMGR"
FT   gene            144670..146229
FT                   /locus_tag="MFS40622_0158"
FT   CDS_pept        144670..146229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0158"
FT                   /product="Starch synthase"
FT                   /EC_number="2.4.1.21"
FT                   /note="PFAM: glycosyl transferase group 1; Starch synthase
FT                   catalytic domain protein; KEGG: mja:MJ1606 glycogen
FT                   synthase (GlgA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68856"
FT                   /db_xref="GOA:D3S746"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:D3S746"
FT                   /inference="protein motif:PRIAM:2.4.1.21"
FT                   /protein_id="ADC68856.1"
FT                   /translation="MKIAILAPTITPIVSYGGLGDVMRDLPKFLKKGNEVVVLTLNHYN
FT                   RYFNIPYEVIKKITVIYKGAKITFDVLRTKHPTTGVDLIVFSNESVNNLNVWDPIKYEI
FT                   FADLVVTYLDDVKDIDVVSGHDWMCGLAIAKCNDILDLPTTLTIHNEAFKGGVVEYKGE
FT                   VMTFLELGIKHADAVNTVSPTHAEEIKNCPYIKKYLDNKPFCGILNGIDIDEYDPMKII
FT                   ERMFNLSNNKLDPRNYGYISPYSAEDAYDIKPKIKYSWFYREGIYEYVEDWNKIDKEIW
FT                   ATDVEVYGGINGGIETPLIGFVGRATHQKGFNTMFEAIPELLEKHDIRFVFLTKGDRDI
FT                   EERLKNLANEYDGKILALIGYSLPLSSLVFAGSDWIIMPSYWEPCGLVQMEAMAYCTPV
FT                   IATETGGLKDTIIPLHPNPYEHPNFDKATGVLFKVPDKAGFMWGVEHALNWTFYKLNEI
FT                   CMFMQYIRYKCPKHPYDENAPLSMMMKNCYYHVLRNLSWQNSPSIRKYKGLFGGAIYKH
FT                   FL"
FT   gene            146258..147466
FT                   /locus_tag="MFS40622_0159"
FT   CDS_pept        146258..147466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0159"
FT                   /product="phosphoglucose isomerase (PGI)"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   mja:MJ1605 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68857"
FT                   /db_xref="GOA:D3S747"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D3S747"
FT                   /inference="protein motif:PFAM:PF00342"
FT                   /protein_id="ADC68857.1"
FT                   /translation="MLSYDYKNALEVGEISFEDISRVDFTNAYSKLMEKLDNGVVGFRE
FT                   AIYDESLDKYESLNGYKNVVVVGMGGSILGTMAIYYAISPFNNNAYFIDNSDPEKTLSI
FT                   LKKVDLNESIIYIISKSGNTLETLVNYYLIKKRIEKLNSFKGKVVFITNGGKLKREADK
FT                   NNYDTFSIPENVPGRFSVFTAVGLAPLCSLGIDISKILKGAREMDKICQNEDILKNPAL
FT                   LNGVIHYLYDKRGKDISVIMSYVESLRYFGGWYKQLIGESLGKNGNGITPLLSIGAKDQ
FT                   HSLLQLYMDGKKDKIITFIVAKKYRLDEEIEFEDINDEKISCKYSDIIKHQQKATEIAL
FT                   TNNGVPNVRITLDEINEMAMGALLYMYEMQVGFMGELYNINAYNQPAVEEEKKICWRLI
FT                   KQP"
FT   gene            147498..148877
FT                   /locus_tag="MFS40622_0160"
FT   CDS_pept        147498..148877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0160"
FT                   /product="ADP-specific phosphofructokinase"
FT                   /EC_number="2.7.1.146"
FT                   /note="KEGG: mja:MJ1604 ADP-specific phosphofructokinase;
FT                   TIGRFAM: ADP-specific phosphofructokinase; PFAM:
FT                   ADP-specific phosphofructokinase/glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68858"
FT                   /db_xref="GOA:D3S748"
FT                   /db_xref="InterPro:IPR007666"
FT                   /db_xref="InterPro:IPR011790"
FT                   /db_xref="InterPro:IPR015990"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3S748"
FT                   /inference="protein motif:TFAM:TIGR02045"
FT                   /protein_id="ADC68858.1"
FT                   /translation="MEIKKFIETIKEAKLFTAYNTNVDAIKYLTDNDVQKLVDEFNHED
FT                   IIKRMEEYPRIIEEPLDFVARLVHSIKTGKPAEVPVKDDKKLHEWFDKIKYDEERMGGQ
FT                   AGIVSNLMATLQIDKIIVYTPFLSKKQAEMFVDYDNLLYPLVENGNLVLKKVREAYRDD
FT                   PIKINRIFEFKKGLKFKLNGEEIVAKQSTRFIVASRPEALRIEVRDDVRQFLPEIGESV
FT                   DCAFLSGYQAIKELYKDGKTAKYYFERAKEDIKLLKKNKNIKTHLEFASISNVEIRKMV
FT                   VDYILSSVESVGMDETEIANVLHILGYDDLSKKILKDSLVEDVIEGAKILLNKFKNLEV
FT                   VQIHTIYYILFVCRADNPLSKEELEECLEFSTILASTKAKLGNIKVIDDLYEGLKIPHN
FT                   KYGDLLKEIADKFNDDNYKIALSPSRYVEKPKSTVGLGDTISSGAFVYYVSLLNKKIRE
FT                   S"
FT   gene            complement(148885..149565)
FT                   /locus_tag="MFS40622_0161"
FT   CDS_pept        complement(148885..149565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0161"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: mja:MJ1603 ribose-5-phosphate isomerase A;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase; regulatory protein DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68859"
FT                   /db_xref="GOA:D3S749"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3S749"
FT                   /inference="protein motif:TFAM:TIGR00021"
FT                   /protein_id="ADC68859.1"
FT                   /translation="MSNEDLKLKVAKEAVKLVKDGMVVGLGTGSTAALFIRELGNRIKE
FT                   EELTVFGIPTSFEAKMLAMQYEIPLVTLDEYDVDIAFDGADEVEEKTLFLIKGGGGCHT
FT                   QEKIVDYNADEFVVLVDESKLVKKLGEKFPIPVEVIPSAYRVVMRALSNMGGEAVIRLG
FT                   DRKRGPVITDNGNMIIDVFMNIDDAIELEKEINNIPGVVENGIFTRVDKVLVGTKKGVK
FT                   TLKK"
FT   repeat_region   149980..150764
FT                   /rpt_unit_range=149980..150011
FT                   /note="CRISPRS"
FT   gene            151244..152506
FT                   /locus_tag="MFS40622_0162"
FT   CDS_pept        151244..152506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0162"
FT                   /product="domain of unknown function DUF1743"
FT                   /note="PFAM: domain of unknown function DUF1743; nucleic
FT                   acid binding OB-fold tRNA/helicase-type; KEGG:
FT                   mfe:Mefer_1336 domain of unknown function DUF1743"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68860"
FT                   /db_xref="GOA:D3S750"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013696"
FT                   /db_xref="InterPro:IPR024913"
FT                   /db_xref="UniProtKB/TrEMBL:D3S750"
FT                   /inference="protein motif:PFAM:PF08489"
FT                   /protein_id="ADC68860.1"
FT                   /translation="MFIGIDDTDSPNKYCTTYIATLLIEELKGNGYSVDMPKLIRMNPM
FT                   VKYKTRGNGGVAIHVLDELYSKDKEEIKNITISLVEKYTDFECENTNPGIVFLDETKYK
FT                   ENREKLNYYYKKVLYDIVSIDYAEKFILKVGGEFIKYKLGRGIIGALGAISSTPPYTYE
FT                   LLAYRKKEMWGKKREIDENSVIKMDKETFPYTFDNYDYENNKVLITPNTPCPVLFGIRG
FT                   IDAEILIKAMNMIEGEKPERFMIFKTNHGTDVHLRMMNIKDIYPNTGVIVYGKVIEEPR
FT                   DIEGGHVIFRLSDGTGEIDCVAYEPTKGFRDIIRKLIVGDYIAVYGTVREEPLGINIEK
FT                   IKILRLEKKFVKDKRCPYCGGTLKAKGKKAGYKCKKCKKSIAYDEIRKIEVERDLKPGF
FT                   YEVPGSARRHLSKPIQLIDLI"
FT   gene            152528..153685
FT                   /locus_tag="MFS40622_0163"
FT   CDS_pept        152528..153685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0163"
FT                   /product="methanogenesis marker protein 1"
FT                   /note="TIGRFAM: methanogenesis marker protein 1; PFAM:
FT                   protein of unknown function DUF181; KEGG: mja:MJ1094
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68861"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR017667"
FT                   /db_xref="UniProtKB/TrEMBL:D3S751"
FT                   /inference="protein motif:TFAM:TIGR03266"
FT                   /protein_id="ADC68861.1"
FT                   /translation="MDIAYTLASYRICSPEETFEKIQEALKKIETIEIKNIQHLDKVNI
FT                   PVYYLKRRVVIDGKEGIAIHYGKGATEIQAKVSACMEAIERFSAGYDKNKVKEKADNPI
FT                   NIEDLILPQYADKNVKEWVEGIDIINNEVVDIPADAVFYPTSGKLFRGNTNGLASGNNL
FT                   DEAILHATLEVIERDAWSLADLARKIPRRINPEDAKNPLIHELIEKYEKAGVEIILKDL
FT                   TSEFEIPVVAAVSDDSSKNPLMLCVGVGCHLHPEIAILRALTEVAQSRASQLHGFRRDA
FT                   KLREEFTSKIPYEILKRIHRKWFEYEEEISISDMPNNASYDLKKDLEFIKDKISEFGFD
FT                   KLIYVDLNRVGVDAVRVIIPKMEVYTIDRDRLSKNAFERVKKLYY"
FT   gene            complement(153694..154581)
FT                   /locus_tag="MFS40622_0164"
FT   CDS_pept        complement(153694..154581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0164"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mja:MJ1093 NifB protein (NifB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68862"
FT                   /db_xref="GOA:D3S752"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3S752"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADC68862.1"
FT                   /translation="MSKFAHITKVHPCFNEKIHDKVGRVHLPVAPKCNIACKFCRRSLG
FT                   KEACEHRPGVALSVLKPEDVESYLNRVLKDMPNIKVVGIAGPGDSLFNKETFETLKIID
FT                   EKFPNLIKCLSTNGLLLNKYYKKLADLNVKTVTVTVNAIDPEILKDIVEWVYYDKKVHY
FT                   GIEGAKILIENQIDGIKKAYDEDLIIKVNTVLIPEINMNHVVDIAKELKDFVYMQNIIP
FT                   LIPLYKMSNLRPPTCEELKKVREECEKYIPQFRACRQCRADAVGLLKERKILEDFLNEK
FT                   NKKLNVFELKHFSH"
FT   gene            complement(154668..155315)
FT                   /locus_tag="MFS40622_0165"
FT   CDS_pept        complement(154668..155315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0165"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   mja:MJ1092 urease accesory protein (UreH)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68863"
FT                   /db_xref="GOA:D3S753"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:D3S753"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ADC68863.1"
FT                   /translation="MVIFVELIYTITAFILGMLHALEPGHGKSVVAAYILGTKADLKDA
FT                   ILLGVTITISHTAVIFLLGILSIYLLESLNVNVVHDMMSVVGGLILIAVGIWIVKNYLH
FT                   PHEHKVDTKKGIIALGLSAGLVPCPAALAVLLLSIASGNLFDGLVYVAIFSIGLAISLT
FT                   GLAVAFVESKELIKKYIGNKKVSKLPLISGGIIILIGLYTISHPIIEHLNLI"
FT   gene            155605..156297
FT                   /locus_tag="MFS40622_0166"
FT   CDS_pept        155605..156297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0166"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein; KEGG:
FT                   mja:MJ1091 cobalt transport protein CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68864"
FT                   /db_xref="GOA:D3S754"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:D3S754"
FT                   /inference="protein motif:TFAM:TIGR00123"
FT                   /protein_id="ADC68864.1"
FT                   /translation="MEGYLPPMWCAFWWIVSGVVMAYGVIKLKKLLEESPEMKPLVAIS
FT                   GAYMFILSSLKMPSVTGSCSHPCGNALGAVLFGVPITAVLGAIVLLFQALFLAHGGLTT
FT                   LGANDFSMAIVGPTAAVIAYRLCIKAGLNSSIAIFFAALFGDWLTYVTTAIQLAIAFPI
FT                   PSFTAAFTKFIVIYAYTQVPLAIAEGLLTVIIWDYIKKLRPDLLLKLGVVPEEELRPYL
FT                   SPSPAGGE"
FT   gene            156298..156585
FT                   /locus_tag="MFS40622_0167"
FT   CDS_pept        156298..156585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0167"
FT                   /product="cobalt transport protein"
FT                   /note="TIGRFAM: cobalt transport protein; PFAM: Cobalt
FT                   transport protein CbiN; KEGG: mja:MJ1090 cobalt transport
FT                   protein CbiN"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68865"
FT                   /db_xref="GOA:D3S755"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D3S755"
FT                   /inference="protein motif:TFAM:TIGR01165"
FT                   /protein_id="ADC68865.1"
FT                   /translation="METKHIILLGLVALIIALPLIMYAGKGEEEGYFEGSDDIGTETIE
FT                   ETGYHPWFHPIWEPPSGEIESLLFALQAAIGAIIIGYYVGYYKAKREITA"
FT   gene            156645..157442
FT                   /locus_tag="MFS40622_0168"
FT   CDS_pept        156645..157442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0168"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="TIGRFAM: cobalt ABC transporter, inner membrane
FT                   subunit CbiQ; PFAM: cobalt transport protein; KEGG:
FT                   mja:MJ1089 cobalt transport protein (CbiQ)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68866"
FT                   /db_xref="GOA:D3S756"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D3S756"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADC68866.1"
FT                   /translation="MKHNTVDNIAFSNKLRHVNPKLKVIFSLSLLLISVFSQSAIVPLL
FT                   IFFIISLILLFKAKIPKKIYAVFIGVPLGFGILNLIMFAFLFGTVEWFKINIFGFGIPV
FT                   YKDGIDLGFLLLGRMLGGVSSMLFLAFTTPMVELFYIFRELKMPDVVVDMMMLIYRYIF
FT                   VLYEEYETMKFAQESRLGTSNLKSAYNSLGALAAHLFIRAWEKGEKLNITMMSRCYDGK
FT                   LRLLHEIENPSIKYILFIAVFDIFLIILAYLTKDFNITSYIKI"
FT   sig_peptide     156645..156764
FT                   /locus_tag="MFS40622_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.948 at
FT                   residue 40"
FT   gene            157453..158292
FT                   /locus_tag="MFS40622_0169"
FT   CDS_pept        157453..158292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0169"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="KEGG: mja:MJ1088 cobalt transporter ATP-binding
FT                   subunit; TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68867"
FT                   /db_xref="GOA:D3S757"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR015856"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S757"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /protein_id="ADC68867.1"
FT                   /translation="MYMIETRDLYFRYPDGTEVLKGINLKVKKGEMVSILGPNGAGKST
FT                   LFLHFNGILKPWKGEVLIKGKPIKYDKKGLIEVRKTVGLVFQNPDDQIFAPTVKEDVAF
FT                   GPLNLGLPKDEVERRVREALKAVGMEGFENKPPHHLSGGQKKRVAIAGILAMQPEVIVL
FT                   DEPTSGLDPVGASKIMKLLYDLNKKGMTIIISTHDVDLVPVYADKVYVMYDGKILKEGT
FT                   PKEVFSDVETIRKANLRLPRVAHLIEILNKKDNIPIEWGFTIGEVRRNLAEYLKEKR"
FT   gene            complement(158289..159227)
FT                   /locus_tag="MFS40622_0170"
FT   CDS_pept        complement(158289..159227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0170"
FT                   /product="mevalonate kinase"
FT                   /note="TIGRFAM: mevalonate kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: mja:MJ1087 mevalonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68868"
FT                   /db_xref="GOA:D3S758"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR006206"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3S758"
FT                   /inference="protein motif:TFAM:TIGR00549"
FT                   /protein_id="ADC68868.1"
FT                   /translation="MIIETPSKVILFGEHAVVYGYRAISMAIDLTSTIEIREIDRNEII
FT                   LNLNDLNKSLRLNLEDIKNINPNNFGDFKYCLCAIKNTLNYINIEPKTGFEINISSKIP
FT                   ISCGLGSSASITIGTIRAVSEFYDKELKDNEIAKLGYTVEKEIQGKASITDTSTITYRG
FT                   ILEIKNNKPKKIKGNFEEFLKSCKFLIVYVEERKKKTAELVNEVAKIENKDEIFKEIDK
FT                   IIDKALKVNSKEEFGKLMTKNHELLKKLNISTPKIDRVVDIGNRFGFGAKLTGAGGGGC
FT                   VIILVNEEKEKELIKMLNKENVKIFKCKMIN"
FT   gene            complement(159560..160579)
FT                   /locus_tag="MFS40622_0171"
FT   CDS_pept        complement(159560..160579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0171"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: mja:MJ1086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68869"
FT                   /db_xref="GOA:D3S759"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D3S759"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADC68869.1"
FT                   /translation="MKVRIRDFIETVEGLYFAVNTYCHPEDRVFAFLRYVPYEFVDFEI
FT                   EGNNIREINGKRYVKMAETHKAYKFLKEKFNKYLFYDEINNVLMHAIPKEDVKRILRPK
FT                   DRLKEIINEENNLNELEEKCRKLALILEDYGVPIKSMGVSGSLLLKLNSKNSDIDFVIY
FT                   GKDMHKKGREALKQAFEDNKLKPLSDNFWKIAYKKRIKDGTLTYEEFVFYERRKYNRGI
FT                   VDNTMFDLLFTREWEEIDEKYGDKRYKNLGFIKIEGRVLNDDFAFDNPAVYKIECYDDE
FT                   NIKEVVSFTHTYAGQCFNGEEIVARGKLEEVINKNGEKYKRVVVGTTREAFNEYIKLR"
FT   gene            complement(160576..162099)
FT                   /locus_tag="MFS40622_0172"
FT   CDS_pept        complement(160576..162099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68870"
FT                   /db_xref="InterPro:IPR021869"
FT                   /db_xref="UniProtKB/TrEMBL:D3S760"
FT                   /inference="similar to AA sequence:KEGG:MJ1085"
FT                   /protein_id="ADC68870.1"
FT                   /translation="MGNKEINILKIRANLIKYVDVEEIEDLPRVKVKSVEEFLEAIRVL
FT                   GKQVICRYVDNIEQIFFFVDNGVIFYIPSDGFKTLFDLINAKSLGLSAEEYYEYLELGD
FT                   IEEYKKYKSSGFKSIEEYKKAKELGFIGGLEKLVKEGIARKVDDKYCIEYLFYGILEEE
FT                   TFSNDAELYYFAIEKGFSDFDELFNALKAGFGDANEYKDALERGFKDAYEYNDALSKGF
FT                   KDAEEYRIAKAIGVGSKKELEEYMQLKRICENFGLETFEEGYLLKVLMDMELDGEITLK
FT                   DLYNKLKEKERLMKIKKDMLNKLANISSPSWYSTRFTTVDDLEEYLENSEIISYLGEYL
FT                   KEEKIFRRIYPPKPSRRIVIIDAISVLNNMHNLSPNSVESLIKKIKNAGFKNIITVIDK
FT                   ATYYKIRGKDICRFLANECNIKISDSEDEAYSLIIEYIKNFGALVISNASFKDYVIKDP
FT                   KLSHREIKEYIIPFTVENGEINLDIELLRKLYTELVTKRIEKIKANVVS"
FT   gene            complement(162135..162989)
FT                   /locus_tag="MFS40622_0173"
FT   CDS_pept        complement(162135..162989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0173"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: mja:MJ1084 shikimate 5-dehydrogenase; TIGRFAM:
FT                   shikimate 5-dehydrogenase; PFAM: Shikimate dehydrogenase
FT                   substrate binding domain protein; Shikimate/quinate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68871"
FT                   /db_xref="GOA:D3S761"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D3S761"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ADC68871.1"
FT                   /translation="MIDAKTKVIGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLP
FT                   ENLKYVIDGAKALGIVGFNVTIPHKIEIMKYLDEIDKDAQLIGAVNTIKIEDGKAIGYN
FT                   TDGIGARMALEEEIGKVKDKNIVIFGAGGAARAVAFELAKDNNVIIANRTVEKAEALAK
FT                   EISEKLNKKFGEEVKFSGLDIDLDGIDIIINATPIGMYPNVDVEPIVKAEKLREDMVVM
FT                   DLIYNPLETVLLKEAKKVNAKTINGLGMLIYQGAVAFKIWTGVEPNIEVMKNAIIDKII
FT                   NKK"
FT   gene            complement(163067..163648)
FT                   /locus_tag="MFS40622_0174"
FT   CDS_pept        complement(163067..163648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0174"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   mja:MJ1083 iron-sulfur flavoprotein (isf)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68872"
FT                   /db_xref="GOA:D3S762"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3S762"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ADC68872.1"
FT                   /translation="MKVIGISGSPRPEGNTTLLVREALNAIAEEGIETEFISLADKELN
FT                   PCIGCNMCKETGSCQIIDDVDEILEKMKEADGIILGSPVYFGGVSAQLKMLMDRSRPLR
FT                   IGFQLRNKVGGAIAVGASRNGGQETTIQQIHNFFLIHSMIVVGDNDPTAHYGGTGVGKS
FT                   PGDCKNDDIGLETARNLGKKIAEVVKLIKK"
FT   gene            complement(163701..164075)
FT                   /locus_tag="MFS40622_0175"
FT   CDS_pept        complement(163701..164075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0175"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mja:MJ1082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68873"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S763"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADC68873.1"
FT                   /translation="MKDFIINRLKKFTIEDLMRCILGLQEIEIRVYFDLLENGEGSVLE
FT                   IAERVNRDRTTVQKALRSLMNCGLVSRKKVTEKVGYKYIYNAVELDKVSDIIEELLDDW
FT                   YQNVKKWLNYFRESRNEKNY"
FT   gene            complement(164097..164501)
FT                   /locus_tag="MFS40622_0176"
FT   CDS_pept        complement(164097..164501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0176"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   mja:MJ1081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68874"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D3S764"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ADC68874.1"
FT                   /translation="MLFRYQIKTNKREELVDITPQIVSAISESKVKDGIAVIYVPHTTA
FT                   GVTINENADPSVKHDIINFLSHLIPKNWNFTHLEGNSDAHIKSSLIGCSQTVIIKDGKP
FT                   LLGTWQGIFFAEFDGPRRREFYVKILADKE"
FT   gene            164764..166578
FT                   /locus_tag="MFS40622_0177"
FT   CDS_pept        164764..166578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68875"
FT                   /db_xref="GOA:D3S765"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D3S765"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0500"
FT                   /protein_id="ADC68875.1"
FT                   /translation="MDIKHKIPILLLVLYIILGVFMQYNGISEFKSLPSPIYGGDYYYQ
FT                   MGVIWHIREGGNPLESSSMLGGMPGYLPLYAYICAKFCDLFNLDTMEGMFYFSIVLFIV
FT                   ASVIWFYLFRVLFKDDWIALIGVVLANGVSAYPILKYTNFTHQIMLPLFILTLYLAFKE
FT                   RKIIYYALLGFIYGLLTLSHMVAFVGATLIILTFVIYEIYKNKNRILDYLKDNIKNWGV
FT                   FGAIALPILMLYWYKPIFIYHLHRPYDRLHMDIIDFGRLDVQINFLFNTIKTYLFNFSS
FT                   IGGLINSILVWIGLYAFYTSKEDTLKEFIKIFGIGAIFATFCYFITEPLLKINFIPTYM
FT                   HWFYLWVTAIIVGLYGLNYIKENLNLNELNKKVVVFGLLFIILFANSSYAFVNYVNNDR
FT                   WANVGKYPMPEMYVSLQNYLLKNTNVNDVILSTKELSFVINAISGRKVMVNRWAQQNDP
FT                   YMNLPQRDMDAAVILYGNDTKKKLELIKKYHITYLYWDYNWINSEFQFDNNGRIVGIYD
FT                   PLMTYDTKENRKYLDKYGVKYIPMYFWIDPSARNNYIRKYHLLIISPQNYYNFTNPWKP
FT                   DLNKYLVEVWNYTYNGHKIAVLYKIKVD"
FT   gene            166606..167294
FT                   /pseudo
FT                   /locus_tag="MFS40622_0178"
FT                   /product="hypothetical protein"
FT   gene            complement(167303..169108)
FT                   /locus_tag="MFS40622_0179"
FT   CDS_pept        complement(167303..169108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68876"
FT                   /db_xref="GOA:D3S766"
FT                   /db_xref="UniProtKB/TrEMBL:D3S766"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0502"
FT                   /protein_id="ADC68876.1"
FT                   /translation="MDILLFVIVLFLIYLINPLKDEEKIITTPFVSIFYIIGTSYLLSF
FT                   LSIPMYKILYILPLLLIIILLILKGNLSIKLFFNLNLNLIKSLILIFTLLCSLFIGYAI
FT                   FPKYPCEMWDSQFHMFKVKAIMIEDSIFYKNQEYIRYWHYPSGFHSFAYFLASDVKDIP
FT                   TTIYFIEIFIIMLFVLSHYYIGECIKEGIGVYTALFVPLNYEFYRILLRTIYPNALGYC
FT                   IFLILIAFLLRYKSTKNNIYLYFFSFGVFSLIFTHTFPFLMLILFLASLIFWDIIYKEY
FT                   RDMLNYIKFFSISILCSLVIIHFKLINDVISYSNTSYVVNNINLYKVYIVIISIFCGVG
FT                   TCTSTNIAIALLSNHQISFFLFIKYLLVSSIYIILFIIGTIFLIKNRKGYFVFYILLMI
FT                   LWLLNNQLIGFKIPFFSALYNSIRWLYNFQILMPVFYGCGLYYITERTTSTKKKFLIIA
FT                   GIIILLGYNAYTIYSTHPKFYWKFYLVGSDEIDAFNFINKNNISNELFLNFGQDSGQFL
FT                   PIFTNNKCVFCWGNYNKFNNVTANEIINYTWHNNYNKFIHFCKTNNISYVFISKNLKIN
FT                   YKFFENNSYFEKIYSKNNITIIEIK"
FT   gene            169234..170466
FT                   /locus_tag="MFS40622_0180"
FT   CDS_pept        169234..170466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0180"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: mja:MJ1079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68877"
FT                   /db_xref="GOA:D3S767"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:D3S767"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ADC68877.1"
FT                   /translation="MIIVTKSIIKSETMLNLPYLILGIICGTITGLFPGIHPNNIVALS
FT                   FLILPYFGINNYVPFLIGLVIAHYFINFIPSAFLGVPDDETAVSALPMHKLTLNGNGYE
FT                   GIVLAGFGSYLGVVFSIIISLFLISILHFNVKAFYCSIKIFIPLILIAFVIYQIFTAKS
FT                   IWEVLVIFLSGIFGIAVLYCSEAFNITLTAIFTGMFGIPLLINNLKIYKIKSQIITIPE
FT                   FELKFLKSSFFASVAGFFRIFLPGISGSQLNYILSKILNEKDLKNFIVSQGSIILSNEV
FT                   FSILSVIFIGVGRSGVARAIQLLNANIDINTAIFSILVSSTISLIILLKLSKYLLIFIR
FT                   KVNFKFLSLFFIMFCSLVVVIGSYNTYLIHHIAVYITSICIGLLALKSNSNLSNMMNVL
FT                   IFPTILYFLGR"
FT   gene            170468..171430
FT                   /locus_tag="MFS40622_0181"
FT   CDS_pept        170468..171430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mfe:Mefer_0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68878"
FT                   /db_xref="GOA:D3S768"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:D3S768"
FT                   /inference="protein motif:PFAM:PF03706"
FT                   /protein_id="ADC68878.1"
FT                   /translation="MDLKGQILNKRTIVSFILSLGIILYIFSKIDLDKLILILKNTNIF
FT                   YYFFAVAMFYLSILIKSYRWRIFLKNTDIDLKLKDAFVIYYLSMFVNSLVPAKLGDIYR
FT                   GYLLKKKTNKSISLGVGTVFIERIFDLVAMISLLFISAYLSFKSDIPKEILYSIKWGTI
FT                   IILFLIILIFGFLLVNSKINLKNNKIERILMNFEKGLRAVKLNTLPLLIILSFVGWFIE
FT                   GLTIYFIFLALNLNLEILFGVFSDLASSLLTAIPITPSGLGIVEYALIYILKLKNIDYS
FT                   GAFAVLILYRLISYFSIVLFGAIMFYIVEGNILRESKNG"
FT   gene            171588..173150
FT                   /locus_tag="MFS40622_0182"
FT   CDS_pept        171588..173150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0182"
FT                   /product="seryl-tRNA synthetase"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); KEGG: mja:MJ1077
FT                   seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68879"
FT                   /db_xref="GOA:D3S769"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR004503"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041293"
FT                   /db_xref="UniProtKB/TrEMBL:D3S769"
FT                   /inference="protein motif:TFAM:TIGR00415"
FT                   /protein_id="ADC68879.1"
FT                   /translation="MKLTFDLDGKIIFSKELSEEAKKVVEEILKNADSIFLRGVPKGKE
FT                   DEASKIKSYEFEGNTLKLKIVSGTYTRAHEGLIRLRKPLAEKLGRNFRIGVRGIEIDNY
FT                   VITIETDEDKAKKLEGIKVPECEAKVEGNKIILTFKDIGESELKRNIIDRAIKFVKTEL
FT                   EKEEEDLTFKVCKIPPGTIVSEYKAKRKITFDKDPTDVAEKLGWVKKFPGRGQWFYAPP
FT                   ITALFRVLEELIVEEVVKKIGFQECLFPKLIPLEIMYKMRYLEGLPEGMYYVCPPKREP
FT                   ELFKEFVNEMMIKKEIPIEKLKTLLRDPGYVLAPAQCEPFYQFFEGEVIDVDKPIMFFD
FT                   RSGWTYRWEGGGARGLDRVNEFLRVECVWIGSPEFVEETRDKTLKYAEKLAEKLDLEYW
FT                   VEVGDDPFYLEGRKKEDRGIEFPDVPKYEMRLWLPHIKDERKGVAVTSANVHGTHFVEG
FT                   FRIKDYKGRKVWTGCTGYGITRWVVGYLAQYGFDFDDWHPIIKKKIEKLPEVPQLITWP
FT                   KKD"
FT   gene            173166..173732
FT                   /locus_tag="MFS40622_0183"
FT   CDS_pept        173166..173732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0183"
FT                   /product="GMP synthase, small subunit"
FT                   /note="TIGRFAM: GMP synthase, small subunit; PFAM:
FT                   glutamine amidotransferase class-I; KEGG: mja:MJ1575 GMP
FT                   synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68880"
FT                   /db_xref="GOA:D3S770"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR023686"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3S770"
FT                   /inference="protein motif:TFAM:TIGR00888"
FT                   /protein_id="ADC68880.1"
FT                   /translation="MIVILDNGGQYVHRIYRSLKYIGVSSKIIPNTTPLEEIEGNEEIK
FT                   GIILSGGPDIEKAKNCIDIALNAKLPILGICLGHQLIALAYGGEVGRAEAEEYALTKVY
FT                   VDKENDLFKNVPKEFNAWASHKDEVKKVPEGFEILAHSDICRVEAMKHKTKPIYGVQFH
FT                   PEVAHTEYGSEILKNFCKVCGYKFE"
FT   gene            173913..174479
FT                   /locus_tag="MFS40622_0184"
FT   CDS_pept        173913..174479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0184"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: mja:MJ1576 LemA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68881"
FT                   /db_xref="GOA:D3S771"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D3S771"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ADC68881.1"
FT                   /translation="MSLLLIVVGLIIILIVLGIVIYAISIYNRFQTLKNGAEATLGQIR
FT                   VALKKRLDMINQLVEAVKSYASFEKETLTKITELRSSVLKANTAEDIQNIDRESRNILG
FT                   NILVAVENYPELKTSETVKELMDAIKEIEDEIARHRYTYNNIVQEFNTKIDTFPSNIIA
FT                   SMFGFGKMDYLQFEEEIYERPKINF"
FT   gene            174500..176326
FT                   /locus_tag="MFS40622_0185"
FT   CDS_pept        174500..176326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0185"
FT                   /product="Protein of unknown function DUF2207, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2207, membrane;
FT                   KEGG: mja:MJ1577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68882"
FT                   /db_xref="GOA:D3S772"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D3S772"
FT                   /inference="protein motif:PFAM:PF09972"
FT                   /protein_id="ADC68882.1"
FT                   /translation="MREEKKIIIFCIFVFVVGVVGAFLVTSSNGVNYTNIDIKNYKANL
FT                   YIEKNLTLEESYTYEILENKRYRMLYRDWKVPLVYNSKLDVPYVEVLNLSASSKDMIGY
FT                   VVDYKGDIFVFSNNTWIKKSVKNLVYEYGIINEVGFYNPYRYDAGIYTTKYKFIIYPPI
FT                   ETDNKVYHINLKLADEHLPYKNVEINIIDRNSSILNLFVYPSTFKVHKTDIGYVIEGSS
FT                   PEDEPIEVEMLLKPNSVNGFVKYMENVEEKTISAYKRYILINYIITALKYLLIATILLF
FT                   PLIAYLIYLRFGKEKSYIVPEYLSYVPNKNRKPWIVNLIFNGEVGKFDKNGFYATLLDL
FT                   HNRGYIKIIKDGEDIKIKILKRDDNLDIYEKEVMNFLIRHSKNGEFNPKDLENAVSHWT
FT                   DEYEIKRLWNEINGIMNNPLFSSTLTKRFLETKGKDILWISLVIFITLTLILFGISMNY
FT                   SNYYPTLKDVFYLSIILVIQNIILILTPKSLFGRWKDDYYKEKLEWEAFKNFLSDLAMI
FT                   KKYSPEDISIWKEWLIYGTALGVGDKVVEAMKSLNINIPEVDIAPAVYIAYNSMYSHIN
FT                   NAYSSVVASSSMSSGGGFGAGGGFGGGGGGAR"
FT   gene            176349..177119
FT                   /locus_tag="MFS40622_0186"
FT   CDS_pept        176349..177119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0186"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="KEGG: mja:MJ1578 cobalamin biosynthesis precorrin-3
FT                   methylase (CbiF); TIGRFAM: precorrin-4
FT                   C11-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68883"
FT                   /db_xref="GOA:D3S773"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3S773"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADC68883.1"
FT                   /translation="MNNDRKVIIVGAGPGDPELITIKGKKTIEDADVIIYAGSLVNEKL
FT                   LEYSKKNAEIYNSANMNLEEIVEVMVKAVNEGKKVVRLHTGDPSIYGAIKEQIDELAKH
FT                   NIDVEIIPGVSSLFAATASLKVELTLPDVSQTVIITRPEGRTPMPEKEKLRDLANHQST
FT                   MAIFLGVSMIDKVVKELIEGGYKEDTPVAVVYHASWYDEKIIRGTLKDIAEKVKKEGIK
FT                   KTALIIVGEVLNPKYYAYSKLYDKDFEHGYRKKE"
FT   gene            complement(177120..177332)
FT                   /locus_tag="MFS40622_0187"
FT   CDS_pept        complement(177120..177332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68884"
FT                   /db_xref="UniProtKB/TrEMBL:D3S774"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0761"
FT                   /protein_id="ADC68884.1"
FT                   /translation="MNQRKEIELLMYDVLPYMANIEFIRELFENVESLEELEQKAKELL
FT                   EKETDITKKTDLKILLEKIEERKSK"
FT   gene            complement(177310..177654)
FT                   /locus_tag="MFS40622_0188"
FT   CDS_pept        complement(177310..177654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0188"
FT                   /product="Protein of unknown function DUF2304"
FT                   /note="PFAM: Protein of unknown function DUF2304; KEGG:
FT                   mja:MJ1580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68885"
FT                   /db_xref="GOA:D3S775"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D3S775"
FT                   /inference="protein motif:PFAM:PF10066"
FT                   /protein_id="ADC68885.1"
FT                   /translation="MELIQIVGVIFALFALSRVVLQLKRRSISFNEGLFWIFIWSLVVI
FT                   FLIFPEFFGYVAEFLGVGRGVDALMYISIVVLFYLIYRLYAKIDALERQITHIVREIAI
FT                   RDRYEPKKRD"
FT   gene            177958..178875
FT                   /locus_tag="MFS40622_0189"
FT   CDS_pept        177958..178875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0189"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: mja:MJ1581 aspartate carbamoyltransferase
FT                   catalytic subunit; TIGRFAM: aspartate carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68886"
FT                   /db_xref="GOA:D3S776"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3S776"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ADC68886.1"
FT                   /translation="MRHLISMKDIGKEEILEILEEAKRMEEFLNTKRPLKLLEGKILAT
FT                   VFYEPSTRTRLSFETAMKRLGGDVITMTDLKSSSVAKGESLIDTIRVISGYADIIVLRH
FT                   PSEGAARLASEYSQVPIINAGDGSNQHPTQTLLDLYTIMREIGRIDGIKIAFVGDLKYG
FT                   RTVHSLVYALSLFDNVEMYFISPKELKMPRDIIEDLKAKNIKFYEKESLDDLDEDVDVL
FT                   YVTRIQKERFPDPNEYEKVKGSYKIKREYVEGKKFIIMHPLPRVDEIDYDVDDLPQAKY
FT                   FKQSFYGIPVRMAILKKLIEDNER"
FT   gene            178882..179631
FT                   /locus_tag="MFS40622_0190"
FT   CDS_pept        178882..179631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0190"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: mja:MJ1582 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68887"
FT                   /db_xref="GOA:D3S777"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3S777"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADC68887.1"
FT                   /translation="MKDIKYVDAHCHIEDKAFNKNRDEVIERAKKENVIIVTSGASLGG
FT                   CLRALELRKKYGIYLTLGYHPSRVKADDKVVNKVYNLIRDNKDEILAVGEIGMDIKDEN
FT                   YERQEMIFKKFLSLAEELNKPIVVHARGFERKIFDIAKNKANIMFHCYSGDVELAKEIG
FT                   REGHLISISTLVCFSEHHKKLVESLDLEYLTTETDSPYLSPIKGAKNEPRNVKLVVEEI
FT                   AKIKEMDIEEVANIIYKNTCKFFKRRL"
FT   gene            179631..180011
FT                   /locus_tag="MFS40622_0191"
FT   CDS_pept        179631..180011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0191"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   mja:MJ1583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68888"
FT                   /db_xref="InterPro:IPR023368"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:D3S778"
FT                   /inference="protein motif:PFAM:PF01980"
FT                   /protein_id="ADC68888.1"
FT                   /translation="MYYLNPIGVVEQNNDYTVLNIFDEFLDGLDGLKEGDYIIVLVWFH
FT                   KNDSEERRKILKVHPRGDINNPLKGVFATRSPYRPNPIGKYTVKTHKIDKNKIFIDKID
FT                   AYDKTPIIDIKIFSEELDCPTR"
FT   gene            180133..180315
FT                   /locus_tag="MFS40622_0192"
FT   CDS_pept        180133..180315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100039738"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68889"
FT                   /db_xref="UniProtKB/TrEMBL:D3S779"
FT                   /inference="similar to AA sequence:KEGG:100039738"
FT                   /protein_id="ADC68889.1"
FT                   /translation="MFDMDIFGNSKSKKGPKTARGMINKMLTGDGRKKPTLERILGLEE
FT                   PKKKKKKSSSKKKKK"
FT   gene            180353..181162
FT                   /locus_tag="MFS40622_0193"
FT   CDS_pept        180353..181162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0193"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: mac:MA3111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68890"
FT                   /db_xref="GOA:D3S780"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D3S780"
FT                   /inference="protein motif:PFAM:PF04307"
FT                   /protein_id="ADC68890.1"
FT                   /translation="MLGKHHLSITTGFFIPILVFGVYELLNGSVEYFYYSICILLFASI
FT                   GSLLPDADSEGKATLYYRYRLIYYPMALIHEIIILLFNNQKIKEKLKIGYTIEKRHRGI
FT                   LHTPIGAFLSSLLLTAIFFIAYVSIAIYLNINVDLLIILSVFLGLFFGQIMHLIEDSFT
FT                   VSGINWLFPFGNKTINGKIYTFEKVKGKVDIRPDLYAWFYQLSGVILLVIVLFYSNYLP
FT                   SSMIFEIIGLGIVINLMALIGMYFISNTNMNLWLVDKRTWRKIQKNK"
FT   gene            complement(181220..182140)
FT                   /locus_tag="MFS40622_0194"
FT   CDS_pept        complement(181220..182140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0194"
FT                   /product="Fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   mja:MJ1585 aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68891"
FT                   /db_xref="GOA:D3S781"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:D3S781"
FT                   /inference="protein motif:PRIAM:4.1.2.13"
FT                   /protein_id="ADC68891.1"
FT                   /translation="MVKRLKKKDVKVPLTVPEDMKEEYIKNYLELTKRTGNVMIFAGDQ
FT                   RIEHLNDDFFGEGIAKEDASPEHLFNIASKGKICGFATQLGLIARYGMDYKKVPYIVKI
FT                   NSKTHLVKTRDPISRALVTVKDVVELKENSGLNILGVGYTIYPGSEYEHIMFEEASRVI
FT                   LEAHKHGLIAIIWSYPRGKNVKDEKDPHIIAGAAGVAACLGADFVKVNYPKCDNPAERF
FT                   KEAVLAAGRTGVLCAGGKSIEPEKFLKQIWEQINISGARGNATGRNIHQKPLDDAVRMC
FT                   NAIYAITIEGKSLEEALKIYYGDRK"
FT   gene            182228..183664
FT                   /locus_tag="MFS40622_0195"
FT   CDS_pept        182228..183664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0195"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain protein; KEGG: mja:MJ1586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68892"
FT                   /db_xref="GOA:D3S782"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D3S782"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ADC68892.1"
FT                   /translation="MELFSILREKIKEKEVITPKEMAIIDDNAEFLGVQKILLMENAGK
FT                   AVYEEIKDIDAEEYIIFCGTGNNGGDGFVVARHLGKGEVVLIGKETEIKTYEARENFKI
FT                   LKNLSEFGNIKIREIRRAEEVEDIFERLKDKKAIIIDAMIGTGVKGELREPFKTIVDKI
FT                   NELKKINKEIFVVSVDVETGDLKSDITITFHKRKTINKDNAIVKEIGIPKEAEYIVGWG
FT                   DLKALKKRDSNSHKGQNGKVLIIGGSRDFYGAPILAGLAALKIADLVGILSVDKVINKL
FT                   NHPEFILYKVEGDYLSSQHVDYALDIAKKYDVVVLGNGLSANNRTKAFVNEFLSKYKGK
FT                   VVIDADAIKVIDYHGFEFSENYIFTPHKREFEYMNIDLDNIEKIKSTIVLKGRYDIIFN
FT                   ANNLKINKTGNAGLTKGGTGDVLAGLIGALFAVNEAFLSACCGAFINGYAGDLLLKEKG
FT                   YCYTPLDLIEKIPNVLKIFE"
FT   gene            183991..184860
FT                   /locus_tag="MFS40622_0196"
FT   CDS_pept        183991..184860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0196"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: mfe:Mefer_1097 PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68893"
FT                   /db_xref="GOA:D3S783"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D3S783"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADC68893.1"
FT                   /translation="MKADLHIHTKYSGIGKFWKLKFPDSVEEPRNILKVAKKRGIDIIA
FT                   ITDHNTIKGGIETKKLEKEFGVEVIIGSEIMTTEGEIIGLFLNEDIPKGLTPEETIELI
FT                   KEQGGLAVAPHPYSPICKALGDRIFDLDLDGVEVFNAYHRDGIVNNIALNKVIKNYHKK
FT                   PFAFIGSSDAHIARMVGNAYTLFEGNSADDLYKAIIKKRTSFNGKPTPLYQAILWSYNV
FT                   VYESEKKLIKSLIFKIDDNTINSIKFYKKILGIFGGFIYIFTPLPILSGFLGNYYLKKK
FT                   AKEKMKEV"
FT   gene            184874..185749
FT                   /locus_tag="MFS40622_0197"
FT   CDS_pept        184874..185749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68894"
FT                   /db_xref="GOA:D3S784"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:D3S784"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0657"
FT                   /protein_id="ADC68894.1"
FT                   /translation="MALQIFIKILPLMFFGILLANLMYHLNILYKLQKYIKNNYFPIIA
FT                   VFFVSSTSGSFLLKNLLKNNEISENDIIPLYFLGMFIFGIHIILFYAIPMAVSLGWYVG
FT                   GIYILIKFLVTLNYLIISVLMLKRRGCNIRNIEFKSKSGGLYKAIKETFKQYFRVLASF
FT                   VPSVLIITYLIEHGLLDVVENFAGSLLNTLNLSPTILVIVLTGLATISGAIGIASGLLD
FT                   ENILSPNEIILSLIIAEFLNRIVLYLRKYLPIQLSIFGKFGIKLATLHLIVYEISLLVV
FT                   IVIWYFFFIL"
FT   gene            185940..186398
FT                   /locus_tag="MFS40622_0198"
FT   CDS_pept        185940..186398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68895"
FT                   /db_xref="GOA:D3S785"
FT                   /db_xref="UniProtKB/TrEMBL:D3S785"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0656"
FT                   /protein_id="ADC68895.1"
FT                   /translation="MRISPLIAGLIGGFIAAMLQALFKVFPPPAYGICIACHTRDLVNW
FT                   IVNHLFGTSLGMAPVSKAFPVLTVVGIFIGALIAAFMHKEFKIKQTHNPAVGFVLGILV
FT                   INFALLMGGCPVRETLRTAYGDIIAFISLIAMFVGVVVASEVYLKRNL"
FT   gene            186418..186891
FT                   /locus_tag="MFS40622_0199"
FT   CDS_pept        186418..186891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68896"
FT                   /db_xref="GOA:D3S786"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D3S786"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0655"
FT                   /protein_id="ADC68896.1"
FT                   /translation="MDYLPVIGTFIFGIILGYLFQRARMCFIGGMRDFYLIRDTWLIKG
FT                   LFGFFAGALIGFIIFSAIGNISLFPWLAVKGVLPIPGDPLGASGTLMGHLILAIIGGFG
FT                   VGFFSVVQGGCPLRNYVMAAEGNKTAIAYLFGLAVGAVIFHKFVAPMVKTIMT"
FT   gene            186927..187748
FT                   /locus_tag="MFS40622_0200"
FT   CDS_pept        186927..187748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0200"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; PFAM:
FT                   extracellular solute-binding protein family 1; KEGG:
FT                   mae:Maeo_1345 phosphate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68897"
FT                   /db_xref="GOA:D3S787"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D3S787"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ADC68897.1"
FT                   /translation="MRKFLGIFIGILVVLCLCGCINSNKETVKEEKITLAGGTALVPIM
FT                   EEAGKEFMKKHPNVKVIVSGGGSGFGIKQVGEGYVDIGMAGRDLKPEEKEKYPNLKVYR
FT                   IGYDGVAIVVNPKNPIDGLTKEQVKKIFAGEITNWKEVGGKDAPINIYTRDPESGTRDT
FT                   FWRLVLDKGNITKKAIVVASNGEMKAKIAMDENGIGYLSVGYVDKSVKAIKLDGIAPTQ
FT                   ENVMKGIYKVYRPLNLITNGEPKGVVKEFIDFVLSDEGQKIVEEKGFIPVK"
FT   sig_peptide     186927..187004
FT                   /locus_tag="MFS40622_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.611) with cleavage site probability 0.471 at
FT                   residue 26"
FT   gene            187808..188656
FT                   /locus_tag="MFS40622_0201"
FT   CDS_pept        187808..188656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0201"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: mvn:Mevan_0421
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68898"
FT                   /db_xref="GOA:D3S788"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3S788"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ADC68898.1"
FT                   /translation="MRKIKEIIIEQVMKIFAIFSSIVVLGIIFLLLVNGLPIFNYVSPI
FT                   NFIFGMNWNPDTGDFGIFPMIIGSFCITILALLFAVPLGVGCAIYLAEIASEKVRNVLK
FT                   PVVEILTAIPSVVYGFVGMVLLVPWIREILNVNPGYSWFAASVILSIMILPTITSISED
FT                   AIRNVPQSIKKASFSLGATHWQTIKYVILPHSFRGILAGIFLAMGRAVGETMAVLMVAG
FT                   NCPLIPKSIFDPVRPLTSHIILNIKEASVGSPVYYAMFACGIILLFIIVVLNICIRMIE
FT                   K"
FT   gene            189400..190824
FT                   /locus_tag="MFS40622_0202"
FT   CDS_pept        189400..190824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tko:TK1678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68899"
FT                   /db_xref="GOA:D3S789"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:D3S789"
FT                   /inference="similar to AA sequence:KEGG:TK1678"
FT                   /protein_id="ADC68899.1"
FT                   /translation="MSRLVALFIIPLLFFWAPSAFASADSGYRIIGAYPLNEEVAFVVM
FT                   NESSNVLYLVFYNGSSFRAEKLNISEEYHIVHWNGNSWLLQKGERGTVGLYIYNGTLEH
FT                   VKTFKNGSLCTDNDLQIRWNGKEYLITFLGKGREDLSTGECIFRFKNYLLSGDRLIPLN
FT                   ATGSGMWVPGLNAWLVGESLVDENGRVIGKYNFSKTGVYSVGLAVDGNKTLVVVSSDGG
FT                   WIRVFALENSSLILVYSKKLGKWELGNDPRPPNIWTGKPILIGYESGDTLVPTLWLFNG
FT                   TDFMKIKTEFKTSTSLDPIFCSDQGYILASTPVNVTKRGGLLHLELYTFKDSSLSKVSS
FT                   LEVKWGYVRVINAAEFWGFPVPEIERGEILVVSNGDYIFLFNSSHAVNLLSGMVFKLPE
FT                   PLHDGRYWVAPYCGGWIVFNEEKVYFFKNGRFRDITQEMLSALHGKKNRVSLTAVILGG
FT                   LVLVAVVLIVALRKRG"
FT   sig_peptide     189400..189468
FT                   /locus_tag="MFS40622_0202"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.777 at
FT                   residue 23"
FT   gene            191224..192080
FT                   /pseudo
FT                   /locus_tag="MFS40622_0203"
FT                   /product="hypothetical protein"
FT   gene            192247..192717
FT                   /locus_tag="MFS40622_0204"
FT   CDS_pept        192247..192717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0204"
FT                   /product="Protein of unknown function DUF2297"
FT                   /note="PFAM: Protein of unknown function DUF2297; KEGG:
FT                   mja:MJ0003 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S790"
FT                   /inference="protein motif:PFAM:PF10059"
FT                   /protein_id="ADC68900.1"
FT                   /translation="MKGKKIAIVAHCILNQNSVVNGLERAEGAFNEVVEILLKHNYAII
FT                   QLPCPELIYSEYNREGKTKEEYDTKEYRELCKELLKPIIKYLEEYKKYNFKFILIGIEN
FT                   SPTCDIFKNRGILMEELLNEVEKLDIDIKMIEYPKEEGNYKAFIKNLKKMIK"
FT   gene            192714..193445
FT                   /locus_tag="MFS40622_0205"
FT   CDS_pept        192714..193445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0205"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /EC_number="1.3.7.8"
FT                   /note="KEGG: mja:MJ0004 (R)-2-hydroxyglutaryl-CoA
FT                   dehydratase activator; TIGRFAM: CoA-substrate-specific
FT                   enzyme activase; PFAM: ATPase BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68901"
FT                   /db_xref="GOA:D3S791"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D3S791"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ADC68901.1"
FT                   /translation="MILGIDIGSTTTKMVLMEDNRIFWYRIEDVGVVIEEDILSKMIKE
FT                   IEQKYPIDKIIATGYGRHKISFADKVVPEVIALGKGANYFFNDADGVIDIGGQDTKVLK
FT                   IDKNGKVVDFILSDKCAAGTGKFLEKALDILKIDRDEINKYKSDNVAKISSMCAVFAES
FT                   EIISLLSKKVPKEEILMGVYESIINRVIPMINRLKIQNMVFSGGVAKNKVLVEMFEKKL
FT                   SKKLLIPEEPQIVCCVGAILV"
FT   gene            complement(193449..194588)
FT                   /locus_tag="MFS40622_0206"
FT   CDS_pept        complement(193449..194588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0206"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: mja:MJ0005 formate
FT                   dehydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68902"
FT                   /db_xref="GOA:D3S792"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S792"
FT                   /inference="protein motif:PFAM:PF04422"
FT                   /protein_id="ADC68902.1"
FT                   /translation="MKYALIQATDNEILKKAECGGAVTALFKYLLDKKLVDGVLALKRG
FT                   EDVYDGIPVFITNSDELIETAGSLHCAPVNFGKLIAKYLADKKIAVPTKPCDAMAIREL
FT                   AKLNQINLDNVYMIGLNCGGTISPITAMKMIELFYEVNPLDVVKEEIDKGKFIIELKSG
FT                   EHKAIKIDELEEKGFGRRKNCQRCEVMVPRMADLACGNWGAEKGWTFVEICSEKGRKLV
FT                   EDAEKEGYIKIKQPSEKAIQIREKIENIMIKLAKKFQKKHLEAEYPSLEEWEKYWNRCI
FT                   KCYGCRDNCPLCFCVECRLEKDYIDEKGKIPPNPLIFQGVRLSHIGQSCINCGQCEDAC
FT                   PMDIPLAYIFHRMQLKVRDTFGYIPGVDDKLPPLFMSEK"
FT   gene            complement(194585..195703)
FT                   /locus_tag="MFS40622_0207"
FT   CDS_pept        complement(194585..195703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0207"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; KEGG: mja:MJ0006 formate
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68903"
FT                   /db_xref="GOA:D3S793"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:D3S793"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ADC68903.1"
FT                   /translation="MRVVHTICPGCSVGCGIDLIVKDSKVVGTYPYKRHPINEGKNCIN
FT                   GKKCYEIIYHEKRLKKPLIKKNGKFVEVTWDEALSFIVEKIESYNGDDITFIASGRCTN
FT                   EDNYALKKLADSLKAKIGHCICNSPKVNYAEISTSIDHIEDAKNIIIIGDVFSEHALIG
FT                   RKVIRAKDKGAKVTIFNTEEKEILKLNADEFVKVDDYSNIDLGNVDENTIVIINAPINV
FT                   DELAKTAKVLPIAKHCNTVGATLIGIPALNKDEYFELLKNSKFLYIMGENPALIDKDAL
FT                   KNAEFLVVQDIIRTETAELADVVLPSTCWAEKEGTFTNTDKRVQKINKAVNPPGEAMDD
FT                   WMIIKNLAEKLGIDLGFNSLEDIQKEVIKVIS"
FT   gene            complement(196029..197336)
FT                   /locus_tag="MFS40622_0208"
FT   CDS_pept        complement(196029..197336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0208"
FT                   /product="formylmethanofuran dehydrogenase subunit B"
FT                   /EC_number="1.2.99.5"
FT                   /note="KEGG: mvu:Metvu_0713 formylmethanofuran
FT                   dehydrogenase subunit B; TIGRFAM: formylmethanofuran
FT                   dehydrogenase subunit B; PFAM: molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68904"
FT                   /db_xref="GOA:D3S794"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR016457"
FT                   /db_xref="UniProtKB/TrEMBL:D3S794"
FT                   /inference="protein motif:TFAM:TIGR03129"
FT                   /protein_id="ADC68904.1"
FT                   /translation="MREIKNVVCPFCGTLCDDVVVIVDNEGHIIGTRNACRIGHAKFMH
FT                   FEGAVRWREPLMRENKKDDFKKVDIDTAIEETARILVEADLPLIYGFSATECHAHVYGI
FT                   ELAELVRGVVSNTAEVCHGPSVWALQDVGYPICTLGEVKNRADVIIYWGSNPMHAHPRH
FT                   MSRYSVFARGFFRERGREDRTLIVVDPRETDTAKLADVHLQVEPHKDYELISAMRAVLK
FT                   GFELQVDKVAGVPVDLIYEAVEICKNAQFGCLFFGMGVTQSGSKHRNIDNAICLVIDLN
FT                   AYTKFTLIPMRGHYNVNGFNQVCTWVTGFPLCVDFSRGYPRFNPGDTSVTDLLMRKEAD
FT                   AMLNIASDPGAHFPQKAVERMAEIPLICIDPHDTPTAELANIIIPPAIAGVEAEGTAYR
FT                   MDGIPIQLKKVIDPPEGVLPDREILKRIISKVKEFL"
FT   gene            complement(197361..199325)
FT                   /locus_tag="MFS40622_0209"
FT   CDS_pept        complement(197361..199325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0209"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; FAD dependent oxidoreductase; KEGG: mvu:Metvu_0714
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68905"
FT                   /db_xref="GOA:D3S795"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:D3S795"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68905.1"
FT                   /translation="MEEPRIGVYVCHCGVNIGGVVDCKAVAEFAKTLKNVVVARDYKYM
FT                   CADPGQEMIKKDIKEYNLNRVVVAACSPRLHEPTFRRCVAEAGLNPFLFEFANIREHCS
FT                   WVHMHEPEKATEKAKDLVRMAVAKARLLEPLEFIKVGVTKRALVIGGGVAGIQAALDLA
FT                   DMGFETILVEKSPSVGGRMAQLDKTFPTNDCSICILAPKMVDVAKHPNVKLYAYSEVVD
FT                   VQGYIGNFKVKIMKKPRYVDETKCTGCGQCAEVCPIEVPNEFDMGLGMRKAIYKPFPQA
FT                   VPSKYTIDKEHCIECGLCAKVCGPKAIDFNQKPEFIEVEVGTIICAIGYDPFDPTVREE
FT                   YGYGIYDNVITALELERMINASGPTGGKVIRLSDGKKPKRIAFIQCVGSRDAKVGNKYC
FT                   SNVCCMYAMKNSQLIKEKSPDTEIDIYYMDIRAFSKGYEEFYERSAKQYGINFIRGRPA
FT                   QILEDPKTKNLIIRAEDTLLGEIIEKEYDLVVLSVGMVPTKSADEIQRILGISRTPDQF
FT                   FMEAHPKLRPVDTATDGVYLAGACQGPKDIPASVAQGSAAAARAAIPLAKGEVEVEPIV
FT                   ATVNEEICGGCGVCVKQCPYGAPRLVEKDGRLVCEVIAALCKGCGTCAAGCPSGALEQN
FT                   HFKTIQLYKQIEGAFRDPA"
FT   gene            complement(199407..200576)
FT                   /locus_tag="MFS40622_0210"
FT   CDS_pept        complement(199407..200576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0210"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ1193 polyferredoxin (MvhB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68906"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S796"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68906.1"
FT                   /translation="MNGITIQRDACLVCYACQAECPTKAIDIDNFNVCNLCMECVKACP
FT                   TGALVEEEIEINGKKLKRVSYLAHKCEKCGNCAEACPIGIKKVDDDFPYSKGHCVLCQK
FT                   CIEVCPIEIISLPGVIDKPKREVKAPKEPIVVTEACVGCGICVPECPVSAITLEDGKAV
FT                   IDKSKCIYCSICAQTCPWNAIFVAGKIPKKRRKEVKKFEVNAEKCIYCLKCVEVCPGNM
FT                   IKVDKENMIVIPPKSCPACKLCVNTCPVNALELEVKLSSPHPITDEGLVIVEEDYEVLK
FT                   KCASVCPTEAIVVDEDKKEVRMCIVCGACTVACPTGALKLGKIEHNGKEYNRIEFSPYL
FT                   CDKCGKCVEVCPMKTLRLSRGKLPLKGYCVMCLLCLSVAEKEKKVLALK"
FT   gene            complement(200579..201997)
FT                   /locus_tag="MFS40622_0211"
FT   CDS_pept        complement(200579..201997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0211"
FT                   /product="nickel-dependent hydrogenase large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase large subunit;
FT                   KEGG: mvu:Metvu_0716 nickel-dependent hydrogenase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68907"
FT                   /db_xref="GOA:D3S797"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:D3S797"
FT                   /inference="protein motif:PFAM:PF00374"
FT                   /protein_id="ADC68907.1"
FT                   /translation="MVKLSVEPVTRVEGHGKITISFDENGNLDKVHFHVVEVRGFEKFL
FT                   EGRYIEDAPIYTPRICGICQVAHHLASAKAVDEVFGVKIPETAELLRNLMHQGATIHSH
FT                   ALHFYFLAAPDLMFPTTDDVLRRNILGIAKEHPEIVKEAIELRKIGQTIVKVVGGRAIH
FT                   PVTAVVGGQSKPLKEEERDELLKLSERAIELSEKSIEIGKKLLENLKENDLLDIGYFES
FT                   YHLGMVNDGVHELYDGTLRVINPKGKVEYEFEPSEYLNYIAEGVKPYSYLKFPYLKDKG
FT                   PEEGIYRVNTLSRLNVADKMATPLAQKYYEEFIKEFGKPCHYPMLFHYARLIELLSSAE
FT                   KVKELLENDKIVDTDIRAEPEDIVGEGVGCVEAPRGTLIHHFKTDEDGIITEANLIVAT
FT                   VQNNPAMDIGVRKVAEKYIKSPEDATPQVLNYMEMVIRAYDPCLSCATHIIGNEGHLTL
FT                   EIFQGNRLSKKIMG"
FT   gene            complement(202011..202907)
FT                   /locus_tag="MFS40622_0212"
FT   CDS_pept        complement(202011..202907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0212"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: mvu:Metvu_0717 NADH ubiquinone oxidoreductase 20 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68908"
FT                   /db_xref="GOA:D3S798"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="UniProtKB/TrEMBL:D3S798"
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /protein_id="ADC68908.1"
FT                   /translation="MVIATTWLCCCSGCHISLLDLHEELLNLLENVELIHCPVLMDVKE
FT                   IPDEIDIALIEGGIRNKENEEIAKEMRNKAKIVIAFGTCATFGGVPGLGNLYSKEEILE
FT                   KVYKTTLSTKNDEGIIPSEEVPPLTSRVKPLSEIIDVDYFIPGCPPNPEMIAKVLKALL
FT                   EGKKPELPKKNLCDECPRKKSTNGISIGKIKRKFEGKPDPERCLLEQGYLCLGIVTRAG
FT                   CGALCPRAGVPCSGCNGPTDAVIDQGAKMISALCSDFGIDKDKETDPTALPKSIKDKIG
FT                   SFYKFTLPSALIPGKLR"
FT   gene            complement(202917..203336)
FT                   /locus_tag="MFS40622_0213"
FT   CDS_pept        complement(202917..203336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0213"
FT                   /product="methyl-viologen-reducing hydrogenase delta
FT                   subunit"
FT                   /note="PFAM: methyl-viologen-reducing hydrogenase delta
FT                   subunit; KEGG: mvu:Metvu_0718 methyl-viologen-reducing
FT                   hydrogenase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68909"
FT                   /db_xref="GOA:D3S799"
FT                   /db_xref="InterPro:IPR003813"
FT                   /db_xref="UniProtKB/TrEMBL:D3S799"
FT                   /inference="protein motif:PFAM:PF02662"
FT                   /protein_id="ADC68909.1"
FT                   /translation="MEWEPKIIGFCCNWCTYGGADTAGVGRMQYPPSIRIIRVMCSGRI
FT                   EPSLILKAFREGADGVFVGGCHLGDCHYDSGNYKWQRRAIFLKQLLPEFGIEPERFRFE
FT                   WISASEGEKFQKTMIEFYNTIKALGPLKLNEKLKE"
FT   gene            203612..204754
FT                   /locus_tag="MFS40622_0214"
FT   CDS_pept        203612..204754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0214"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-component;
FT                   KEGG: mja:MJ0007 2-hydroxyglutaryl-CoA dehydratase, subunit
FT                   beta (HgdB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68910"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A0"
FT                   /inference="protein motif:PFAM:PF06050"
FT                   /protein_id="ADC68910.1"
FT                   /translation="MAIKFGDMMQLKAIEKLMQKFASRKEQLYKQKEEGKKVFGMFCAY
FT                   VPIEIILAADAIPVGLCGGKNDTIPIAEEDLPRNLCPLIKSSYGFKKAKTCPYFEASDI
FT                   VIGETTCEGKKKMFELMERLVPMHIMHLPHMKDDASLNIWINEVKKLKELVEKETGNKI
FT                   TEEKLKETVDKVNKVRELFYKLYELRKNKPTPIRGLDVLKLFQFAYLLDIDDTIEILED
FT                   LIKELEERVKKGEGYEGKRILITGCPMVAGNNKIVELIEEVGGVVVGEESCTGTRFFEN
FT                   YVEGYSIEDIAKRYFKIPCACRFKNDERIENIKRLVKELDVDGVVYYTLQYCHTFNIEG
FT                   AKVEEALKEEGIPVIRIETDYSESDREQLKTRLEAFIEMI"
FT   gene            204835..205482
FT                   /locus_tag="MFS40622_0215"
FT   CDS_pept        204835..205482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0215"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: mja:MJ0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68911"
FT                   /db_xref="GOA:D3S7A1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A1"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADC68911.1"
FT                   /translation="MIGICMRSKEGFMFNNKLIDWGLHYNPKIVKDNNIIGYHAPILDL
FT                   DKKESIPILKNIIKEIRGKSYLTIHLHNGKNREIDKEALIENLSIVNEFAQENSIKLCI
FT                   ENLRQGFSSNPNNIIEIADEINCFITFDIGHIPYDKRVEFLEICSDRIYNSHVYEIEKD
FT                   GRHLPPKNLNNLKPILDRLLDVKCEMFLIELMEIKEILATERMLRDYLEKYW"
FT   gene            205489..206319
FT                   /locus_tag="MFS40622_0216"
FT   CDS_pept        205489..206319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68912"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A2"
FT                   /inference="similar to AA sequence:KEGG:MJ0009"
FT                   /protein_id="ADC68912.1"
FT                   /translation="MIFNQNIPNFIDFKKSFKELTLSDETFKIIEERGIKLNEIAIGEF
FT                   SGRDSVAAIIKAMEEGIDFVLPVVAFTGTDYGNIAIFYKNWEITNRRIKEIDKDKVLLP
FT                   LHFMFEPKLWNALNGRWVVLLFKRYGYYSPCIGCHAYLRIIRIPLARHLGNKIISGERL
FT                   YHNGDFKIDQIEEVLNVYSKICRDFDVELILPIRYIKEGKKIKEIIGEEWEQGEKQFSC
FT                   VFSGNYRDKDGKVIFEKIGILKLLNEFIYPASIEILKEGYKGNFNYLNIVKRII"
FT   gene            206327..207613
FT                   /locus_tag="MFS40622_0217"
FT   CDS_pept        206327..207613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0217"
FT                   /product="phosphonopyruvate decarboxylase-related protein"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: mja:MJ0010 BcpC phosphonopyruvate
FT                   decarboxylase; TIGRFAM: phosphonopyruvate
FT                   decarboxylase-related protein; PFAM:
FT                   2,3-bisphosphoglycerate-independent phosphoglycerate
FT                   mutase; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68913"
FT                   /db_xref="GOA:D3S7A3"
FT                   /db_xref="InterPro:IPR004456"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR042253"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A3"
FT                   /inference="protein motif:TFAM:TIGR00306"
FT                   /protein_id="ADC68913.1"
FT                   /translation="MRAILILLDGLGDRGSEILDNKTPLQFANTPNLDRLAENGMCGLM
FT                   TTYKEGIPLGTEVAHFLLWGYSLEEFPGRGVIEALGEDVEIEENAVYLRASLGFVKKDE
FT                   NGFLVIDRRTKDISRDEIEKLISDFPTFVDGYEFELIYSYDVHFILKIKEKNGWISDKI
FT                   SDSDPFYKNRHVMKVQAVKELCKSEVEYNKAKDTARALNKYLLSVYKILQNHKINRKRR
FT                   KLEKMPANFLLTKWASRYKKVESFKERWGMNAVILAESSLFRGLAKFLGMDFIKIESFE
FT                   EGINLISELDYDFIHLHTKAPDEAAHTKNPLNKVRVIEKIDKLIGNLRLRDDDLLIITA
FT                   DHSTPSVGDLIHSGESVPILFYGKNVRTDNVREFNEIACSNGHLKIRGDELMPLILNYT
FT                   DRALLYGLRAGNRLRRYIPKDDDIELLEG"
FT   gene            207615..208178
FT                   /locus_tag="MFS40622_0218"
FT   CDS_pept        207615..208178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68914"
FT                   /db_xref="InterPro:IPR021778"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A4"
FT                   /inference="similar to AA sequence:KEGG:MJ0011"
FT                   /protein_id="ADC68914.1"
FT                   /translation="MIGKLKNLFKLKKETKKEKESLEGKGLIIFENTKDAMKAENILKG
FT                   KYKIKVVAPPAEIREGCDLAIEYELIDEFGIKRELEINGIKPLKFISLSDYSLKPLELI
FT                   KVKEVDGFILVRCGNMKITIDKEGNIVNISGGGCPDVPYLALKLKGKNIKEIKEEETPK
FT                   NLGFTLCAYTLHKAYEKAKELVNE"
FT   gene            208194..209024
FT                   /locus_tag="MFS40622_0219"
FT   CDS_pept        208194..209024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0219"
FT                   /product="protein of unknown function UPF0031"
FT                   /note="PFAM: protein of unknown function UPF0031; KEGG:
FT                   mfe:Mefer_0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68915"
FT                   /db_xref="GOA:D3S7A5"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A5"
FT                   /inference="protein motif:PFAM:PF01256"
FT                   /protein_id="ADC68915.1"
FT                   /translation="MIIAGTMPIKGLDLVIGKATLKGDKIIINNKEFPVSMGTGALIGA
FT                   VLKTLEYFGEKDVKIITAGDIGEGDGSLKIYNALKEIDDDLLIIHYIKPKISKIKEIDF
FT                   SPKIIADAGGMYAAKAANIGDKFYLFLPDVGELAFLADEKATHPAYVRGFISEIDDKEV
FT                   PKLIERAYKLKMPKYMVVKGETDYIVKEGEITNTIKEPKIEAMECIGGTGDTLTGIISS
FT                   LISVGFNAEEAMSLGCKINRKLGEVANAKPNTQVIEIISTIPKALEMTLKQIKQ"
FT   gene            209091..210119
FT                   /locus_tag="MFS40622_0220"
FT   CDS_pept        209091..210119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0220"
FT                   /product="coenzyme F420-dependent
FT                   N(5),N(10)-methenyltetrahydromethanopterin
FT                   reductase-related protein"
FT                   /note="TIGRFAM: coenzyme F420-dependent
FT                   N(5),N(10)-methenyltetrahydromethanopterin
FT                   reductase-related protein; PFAM: H2-forming
FT                   N5,N10-methylenetetrahydromethanopterin dehydrogenase;
FT                   KEGG: mja:MJ1338 H(2)-dependent
FT                   methylenetetrahydromethanopterin dehydrogenase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68916"
FT                   /db_xref="GOA:D3S7A6"
FT                   /db_xref="InterPro:IPR004889"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR010063"
FT                   /db_xref="InterPro:IPR024190"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038182"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A6"
FT                   /inference="protein motif:TFAM:TIGR01724"
FT                   /protein_id="ADC68916.1"
FT                   /translation="MKISVYGAGNQNLYINQLNLPEKFGGTPPYGGSRMAIEFAQAGHD
FT                   VILAEPNKDIMSDDLWKKVEEAGVKVVSDDIEAAKHGEIHVLFTPFGKATFRIAKTIIE
FT                   HVPENAVICNTCTVSPVVLYYSLEPILRTKRKDVGISSMHPAAVPGTPQHGHYVIGGKT
FT                   TDGKELANEEQIKKVVELAKSAGKEAYIVPADVSSVVADMGSLVTAVALSGVLDYYTVG
FT                   RKIINAPKKMIEQQVIMTLQTMASLVETSGVEGLVKALNPELLIRSASSMKLLDKQKDL
FT                   DAALEILKNLDETLKKEVEKAEIKPTTLVAAQSLVKEIKTLIGGAAAEGAIKRSARKLF
FT                   EH"
FT   gene            210173..210646
FT                   /locus_tag="MFS40622_0221"
FT   CDS_pept        210173..210646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0221"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: mja:MJ1339 protein
FT                   with ATP/GTP-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68917"
FT                   /db_xref="GOA:D3S7A7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR016433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A7"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADC68917.1"
FT                   /translation="MKKDEIKVVVVGSSDVGKTTLMENMIGKIGKVEYKGITTAIDYGS
FT                   LTINDKKIHFFGTPGQKRFEFMRELALKGTNLALVVLDASKGVTKEDEEIVKLLESKKI
FT                   PYGIFINKTDVGDIDTSEVYNFCNPKFVVKGCATKKDGLDKLINEIIVFCRSC"
FT   gene            210788..211174
FT                   /locus_tag="MFS40622_0222"
FT   CDS_pept        210788..211174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0222"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG: mja:MJ1340
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68918"
FT                   /db_xref="GOA:D3S7A8"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A8"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ADC68918.1"
FT                   /translation="MHNLHKPEHKGENMIDRVLLELNKTEGIKGSMVVGKDGLVIASQL
FT                   PGNVDAELVGAMASAAFGAAERTAAEIGMGALEQTMIEGEHGKTLMVDAGEGILVVLTD
FT                   AKVNLGLIRITMKRAAEKIKAMLS"
FT   gene            complement(211169..212107)
FT                   /locus_tag="MFS40622_0223"
FT   CDS_pept        complement(211169..212107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1341 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68919"
FT                   /db_xref="GOA:D3S7A9"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7A9"
FT                   /inference="similar to AA sequence:KEGG:MJ1341"
FT                   /protein_id="ADC68919.1"
FT                   /translation="MILRHRRPNIYGLMNKEGSKEEVEIIINDLLNRDYKITFLPSGSS
FT                   AVFLSMWIAKIYSNEILIPDMGGWQGFLKFPKVLNLKTNMVETNLGIIDVEKLDKYLGR
FT                   NSSFILTSLAGYLAPQPLKEIKKLCEEREVLFIEDISGKIGGDCGYGDIVVCSTGSPKI
FT                   LNCEYGGFLGISKETEEKLGNALNDIKILSKTYKTVNYFGLLKEELLNAKKVYKKYVMA
FT                   NKIIKNEIENAYFKEYEGISVFIECDNPKNASKKINSLIKLDNKKSITTICPNYERILK
FT                   NGIVFETKKIDVSELNKEVINEIIVTLQSIL"
FT   gene            complement(212369..213667)
FT                   /locus_tag="MFS40622_0224"
FT   CDS_pept        complement(212369..213667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0224"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: ammonium
FT                   transporter; KEGG: mvu:Metvu_1723 ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68920"
FT                   /db_xref="GOA:D3S7B0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B0"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADC68920.1"
FT                   /translation="MATADLINQTLVNATIASMHSVGINTDGITNIVQALVKIANASDV
FT                   YFLVVMGVLVFMMQWGFAMLEGGQVRKKNVNNVMMKNMVDWLIGCVSWLLIGGILCTSI
FT                   DPADFINWWSKIFSASPFLVDNGLELANWFFGLVFCATAATIVSGGVAERIKFGAYVLI
FT                   SLIITAFLYPLFVYLGPWGASIVPWHDYAGSLVVHGLGGFLALGAILALGPRIGRFVDG
FT                   RPVPILGHNIPMAVFGAFALAIGWYGFNVGSSLALGDISGLVCATTTLAMAGGGIGALI
FT                   ASRKDVLFTANGIVAGLVAICSGTDIVSPIGGLLIGLAAGLQVPIVYRLIERLGIDDVC
FT                   GVVPVHGTAGVVGAIGAGIFGMTALGGTGDVSLIDQIIASIFCFIYGTGLGFILTKIVG
FT                   ILLGGLRVSEEEEKMGLDLAEHKMPAYPEEAVI"
FT   gene            complement(213699..214037)
FT                   /locus_tag="MFS40622_0225"
FT   CDS_pept        complement(213699..214037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0225"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mja:MJ1344 nitrogen regulatory protein P-II (GlnB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68921"
FT                   /db_xref="GOA:D3S7B1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B1"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADC68921.1"
FT                   /translation="MRKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVER
FT                   YRGREYIVDLIPKVKIELVVREEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRT
FT                   KEEGRDVL"
FT   gene            214472..215398
FT                   /locus_tag="MFS40622_0226"
FT   CDS_pept        214472..215398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0226"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide repeat; KEGG: mja:MJ1345 O-linked GlnNAc
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68922"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B2"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADC68922.1"
FT                   /translation="MEMNNESILWDEYFNALENKNYEKALYLIDKILEIRKAPDIYVRK
FT                   AKILRTMGKNDEALEYFDKALKIKPKYILANFLKGALLVSLGRLEEAKEIFLKLYRLKK
FT                   SDLSVKYAIAFILKKLGEYDSALKILDEVLKKYPQSAIAWAEKGEILYKEGKLKKSLEC
FT                   FDNALKINPNDCQSLQYKGEILFKLGRYGEALKCFKKVFERNDKDIRALMYIIQILIYL
FT                   GRLSQALEYTKKALKLNPDDPLLYLYKGIILNKLGKYKDAIKYFDKVLEINPNFPEAWN
FT                   GKAVALEKLGKINEAIECYNRALDIYE"
FT   gene            215505..216851
FT                   /locus_tag="MFS40622_0227"
FT   CDS_pept        215505..216851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0227"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: mja:MJ1346 glutamine synthetase (GlnA);
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68923"
FT                   /db_xref="GOA:D3S7B3"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B3"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ADC68923.1"
FT                   /translation="MNVEQAIEYVKKNNVKFIRFQFVDILGFPKNVAYPVKSGEKGIEE
FT                   LREIFENGVWFDGSSITGFVGIEESDMLLKPDLSTLSVLPWRPEEKSVARVICDVYKDE
FT                   KTPFEGDPRSRLKAILEELKKEMNGEYFVGPEPEFFLLKRDPHDPHKWVPVDDGGYFDV
FT                   EPLDDAPDIRRDIVLALENLGFHVEASHHEVAPGQHEVDFKFDNALKTADSVITFKMTI
FT                   KNIAKKHGLRATFMPKPFFGMNGNGMHCHQSVWFNGEPSFYDPNGPYNGLSEICLSYIA
FT                   GILEHAKALVAITNPTVNSYKRLVPGYEAPVNIAWANKNRSAIIRVPAARGKATRIEFR
FT                   APDPTCNPYLAFACMLAAGLDGIKRKLTAPEPVERNIFRMSEEEKKQLGIESVPANLAA
FT                   ALDELECDEVLQKALGKHIYENYMEIKRAEWDDFRTAVTDWETGKYLIY"
FT   gene            216954..217652
FT                   /locus_tag="MFS40622_0228"
FT   CDS_pept        216954..217652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0228"
FT                   /product="exsB protein"
FT                   /note="TIGRFAM: exsB protein; PFAM: Queuosine
FT                   synthesis-like; KEGG: mja:MJ1347 ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68924"
FT                   /db_xref="GOA:D3S7B4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B4"
FT                   /inference="protein motif:TFAM:TIGR00364"
FT                   /protein_id="ADC68924.1"
FT                   /translation="MKAITVLSGGLDSTVATLIAKDLGYEVTAITFNYGQRAAKREINS
FT                   AKKICEILGIEHIVVDLPFVKQFGKSSLVTEKEIPTLKMEELDSEKAFETMKAVWVPAR
FT                   NVIMFGIASGFAEALDAEKIFIGINKEEGVTFPDNTIEFVEAFNKVLEYGTLNKVKIEA
FT                   PLYDKTKEEIVKLGAELEKKLGVEVLKYSYSCYRDNGEDFLHCGKCESCMRRKRAFLMA
FT                   GVEDKTKYIE"
FT   gene            217698..218675
FT                   /locus_tag="MFS40622_0229"
FT   CDS_pept        217698..218675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0229"
FT                   /product="Tetratricopeptide TPR_3"
FT                   /note="PFAM: Tetratricopeptide TPR_3; KEGG: mja:MJ1348
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68925"
FT                   /db_xref="InterPro:IPR011716"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B5"
FT                   /inference="protein motif:PFAM:PF07720"
FT                   /protein_id="ADC68925.1"
FT                   /translation="MTNNWLNSLYKYWLKGCEFYNKGDYDKAIEYFNLVNKIFKENTIE
FT                   YDYYELREDAYKEILNNNIEEGIKKFVWFVEGILADRDYYDLSGELLTIASIFAKIGRL
FT                   DIVRCFLNRGAEWIYNDDIKNANPEEVLKSILTDAFSDDEREEILNKEPNLKKPFEDIT
FT                   YYFNLDFFDFMMSFFIGAGNWKRFLKVYEEFKNKIKNCQISEETANKIIERFDEPRSDL
FT                   LAIAHLLKGNYEKCLYCIELFKKSFNLDEFDEIYKEEINFIENIANNLKNGVIKKEEWL
FT                   NRLNEIYADILNQPLPKTYKEAYHNHFLDEILMYCILKEFIEKL"
FT   gene            complement(218676..219749)
FT                   /locus_tag="MFS40622_0230"
FT   CDS_pept        complement(218676..219749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0230"
FT                   /product="Coenzyme F420 hydrogenase"
FT                   /EC_number="1.12.98.1"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: mja:MJ1349 coenzyme
FT                   F420-reducing hydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68926"
FT                   /db_xref="GOA:D3S7B6"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B6"
FT                   /inference="protein motif:PRIAM:1.12.98.1"
FT                   /protein_id="ADC68926.1"
FT                   /translation="MKSYKNLKEEVWDTNRCSGCGACVAVCPVNNLYFREESPVKFECD
FT                   ECSCIIVPADIVEHPISAEFCKTVVYDVPCGACYDACPRIKKSAVPKPKGLGNILKAVR
FT                   AKASIEIKNAQNGGVVTAILANAFDEGLIDGAIVMIDDKWTLEPESYLALSKEDVLKSA
FT                   GSKYLWKGPILKALKTAVMEKKLRKLAVVGTPCVINAIYQILSSDNDLLKPFREAIRLK
FT                   IALFCFETYDYSKMIKKLSEDGIEPWEVKKMDIEASKLKITLINGNTVEYKLKDVEFAM
FT                   RNGCKVCGDFTGLTSDISVGNVGTEKGYSTVLIRNKWGEGFFKRAVYNGYITYDENVDL
FT                   DAVKKLAELKRKRVKKD"
FT   gene            complement(219831..220607)
FT                   /locus_tag="MFS40622_0231"
FT   CDS_pept        complement(219831..220607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0231"
FT                   /product="glutamate synthase alpha subunit domain protein"
FT                   /note="PFAM: glutamate synthase alpha subunit domain
FT                   protein; KEGG: mja:MJ1350 formylmethanofuran dehydrogenase,
FT                   subunt C (tungsten)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68927"
FT                   /db_xref="GOA:D3S7B7"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B7"
FT                   /inference="protein motif:PFAM:PF01493"
FT                   /protein_id="ADC68927.1"
FT                   /translation="MEEVVIDAKDMHYKELNEKIHQILKENPDVKKIILKNVLGQRFIG
FT                   NGLQKKDLTIEIYGIPGGDLGMFMSGPTIIVHGNAEFAPGNTMDDGTIVIYGSSGDVTA
FT                   HSMRGGKVFVRGDVGYRSGIHMKAYKDKVPVLVIGGRAKDFLGEYMAGGIIIVLNIDEE
FT                   GNDLGKVKGRMIGTGIHGGAIYIRGEIDKDQLGVAADIKEFTEEDLEKIKPHIEEFCKW
FT                   FNLPEDVKNKLLNSKWTKIAPISKRPFGKLYTPDLM"
FT   gene            complement(220633..222165)
FT                   /locus_tag="MFS40622_0232"
FT   CDS_pept        complement(220633..222165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0232"
FT                   /product="Glutamate synthase (NADPH)"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein; KEGG:
FT                   mja:MJ1351 glutamate synthase (GltB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68928"
FT                   /db_xref="GOA:D3S7B8"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B8"
FT                   /inference="protein motif:PRIAM:1.4.1.13"
FT                   /protein_id="ADC68928.1"
FT                   /translation="MIPSYVPPKYKVEVDPNRCMLCERCTVECSWGVHRREGDRIISYS
FT                   NRCGACHRCVVMCPRDAITIKENAISWRTHPLWDIDARVDIYNQAKTGCILLSGMGNAK
FT                   EHPIYFDKIVLDACQVTNPSIDPLREPMELRTYIGKKPKQLEFEFVEEEIDGKKIKKAK
FT                   LKTKIAPNLKLDTPIMIAHMSYGALSLNAHLSFAKAVKECGTFMGTGEGGLPKALYPYA
FT                   DHIITQVASGRFGVNEEYLMKGAAIEIKIGQGAKPGIGGHLPGEKVTAEISATRMIPEG
FT                   SDAISPAPHHDIYSIEDLAQLVRSLKEATRWKKPVFVKIAAVHNAPAIAVGIATSDADA
FT                   VVIDGYKGGTGAAPKVFRDHVGIPIEMAIAAVDQRLREEGLRNEISIIASGGIRCAADV
FT                   FKAIALGADAVYIGTAAMVALGCRVCGRCYTGLCAWGIATQRPELVKRLDPEVGARRVA
FT                   NLIKAWTHEIKELLGAAGINSIESLRGNRDRLRGVGLNEVELRVLGIKAAGE"
FT   gene            complement(222195..223283)
FT                   /locus_tag="MFS40622_0233"
FT   CDS_pept        complement(222195..223283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0233"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   mja:MJ1351.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68929"
FT                   /db_xref="GOA:D3S7B9"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7B9"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADC68929.1"
FT                   /translation="MCGIIGFMSRKKRMIKGDKIALALDSLKERGNGKGSGYVGYGIYP
FT                   TKYKDCYAFHILIDNTPKFEKIKVEVENVLEQYGTIVKDEEIPTEDGIIEKTQIPWRYF
FT                   YEVDEKFADREEDVVVDIVMEINDKIDGAFVISSGKDLGVFKAVGWPNEVAEFYRIDKY
FT                   EGYMWLAHARYPTNTRAWWGGAHPFNLLNWSVVHNGEITSYGTNKRFVEMFGYKCRLLT
FT                   DTEVVAYILDLLMRKHKIPVEYALSALAPRFWDEIDKMPEEERELHTAIRLTYGGAMLN
FT                   GPFAIAVGTPQGLIFMNGDIEKETTMFGLTDRIKLRPLIAAEKDDMIFVSSEESAIRRI
FT                   CPDLDRVWMPDAGVPVIARPWK"
FT   gene            complement(223620..224381)
FT                   /locus_tag="MFS40622_0234"
FT   CDS_pept        complement(223620..224381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0234"
FT                   /product="NAD+ synthetase"
FT                   /EC_number="6.3.1.5"
FT                   /note="KEGG: mja:MJ1352 NH(3)-dependent NAD+ synthetase
FT                   (NadE); TIGRFAM: NAD+ synthetase; PFAM: NAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68930"
FT                   /db_xref="GOA:D3S7C0"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C0"
FT                   /inference="protein motif:TFAM:TIGR00552"
FT                   /protein_id="ADC68930.1"
FT                   /translation="MEEIVNKITKFIKENVEEAKANGVVVGLSGGIDSSVTAYLCVKAL
FT                   GKDKVLGLIMPEKHTNPRDIEHAKMVAENLGIKYIISDITDILKAFGAGGYVPTKEFDK
FT                   MADGNLKARIRMCLLYYFANKYNLLVAGTSNKSEIYVGYGTKHGDIACDIRPIGNLFKT
FT                   EVRELAKYLGVPKEIIEKPPSAGLWEGQTDEGELGIKYETLDEILKLYEKGKTPEEIHK
FT                   ETNIPLETIEYVFDLIKKNEHKRTLPPTPEI"
FT   gene            complement(224518..225657)
FT                   /locus_tag="MFS40622_0235"
FT   CDS_pept        complement(224518..225657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0235"
FT                   /product="coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein"
FT                   /note="PFAM: coenzyme F420 hydrogenase/dehydrogenase beta
FT                   subunit domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: mja:MJ0005 formate
FT                   dehydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68931"
FT                   /db_xref="GOA:D3S7C1"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C1"
FT                   /inference="protein motif:PFAM:PF04422"
FT                   /protein_id="ADC68931.1"
FT                   /translation="MKYALIQSTDSKILKKAECGGAVTALFKYLLDKKLVDGVLALKRG
FT                   EDVYDGIPVFITNSDELIETAGSLHCAPVNFGKLIAKYLADKKIAVPTKPCDAMAIREL
FT                   AKLNQINLDNVYMIGLNCGGTISPITAMKMIELFYEVNPLDVVKEEIDKGKFIIELKSG
FT                   EHKAIKIDELEEKGFGRRKNCQRCEVMVPRMADLACGNWGAEKGWTFVEICSEKGRKLV
FT                   EDAEKEGYIKIKQPSEKAIQIREKIENIMIKLAKKFQKKHLEAEYPSLEEWEKYWNRCI
FT                   KCYGCRDNCPLCFCVECRLEKDYIDEKGKIPPNPLIFQGVRLSHIGQSCINCGQCEDAC
FT                   PMDIPLAYIFHRMQLKVRDTFGYIPGIDNRMPPLFTGEE"
FT   gene            complement(225686..227761)
FT                   /locus_tag="MFS40622_0236"
FT   CDS_pept        complement(225686..227761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:227363..227365,aa:Sec)
FT                   /locus_tag="MFS40622_0236"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="Contains selenocysteine; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit; PFAM: molybdopterin
FT                   oxidoreductase; molybdopterin oxidoreductase Fe4S4 region;
FT                   molydopterin dinucleotide-binding region; KEGG:
FT                   mfe:Mefer_0653 formate dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68932"
FT                   /db_xref="GOA:D3S7C2"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C2"
FT                   /inference="protein motif:TFAM:TIGR01591"
FT                   /protein_id="ADC68932.1"
FT                   /translation="MSEFKIVHTICPYCGTGCGINLVVKDGKVVGVYPFKRHPVNEGKL
FT                   CIKGNYCYEFIHREDRLKKPLIKKNGEFVEATWDEALSLIAERLKEYAPEEIGFFSSAR
FT                   CTNEDNYILQKFARVVIKTNNIDHCARLUHSATVIGLGEAFGSGAMTNSIEDIEEADCI
FT                   LIIGSNTFEQHPLIARRVIRAKEKGAKIIVIDPRKTMTAKQADLHLQIVPGTNVALINA
FT                   MMHVIIKEGLIDEEFIKKRTKGFEELKKVVEKYTAEYVSKICKVDKELIVEAARMYGSA
FT                   DRASILYCMGVTQFTHGVDSVKSCCNLALITGNIGKRGTGVNPLRGQNNVQGACDMGAL
FT                   PDVFPGYQKVNVAYEKFEEAWRVELNHEIGLSIPEMIEKAGKDIKCLYIMGENPMVSDP
FT                   DIRHVEHALKSLDFLVVQDIFLTETAQLADVVLPAACWAEKDGTFTNTERRVQLIRKAV
FT                   NPPGEALEDWLIIKKLAEKIEYGDKFNYNSPRDIFEEIRKITPQYTGISYDRLGVDGIQ
FT                   WPCPDGNHPGTPILHVKRFATPDGLGKITPIEYEEPAELPDKEYPFILTTGRIIFHYHT
FT                   GTMTRRCKHIIKEINEGFVEINPEDAKKLGIRNGEFVRVASRRGEVVVKARITEDIKEG
FT                   VVFMPFHFAETAANMLTNTALDPYCKIPEFKVCAVKIEKVKIGEISSAKHPIKHTA"
FT   gene            complement(227777..228181)
FT                   /locus_tag="MFS40622_0237"
FT   CDS_pept        complement(227777..228181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0237"
FT                   /product="FlpE-related protein"
FT                   /note="KEGG: msi:Msm_1464 FlpE-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68933"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C3"
FT                   /inference="similar to AA sequence:KEGG:Msm_1464"
FT                   /protein_id="ADC68933.1"
FT                   /translation="MAKKDPKASQLRAVIIMNIKITIERLKFERPKENPKNMKLELNLS
FT                   WSIEYKRIDDNSLNYTCKLKTDNEFPISFTVEGTIEFENGITTISDDISQCILDNMAQI
FT                   LINMVNLTRDRDIDLKDFPQVTVSAQKIAS"
FT   gene            complement(228385..228921)
FT                   /locus_tag="MFS40622_0238"
FT   CDS_pept        complement(228385..228921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0651 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68934"
FT                   /db_xref="GOA:D3S7C4"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C4"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0651"
FT                   /protein_id="ADC68934.1"
FT                   /translation="MVKMSKIKELVKFARSMPSATISLIFWGGMVVFATLISKNFWIAV
FT                   LSIPFLLGLVYIPYKISIINKNLSKTLIPIYQKEAPLLKIGEITKDRLNERVKIMGTIE
FT                   KIIYGISPKPTILVKDDTGSIYVNLIVPPPDNVKIGDRVEVYGVVTKHYKFFGFIGIPK
FT                   LWKPKIYGIGVKKLN"
FT   sig_peptide     complement(228817..228921)
FT                   /locus_tag="MFS40622_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.702) with cleavage site probability 0.689 at
FT                   residue 35"
FT   gene            complement(228905..229720)
FT                   /locus_tag="MFS40622_0239"
FT   CDS_pept        complement(228905..229720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0239"
FT                   /product="formate/nitrite transporter"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   mfe:Mefer_0650 formate/nitrite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68935"
FT                   /db_xref="GOA:D3S7C5"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C5"
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /protein_id="ADC68935.1"
FT                   /translation="MFNPPAKSVEMAANAGEYKANLPWNQLFVRGIMGGAYIAMGAGLC
FT                   TVCSTGVAQTLGVGVAKLIGGAVFPVGLILIILTGMELVTGDMMLLPLAILKRKATFAQ
FT                   LLKVWFWVYIGNLVGSLIYALIMAYGPLRTFKNGEWVVNSFGQTAIKIAEVKVLPYISG
FT                   GAMGWLSCLIKGIGCNWLVNLAVMGSFAASSVIGKFFMIWFPIMTFVASGFEHCVANMY
FT                   FIPAGMLLGAKVTAVDWWLWNELPATIGNIIGAVIFVAMVYWYAYGKDV"
FT   gene            complement(229957..230214)
FT                   /locus_tag="MFS40622_0240"
FT   CDS_pept        complement(229957..230214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68936"
FT                   /db_xref="InterPro:IPR021603"
FT                   /db_xref="InterPro:IPR038549"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C6"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0649"
FT                   /protein_id="ADC68936.1"
FT                   /translation="MSKEIIITTTHEIPGIEICLKDVIFEAIEGTNVEELIAKMKEKVK
FT                   AKNLDGILGFRIVSVVEEGKIKLIGYGSGFEIIKSQWAVY"
FT   gene            complement(230291..232186)
FT                   /locus_tag="MFS40622_0241"
FT   CDS_pept        complement(230291..232186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0241"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   mfe:Mefer_0648 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68937"
FT                   /db_xref="GOA:D3S7C7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC68937.1"
FT                   /translation="MVKKLKLRGKLLILSIIISIIPVAILGAVSVENTIQTMDEEAQKK
FT                   INTDLQIAEYILNQRLNFLSKSLELVSDNIALSIKSKNLSDLKTIALNLKNTTNSDFVI
FT                   IFDKDGKVLASSNNNKTGYIDLKHIIKKVLSGGEINSIEIIDETTLKNENLFNKTVIPI
FT                   TITEHSIEVNKTIETRALGLVSAKPILDENGNVIGGILVCDVLNKDYKLVDEISKHSGD
FT                   VVTIFLDGIRVSTNVKNENGTRAVGTLVSKEVYNKVVRQGEIYQGRAFVVDKWYLTSYK
FT                   PIYNSDGEIIGMLFVGTPEQPFIELQQNIKSHTILIGFLSILLALIVSFVLSETIISPI
FT                   KKLKSAAEKISSGDYNIYVNVNSNDEIGELAKAFNKMAEDVRKSHEALKKHAKELEESY
FT                   EKLKEVDRLKSEIISIVSHELRTPLTSIKGYVELVLDGLMGELNENQRRCLEIAKNNID
FT                   RLKRLIDNMLDLSKIESGAIKFDIKDIKVKDMINEVLNSLQPLTKEKNIEVKCDIEDNL
FT                   TAKVDKDRIIQVLINLIENAIKFSPVKGVIEIHAFRDKNYAHIIIKDYGPGIPKKDLER
FT                   IFDKFYQVNFPKIKRDGAGLGLAICKSIIEAHGGKIWVESELGKGSAFHILLPME"
FT   gene            complement(232192..232557)
FT                   /locus_tag="MFS40622_0242"
FT   CDS_pept        complement(232192..232557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0242"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: mfe:Mefer_0647 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68938"
FT                   /db_xref="GOA:D3S7C8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC68938.1"
FT                   /translation="MAKILVVEDEEDILNLIKIILDMEGHSTILTKDGEEGIKALEDND
FT                   DISLIILDIKMPNMNGWEFLEIIKNNDKWKDIPVIVLTAYTQVSDIEKAKEMGVESYIA
FT                   KPFSREELIREINYIIK"
FT   gene            232671..234083
FT                   /locus_tag="MFS40622_0243"
FT   CDS_pept        232671..234083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0243"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745; FIST C
FT                   domain; KEGG: mfe:Mefer_0646 domain of unknown function
FT                   DUF1745"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68939"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7C9"
FT                   /inference="protein motif:PFAM:PF08495"
FT                   /protein_id="ADC68939.1"
FT                   /translation="MRFIEFGWGYSNDDNPLKSGAYAVTEALKNIENTKYINLAFLFSS
FT                   PDYEPEEVLNGVKLILGNNIPIVGGSARYSIINDELHSGVSVGIISSKYIDIGIGVGLG
FT                   VSINPEECGKKAIETAIKDLGMAPKLVMVFMDCCNFEEEVLDGIIKKLGMSVPIFGGVT
FT                   SDNFEFNRAYQYCNDVYVDSVVCVAFGGDIVPKITVGRFSENELKSKRMKGRVTEANKR
FT                   YVSKINNINALDYYISVFNYEKLDEIAKDREFYFTHQFGILDFNNKKIHIKGPVAIKNN
FT                   VLVFGSNIREGVELIDYEIDKDKIKHIFEEISKNILETPPFYPHAFSFLALPVYLAEIG
FT                   KDKVNEWLKILGDLYPLFGFSSYGEIVFSEYNNYTIALCSILPDLANICIKEGISMITK
FT                   YPATKETIKKIYEMGGSVKIEELAENLGIHRRTAYDRVEPLLKYGFAKKDGAKVELTEL
FT                   GKLLLKKFILKF"
FT   gene            234614..235045
FT                   /locus_tag="MFS40622_0244"
FT   CDS_pept        234614..235045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68940"
FT                   /db_xref="GOA:D3S7D0"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D0"
FT                   /inference="similar to AA sequence:KEGG:MJ1354"
FT                   /protein_id="ADC68940.1"
FT                   /translation="MDFALVLGILSAMGFLVFLGIGGHILLGYEIIRKISKAYEKGEDV
FT                   KELESKIINKSHLTNTLEKITTFTLTSIFLFEMEKYRYVIDVGYMVLFLVTLTLYLVPN
FT                   LSLLVWATFFGVTIFMIMLWIWRFMALKEFNKAFIEELK"
FT   gene            235387..237102
FT                   /locus_tag="MFS40622_0245"
FT   CDS_pept        235387..237102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0245"
FT                   /product="protein of unknown function DUF505"
FT                   /note="PFAM: protein of unknown function DUF505; KEGG:
FT                   mja:MJ1355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68941"
FT                   /db_xref="InterPro:IPR007548"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D1"
FT                   /inference="protein motif:PFAM:PF04458"
FT                   /protein_id="ADC68941.1"
FT                   /translation="MFLKKRHLEILKKMKETEMQNEIEKALPEEFKTRALELFILGFAE
FT                   LKENKIIFTEAGKRLMEIVDKIDLEKIPDVFVDSEIIKIMELLEETGNVPEEWMTILKE
FT                   RFLADENGLTDIGKEILKIYRETHPVVYLTPEILAFIKDMPKIGVYDELITYKNTKKYG
FT                   DNIINALQAMRLLLISPKTESGKAFATTKALNYVLKVASLVPNLSRALILRKEDFEILE
FT                   KGETTEEMTESGFYAEGKVTELGQAMMDTYKEMGKVEEKTLPIYILDDEIKVLKAIEEI
FT                   KEKYETNPEILPTYDEIKKRTNIDDLGAVLHTLESKELIKREVVKNKDTYWMTEFGEKV
FT                   KEFGEVSTDGMKAITYPESGDVPIAEWVVKGKEEGTVKRGMTEKGKYLIKLSKTIKRKP
FT                   YLTKYDISTLIKTPRKKYIHRDELVKLIQSHVGGDEKEIIKALGEAESKGFIKELQNKM
FT                   IKLTDLGEDVKTAIEMAKIQELLATKFAVTPTTFNILKTIYDHKEEFDKVWKEKSEGKE
FT                   HKENEIVLLAKYLSLTPEEIKKNLVILKNVGFIGKKGLTDAGVKLVEAYITFYK"
FT   gene            237253..237822
FT                   /locus_tag="MFS40622_0246"
FT   CDS_pept        237253..237822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68942"
FT                   /db_xref="GOA:D3S7D2"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D2"
FT                   /inference="similar to AA sequence:KEGG:MJ1356"
FT                   /protein_id="ADC68942.1"
FT                   /translation="MNVGFDEIYSEVIENMRHFASEEKDFSKLTQYKDILSKTIDDVVK
FT                   EVFDDIFSYEKTKTLFDESKRNELEDEFKKWIKSFFEISNSDDLNEFYKEIVRRGIKYV
FT                   EKDFLPEYLTAIIIKIEDRLKNKLKEELKEDSQEIIDILDDLLKRVILLNVAAYMNFES
FT                   KVLDYIGINQNLKKNTVKLGIKKMGL"
FT   gene            complement(237817..238845)
FT                   /locus_tag="MFS40622_0247"
FT   CDS_pept        complement(237817..238845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0247"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein ; TrkA-C domain protein; KEGG: mja:MJ1357 potassium
FT                   channel protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68943"
FT                   /db_xref="GOA:D3S7D3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D3"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADC68943.1"
FT                   /translation="METSKKLVIVAVLSITLILTYAYLISIIEGVDYFTALYFSVVTIT
FT                   TTGYGDFTPKTFLGRALTVVYLCIGVGIVMYLFSLIAEFIVEGKFEEFVRLKKMKNKIK
FT                   NLKDHYIICGYGRLGRVVGEKFIEEDIPFIAIDINEEVLKEEYEKYPDKFLYIVGDAKK
FT                   DEVLKKAKIDKAKGLIATLPSDADNVFLTLTARELNPNILITAKADEKDAIKKLKIAGA
FT                   DRVVSPYLIGGLRMAEVSVRPGILDFITTFIKIAKDEYKEDVDLKKFVVEKGSELEYKS
FT                   LKDANIRGRTGATILGIKRGNEFYINPSPELIIKAGDIIYAFGTEENLKYLENLIKKKK
FT                   KL"
FT   gene            complement(238909..241335)
FT                   /locus_tag="MFS40622_0248"
FT   CDS_pept        complement(238909..241335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0248"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: mja:MJ1401 putative ATP
FT                   dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68944"
FT                   /db_xref="GOA:D3S7D4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D4"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADC68944.1"
FT                   /translation="MLIVRKPKKKKDEIEIVKVDGKIEDGIEIKNNQKIFANYKKVGDK
FT                   YKLYRCRVGDKLIQPSKVLELLKSDKIYILKENEGDIEEILKSYNLKFEYIELCPFCLL
FT                   KNIYKRLTRNNRCKYGNLEICISCGVNEIKEEVKISEEFIEKFLRRFKDVDKVLSLLRI
FT                   KNPLDKPELTRYDIITGSEEDKIENYKIDELDIPKELKEIIKSRGINELLPVQTLSVKA
FT                   GLLKGEDLLIVSATSSGKTLIGELAGIKNLVETGKKFLFLVPLVALANQKYLEFKERYE
FT                   KLGFKVSLRVGLGRIGKKVDVETSLDADIIVGTYEGIDYLIRTKRLKDIGTVVIDEIHS
FT                   LNLEERGARLDGLIGRLRFLFKDTQKIYLSATIGNPKELAKQLGAKLVLYNGRPVPLER
FT                   HIIFCKNDFAKLNIIKEIVKREWQNISKFGYRGQCLIFTYSRKRAEHLAKSLKAKGIKA
FT                   EFYHGGMEYIRRRKVEDDFANQKIQCIVTTAALSAGVDFPASTVILESLAMGGDWLNPA
FT                   EFQQMCGRAGRKGMHEIGKVYLLVEIGKKYHAKMENTEDEIAFKLLNAVPEDVRVEYSE
FT                   DEEEEQILATISAGINKRQDIDRVPYIGRAFSLNKILGNLENYGMIKPQNEIKLTNYGS
FT                   AVAISFLYPKIAEKIKEGIIENKELIKLITEIMPFENVYLSNNLKIKLSKILNINVPSR
FT                   FFDALEVIKEGMEKIRDKKLKEDLTLIIMEFEGVEVEEKILEMIINLRISGKTPGQISK
FT                   TLYEEFKIQTYSGDIYYYLEQLLNLLDAIERIARIFNKRYAEKVKELKEKIENPK"
FT   gene            241437..241628
FT                   /locus_tag="MFS40622_0249"
FT   CDS_pept        241437..241628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0249"
FT                   /product="Protein of unknown function DUF361"
FT                   /note="PFAM: Protein of unknown function DUF361; KEGG:
FT                   mja:MJ1400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68945"
FT                   /db_xref="GOA:D3S7D5"
FT                   /db_xref="InterPro:IPR007166"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D5"
FT                   /inference="protein motif:PFAM:PF04021"
FT                   /protein_id="ADC68945.1"
FT                   /translation="MISIKSNKGQISLEFSLLVMVVVLSAIIVSYYLIKTAIETRDANM
FT                   EVINESYTTAKNALSNVT"
FT   gene            241668..242261
FT                   /locus_tag="MFS40622_0250"
FT   CDS_pept        241668..242261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68946"
FT                   /db_xref="GOA:D3S7D6"
FT                   /db_xref="InterPro:IPR022970"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D6"
FT                   /inference="similar to AA sequence:KEGG:MJ1399"
FT                   /protein_id="ADC68946.1"
FT                   /translation="MLLIGITGMPGAGKSSIYEVAKKYNLPVVSMGDVVRYETKKRGFE
FT                   LTPENVGNTAIKLREEFGNEAIAVACLKYIEENLKDKEIVIVEGIRSLYEVNYFRKHKP
FT                   LVLIAIHSSPLTRFERLKKRGREDDSASWEIFVERDLRELGFSIGHAIALADFVVVNEK
FT                   SFEDCLNQLDNILKEILSNLEKYKKYNFIYETLR"
FT   gene            complement(242239..243393)
FT                   /locus_tag="MFS40622_0251"
FT   CDS_pept        complement(242239..243393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0251"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: mja:MJ1398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68947"
FT                   /db_xref="GOA:D3S7D7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D7"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADC68947.1"
FT                   /translation="MKKATLLLITLILFYFVHVYGINVSLENISQYLYTDTVYLSYENG
FT                   IPCFYVGEKKEFVIIPPYIKVDNDIAPLIKKLGFKIDNETYNLIITKKDVNTDKMAIIF
FT                   APINGSKRIYGNETVIWTNDPLKLKQSEVEALYTLPEKGKVIARYKNGKPAAIKINNKI
FT                   YVGFKPNEEVLANLIYVHIVKRTSNPLPYILFTVILTLVSLMLTFQETLKKKFLDLISA
FT                   LASVKVFILSRVNILDEEKVLLNDTRREIYNYILDNPGCHLRELSKNLNKSVSTLTWHL
FT                   RILEKANLVKSKKLGNKLIYYPANMDVRDLPLLYLKNETQKSIFEYLSKNSAHLRKIAK
FT                   DLNLNVETVRYNLKKLENLGIVKAREEGNRVVYYINESILKFHK"
FT   gene            complement(243401..243649)
FT                   /locus_tag="MFS40622_0252"
FT   CDS_pept        complement(243401..243649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68948"
FT                   /db_xref="GOA:D3S7D8"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D8"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0422"
FT                   /protein_id="ADC68948.1"
FT                   /translation="MVEEDKEILIKLKKIREIRRKRILIGSFLVSTSIIMSEISVFVFT
FT                   GVFEVDISVGLLLLFISLIFLFIGLYLIIHLPPIAID"
FT   gene            complement(243655..245163)
FT                   /locus_tag="MFS40622_0253"
FT   CDS_pept        complement(243655..245163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68949"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7D9"
FT                   /inference="similar to AA sequence:KEGG:MJ1397"
FT                   /protein_id="ADC68949.1"
FT                   /translation="MRSVYLIFLIIIFFAFFSLTYGNIYEYRGVVFYPNGSQTVDISKL
FT                   YVDYNNTNSFSIYIFYKNATIYLPYPKNITVDLPPQEFKIAITISASRISKSDWEVYYK
FT                   INNNYPYNILFNVSFPNGFSIKNTSILVPANSYKIITLSKTLNSDTLYFGESNVSFDVP
FT                   ATVKIRYSLPIPFSIIKSNRILDNGSIEWTATYIIKNDKTVPLNVNVSYWAVINNKKIN
FT                   FGNYSYTLSPNENITQSFKLISDDVPIFYLRFYAWRDIYENIKIKPALKVGNSYIIGIG
FT                   KVDGLSFNIPYVEKNEEEKENKKGEKKEKWNEKTGKEKSSKITEQIQKQEEEREETPQS
FT                   KNKKESFKNEGYEQQEERKYPVIIKEKDEEKIKKVVAATVATITTTSLTLMLVPPIFRR
FT                   RPDIADKGVFTIEELKMLNSTVYIPEGCKLGKILPGGITIIKLTDAEKELARDLHEIYD
FT                   IPLNSAKAIVLGVRYGGRVFLSNKKAWRLAIKIGLEAYLFKEKR"
FT   gene            complement(245236..253941)
FT                   /locus_tag="MFS40622_0254"
FT   CDS_pept        complement(245236..253941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0254"
FT                   /product="legume lectin beta domain protein"
FT                   /note="PFAM: legume lectin beta domain; KEGG: mja:MJ1396
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68950"
FT                   /db_xref="GOA:D3S7E0"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E0"
FT                   /inference="protein motif:PFAM:PF00139"
FT                   /protein_id="ADC68950.1"
FT                   /translation="MIFNLKNISIFVLAILLVSNVSLGLNISTINESLDSNNMDVAFNK
FT                   SLPSSIDALNYNLTKNESVGKDNNVTINITNVTNEEENECYLNVIVNGYKVIVETNGKV
FT                   FGFANGTPLKFVKIDSSKYVISPVILNTPMEIYTKFDGNKILHKTVILNYTKPEKENEE
FT                   TKKKELHYLNVSFDNFKLIVKTNGKPYAKYLDVNIKVKTKKIKKYEYLVYPLILNKTII
FT                   IYAKFKNETLNKTVFLNYTCENENLTNKTILTRDVYFPSEKIVVKTNFKPNTAYIITPD
FT                   NKIIRLKVHKKGKFYVLSTKLKKNVILGNYSVVIDGIKKTFAVDYYKINAKLINNRFIV
FT                   GNVSYYVKEPKFLTLIIYPNKKEIDVPLINGTFDIPLDYLVNKLNISKPEKIKKIVLIC
FT                   GNAEEKIKIKLKNKEKLKKLISYDPVNKEVVIKIEGNKKDVEKILKEYKKGKYYISKIM
FT                   DINNHTTIEIRVKADEEILKDYGLPVDVIKTTETIKKISNNKIRVEVNNKLDGIWYRFS
FT                   CKIPKGYRVKEIVGDDGRIIKNNISINRLTGEVVGEVRWYIENNTLYFYDDPIYGYDIS
FT                   LIPPAPNNSIAVELSYDGQDNGGCGQISAIVFPYSEGDNISTIETYDHAGRTGDYDYAN
FT                   NIDADAGSKIAIKYTSGIRTRQYGNGGDYYETASFYLSEINRTDVPLNTVPNGVLESVI
FT                   ITNMYAPWTNNELNITQKVIIRGNNKWFATIYYIKNPTTKTYTNLKFFQGMDWNFRGSY
FT                   QKDNAYYNNANDVVYGYDSDAPSGDIQYGGFKSILPSYEHDVNPYWRMWDDIKYDNLNN
FT                   YSSYNGDAGVALAWTKSSLKPGEIWVVPIIWGLGYNFTDMMNEINMGLSQLYDTGVKTI
FT                   NYPNNGDVFNPNLQPIIYVNSTIALYGLVDAYNLNVSINVTQINGTYTYTNSTLINLSV
FT                   PYEEEKTISFPINISNMPYGAYNITIKTNLPNDQNTSNDEKSIIIYISPFSIEPEYQEK
FT                   TGNAGEEIFYNITLYNFGSGERFDINITNSTKGWTTCIYNNSTLIAEDTNGDGIWDYIS
FT                   PNYDLNANNLPDIYVPHGELNLTVSKVIPPTTPLGEIDLTTLKFVNTNNPSIYDIASFQ
FT                   TSTPFPPSVQKTFYLHGDSSRTLNTSIPTEIDNYTTITGNSLASWTQIPRFADDFTVVG
FT                   NISILLYMSDPDVLGGFETHKIVVSLIATNGVNSITLGSDTEDLNLYSTTRPYTFNIPL
FT                   NSIVTIPKDYYLILRVENLQSTNSINIYHDSTYVSNITLNTTTYVEVQNIYADKDVYIP
FT                   GDTATVFVNITDPIGSYDIKGANIAVYYPNGTLYINDSMNLQEVDANTPSLWKLFNYSF
FT                   KVPVSGNYNITITGIESNGVIYKKDYVLCVGYEIQGYVKEDFGTLGVEDSSDKGVYDVN
FT                   VSLFEDSNNNGVLDKNDKMINSTTTDVFGYYKFLVYNTSKTYFVAVNSKTISPTRGYNQ
FT                   GYNINDVWAEETYQTLYAPINTSQWIANGNATVSTNKLLLTPDDYNQVGSVWYYEPVNL
FT                   SEDFVIEYYAYLGDNPDGADGVTFTLQPNGLSEWGGAGGGLGYAGITPSVAVEIDTWLN
FT                   DFDYPATTDHIAIDVDGIVNHTYNNITFLTPNPYDLGNVEDGTEHKVKIVWNATTKQLT
FT                   VYFDGSQVLTWNKDITQILGTTAYFGFTGGTGGAKNLQYIKPTYAKNGNSYIIKPTYSI
FT                   VSMFGGRNPGKSDDWNTGDYEHYCTVDLNNYHGENITFGFSFDVITNTNPVGQGSFAQF
FT                   IKNANAIVGEDKAYFKIPKTELHGKYYVIYTNNNSIVDNLTVINGSTQVDGDVLLSGSQ
FT                   WIANGDSYINNSENLTLIITPDDYNQVGSVWYYEPVNLSEDFVIEYYAYLGDNPDGADG
FT                   VTFTLQPNGLSEWGGAGGGLGYAGITPSVAVEIDTWLNDFDYPATTDHIAIDVDGIVNH
FT                   TYNNITFLTPNPYDLGNVEDGTEHKVKIVWNATTKQLTVYFDGSQVLTWNKDITQILGT
FT                   TAYFGFTGGTGGAKNLQYIKPTYAKNGNELLNLDAISKNPVINNLAYNTTISNINFENV
FT                   SVAILGNESGLNYLKITNVSVFGNILKAGIELLDYNWNMQEYPAYMTNIHINSSDAYGI
FT                   EMLNRIWLIFEDSLIEMHNGIGVYWANWAGGYGNLTMENISIKECNHGIYFYKNGNIAS
FT                   IINSKIENSAYEGIYIIDSNNISILNTSIINNSIGIFSNNSSISVENSTVFNNRFEGIY
FT                   VENSNITTYNLSVSNNSIGIYIKGFGNNKISLSRIFYNNYGVEVVNSSKILMNSSEIFN
FT                   NSIDGIAVFNGDNLTITNNRIYNNNYSFLSYGNLTNVFIYNTSFENSTNKSLDIEVPSN
FT                   SVLNNLTILDSKILNSGEYGLYVYSLGDSSNLNISGNFINASFRDGILIFGVNDIEILN
FT                   NNITNNGLIGGDPAGAGIKVIGYNTANVTIENNNCSNNGGNGIDVEDYYGNYLRNVTIE
FT                   NNYLSNNGIEANAGNALFIGGRVENVLVKNNIMQYSDAQAILIQEPNGWATWAWIGTNI
FT                   TIDNNTIQYNGLTVEAGNVTAGITIGAYGNYNQDDGYIIIKNNKIINNNLCPNPSYGGK
FT                   VGGIEIYGLNESWINLEFNITNNIIANNSAYGISVAASKDINIVNNTIYNNEKGITLPT
FT                   YDSAPHNIIISKNSIYNNSMLGIDLNDDNVTLNDGLINPNEANYGIDYPIITYAELVGD
FT                   NLTIRGYIGNGTGSSNFANAIVEIFLVKNSTGGDNLIGNNISSDGTTLDDTYGEGWIYL
FT                   GSLIADSNGFFNGTLNVSGKGVDYDSILTATATINGYGTSEFGRNYLLIKKFFNITGSI
FT                   TMLPNGYNITIKSYNTTRDVYVYWYKPNDIGVINISGDYNENGTNGNTYWFKFNIINAN
FT                   EVKKISITTNTTTIEGLIIGIDPK"
FT   gene            complement(254086..254817)
FT                   /locus_tag="MFS40622_0255"
FT   CDS_pept        complement(254086..254817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68951"
FT                   /db_xref="GOA:D3S7E1"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E1"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0425"
FT                   /protein_id="ADC68951.1"
FT                   /translation="MMKRFALFFVFLALITPTFADVEEITNYNMTVDLTKNPAHITNII
FT                   TIQNLVKYPLVPGIGELRLQKEEPKKILFIPIPFTGEKKPIKIENLKGYYIIGHQKYPM
FT                   NVSVSYKDTYSVIEYQIWDPIDSGKNITLIIEYDADIVDNGILFKTVSIPVGCDLNIRK
FT                   FNINFISPYHLTYQEPDGNGFQIPKNTLFIVKAEFSILPLPKLPTYGYVLFWLSILSVL
FT                   VIIFVYTELRRRNKGNKDNNG"
FT   sig_peptide     complement(254755..254817)
FT                   /locus_tag="MFS40622_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 21"
FT   gene            complement(254856..257804)
FT                   /locus_tag="MFS40622_0256"
FT   CDS_pept        complement(254856..257804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68952"
FT                   /db_xref="GOA:D3S7E2"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E2"
FT                   /inference="similar to AA sequence:KEGG:MJ1394"
FT                   /protein_id="ADC68952.1"
FT                   /translation="MPDVRLRFVNSSIVLITLILTVPLLMLNCVSGLKTIFYDDFENWS
FT                   GWYNYSNGAVEQSSNYSYSGTYSLRKFLNDDPNGGYKLIGKEIGRNIVVEGWIYRPTPY
FT                   VSGKWDRIGIEDENFNGYSIRIEHDYNIIAIETRVGGIASSTLATATWNPPENEWYHFK
FT                   FYLYSNGTLKLEVYYENGSLGATVSTTDNTYTKFDRVVVHGGQDYYVDDLRISDLYPPL
FT                   RVRYIEEYNATAIVDGTGKTDYSSGLTGHIVIENTAPYEEDTLNDVWVAVDIKNNASGL
FT                   RLVYNGTPKGVFIKDSAPAYTGLPSGLTYIHIPILPNNSYVEYEFDIDASQTLPILVNE
FT                   TYDATKIPANKMSEWTINLTVYLNKNLVPNGENVNVKVIKYLSNGQFYDNFENWTGWEQ
FT                   YRNGIVQWSSSYSHSGNYSLEKYGVSTSLNNDPNGGFKLLPKEIGRDVVISGWIYRPSN
FT                   WGGGPIDRIGLEDENFNGYSFRVDHYNNYISIDRRTGGNPQEISIEVPWNPPEDEWYYF
FT                   EFHIYSNGTLTFSTYYKNGSLGATVSTTDNTYTKFDRVVVHGGYVYYVDDLEVNSKNFD
FT                   FYGDKNWTYLEITSANPSEGVAVLFDGDYFKKDYNTSNLNAINWSNITLNWSNDKATLV
FT                   FNVLGSYSYSERDNILAKYGFAKILFNYNGTNTNTSIKGVYASGCCAISTSHGTTGEIN
FT                   IWKENATFKNNAKSYSFNLTNLNIWAVNKSAYEFCWNPFNESIWIDGSNYTVTPNIDIP
FT                   PGGVWNSKTYNFTFSGVPIVWANCTFTVSKKDYILLNETSQIGNSYIVIEEIYVVGSYL
FT                   VKVTKHIVPNDDGTYDIYIVVENIGSEKTPEYVYVYDLVPKNFTVSDEWVNQSSMLIAS
FT                   GSHTITTNPRYNLSMWWALHAIYPGADGDGSYTDWSEISANETVVIHYKLNGTGEFYPS
FT                   DAFIVGIDPTNSLLPTTSPKITTVSGTIENNFETFLILINVIFGLGILIKRI"
FT   gene            complement(257957..259786)
FT                   /locus_tag="MFS40622_0257"
FT   CDS_pept        complement(257957..259786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68953"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E3"
FT                   /inference="similar to AA sequence:KEGG:MJ1393"
FT                   /protein_id="ADC68953.1"
FT                   /translation="MRKLIFMITLLITLAFLGTLFGYGNNGPLYVTYYEKYNITGNATG
FT                   EGTISAKINNITGYIIINNTGKDVNDTLQDVWVAVKVVNNITGLKVIKNTTPKGVFIEN
FT                   TAPAYTGLPSGLTYIHIPILPNGTYVIVSFGINPAITGVPLLINETYSDTKIPSRKLAN
FT                   WSVYMNISRNVSALPSADTAVSVSMTKYLSNDINNYGSDTWNFLNITDAIPNQGSTELW
FT                   NGPYFAGTANDSLNWTGVVLNSTQNASITIDITGNNTYANRTGTLMKYGFAVIFFEFNG
FT                   TMSGTEIEGVYAAGYAAPSATKEGPFLNVSSGKYEIWYENASVKNNAESYYFNLTNVTI
FT                   WAVNGSNPAIVDPFNTTLIIPGSKNALSPNKLLAPGDIWNSEKFNFTFNGVPVVWANCT
FT                   FKVADTNITLINRSVHEYSTKYGSSYIVVEEIYVVGSYLVKVTKHIVPNDDGTYDIYIV
FT                   VENIGSEKTPEYVYVYDLVPKNFTVSDEWVNQSSMLIASGSHTITTNPRYNLSMWWALH
FT                   AIYPGADGDGSYTDWSEISANETVVIHYKLNGTGEFYPSDAFIVGIDPTNSLLPTTSPK
FT                   ITTVSGTIENNSEPILALITVLAGLGIIIRRAM"
FT   sig_peptide     complement(259718..259786)
FT                   /locus_tag="MFS40622_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.430 at
FT                   residue 23"
FT   gene            complement(260038..261513)
FT                   /locus_tag="MFS40622_0258"
FT   CDS_pept        complement(260038..261513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0258"
FT                   /product="isopropylmalate/citramalate/homocitrate synthase"
FT                   /note="TIGRFAM: isopropylmalate/citramalate/homocitrate
FT                   synthase; PFAM: pyruvate carboxyltransferase; LeuA
FT                   allosteric (dimerisation) domain; KEGG: mja:MJ1392
FT                   (R)-citramalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68954"
FT                   /db_xref="GOA:D3S7E4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR011830"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024890"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E4"
FT                   /inference="protein motif:TFAM:TIGR02090"
FT                   /protein_id="ADC68954.1"
FT                   /translation="MMVRIFDTTLRDGEQTPGVSLTPNDKLEIARKLDELGVDVIEAGS
FT                   AITSKGEREGIKLITKEGLNAEICSFVRALPIDIDAALECDVDSVHLVVPTSPIHMKYK
FT                   LRKTADEVLETALKAVEYAKEHGLIVELSAEDATRSDVNFLIKLFNEGEKVGADRVCVC
FT                   DTVGVLTPQKSQELFKKITENVNLPVSVHCHNDFGMATANTCSAVLGGAVQCHVTVNGI
FT                   GERAGNASLEEVATALKILYGYDTKIKMEKLYEVSRIVSRLMKIPVPPNKAIVGDNAFA
FT                   HEAGIHVDGLIKNTETYEPIKPEMVGNRRRIILGKHSGRKALKYKLDLMGIEVSEDQLN
FT                   IIYERVKEFGDLGKYISDADLLAIVREVTGRVVEEKIKLDELTVVSGNKITPIASVKLH
FT                   YKGEDITLIETAYGVGPVDAAINAVRKAISGVADIRLVEYRVEAIGSGTDALIEVVVKL
FT                   RKGTEIVEVRKSDADIIRASVDAVMEGINMLLD"
FT   gene            complement(261658..263193)
FT                   /locus_tag="MFS40622_0259"
FT   CDS_pept        complement(261658..263193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0259"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mja:MJ0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68955"
FT                   /db_xref="GOA:D3S7E5"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADC68955.1"
FT                   /translation="MIERALILDGYTDEPAGLGVPPYIGIYPRYAYGVLDKYNVKVDYI
FT                   TIDKFREVRGSFNLDKYDAIICICGFHTPGKYLNANPATLKEFVSILYNYDGLKILGGP
FT                   SATKYGSSMIGGRIEDESKYKAFFDVVAEGDLEAVLNDLLRERSLEKVDFNRYRTYEEL
FT                   REYAIRGAKVVKKHPNYPYIIAEIETYRGCSRALSGGCSFCTEPRRFGLPTFRDERDIV
FT                   DEIKALYDEGIKYFRIGRQPCMLSYKSIDSEKEEVPKPNVEAIEKLFKGIRNVSNPKVL
FT                   HIDNANPAVIARHENESREVAKILVKYCTSGNVAAFGVESFDEKVIKANNLLTTPEDVL
FT                   KAVEILNEIGGQRGETGLPYLLPGINLLFGLKGERKETFAINFEYLKEIYDRGFMIRRI
FT                   NIRQVVPFFGTDITLKDIKKAEKRKKLFLWFKEKVREEIDNKMLKRVVPKGTILKDVFI
FT                   EVKERDNLYFGRQFGSYPILVGIVDKNLKIGEFVDVEIVDYGRRSITGKVVKN"
FT   gene            complement(263263..263868)
FT                   /locus_tag="MFS40622_0260"
FT   CDS_pept        complement(263263..263868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68956"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E6"
FT                   /inference="similar to AA sequence:KEGG:MJ0275"
FT                   /protein_id="ADC68956.1"
FT                   /translation="MKKLAVIFLSLILAISICGCFNNEKREAYKSNISTDVEKENMKTY
FT                   NNESVGNLEEKSHKLNITNDENTTNNTIKTTKRYDFSKSVDIDKMFLNLPYNEEMDFDG
FT                   KVIKKYKNITFAVSKKPIDFSYAYAFNEVKKYPQRDIFGNYTYYEFIPQNTNLSISYCY
FT                   YRKVGNYYIVMQTYEKSKRATDLWINWTKHIFSLFEEK"
FT   sig_peptide     complement(263800..263868)
FT                   /locus_tag="MFS40622_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.722) with cleavage site probability 0.650 at
FT                   residue 23"
FT   gene            complement(263871..264296)
FT                   /locus_tag="MFS40622_0261"
FT   CDS_pept        complement(263871..264296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0275.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68957"
FT                   /db_xref="GOA:D3S7E7"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E7"
FT                   /inference="similar to AA sequence:KEGG:MJ0275.1"
FT                   /protein_id="ADC68957.1"
FT                   /translation="MKVYNAYKVVGAFMFSTSILFVLYISTLLQSFKLPLPVILVVDVL
FT                   IILIFAYLFLKPKKLVILEDGIKIDDEFYSWNDVIEFFVSLNSIQINLKGKREETFNWE
FT                   TPGLFKYRPQIEYVVKKDTELLKILRKKIGHKERKRG"
FT   gene            complement(264317..265417)
FT                   /locus_tag="MFS40622_0262"
FT   CDS_pept        complement(264317..265417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0262"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: mja:MJ0276 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68958"
FT                   /db_xref="GOA:D3S7E8"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E8"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADC68958.1"
FT                   /translation="MKVEFMQGNQACAKGAIKAGCRFFAGYPITPSTEIAEAMSRELPK
FT                   VGGYYIQMEDEIGSIAAVIGASWGGLKAMTATSGPGFSLMQENIGFAYMTETPCVIVDI
FT                   QRGGPSTGQPTMASQGDMMQCRWGSHGDYEVIALSPSSVQEMYDFTIMAFNYAEKYRIP
FT                   VFVMADEIVGHMREKVVLHDNIEIIDRKKPDEKPCKKPYPFDKLIPEMPVFGEGYNVHI
FT                   TGLTHDERGYPDVSPETHDKLVRRIVNKIRKNKDEIIKWEGENIDAEIMFICYGSPSRT
FT                   VKHAVRNLMEKGLDVGYIRLITVYPFPDELLKKLKAKKVIVPEMNLGQIYYEVERVCKK
FT                   ADEIILVDKIGGELHRPEELERAVLE"
FT   gene            complement(265495..267270)
FT                   /locus_tag="MFS40622_0263"
FT   CDS_pept        complement(265495..267270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0263"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein domain
FT                   protein TPP-binding; KEGG: mja:MJ0277 acetolactate synthase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68959"
FT                   /db_xref="GOA:D3S7E9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7E9"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADC68959.1"
FT                   /translation="MKGAEAIIKALEAEGVKIIFGYPGGAMLPFYDALYDSDLIHILTR
FT                   HEQAAAHAADGFARASGEAGVCVSTSGPGATNLVTGIATAYADSSPVIALTGQVPTKLI
FT                   GNDAFQEIDALGLFMPITKHNFQLKKPEEIPETFRAAFEIATTGRPGPVHIDIPKDVQD
FT                   GEIDIEKHPIPAKVDLPGYKPKTVGHPLQIKKAAKLIAEAEKPVILAGGGVIISGASEE
FT                   LLRLAEFVKIPVCTTLMGKGCFPEDHPLSLGMVGMHGTKAANYAVTECDVLIAIGCRFS
FT                   DRVTGDIRYFAPEAKIIHIDIDPAEIGKNVRADIPIVGDAKNVLRDLLAALIALEIKNK
FT                   DAWIERIYELKKLSIPMMDFDDKPIKPQRFVKDLMEVLNEIDPMLKNTIITTDVGQNQM
FT                   WMAHFFKTKMPRSFLASGGLGTMGFGFPAAIGAKVAKPYANVISITGDGGFLMNSQELA
FT                   TIREYDIPVVICIFDNRTLGMVYQWQNLYYGQRQSEVHLGESPDFVKLAKSYGVKADRI
FT                   TSPDEIKEKLKEAILSNEPYLLDIVIDPAEALPMVPPGGRLTNIIQPIRVEPKIKKAEF
FT                   DEIKKVREMATVKEF"
FT   gene            complement(267448..267912)
FT                   /locus_tag="MFS40622_0264"
FT   CDS_pept        complement(267448..267912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0264"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   mja:MJ0278 peptidyl-prolyl cis-trans isomerase, FKBP-type
FT                   rotamase (SlyD)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68960"
FT                   /db_xref="GOA:D3S7F0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F0"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADC68960.1"
FT                   /translation="MIKKGDYVKVDYILVVDGKVIDTSIEEVAKENKIYYPEREYEPIG
FT                   FIVGNGELIEGFEEAVIGMEVGEEKTVTIPPEKGYGLRDERLIQEIPKEMFADADFEPQ
FT                   EGMLILASGIPAKIIKVTDDTVTLDFNHELAGKELTFTIKICDVQPAESE"
FT   gene            268016..268855
FT                   /locus_tag="MFS40622_0265"
FT   CDS_pept        268016..268855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0265"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: mja:MJ0279
FT                   (S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68961"
FT                   /db_xref="GOA:D3S7F1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023547"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F1"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ADC68961.1"
FT                   /translation="MEKLKAYLELIRAKNCITASIGGIIGYLISSNFEIDILKCILVFF
FT                   VVFFVCAYGNVINDIFDIEIDKINKPFRPLPSGKIKLEEAKTFSAILLILGLALSIFIN
FT                   IYALIIAVVNAVLLYLYAKKYKRYKPVGNFIIGYLTGSVFLFGGVAGKNVMPVVILFLC
FT                   SLLSIWGREIVKDFEDIEGDKKEGVVSLPITYGKKALYFAIFLAILAVVLSPLPYILKI
FT                   FEIYYLILIVICDILFIYAMALLLKNPNKETASKVSKFLKTIMNIVLLAFIVGAIKL"
FT   gene            268908..269288
FT                   /locus_tag="MFS40622_0266"
FT   CDS_pept        268908..269288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0266"
FT                   /product="alpha-NAC related protein"
FT                   /note="TIGRFAM: alpha-NAC related protein; PFAM:
FT                   ubiquitin-associated- domain-containing protein; Nascent
FT                   polypeptide-associated complex (NAC) domain protein; KEGG:
FT                   mja:MJ0280 nascent polypeptide-associated complex protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68962"
FT                   /db_xref="GOA:D3S7F2"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR005231"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR038187"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F2"
FT                   /inference="protein motif:TFAM:TIGR00264"
FT                   /protein_id="ADC68962.1"
FT                   /translation="MFPGKVNPRMLKKMQKMMKDFGMETEDLNPKKVIFVFEDEEWVFE
FT                   EPKVQVMDILGVKTYSITGKPKKIKKEKEEEEVKVEITEEDVELVANQCNVSKEMARKA
FT                   LEECNGDIAEAILKLEEEKEGN"
FT   gene            complement(269285..269818)
FT                   /locus_tag="MFS40622_0267"
FT   CDS_pept        complement(269285..269818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0267"
FT                   /product="peptidase zinc-dependent"
FT                   /note="PFAM: peptidase zinc-dependent; KEGG: mja:MJ0281
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68963"
FT                   /db_xref="GOA:D3S7F3"
FT                   /db_xref="InterPro:IPR012091"
FT                   /db_xref="InterPro:IPR012962"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F3"
FT                   /inference="protein motif:PFAM:PF07998"
FT                   /protein_id="ADC68963.1"
FT                   /translation="MIMRICIQPVGDVDIEILNFLKKKLQDIFGICEILPKIDIPIYAY
FT                   DSIRQQFNSTLILKSLPNVCDVILGVVDVDIYADNLNFVFGEAELFGRRALISLTRLRP
FT                   EFYGLPPNKDILKIRALKEAMHEIGHVLGLMHCENRECVMSFSNSIIDVDLKDWKYCEK
FT                   CLKKLRDRGIYISI"
FT   gene            complement(269860..271317)
FT                   /locus_tag="MFS40622_0268"
FT   CDS_pept        complement(269860..271317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68964"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC68964.1"
FT                   /translation="MISKLKLKTFKIEKRYSANTAFVIFKILKIYDSKIDVIDYITLHR
FT                   VFAEIHEELIETTYRHFFGYLYQSLISYKRRNYYKLQYQINSAIYDMEIMGVKILYSRL
FT                   YDYYEYLDDSLSNNFFERIDDMIECDKLVLKNKKLKYLWNLALYNLCTANKILNLYIQT
FT                   NRGIYRQKSINLCKKISAILSDFINKHNIEYFYKYPSLLTYILYNLESNKQFVSRNHSI
FT                   QSAILRIRDYLPTLFSKAKFKHLCWMCINLYDLDKELFNQAFRLFLEKLLESEQKRIEI
FT                   PKQELPQVVLVLAYYLSDKYNGKLNFDFPIEFEKIDFENVYNILFPKYQQEFYKINVSD
FT                   EDLRRLQNMDDSEIRKSLSKIIKMSDKIPEYVKQKLDTESEKPHTSAEISDFEIEIKIN
FT                   NKSLYVCFPIKSGREIRSRTVSENYIYQITKPFIHYKDCAVIFLTAKKCSLNLRNAINK
FT                   YKERFSLPIDVLEAENLAKLFKIYGVL"
FT   gene            complement(271335..271724)
FT                   /locus_tag="MFS40622_0269"
FT   CDS_pept        complement(271335..271724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0269"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: conserved hypothetical protein; K02331 DNA polymerase
FT                   phi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68965"
FT                   /db_xref="GOA:D3S7F5"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F5"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADC68965.1"
FT                   /translation="MGMENYKHIIDINMLRYLFSPYVVFIYGSTVTKTKVNKWKIYSDI
FT                   DLIIVLDDEKKKSVSTLKRDYLLNKFCNLTDKRFDVIWISKSEYEKLVNNKTFKSFLKK
FT                   CEVLYIGDDEWFQKTWLKIRDYTIY"
FT   gene            271835..272248
FT                   /locus_tag="MFS40622_0270"
FT   CDS_pept        271835..272248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0270"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: mja:MJ0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68966"
FT                   /db_xref="GOA:D3S7F6"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F6"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADC68966.1"
FT                   /translation="MVKLNEDMVKSLENEVVFIATASKDGIPNVAAMRAVKVLDAEKGI
FT                   VLIADNFMNKTLKNILENPRVALTTANCRDMPYQYKGTAEYYTEGEYLKIAEEVDKALK
FT                   PELKPKGAVVIKITEIYNLKSGPDAGKLIAKDK"
FT   gene            272404..273276
FT                   /locus_tag="MFS40622_0271"
FT   CDS_pept        272404..273276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0271"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; KEGG: mja:MJ0283
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68967"
FT                   /db_xref="GOA:D3S7F7"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F7"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADC68967.1"
FT                   /translation="MTECDGNCNNCPSKNTCPDTKKLLAQQDAKIRENMAKIKHKIVIL
FT                   SGKGGVGKSTVTVNLAAALNLMGKKVGVLDADIHGPNIPKMLGVENVQPMAGPAGIFPI
FT                   ITKDGIKTMSIGYLLPDDKTPVIWRGPRVSGAIRQFLADVVWGELDYLLIDTPPGTGDE
FT                   QLTIMQSIPDIDGAIVVTTPEEVSVLDVKKSIMMAKMLNIPIIGIIENMSGFVCPYCNK
FT                   VVDIFGRGGGEKAAKELGVEFLGRIPLDIKAREASDKGIPMVLLDCKASEEFKKIVERI
FT                   VEKVEGKKE"
FT   gene            complement(273284..273952)
FT                   /locus_tag="MFS40622_0272"
FT   CDS_pept        complement(273284..273952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0272"
FT                   /product="thymidylate synthase, methanogen type"
FT                   /EC_number="2.1.1.45"
FT                   /note="KEGG: mfe:Mefer_0421 thymidylate synthase,
FT                   methanogen type; TIGRFAM: thymidylate synthase, methanogen
FT                   type; PFAM: thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68968"
FT                   /db_xref="GOA:D3S7F8"
FT                   /db_xref="InterPro:IPR014620"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F8"
FT                   /inference="protein motif:TFAM:TIGR03283"
FT                   /protein_id="ADC68968.1"
FT                   /translation="MLCIKKPSVASAFDELIPKILKDGDIVETEFGERTKEIRNTIIQI
FT                   TNPKLKKVPEKYPLGKMAVEEYTKNLLYGSNNTFSYDYHERLFKYPYANEKINQINYII
FT                   EKLNQQKNSRRAVAITWNPKIDIDISRDERGSVPCLQLLQFLIRDDNLYMTVVFRSNDA
FT                   LIAFVANALGLISLGELVAEKTNTKLKEYVHHSISMHVYIDRDRDYIKKYFPECLEYIK
FT                   "
FT   gene            complement(274053..274757)
FT                   /locus_tag="MFS40622_0273"
FT   CDS_pept        complement(274053..274757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68969"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7F9"
FT                   /inference="similar to AA sequence:KEGG:MJ0512"
FT                   /protein_id="ADC68969.1"
FT                   /translation="MVLGKISSLLPNSQILTKVKIVDIRKKESEEGAIFYIGTMVDKDG
FT                   VANFITTIPLEKGKCYEIFGRITEEKSVRIVEKVIKGVKYPKEIPEIPKEQLYNRGEVL
FT                   DVKVPAILEVSQSTIFVNYYCKICRGIVDTKIKPRGLVYICRNCGEIDPEDVDVKIKVF
FT                   GKIHFGTSSKRCYIPPATLEQFMPGILDMLEEYGIDDTIREICLKLNGKTFLVRGFEGK
FT                   EGNYIITEMEDI"
FT   gene            complement(274784..275488)
FT                   /locus_tag="MFS40622_0274"
FT   CDS_pept        complement(274784..275488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68970"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G0"
FT                   /inference="similar to AA sequence:KEGG:MJ0513"
FT                   /protein_id="ADC68970.1"
FT                   /translation="MVKYGIKIEDDKVEIVRYSTVYTDEGVEELEEIYLQIKADDYESI
FT                   LGRYEPYPKKDVRFVGNLDDLKVVKGQEMRTAVPIPLSLCRAKYLKRIDEDDERITYLD
FT                   INGVPIQRGIIVGIVVGVQHKRTSTGKDYTIFRIFDGYGWGRLRLFGIKANPEVFTGMF
FT                   IRGFVRFGAVEFRTEEGELRKAISLTLNDMPVIVQPKEYIVHKKFIDEVVLPRVAPELI
FT                   EEEKEDEETEEE"
FT   gene            complement(275858..276640)
FT                   /locus_tag="MFS40622_0275"
FT   CDS_pept        complement(275858..276640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0275"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0514 polyferredoxin (MvhB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68971"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G1"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68971.1"
FT                   /translation="MSIECHNIKVITLIEIKKSLDEILSKIDGDKRYINEVAKKITPIT
FT                   YKLLYINETKCIRCNLCYKECPVDAIEKAKVKKSAKIIEDKCVKCEICAQTCPVGAIYV
FT                   IEGRAEIEDSEVHYTIKEKSIPHRKIRLKRYELDENTCIKCGICARFCPTNAIKVVRRK
FT                   SIEVNLDLCMGCGACAEVCPKKCIKVERELGEVIKTRDIEVDKNLCVGCFVCVEECPIN
FT                   AIEQEGDKVKINKDKCILCGRCADVCPANAIKIWEKKI"
FT   gene            complement(276610..277101)
FT                   /locus_tag="MFS40622_0276"
FT   CDS_pept        complement(276610..277101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0276"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0514.1 polyferredoxin (MvhB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68972"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G2"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68972.1"
FT                   /translation="MIKEIIAKHFNLADKNIQLLPKFNIILNKREIIVKEDKCISCGKC
FT                   IEICPVDAITYSKDGLFIVIDKEKCVFCGRCKKVCPTNAIVIIRLRCEINEDARIIEVD
FT                   KYEFIEYISERCASCLVCLRNCPFNAIEEYGSKIRIDINKCELCGRCEELCPLNAIILR
FT                   "
FT   gene            complement(277079..278296)
FT                   /locus_tag="MFS40622_0277"
FT   CDS_pept        complement(277079..278296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0277"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0514.2 polyferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68973"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68973.1"
FT                   /translation="MASSLWYLYEFARKKWIKRFIDAKSDKSSYIPPERYRKIPPIVKF
FT                   PEKCISCEACKESCPAFAVEMVYSEEYNKNLPVFDEGSCIACANCVEVCPTGVLEMDKH
FT                   RIETEGLFFDKPKYHNLIIDEEVCVRCGNCERACPINVIERKEGKYVINMALCISCKEC
FT                   VKACPIENAIIIFDEKTLKEKIDKAFEIKNKKTIGKLEIKENAIEEIPHIVNGLCISCG
FT                   ICKDVCVGEIDLKEKKVVKCVKCGLCIELCPTTAIRIYKPIISKRKDICYVIDEDLCIG
FT                   CRICYKVCGAGAIKISKETKLPYIVPELCVRGGACARECPVEAIKIVKPEEAEEAVKVR
FT                   IIEDKIIESIEADLILYTEKYGKVKEEIEKLSLKKLKEELKKRVYEENKRIKEMKRELY
FT                   DKGNNS"
FT   gene            complement(278454..279587)
FT                   /locus_tag="MFS40622_0278"
FT   CDS_pept        complement(278454..279587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0278"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   nickel-dependent hydrogenase large subunit; KEGG:
FT                   mja:MJ0515 carbon monoxide dehydrogenase, hydrogenase
FT                   subunit CooH (CooH)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68974"
FT                   /db_xref="GOA:D3S7G4"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G4"
FT                   /inference="protein motif:PFAM:PF00346"
FT                   /protein_id="ADC68974.1"
FT                   /translation="MATIPIGPIHPVLKEPLRIKLVLDGERPVDAEIEMGYVHRGIEKI
FT                   MEGKHCHKGIYLAERVCGICSYVHTMTFAECIEHISKIEIPDKAKYLRVVTCELERIHS
FT                   HLIASAVYNLSIEHETLAMWLLNVREIIMDLMEMITGNRVNMGYNVIGGVRRDINREMM
FT                   NEIYKKLDIFEEELKNIIEVFETGPLIALRSKGIGILPYHEVMRTRAVGPVCRGSGLPE
FT                   SDWRLRHSTYQELKFKPVWREEGDNFARMMVRHEEVIESVRLIRKALELYEECSGDIRV
FT                   KAEIKGGKGEWRNEAPRGEVTYRMEITDGGIIKRIMIRTPTVMNLEAYKYMLKTCPTVA
FT                   DAISAYTSIDPCVSCTERCIVAIKDGKEIPININLKF"
FT   gene            complement(279592..280038)
FT                   /locus_tag="MFS40622_0279"
FT   CDS_pept        complement(279592..280038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0279"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: mja:MJ0516 carbon monoxide dehydrogenase, hydrogenase
FT                   subunit CooL (CooL)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68975"
FT                   /db_xref="GOA:D3S7G5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G5"
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /protein_id="ADC68975.1"
FT                   /translation="MVKEFLRKRSIHVCVINTGGCNGCDIEIVACLAPRYDIEQYGIYV
FT                   HNNPREADVLLITGPVTLQWAERLKEIYEKTPEPKIVVAVGACALSGGIFKEGHVVGGV
FT                   DKVIPVDAKIPGCPPRPSEIIETILKVAPKAIAMREKKLKNRDE"
FT   gene            complement(280041..280454)
FT                   /locus_tag="MFS40622_0280"
FT   CDS_pept        complement(280041..280454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0280"
FT                   /product="(NiFe)-hydrogenase-3-type complex Eha, EhaM"
FT                   /note="PFAM: [NiFe]-hydrogenase-3-type complex Eha, EhaM;
FT                   KEGG: mja:MJ0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68976"
FT                   /db_xref="InterPro:IPR012056"
FT                   /db_xref="InterPro:IPR036606"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G6"
FT                   /inference="protein motif:PFAM:PF09218"
FT                   /protein_id="ADC68976.1"
FT                   /translation="MAEIVDIDKKYVENSLKQKMNVLKDNRFLMDDVFIPIAKALKIDV
FT                   DEVIEIFAKKLDFASCYELHAYAEQAKMGCLGRKVDIDLGLCWLSDFFGLIKKEEADLI
FT                   RKKVVESHLLYKKPYKEALEEGRQMIIKLLKEE"
FT   gene            complement(280457..280744)
FT                   /locus_tag="MFS40622_0281"
FT   CDS_pept        complement(280457..280744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0281"
FT                   /product="Protein of unknown function DUF2104, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2104, membrane;
FT                   KEGG: mfe:Mefer_0330 protein of unknown function DUF2104,
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68977"
FT                   /db_xref="GOA:D3S7G7"
FT                   /db_xref="InterPro:IPR011305"
FT                   /db_xref="InterPro:IPR019211"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G7"
FT                   /inference="protein motif:PFAM:PF09877"
FT                   /protein_id="ADC68977.1"
FT                   /translation="MGLFELNLAIILFIIGNFIGLEYSYRKYSSPYVERKIDKIALTLS
FT                   IIGGVLINSPLYMLGCLLIGFPLGMRPGYGRVEFIVGLIIALLLYLLLRW"
FT   gene            complement(280756..281001)
FT                   /locus_tag="MFS40622_0282"
FT   CDS_pept        complement(280756..281001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68978"
FT                   /db_xref="GOA:D3S7G8"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G8"
FT                   /inference="similar to AA sequence:KEGG:MJ0519"
FT                   /protein_id="ADC68978.1"
FT                   /translation="MKGYVYFFTIACIIAVIYCILVSLLQVNVIPIVLVFGLILITAIS
FT                   IINKKIAHKMEDIEVLFMLLVLAFFAYTLYKLYIPV"
FT   gene            complement(281010..281882)
FT                   /locus_tag="MFS40622_0283"
FT   CDS_pept        complement(281010..281882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0283"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: mja:MJ0520 NADH-ubiquinone oxidoreductase, subunit
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68979"
FT                   /db_xref="GOA:D3S7G9"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7G9"
FT                   /inference="protein motif:PFAM:PF00146"
FT                   /protein_id="ADC68979.1"
FT                   /translation="MDTSLIGVINLTIHAFLVGSLLLGLHRKIMARIQGRPGPPIIQYL
FT                   LHTLKFYVKEITFPITAGNPLYIFVALLDVAIWLAALIIAIDFKSSLLIIIGIYVLQKI
FT                   VEHGCGLSSGSPYGKIGGVRSVFSAAAEVPLFAVVAAIYLTTHSVLISDILNYQEINGS
FT                   LLFKMPICAFAFFILLVSKAPNSPFGIVKGKDIVSGYMTEHYGLLASIIYIAEAIAYFV
FT                   LLWLFIAIFIGPFVINSPILTLAVMVVMTVILAFVNGLTPLLAPHHSVMLQMTIAGLVL
FT                   CDVLYRLLM"
FT   gene            complement(282031..282231)
FT                   /locus_tag="MFS40622_0284"
FT   CDS_pept        complement(282031..282231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68980"
FT                   /db_xref="GOA:D3S7H0"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H0"
FT                   /inference="similar to AA sequence:KEGG:MJ0521"
FT                   /protein_id="ADC68980.1"
FT                   /translation="MDEERKYGLYLLIIGLLCVVGIIMLNGLICYILYVIAVPSLLYGI
FT                   GAFVIPKTRRKDAGKLPFRGY"
FT   gene            complement(282242..282898)
FT                   /locus_tag="MFS40622_0285"
FT   CDS_pept        complement(282242..282898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0285"
FT                   /product="(NiFe)-hydrogenase-3-type complex Eha, membrane
FT                   protein EhaH, predicted"
FT                   /note="PFAM: [NiFe]-hydrogenase-3-type complex Eha,
FT                   membrane protein EhaH, predicted; KEGG: mja:MJ0522 NADH
FT                   dehydrogenase I"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68981"
FT                   /db_xref="GOA:D3S7H1"
FT                   /db_xref="InterPro:IPR017059"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H1"
FT                   /inference="protein motif:PFAM:PF10125"
FT                   /protein_id="ADC68981.1"
FT                   /translation="MIETISGFLFGKVPFGDIVFSFSEFSIIGFITAVIFTIIVYLTKP
FT                   EKQLEAQKFKVEDKLELVTLKELKIRRMMAIVCGIATAGAMLTYDLFDYALFLTLVGIA
FT                   NIGIVSAVKREWVLNAAYQYGLIAMIATLPLFGSAGMILAKTGTLSIFELPKTQASLLF
FT                   EKIIFAAGMAGETGIAPFYAAKAEMFRAPGSPYILMIHLSSLLLIVRTVEILLTI"
FT   gene            complement(282895..283590)
FT                   /locus_tag="MFS40622_0286"
FT   CDS_pept        complement(282895..283590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0286"
FT                   /product="Protein of unknown function DUF2105, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2105, membrane;
FT                   KEGG: mja:MJ0523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68982"
FT                   /db_xref="GOA:D3S7H2"
FT                   /db_xref="InterPro:IPR011311"
FT                   /db_xref="InterPro:IPR019212"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H2"
FT                   /inference="protein motif:PFAM:PF09878"
FT                   /protein_id="ADC68982.1"
FT                   /translation="MDSFVYSLYHPTILVGFAVGILSLLAIGFQKNDLHALILTDVIEC
FT                   AMLIIIAGVGTDLAEALILPGLVVSLAELLAVSEVLITRKYLKSKRPKPRSYKLFEEFK
FT                   LPLHTGELKYNIEMEILKTSPKFLAVVLIVYGAILSGFTGGAVIATGLLFYALSQRVIG
FT                   AEISEELKAMWEGISGLSGVAWALWVFGFLGFFIFPDKWLLCLLMAGLGLVIKVGSKLG
FT                   LIGYIGEVR"
FT   gene            complement(283599..284060)
FT                   /locus_tag="MFS40622_0287"
FT   CDS_pept        complement(283599..284060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0287"
FT                   /product="(NiFe)-hydrogenase-3-type complex Eha, membrane
FT                   protein EhaF"
FT                   /note="PFAM: [NiFe]-hydrogenase-3-type complex Eha,
FT                   membrane protein EhaF; KEGG: mja:MJ0524 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68983"
FT                   /db_xref="GOA:D3S7H3"
FT                   /db_xref="InterPro:IPR011313"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H3"
FT                   /inference="protein motif:PFAM:PF09879"
FT                   /protein_id="ADC68983.1"
FT                   /translation="MKQLGKIWNYLSKPEIVPRIFSVFLALVFIFGVLTPHYLNPNQLY
FT                   PKPIPHSQTLKTPLAPYDRGGIPLKEPAELKAQYPQYAPNLGKITAYLTPIAEWIKDKT
FT                   YYFGTTIVSTPGGILDEILYYTRGMDTVLESSILLISFMIFSWMFFNKD"
FT   gene            complement(284073..284333)
FT                   /locus_tag="MFS40622_0288"
FT   CDS_pept        complement(284073..284333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0288"
FT                   /product="(NiFe)-hydrogenase-3-type complex Eha, membrane
FT                   protein EhaE"
FT                   /note="PFAM: [NiFe]-hydrogenase-3-type complex Eha,
FT                   membrane protein EhaE; KEGG: mfe:Mefer_0323
FT                   (NiFe)-hydrogenase-3-type complex Eha, membrane protein
FT                   EhaE"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68984"
FT                   /db_xref="GOA:D3S7H4"
FT                   /db_xref="InterPro:IPR011317"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H4"
FT                   /inference="protein motif:PFAM:PF09880"
FT                   /protein_id="ADC68984.1"
FT                   /translation="MEFVEYILYIGYALLIIGALGTVVGPKVDNPLIRMLNVEVPAVGV
FT                   ALVFLTYDEALALMTFIAVNAVLSLILVRAVILDAEYKEND"
FT   gene            complement(284354..284632)
FT                   /locus_tag="MFS40622_0289"
FT   CDS_pept        complement(284354..284632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0289"
FT                   /product="Protein of unknown function DUF2108, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2108, membrane;
FT                   KEGG: mja:MJ0526 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68985"
FT                   /db_xref="GOA:D3S7H5"
FT                   /db_xref="InterPro:IPR011308"
FT                   /db_xref="InterPro:IPR019213"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H5"
FT                   /inference="protein motif:PFAM:PF09881"
FT                   /protein_id="ADC68985.1"
FT                   /translation="MDILPLISGICCILGGIGVILHTNPINKIIMLSVLEIGMIGLIVS
FT                   CYYLDIAIVSSLCEPICTIILLLGYLKYLTTVKKKKRYGRNLPILSK"
FT   gene            complement(284651..284896)
FT                   /locus_tag="MFS40622_0290"
FT   CDS_pept        complement(284651..284896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0290"
FT                   /product="Protein of unknown function DUF2109, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2109, membrane;
FT                   KEGG: mja:MJ0526.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68986"
FT                   /db_xref="GOA:D3S7H6"
FT                   /db_xref="InterPro:IPR011316"
FT                   /db_xref="InterPro:IPR019214"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H6"
FT                   /inference="protein motif:PFAM:PF09882"
FT                   /protein_id="ADC68986.1"
FT                   /translation="MDTVEIIIGLIALLMTARIFLERSRARKLLYLCCLSFCISALIAL
FT                   YVDSPMGGIAAITYFICSTLSSNAIAYTIEQTKHLE"
FT   gene            complement(284896..285390)
FT                   /locus_tag="MFS40622_0291"
FT   CDS_pept        complement(284896..285390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68987"
FT                   /db_xref="GOA:D3S7H7"
FT                   /db_xref="InterPro:IPR011314"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H7"
FT                   /inference="similar to AA sequence:KEGG:MJ0527"
FT                   /protein_id="ADC68987.1"
FT                   /translation="MEIAEIVKIITAGIICWLNFVLIDTYFGLPEKPGVLGAKTIGEKI
FT                   RDIGGNLNGGYFMGNIVCSPDASAGTLLASIMNYLMGIEGGFIAALLVWIGNRLCADPG
FT                   YAGTIGALTITAIIYILNPIIEAKYFIGGMVLAIFTIQGLEHKWASKLLGKIAKKMNRG
FT                   E"
FT   gene            complement(285390..285653)
FT                   /locus_tag="MFS40622_0292"
FT   CDS_pept        complement(285390..285653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68988"
FT                   /db_xref="GOA:D3S7H8"
FT                   /db_xref="InterPro:IPR011306"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H8"
FT                   /inference="similar to AA sequence:KEGG:MJ0528"
FT                   /protein_id="ADC68988.1"
FT                   /translation="MNIAILYIVALVTSIIVALILKLPILPREKPIRFSFETSVIFPTP
FT                   ILALGIEAIFRNLFGDYISLAFFAGLFGALLSKYADKLFGEP"
FT   gene            complement(285658..286296)
FT                   /locus_tag="MFS40622_0293"
FT   CDS_pept        complement(285658..286296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0293"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: mja:MJ0529 repressor
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68989"
FT                   /db_xref="GOA:D3S7H9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7H9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADC68989.1"
FT                   /translation="MYKKLEIIERAILLNPQYIQAFREKLKITQSKLAKESGISQSHLS
FT                   MLEKGKRPATKLIATAVTLGLLKCFSSNNVENPIIELLDALSLLKFEDSFAEFVSEIIE
FT                   KDDKRYLRLIENYPVLIISKENLLNEMKNRLEVMDIERIELSRGKIKVIGKHLDNKYVE
FT                   ILLDCSDIRRLEKKFMKKTGKKVIIQVFPKDEVPPIYSTNKDCIIIHCW"
FT   gene            286473..287069
FT                   /locus_tag="MFS40622_0294"
FT   CDS_pept        286473..287069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0294"
FT                   /product="ZPR1-like zinc finger protein"
FT                   /note="KEGG: mja:MJ0530 hypothetical protein; TIGRFAM:
FT                   ZPR1-like zinc finger protein; ZPR1-related zinc finger
FT                   protein; PFAM: ZPR1-type Zinc finger domain protein; SMART:
FT                   ZPR1-type Zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68990"
FT                   /db_xref="GOA:D3S7I0"
FT                   /db_xref="InterPro:IPR004457"
FT                   /db_xref="InterPro:IPR004470"
FT                   /db_xref="InterPro:IPR040141"
FT                   /db_xref="InterPro:IPR042451"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I0"
FT                   /inference="protein motif:TFAM:TIGR00310"
FT                   /protein_id="ADC68990.1"
FT                   /translation="MESVQRLDCPVCGGKGTFVITSHQIDIPYFGPVLETTMICEKCNF
FT                   RRSDVFPLEVREPKKYILKIKSERDLNKRVVRSSSAYIQIPELGVEIKPGPLAEGFVSN
FT                   VEGVLNRVDNILQTLIRWAETEEQKKKAEELRERIKKLKEGKDEATLILIDPLGHSAII
FT                   GDGVEEETLSEEEVEKLKEGIVIVDLDKDKEKEKE"
FT   gene            287332..287496
FT                   /locus_tag="MFS40622_0295"
FT   CDS_pept        287332..287496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68991"
FT                   /db_xref="GOA:D3S7I1"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I1"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0466"
FT                   /protein_id="ADC68991.1"
FT                   /translation="MCTPISVTAMGALPTLSMMVPYVLGAVALMLAAAWSFVSAKVESI
FT                   AKTTATVTE"
FT   sig_peptide     287332..287409
FT                   /locus_tag="MFS40622_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.888 at
FT                   residue 26"
FT   gene            287553..287705
FT                   /locus_tag="MFS40622_0296"
FT   CDS_pept        287553..287705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68992"
FT                   /db_xref="GOA:D3S7I2"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I2"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0465"
FT                   /protein_id="ADC68992.1"
FT                   /translation="MCAPVSATTSVGASLISQALMIGEVIGFAGIIGVLLFVFKDTINA
FT                   VISRS"
FT   gene            287772..288617
FT                   /locus_tag="MFS40622_0297"
FT   CDS_pept        287772..288617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0297"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   mvu:Metvu_0464 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68993"
FT                   /db_xref="GOA:D3S7I3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADC68993.1"
FT                   /translation="MLSILSSMIKPKILQVETTNDCNSNCKICMRRFWKRGVGYMSYDD
FT                   FTKLPIQEFDEVALHGWGECFLHPDLFKMVKYVKQHNVKASLCTNGKLLGERLEEVLSS
FT                   GLDEIAFGIYTLDGKDDIINNIQALIEERNNRNINLAIFFDITVFKENLNEIKDIVEKA
FT                   IELGVDGVVFHRLFDIYNVDEGVKYDLTPKEEKEFFSLIKNKYSKQIPLYFPLKHTTPC
FT                   RVLLKCMFVRYDGLQSPCVYLSDDVLGDARNASYKEMLKRHIYFIKGVKKNAICRKCIW
FT                   "
FT   gene            288589..289179
FT                   /locus_tag="MFS40622_0298"
FT   CDS_pept        288589..289179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0463 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68994"
FT                   /db_xref="GOA:D3S7I4"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I4"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0463"
FT                   /protein_id="ADC68994.1"
FT                   /translation="MPSAENVYGKLYNDLTKFAIVYFLALIGYFSSLFSVESLWYNLFH
FT                   IRAPFLGMVLFGGFYYIIWIVIAKEVCGKYYGVMVATLIACFALLASPWFGVSNPPWFG
FT                   VVGLISFIIMGYLTERFNGAVGLPAAVIINWTVFWAFNPDVFAARYSISALVITFILSI
FT                   ISGFIGDYIGKYLGKVLKNYINFKNIPSSNLDQ"
FT   gene            289192..290652
FT                   /locus_tag="MFS40622_0299"
FT   CDS_pept        289192..290652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0299"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   mvu:Metvu_0462 tetratricopeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68995"
FT                   /db_xref="GOA:D3S7I5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I5"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADC68995.1"
FT                   /translation="MNKTTKIILGILCIIGAVGLVVYGYQTYKAEYLAAKYTNEGIPIL
FT                   REAIADGNMSAYKLADHYFDLAIKADPYYPWAWYNKANVYANTDHFYHYDKYPNETYIQ
FT                   AGLADEQKNYDMAMKCVHRFMELDPKDAPLGYQLIGAANYLYYDTYNDKVKYVLPPDFE
FT                   ALKGIDEIYKVSGKGGTASLLANIARTYLSMGEFNDSYKYYVYSQITDPKENPMAKYAI
FT                   PEGPAFEHLVWSAIILAELHDPKVNYALANKYCHMFVDNYGPKLGWTMDLGYMPTAVSA
FT                   YQLGKYDEVLKCCNLIINKYSNPKSDDLDDYSPYYGEANRYIAMVDMKKGDLEDAIKHL
FT                   KENIRFSSMMVPPADDYPADIPVGYYERGLAYYFLGKYTGNKSYYELALKDFKYLVDNP
FT                   NVSNRSIAHENYYFLGTVMTGCTYAKLGDYNNAQKYLKMALDELSTNEQLIGYNKYFRK
FT                   DTEMLYNEMKNKDFKGIDAFPWLWEIEH"
FT   gene            290956..291606
FT                   /locus_tag="MFS40622_0300"
FT   CDS_pept        290956..291606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0300"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: formylmethanofuran dehydrogenase subunit E
FT                   region; KEGG: mvu:Metvu_0708 formylmethanofuran
FT                   dehydrogenase subunit E region"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68996"
FT                   /db_xref="GOA:D3S7I6"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR026328"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I6"
FT                   /inference="protein motif:PFAM:PF02663"
FT                   /protein_id="ADC68996.1"
FT                   /translation="MKNLEKNIDNELEELVKFHGHLCFGLALGYRVGKVVRQYFSRAED
FT                   EELVAIVENDSCSIDAIQYMLGCTFGKGNLIYKDYGKHVYIFYSRIQKKAIKISVQGTL
FT                   LEYIENMVNTFEEYKEKLKKENDENETIKEKLKDFAKKLNNQIIEKVLTSSDDELFNIS
FT                   WIDIKPPKRAKIYRLVKCEVCGEYFIETKGRLINKKIVCKECFEKLLNQEDED"
FT   gene            291817..292275
FT                   /locus_tag="MFS40622_0301"
FT   CDS_pept        291817..292275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0301"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mja:MJ0531
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68997"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I7"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADC68997.1"
FT                   /translation="MYGENLYKKIVIPTDGSDVSLEAAKHAVNIAKEFDAEVYAIYVVD
FT                   VSPFVGLPAEGTWEMISELLKEEGHEALKKVKKLAEEWGVKIHTEMLEGVPAKEIVEFA
FT                   EKKKADLIVMGTTGKTGLERILLGSVAERVIKNAHCPVLVVKKPKKEE"
FT   gene            complement(292277..293452)
FT                   /locus_tag="MFS40622_0302"
FT   CDS_pept        complement(292277..293452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0302"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   glucose-inhibited division protein A; KEGG: mja:MJ0532
FT                   bacteriochlorophyll synthase 43 kDa subunit (ChlP)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68998"
FT                   /db_xref="GOA:D3S7I8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023590"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I8"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADC68998.1"
FT                   /translation="MRELNDIYDVVVVGAGPGGSMASYASAKNGTKTLLIEKSQEIGEP
FT                   VRCAEAIPSIEEFGIKPKPEFVRNIIKGGILFSPSGKKVTVTQDKAQGYIVERKIFDKY
FT                   LAIRAAKAGAKVAVKTTAIGLERDGDYWNVIVEFLGEEYVIKTKVVIAADGVESNIAEY
FT                   AGLKAKKKPLEICSCAEYEMTNVELLDKNMMEFYFGNEVAPGGYVWIFPKGETANVGLG
FT                   VRDKKKKAIDYLEEFIENGLAKDRLKDATPIEFKVGGAPVSGPIEKTYTDGVLVVGDAA
FT                   GQISPLTGGGIYLAMDCGLIAGEVASKAIKLNDWSEETLKEYERRWKEKHYEYLMNHLK
FT                   YRKILEKMSDDELDALAEALGESLDGIDLKKFVKRIITKKPSLLKYFKDLL"
FT   gene            complement(293452..293622)
FT                   /locus_tag="MFS40622_0303"
FT   CDS_pept        complement(293452..293622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0303"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mfe:Mefer_0022 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADC68999"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7I9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC68999.1"
FT                   /translation="MVKINYKKCGYCGACVGVCEKLAINLIEHIIVIDEEKCSNCKLCT
FT                   IVCPLNALEGE"
FT   gene            293792..294958
FT                   /locus_tag="MFS40622_0304"
FT   CDS_pept        293792..294958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0304"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   mja:MJ0534 flavoprotein (FprA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69000"
FT                   /db_xref="GOA:D3S7J0"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J0"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ADC69000.1"
FT                   /translation="MVLKIKDNIYCMSFIEWKAKEYRSLDINKGTTYNSYLISDKNNNV
FT                   LIDTVRMKSFDELLSNLKNIVNLKLDYIISSHISLDHNECIGKLVELIGAKVITTKIGK
FT                   YYLDAQFDTENWEFVIVKNGDEINIGNRTLKFITDSKFGHMLTYCVEDKILFSNDLFGQ
FT                   HVVYKEKIDIDVGHKIMPEAKEYFANILLPYRKSILKILNILKDLDLEYICPSHGVIWH
FT                   RMVDEILTKYRIWSSDSCKNVAVIVYATIYYSTEKIARALGEGLVEGGVDVIYHRLDTS
FT                   PLNIIVRDILDAKYVLIGSPTINMNVHPKIGMLLTYIEGLKPSNKKIGVAFGSYGWKEC
FT                   ATKRIIDVFKKLGFKIVDDEILTFRFPPKENDIKKIKEFGRKLAKIDV"
FT   gene            complement(294959..295978)
FT                   /locus_tag="MFS40622_0305"
FT   CDS_pept        complement(294959..295978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0305"
FT                   /product="Histone deacetylase"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   mja:MJ0535 acetylpolyamine aminohydrolase (AphA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69001"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J1"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ADC69001.1"
FT                   /translation="MPKILYNPDVLKHKPKFYHVENPERVETILNSLKLRGFNDIILIE
FT                   GKSSIDEVLEIHSKEYVNSIVKLCNDSFNYYDGDTYISHGTLDAALTAFKLAKEAVKLA
FT                   LKEKDLYFALTRPPGHHAGISGKALGAMSNGFCIFNNIAGAAGLAKKYLKRVIIIDFDV
FT                   HHGNGTQEIFWNDENVIHIDFHQKGIYPGTGDVFDIGGEKAEGTKINLPFPSHSTDFDY
FT                   IFAWNEVVEPILDYFKPDVVLVSAGFDAFINDGLASMDLTETFYRFVGAKLSKYSIAAV
FT                   LEGGYGVGLKYAPPAFLEGYIKAEDILDTLDEKYLVSPSNDIKLMVENVKRMIKEYIF"
FT   gene            complement(296076..296618)
FT                   /locus_tag="MFS40622_0306"
FT   CDS_pept        complement(296076..296618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0306"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: Pyruvate/ketoisovalerate
FT                   oxidoreductase; KEGG: mja:MJ0536 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69002"
FT                   /db_xref="GOA:D3S7J2"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J2"
FT                   /inference="protein motif:TFAM:TIGR02175"
FT                   /protein_id="ADC69002.1"
FT                   /translation="MRKEVRLSGFGGQGIILAGVILGRAAALYDNKEAVQTQSYGPEAR
FT                   GGASKSEVVISDEPIDFPKVIKPDILVCLSQQAYDKYKDDIKEGGVLLVDEDLVSTDKM
FT                   PEVDVTMYKIPFTRIASEEIKLPIVANIVMLGALTRLTNIVSKESMEKAILDSVPKGTE
FT                   EKNLLAFSKGYEFAEKL"
FT   gene            complement(296631..297443)
FT                   /locus_tag="MFS40622_0307"
FT   CDS_pept        complement(296631..297443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0307"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: mja:MJ0537 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69003"
FT                   /db_xref="GOA:D3S7J3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J3"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADC69003.1"
FT                   /translation="MHPALKYMRQDRLPHIFCSGCGNGIVMNCFLKAIDELNIKPEDYI
FT                   AVSGIGCSSRVPGYLYCDSLHTTHGRPIAFATGIKIARPDKHVVVFTGDGDLAAIGGNH
FT                   FIHGCRRNIDLTVICINNNIYGMTGGQVSPTTPYGKKATTAPYGSIENAMDLCKMAIAA
FT                   GASYVARWTTAHPIQLVKSIKKGIQKKGFAFIEVVSQCPTYYGRFNISRKPADMIKFLK
FT                   ENSIHINKAKNMSEEELNGKIVVGEFLDIEKPEFVEELHKLIERLKNE"
FT   gene            complement(297478..298257)
FT                   /locus_tag="MFS40622_0308"
FT   CDS_pept        complement(297478..298257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69004"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J4"
FT                   /inference="similar to AA sequence:KEGG:MJ0538"
FT                   /protein_id="ADC69004.1"
FT                   /translation="MIKIHALEEVKGNSKEIVEKEFENLANELKEKYNAKLRYVDEDIE
FT                   EEGNLKFYTKIGEFEINFDNFKDYINFCLKYGADIEVIKPEKLKLKANEINEVLALVIS
FT                   VFKSFVNTYKIGFNVYVKEKKDIDVEEYKKGKYDEDEIVDFEEEGFIRVKAVFEGIGKN
FT                   EEEVIKNLLISLDRDEIIINKIITKNFNENESFNGLIAVDLLCKPFEMFEIAYKYLPVA
FT                   LSIQRDEIELSLADIQDIGNELSGAIFELSHAVVMRK"
FT   gene            complement(298296..299888)
FT                   /locus_tag="MFS40622_0309"
FT   CDS_pept        complement(298296..299888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0309"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="KEGG: mfe:Mefer_0785 lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase; PFAM: Lysyl-tRNA synthetase, class
FT                   Ic"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69005"
FT                   /db_xref="GOA:D3S7J5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J5"
FT                   /inference="protein motif:TFAM:TIGR00467"
FT                   /protein_id="ADC69005.1"
FT                   /translation="MHWADVIAEKLIEERKADKYIVASGITPSGHIHVGNARETLTADA
FT                   IYKGLINKGVEAELIFIADTYDPLRKLYPFLPKEFEQYIGMPLSEIPCPEGCCESYAEH
FT                   FLNPYLESLDDLGVELTTYRADENYKKGLYDEKIKIALDNREKIMEILNKFRASPLPDD
FT                   WWPINIVCENCGKLKTKVIAYDSEKEEVTYRCEMCGYQGEVKPYKGRAKLPWRVDWPAR
FT                   WSIFNVTIEPMGKDHAAAGGSYDTGVLIAREVYNYEPPKKVVYEWIQLKVGDKAIPMSS
FT                   SKGVVFAVKDWTHIAHPEILRFLLLRSKPTKHIDFDLKKIPDLVDEYDRLEDFYFNNKD
FT                   KDELSEEEEEKIRIYELSTPKIPESKPFVIPYRFCSIIAQLTYDEEKKDVDMERVFEIL
FT                   RRNNYSIEDIDEFSMKKLKDRLLMARNWALKYGEKLVIIDENEAKEIYEKLKDKQKEWI
FT                   KYFAEKLKTTEFDALNLHELIYQTAKELGLNPREAFQASYMILLGKKYGPKLGAFLATL
FT                   GKDFVIRRYSLFE"
FT   gene            complement(300147..300404)
FT                   /locus_tag="MFS40622_0310"
FT   CDS_pept        complement(300147..300404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0310"
FT                   /product="Protein of unknown function DUF2097"
FT                   /note="PFAM: Protein of unknown function DUF2097; KEGG:
FT                   mja:MJ0540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69006"
FT                   /db_xref="InterPro:IPR019208"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J6"
FT                   /inference="protein motif:PFAM:PF09870"
FT                   /protein_id="ADC69006.1"
FT                   /translation="MEEIIDVKNPKKVIEYLNNIDVDEYVEIYFGRVHVEGRLMHYNDG
FT                   LIRLVHEKYGIIEVEIEKILDDLLELVHSNGEKRVVLRFY"
FT   gene            complement(300426..300932)
FT                   /locus_tag="MFS40622_0311"
FT   CDS_pept        complement(300426..300932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0311"
FT                   /product="nicotinamide-nucleotide adenylyltransferase"
FT                   /EC_number="2.7.7.1"
FT                   /note="KEGG: mja:MJ0541 nicotinamide-nucleotide
FT                   adenylyltransferase; TIGRFAM: nicotinamide-nucleotide
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69007"
FT                   /db_xref="GOA:D3S7J7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006418"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J7"
FT                   /inference="protein motif:TFAM:TIGR01527"
FT                   /protein_id="ADC69007.1"
FT                   /translation="MRGFIIGRFQPFHKGHLEVIKKIAEEVDEIIIGIGSAQKSHTLEN
FT                   PFTAGERILMITQSLKDYDLTYYPIPIKDIEFNSIWVSYVESLTPPFDIVYSGNPLVRV
FT                   LFEERGYEVKKPEMFNRKEYSGTEIRRRMLNGEKWEHLVPKAVVDVIKEIKGVERLRKL
FT                   AQTDK"
FT   gene            complement(301018..303315)
FT                   /locus_tag="MFS40622_0312"
FT   CDS_pept        complement(301018..303315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0312"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /note="TIGRFAM: phosphoenolpyruvate synthase; PFAM:
FT                   pyruvate phosphate dikinase PEP/pyruvate-binding;
FT                   PEP-utilising protein mobile region; PEP-utilizing protein;
FT                   KEGG: mfe:Mefer_0788 phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69008"
FT                   /db_xref="GOA:D3S7J8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J8"
FT                   /inference="protein motif:TFAM:TIGR01418"
FT                   /protein_id="ADC69008.1"
FT                   /translation="MKFIAWLDELSNEDVDIAGGKGASLGEMWNAGLPVPPAFVVTAEA
FT                   YRHFIRETGLMDKIKEILSGLDVNDTDALTEASKKIRKLIEEAEMPEDLRLAIIEAYNK
FT                   LSEMCGEDEVTVAVRSSATAEDLPGASFAGQQDTYLNIKGAENVVKYVQKCFSSLFTPR
FT                   AIFYREQQGFDHFKVALAAVVQKLVNAEKAGVMFTVNPITENYDELVIEAAWGLGEGVV
FT                   SGSVSPDTYIVNKKTLEIVDKYIARKETMFVKDEKGETKVVEVPEDMKEKQVLSDEEIK
FT                   ELTKVGLNIEKHYGKPMDVEWAYEKGKFYMLQARPITTLKKGKKEKKVKEEEIEAKILL
FT                   KGIGASPGIATGTVKIIRDVSEIDKVKEGDILVTEMTTPDMVPAMKKAAAIVTDEGGLT
FT                   CHAAIVSRELGTPCVVGTKKATEILKDGMIVTVDGEKGIVYEGEIKKVEEKKPEVTAVI
FT                   QQAPIITATEVKVNVSMPEVAERAAATGADGVGLLRAEHMILGLGKHPRKILEEEGEEA
FT                   LIEALMEGIRKVADAFYPRPVTYRTLDAPTDEFRGLEGGENEPIEHNPMLGWRGIRRGL
FT                   DEVDILKCELKAIKRLREEGYKNIEIMIPLVTHPDEVRKVKEIAREVGLELGKDIPFGI
FT                   MVETPAAALIIEDFIKEGINFVSLGTNDLTQYTIAIDRNNELVSKYYKEDHPAVLKLVE
FT                   HVIKTCKKYGIKTSICGQAGSRPHIVEKLVEWGIDSVSANIDAVETIRRVVARTEQKVI
FT                   LDYIRKSYLEKE"
FT   gene            complement(303506..304036)
FT                   /locus_tag="MFS40622_0313"
FT   CDS_pept        complement(303506..304036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0313"
FT                   /product="ribosomal protein L10.e"
FT                   /note="TIGRFAM: ribosomal protein L10.e; PFAM: Ribosomal
FT                   protein L10e/L16; KEGG: mja:MJ0543 50S ribosomal protein
FT                   L10e"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69009"
FT                   /db_xref="GOA:D3S7J9"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7J9"
FT                   /inference="protein motif:TFAM:TIGR00279"
FT                   /protein_id="ADC69009.1"
FT                   /translation="MIMASLRPNRCYRDVDKPPYTRKEYVKGVPQPKVVHFIMGNLSAE
FT                   FPVKVNLVATRPIQIRHNALEAARVAANKYLTKMCGRMGYKFQIRTYPHQILREHKMAT
FT                   GAGADRISDGMRLAFGKPIGTAARVKEGQAIMTVWVNPDKFPAAKEALRRAAMKLPVPC
FT                   RIVIEQGKELLKL"
FT   gene            complement(304170..304862)
FT                   /locus_tag="MFS40622_0314"
FT   CDS_pept        complement(304170..304862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0314"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   mja:MJ0544 dolichyl-phosphate mannose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69010"
FT                   /db_xref="GOA:D3S7K0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K0"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC69010.1"
FT                   /translation="MIAIVPAFNEEKNILKVLKDLEKLGIDAVVVDDGSKDNTSKVVEE
FT                   FAKNSEIKVYLIRNEKNEGKAKAIEKGTKFALSLNKYKYIIYIDGDYQHKPMDIPKLLK
FT                   KLRDTNADAVFGVRKYKHIPLHRQFSNFFASVLTSLAVFIYSKRFYFFRDVQCGFRIIK
FT                   AEFLKDINFGDGYAVEHFIALQLAKKGAKIVEEYVSVEYHDEAVSYITTKKILEVAKQV
FT                   IKFIFSEQ"
FT   gene            complement(304986..305729)
FT                   /locus_tag="MFS40622_0315"
FT   CDS_pept        complement(304986..305729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69011"
FT                   /db_xref="GOA:D3S7K1"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K1"
FT                   /inference="similar to AA sequence:KEGG:MJ0545"
FT                   /protein_id="ADC69011.1"
FT                   /translation="MKKFFLLLPLIFFLFATNYATNPDIIITPEKCLVNSSVYVIFQWR
FT                   APYAVEDFNVTVFSDAVEFENSTLHYAGVAEDAKVFHIFEGKAVKPGNHTIKVQMKYFV
FT                   DGIDVNKEFLFNIIILTLPEVTYPNNIKNETENISEIKLENTTTSENITKTFKNITTNI
FT                   TTVNTTNISINETNITLNETNKTENIKNTSTTTSQEKVTQKSNGTSTTQTVGNTQNTSN
FT                   WLTYGILGLIIGIVFGFIVMYIIKI"
FT   sig_peptide     complement(305667..305729)
FT                   /locus_tag="MFS40622_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.655 at
FT                   residue 21"
FT   gene            complement(305731..305901)
FT                   /locus_tag="MFS40622_0316"
FT   CDS_pept        complement(305731..305901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69012"
FT                   /db_xref="GOA:D3S7K2"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K2"
FT                   /inference="similar to AA sequence:KEGG:MJ0546"
FT                   /protein_id="ADC69012.1"
FT                   /translation="MILYVIVAISIILNIILGIKVIMLQKELEEVKRATRLTKEEVEKL
FT                   NERIRKLKLGG"
FT   gene            complement(305904..306698)
FT                   /locus_tag="MFS40622_0317"
FT   CDS_pept        complement(305904..306698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0317"
FT                   /product="cell division ATPase MinD"
FT                   /note="TIGRFAM: cell division ATPase MinD; PFAM: Cobyrinic
FT                   acid ac-diamide synthase; KEGG: mja:MJ0547 cell division
FT                   inhibitor MinD"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69013"
FT                   /db_xref="GOA:D3S7K3"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K3"
FT                   /inference="protein motif:TFAM:TIGR01969"
FT                   /protein_id="ADC69013.1"
FT                   /translation="MVTLMAIAIAIASGKGGTGKTTIAANLAVALAKFGKKVAVLDADI
FT                   AMANLELIMGLEGKPITLNDVLAGKADIKDAIYEGPEGVLVIPAGVSLEKFRRAKPEKL
FT                   EEVLKAIHDLVEILIIDCPAGIGKETLIAISSADGLIVVVNPEISSISDALKIIAITKR
FT                   LGTDIIGAIVNRVSNESTELGVKAIETILEVPVIGVVPEDPHVRKAAAFGTPLVIMYPD
FT                   SPAAQAIMEIAAKLVGVKYEAQLKKKKESFISRFIKGLFGRR"
FT   gene            complement(306783..307664)
FT                   /locus_tag="MFS40622_0318"
FT   CDS_pept        complement(306783..307664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0318"
FT                   /product="Uncharacterized conserved protein UCP019262"
FT                   /note="PFAM: Uncharacterised conserved protein UCP019262;
FT                   KEGG: mja:MJ0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69014"
FT                   /db_xref="InterPro:IPR016754"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K4"
FT                   /inference="protein motif:PFAM:PF09894"
FT                   /protein_id="ADC69014.1"
FT                   /translation="MSLIICYYGKNGAVIGGDRRQIFFRGEEQKRKILEEKLYSGEITS
FT                   EDELYNLARELNIKIIIEDDREKVRKISDSVVVGEVRSLGIDARRRRVYATKGKCAIID
FT                   ILNDTVTNQMIKEGFGVVVLGNRFLKKKAEEELKRTAKLFPMMPLQQIEDAIKEIFEKL
FT                   KWHPTISKEYDIYSVNKYEKDFEEVIKKDIESLFKYREQLRKQLIDFGKVMSIVNKIVK
FT                   NGEIGVIKDGKLHLYDNYIAIDKIDPNPKVFKVVEVEGNFKDGDIVVIENGDMKIKGTN
FT                   EKLTTNYIIIHK"
FT   gene            307773..308198
FT                   /locus_tag="MFS40622_0319"
FT   CDS_pept        307773..308198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0319"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein
FT                   DNA-binding domain protein; KEGG: mja:MJ0549 nickel
FT                   responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69015"
FT                   /db_xref="GOA:D3S7K5"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K5"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ADC69015.1"
FT                   /translation="MTEMDRISISLPSKLLREFDEIIAERGYASRSEAIRDAIRDYIIK
FT                   HKWIHSLEGERAGSISVIYNHHASDVMEKITEIQHNYTDIIVATLHLHLDHDHCLETIL
FT                   VRGDAKRIRELTDRLTALKGVKQVKLSVMVPGGQIPE"
FT   gene            complement(308202..309299)
FT                   /locus_tag="MFS40622_0320"
FT   CDS_pept        complement(308202..309299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0320"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mja:MJ0550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69016"
FT                   /db_xref="GOA:D3S7K6"
FT                   /db_xref="InterPro:IPR005909"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADC69016.1"
FT                   /translation="MNQIVNYDYKEFLKKLREKHLKKRKPRDKDKPIAVWIQDDIYRDF
FT                   SIGKSLTIILRTEGCYYAKEGGCLMCSYLMDSSPEKITAENIINQFNYAIEKYKEKINN
FT                   LKDFSVKIFTSGSFLDDREVPKEARDYIFKKLSEFDNLKEVAIESRPEFIDEDKLNEIR
FT                   KYLDVNVEIGVGIESFNEEIREKAINKGITNEQIIRVIELSKNYNVGIKAYLLIKPLFI
FT                   TEKEAIEDAIYSANKCIELGCSRISFCPATVHKGSVMEFFFNKNQYRPPFLWSVIEILR
FT                   EVKKSNPKALIMCDTSGVGSERGAHNLYNCKCNKLIKEKLERFTLMQDIDILNVECECK
FT                   KIWEAYIEVENKNIVPLGDEKKLLL"
FT   gene            complement(309357..310175)
FT                   /locus_tag="MFS40622_0321"
FT   CDS_pept        complement(309357..310175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0321"
FT                   /product="nitrite and sulphite reductase 4Fe-4S region"
FT                   /note="PFAM: nitrite and sulphite reductase 4Fe-4S region;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: mja:MJ0551 nitrite reductase
FT                   (NirA) isolog"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69017"
FT                   /db_xref="GOA:D3S7K7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K7"
FT                   /inference="protein motif:PFAM:PF01077"
FT                   /protein_id="ADC69017.1"
FT                   /translation="MHCNIDLKYGVIMKKDNYTLRISLKPGFINAEQLKAIAYVIENFG
FT                   DNRAHITTRQGIEFKISPEYLEDVEKILNSVNLSLGSTGNRVRQVVSCIGLECYNAIGD
FT                   SVSLARRIHEEFEGVWVPRKVKINVSGCPNSCTFHRFCDIGICYRYKITINKEKCSDCG
FT                   KCKDFCDLDAIDWENKIIKDTCTGEGKCIGLCDAFEAERVISIFVGGKGGRIYKEGKHL
FT                   IDLKTEDDVLLVIDELISLYAKFGKGRMADFVENYGIEKLKQDLYRIIFE"
FT   gene            complement(310192..310941)
FT                   /locus_tag="MFS40622_0322"
FT   CDS_pept        complement(310192..310941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0322"
FT                   /product="precorrin-6x reductase"
FT                   /note="TIGRFAM: precorrin-6x reductase; PFAM: Precorrin-6x
FT                   reductase CbiJ/CobK; KEGG: mja:MJ0552 cobalamin
FT                   biosynthesis protein (CbiJ)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69018"
FT                   /db_xref="GOA:D3S7K8"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K8"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ADC69018.1"
FT                   /translation="MKLLLMGGTKDSVEIGKKLKNLGDVFILYTSTTDYGGKLGEEFAD
FT                   EVIAKPLDKNELKDVIEKYNIDILVDATHPFAINASKNAIDVCKELDIKYVRFERKEEK
FT                   INHPNVIYVKDFIEAARLAKKANKVFHMAGIKNLKTVVDIVGKDKVIARVLPISVNEAL
FT                   KILPQKNIVAMYGTFSKELNKYLIKGYGCDAIITKDSGESGGFKEKVYGALEAGAKVIV
FT                   VERPKINYPICFDDVNELVNYIKNLTL"
FT   gene            311015..312067
FT                   /locus_tag="MFS40622_0323"
FT   CDS_pept        311015..312067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0323"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: peptidase M42 family protein; KEGG: mja:MJ0555
FT                   endoglucanase (CelM)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69019"
FT                   /db_xref="GOA:D3S7K9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7K9"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADC69019.1"
FT                   /translation="MSVVEYLKKLSKLHGISGREDSVREFMKKELEKYCDSVEIDNFGN
FT                   LIAKRGNSGKKIMIAAHMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVVVHGSKG
FT                   DLIGVLGSKPPHRMKEEEKTKIIKYEDMFIDIGAESREEAIEMGVNIGTWVSFLSEVYE
FT                   LGKYRLTGKAFDDRVGCAVLLEIMKRLSEEDIDCQVYAVGTVQEEVGLKGARVSAFKIN
FT                   PDVAIALDVTIAGDHPGIKKEDAPVDLGKGPVVGIVDASGRGLIAHPKVLEMIKAVSEK
FT                   YKINVQWEVGEGGTTDATAIHLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVY
FT                   NCIKEVNGFF"
FT   gene            complement(312074..312577)
FT                   /locus_tag="MFS40622_0324"
FT   CDS_pept        complement(312074..312577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0324"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: mja:MJ0556 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69020"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L0"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADC69020.1"
FT                   /translation="MSKFVKLHLVRTLNKYKELQKVRVKDVMVSGDVITTTPEKTIGEI
FT                   FDEMIKYNISGMPVVDDRGVMIGFITLREIRKYMMSHPYLNVGEVMLKNPPYTTADEDI
FT                   ITAFEKMIEFDKKLDQLPVINTKYPEKILGKLEGIIFMEDIIKLLYKNVIKELKILTTL
FT                   YNTK"
FT   gene            complement(312751..313368)
FT                   /locus_tag="MFS40622_0325"
FT   CDS_pept        complement(312751..313368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0325"
FT                   /product="Suppressor Mra1 family protein"
FT                   /note="PFAM: Suppressor Mra1 family protein; KEGG:
FT                   mja:MJ0557 ribosome biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69021"
FT                   /db_xref="GOA:D3S7L1"
FT                   /db_xref="InterPro:IPR005304"
FT                   /db_xref="InterPro:IPR023503"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L1"
FT                   /inference="protein motif:PFAM:PF03587"
FT                   /protein_id="ADC69021.1"
FT                   /translation="MSYNIILAKSALELIPEEIKDKIKKSRVYKYDILDSNYHYRAMEK
FT                   LKDREMRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFL
FT                   GVMEKVLKGEGNHLIKMEEKTLEDLLNEINAKKIALMTKTGKLTHPNHLKGYDTFIIGG
FT                   FPYGKLNIDKEKVFGDIEEISIYNKGLMAWTVCGIICYSLSF"
FT   gene            complement(313379..314164)
FT                   /locus_tag="MFS40622_0326"
FT   CDS_pept        complement(313379..314164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0326"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein;
FT                   SMART: regulatory protein Crp; KEGG: mja:MJ0558
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69022"
FT                   /db_xref="GOA:D3S7L2"
FT                   /db_xref="InterPro:IPR012015"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L2"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ADC69022.1"
FT                   /translation="MKKRNITEFQVLSEIIRKQPHIKQKEIAENLGITVQAVSEHIRNL
FT                   VKEGYVKSRGRGEYVVTEKGLRKLKNWISEFREYLDEINTAVYRYKDIWPAIAEEDIKD
FT                   GETVYLFMKNGLLYASKEPKGEAKAKALYGGKRGEDIAICEIKGIIDVPKGKVIVFRIP
FT                   PEVVGGSRAVDFDLIKNNLNNLDDYVIATMGTVAYVVAHKLGLKPDIRFAVPEAIVNAC
FT                   NRGCNVVALITGKMAEKVIKKLDNAKISYTVLDATKENM"
FT   gene            314257..315057
FT                   /locus_tag="MFS40622_0327"
FT   CDS_pept        314257..315057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0327"
FT                   /product="stationary-phase survival protein SurE"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: mja:MJ0559 stationary phase survival protein
FT                   SurE; TIGRFAM: stationary-phase survival protein SurE;
FT                   PFAM: Survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69023"
FT                   /db_xref="GOA:D3S7L3"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L3"
FT                   /inference="protein motif:TFAM:TIGR00087"
FT                   /protein_id="ADC69023.1"
FT                   /translation="MEILIVNDDGIYSPSLIALYNALKERFEDAEITIVAPTNQQSGIG
FT                   RAISLFEPLRMTKVKLAKDIIGYAVSGTPTDCVILGIYQILKKVPDLVISGINIGENLG
FT                   TEIMTSGTLGAAFEAAHHGAKSIASSLQITSDHLKFRELEIPINFEIPAKITAKIAEKY
FT                   LDYDMPCDVLNINIPENATLETPIEITRLARKMYTTHVEERVDPRGRSYYWIDGYPIFE
FT                   EEEDTDVYVLRKKGHISVTPLTLDTTIKNLDEFKNKYGKILCEK"
FT   gene            complement(315071..315487)
FT                   /locus_tag="MFS40622_0328"
FT   CDS_pept        complement(315071..315487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69024"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L4"
FT                   /inference="similar to AA sequence:KEGG:MJ0560"
FT                   /protein_id="ADC69024.1"
FT                   /translation="MKIVRVEFSSYEDFYDFEFIAPDDVTEEKFINDLAEAIVKSIKWE
FT                   ELKRSEKLMGKLIEYDEFGLDLIDCIDFKNVYKEMEKRGYKPLKYDIIVYAGAWTYINP
FT                   KTLKITDFHNTGELTKLEKAIQEKLQKLRKSGLY"
FT   gene            315766..316788
FT                   /locus_tag="MFS40622_0329"
FT   CDS_pept        315766..316788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0329"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: mja:MJ0561 adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69025"
FT                   /db_xref="GOA:D3S7L5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L5"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADC69025.1"
FT                   /translation="MTCTIIVGGQWGDEGKGKIISYICDKDKPSIIARGGVGPNAGHTV
FT                   NIGGKSYGIRMIPTGFPYKEAKLAIGAGVLVDPEVLLKEVEMLKDFNVRERLIVDYRCG
FT                   IIEEKHKIMDKKDEHLAKEIGTTGSGCGPANVDRVLRILKQAKDIEELKEFLGDVSEEV
FT                   NNALDREENVLIEGTQGTLLSLYYGTYPYVTSKDTTASSFAADVGIGPTKVDEVIVVFK
FT                   SFPTRVGAGPFPTEMSLEEAESLGIVEYGTVTGRRRRVGYFDFELARKACRLNGATQIA
FT                   LTGLDKYDKECYGVTEYSKLTEKAKEFINKIEEATGVPVTIISTGPEMHQTIDLRSEKL
FT                   "
FT   gene            complement(316957..317889)
FT                   /locus_tag="MFS40622_0330"
FT   CDS_pept        complement(316957..317889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0330"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: mvu:Metvu_0366
FT                   DNA-cytosine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69026"
FT                   /db_xref="GOA:D3S7L6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L6"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ADC69026.1"
FT                   /translation="MNVIDLFSGCGGFSKGFLDENFKILGAIENFKPVVKTYLYNIKAP
FT                   VWMDDIKRIPPKAFDEFIKNEKVDVIIGSPPCEPFTKANKLIKDNPLDRLYKDKVGRLV
FT                   LYYIDYVNYFTQKNDDLIFVMENVPQIKEIKDELKKLFGDIGHKVYFNILRAEDYGNPS
FT                   KRARMFISNIKLKPKKADKIVVVEEALKDIPKDAKNHEIKKLSKEKVEMISKLKWEEAL
FT                   YRYRGKKKLMFNWYRLHPHKLAPTVKGRSRFIHPYEDRLLTVREQARLMSYPDDFVFFG
FT                   GRDAQYNQIGESVPPILSKIIAKEVKERL"
FT   gene            complement(317987..318115)
FT                   /locus_tag="MFS40622_0331"
FT   CDS_pept        complement(317987..318115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69027"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69027.1"
FT                   /translation="MGMKCLIKIIGSLFISFDETEALASGYKSVRICSTESKAFWL"
FT   gene            complement(318162..320840)
FT                   /locus_tag="MFS40622_0332"
FT   CDS_pept        complement(318162..320840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0332"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="KEGG: mja:MJ0564 alanyl-tRNA synthetase; TIGRFAM:
FT                   alanyl-tRNA synthetase; PFAM: Alanyl-tRNA synthetase, class
FT                   IIc-like; Threonyl/alanyl tRNA synthetase SAD;
FT                   phosphoesterase DHHA1"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69028"
FT                   /db_xref="GOA:D3S7L8"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR022429"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L8"
FT                   /inference="protein motif:TFAM:TIGR00344"
FT                   /protein_id="ADC69028.1"
FT                   /translation="MEHNYKVKLFDELGFVRKQCKKCGQYFWTLDPERETCGDAPCDIY
FT                   SFIGKPITKKPYTYKEMVNEFINFFKEHGHEPIKRAPVTARRWRDDILLTIASIAVFQP
FT                   WVTKGIVKPKANPLVIAQPCIRLNDIDNVGRTGRHLTCFTMGGHHAFNREDDFKYWQDE
FT                   TVELCFNFFKKLGIDEKSITFIESWWEGGGNAGPCYEVITHGVELATLVFMQYEKVGDS
FT                   YKEIPLKIVDTGYGIERFVWASTGEPTIYDAIFKNIVNKLKDDAGVEDIDKEILAKITE
FT                   VAGLMDVKDVGDLRKLREEVAKKVNIPVDELDKLISPYEDIYAIADHTRALAFMLGDGI
FT                   VPSNVKDGYLVRMLIRKTLRHMDRLNLSIPITEIVAMQLNEMRDLYPELLDMEDYIMEI
FT                   LEIETNKYRQTIERGKGIVERLLKSKKSIDLDNLIELYDSHGLPPEIVKDVAKSLGKDI
FT                   SIPDNFYTIVAERHENKEEVKEKVKLPEVDVEKTELLFYKYPKMKEFEAKILKVVNDYV
FT                   ILDKTAFYPEGGGQKADTGYIIKGDKKFRVIDVQKENDIVYHKIENLDNELKEGDTVKG
FT                   VIDWDRRLSLMRNHTATHIINAAAQKVLGKHVWQAGSDVDVDKARLDITHYKRISREEL
FT                   KEIERVANEIVLNNYNVKSVFMDRNEAEEKFGFRIYQGGVVPGNILRIVIIEDENGNIV
FT                   DVEACGGTHCQNTGEVGFIKIIKTERVQDGVERLIYSSGLSALKAVQEMEDTLEESAEI
FT                   LRCPTEELPKVIKRFFEEWKEQRKKIEELEKKIGELKKFELMNKFETIGNYKVLVEKVE
FT                   ANPKEMLNIADNLANENAIVVLLNDKDNILCKRGESVDINMAELIRYIAKGGGREHLAQ
FT                   GKYEGDVEEIKKKVIEFIKNK"
FT   repeat_region   complement(321361..322330)
FT                   /rpt_unit_range=321361..321391
FT                   /note="CRISPRS"
FT   gene            322546..323025
FT                   /locus_tag="MFS40622_0333"
FT   CDS_pept        322546..323025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0333"
FT                   /product="Protein of unknown function UPF0113"
FT                   /note="PFAM: Protein of unknown function UPF0113; KEGG:
FT                   mfe:Mefer_0076 protein of unknown function UPF0113"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69029"
FT                   /db_xref="GOA:D3S7L9"
FT                   /db_xref="InterPro:IPR005155"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR040598"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7L9"
FT                   /inference="protein motif:PFAM:PF03657"
FT                   /protein_id="ADC69029.1"
FT                   /translation="MKVRELKKREIDLVKEELSKYANEDFVKEFEYENLVILEGKWLTV
FT                   CYTNKQTIRNLNKFQDIFSVGNVFGEIKRKFRLSLEGFTLISPNIINNYAIINEKGEML
FT                   FLYGRDIFKESIIEVKGSGRIAVFNKNREFLGIGFWDNKMIKNIKDKGWYLREGG"
FT   gene            323184..323981
FT                   /locus_tag="MFS40622_0334"
FT   CDS_pept        323184..323981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69030"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M0"
FT                   /inference="similar to AA sequence:KEGG:MJ1409"
FT                   /protein_id="ADC69030.1"
FT                   /translation="MKAKELAQKILLDIYRNLDEFSKDIIRGDLADIEFKGFYLKGKNG
FT                   EKAYVRNLEDFENLEDFDVEMRKYRLKSINLKNLDDGLMIINLSSRASKEYKFEANEYS
FT                   IIYPSNNTTVEFKERVLKWMELEDDELDEKIIEFDTKMNEILEELLEEIEIDKEISVYI
FT                   DVFMDVNKIENFVEKDDERIIIWIHPVFLFSNDDVLRGLLAYELSRFKSKFLEVGYKDI
FT                   IKYCKELKKLTNKKPKVLEKIKDIANRYGDTDSLNLIDEIENE"
FT   gene            complement(324070..325107)
FT                   /locus_tag="MFS40622_0335"
FT   CDS_pept        complement(324070..325107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0335"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: Nucleolar
FT                   GTP-binding-1 domain protein; KEGG: mja:MJ1408 GTP1/Obg
FT                   family GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69031"
FT                   /db_xref="GOA:D3S7M1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M1"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADC69031.1"
FT                   /translation="MSREANPFKKMPTILMPDELMAKALRRGEKVASEMRKKELPWLLK
FT                   ARFVEEHKVRTIASVVADNLQKVIDKTPPVRKLPKFYQEMVEVLVGIDDFKKSMGAFKW
FT                   ASELVRKLGNEYARKIRAAKTPQQAGKLRKEFVGRVKSILEQIHPEMAFVAVAREKLKD
FT                   LPTFKDLPTVVIAGYPNVGKSTLLKKLTGADVEINSYPFTTKGINVGYMEEIQMVDTPG
FT                   LLDRPLYERNDIELQAILALNYLANLILFVIDASEFCGYTIEEQINLLKEIKELFKVPI
FT                   VVAINKIDLVDEERIKAIEERLKELGISEILKISADKGIGLDELKESLKKTAIKEFLKD
FT                   KESET"
FT   gene            complement(325194..325583)
FT                   /locus_tag="MFS40622_0336"
FT   CDS_pept        complement(325194..325583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0336"
FT                   /product="protein of unknown function DUF126"
FT                   /note="PFAM: protein of unknown function DUF126; KEGG:
FT                   mja:MJ1407 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69032"
FT                   /db_xref="InterPro:IPR002840"
FT                   /db_xref="InterPro:IPR012016"
FT                   /db_xref="InterPro:IPR020794"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M2"
FT                   /inference="protein motif:PFAM:PF01989"
FT                   /protein_id="ADC69032.1"
FT                   /translation="MELKGRSISKGLIEGIAIVSKKPFSFLGGVDEEGNIIDKDSDLYG
FT                   QSLKGKIFVFPYGKGSTVGSYVIYGLAKKGILKGIVNKECEPIVATGAILGGIPLVDKI
FT                   DIEKIKTGDRIVVDGNTGVVKILNK"
FT   gene            complement(325718..326158)
FT                   /locus_tag="MFS40622_0337"
FT   CDS_pept        complement(325718..326158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0337"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: Aspartate carbamoyltransferase regulatory
FT                   subunit-like; KEGG: mja:MJ1406 aspartate
FT                   carbamoyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69033"
FT                   /db_xref="GOA:D3S7M3"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M3"
FT                   /inference="protein motif:TFAM:TIGR00240"
FT                   /protein_id="ADC69033.1"
FT                   /translation="MEELKVKKITNGTVIDHIDAGKALMVFKVLNVPKETSVMIAINVQ
FT                   SKKKGKKDILKIEGIELKKEDVDKISLISPDVTINIIRNGKVVEKLKPQIPDEIEGILK
FT                   CTNPNCITNKEKIRGRFKIESKNPLKIRCYYCEKFLNEVVFE"
FT   gene            complement(326226..327482)
FT                   /locus_tag="MFS40622_0338"
FT   CDS_pept        complement(326226..327482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0338"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: mja:MJ1404 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69034"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR014651"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M4"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADC69034.1"
FT                   /translation="MLNEPVKEIMTKDVVTVTPDTPVSKALGIMEENGFHHLIVVEKKD
FT                   GKEEYYLISMRDLLLASSTHEEVRSLMYKAHCIHEDTPFLDAVCEMLDSGQRAAPIVNS
FT                   VGKMVGIITDYDIMARASKSIIMKDTKVTKIMTRNVITINENDSIGKARALMRDNNIGR
FT                   LVVVDDEGNPVGMVTEVDILKKVFKPKKKMTVGEFKGEKVPRMGQPVRLIMNTPLITVD
FT                   VDASAADAARVMQEYDIRGVPVVKGKSLRGIVTRLDIIKYIADLKKGAMIEIELHGMLD
FT                   PEFKDLAERIIATEVKKMVKHAGRIHWIKITIKKDRDKGGVPYYRITTYVKTPNKLYVG
FT                   EGRPKASLPNKLEAEGEDIAYVSEHERWEFIDILKESLESVLRQLEADYEKHHPKYTGR
FT                   IVKGQFPEEFNPEEFKKEE"
FT   gene            complement(327725..328804)
FT                   /locus_tag="MFS40622_0339"
FT   CDS_pept        complement(327725..328804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69035"
FT                   /db_xref="GOA:D3S7M5"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M5"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1364"
FT                   /protein_id="ADC69035.1"
FT                   /translation="MIDWLKNKKAISPILALLIVLGVTIVVGAVFYAWGSGLFNNSQQK
FT                   TESALEGTTTTMAYDAGAIGVAVPKEIDVEGDLDLGDVLQYYYYGVLYNSSDASKYKLN
FT                   ALAKDSSWGTLYDERIIVPVPISLENYYDSALTNVKIESDGTNEVAGLTLKKITLNYNG
FT                   QSYDAYLLCTNDGTPFKGILNRTGIYPDATWVGDDGNNYTSVYYILAPNSVTKVAAVND
FT                   SKDLSVTDVSQWGDSTHRQSMRLYAGGFNNFYYACAVNGSYSGDTLTATKFIGWNTGFA
FT                   FNKYITPIDAKFYTSEWDVGTLHSRERVSKDIYFFFGSSMGFQEETSGVTTVNIPVKVV
FT                   SDQGAYKQVDVKIVLKDRL"
FT   sig_peptide     complement(328718..328804)
FT                   /locus_tag="MFS40622_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.831) with cleavage site probability 0.479 at
FT                   residue 29"
FT   gene            complement(329121..330194)
FT                   /locus_tag="MFS40622_0340"
FT   CDS_pept        complement(329121..330194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69036"
FT                   /db_xref="GOA:D3S7M6"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M6"
FT                   /inference="similar to AA sequence:KEGG:MJ1403"
FT                   /protein_id="ADC69036.1"
FT                   /translation="MIDWLKNKKAISPILALLIVLGVTIVVGAVFYAWGSGLFNNSQQK
FT                   TESALEGTTTNMFYDTGAIRVAATCIDKIRYQDADDSDSWLGYPSGNGKIAKPSTSNGC
FT                   YNSTYGTVFYDERFIVEIPVTIDTEGYELTGVKVIGGIPQIVDMGGTYTDAFESISAKF
FT                   YAFWLHLNDNYQLLMKNGTLFVGYVNSSGMFEVPTGYAIAWNQTRDTYGKLSSTTGAIS
FT                   SSDWDSVNTTTGVAPLVEAGWPYYGTYCSNVKLYTATGEELKPGFGPGTLVAQWFCSSS
FT                   TCLDKLFNNPEYDVGTLPKNSEKTVKTYLFFNSLYLPNYKGTTNDGYVTFEVPLKVVSN
FT                   EGVTKEVKVKFTVYDDE"
FT   sig_peptide     complement(330108..330194)
FT                   /locus_tag="MFS40622_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.480 at
FT                   residue 29"
FT   gene            330618..331682
FT                   /locus_tag="MFS40622_0341"
FT   CDS_pept        330618..331682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0341"
FT                   /product="Protein of unknown function DUF553"
FT                   /note="PFAM: Protein of unknown function DUF553; KEGG:
FT                   mja:MJ1282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69037"
FT                   /db_xref="InterPro:IPR007562"
FT                   /db_xref="InterPro:IPR022651"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M7"
FT                   /inference="protein motif:PFAM:PF04473"
FT                   /protein_id="ADC69037.1"
FT                   /translation="MRRIILMFLLFLILTNTSAFEKTYDIDHVSYYTLASAKFQKFVKN
FT                   AEIITPLNADNKTTITKDTILVGTPNDNPLIKKYIWAFKIKVNETFPGKNKGVIEKQII
FT                   NGHTVILLAGSDIQGTYASIITFANLNDIPEKPIICETSNEVKTYSISLNSEYFREFVE
FT                   EEILTPEEIEKVKSLSNKLRGKDKKSTIENIAKWVANNIHYDYNKLQKIEQNKYKSWKD
FT                   IYNTPLKTVSTKKGVCLDYATLTSALLLNNNITPYILDVALYNPSSLKISSYHTSVAVK
FT                   INNTYFVIDQQPNLIPINEYVTTTFMRNQKIASIVMFKVVKERDSIKLIKEKEIPTVAI
FT                   YEDLIKLLEMRFNN"
FT   sig_peptide     330618..330683
FT                   /locus_tag="MFS40622_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.675 at
FT                   residue 22"
FT   gene            complement(331659..332423)
FT                   /locus_tag="MFS40622_0342"
FT   CDS_pept        complement(331659..332423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0342"
FT                   /product="Peptidase A24B, FlaK domain protein"
FT                   /note="PFAM: Peptidase A24B, FlaK domain protein; peptidase
FT                   A24A prepilin type IV; KEGG: mja:MJ1282.1 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69038"
FT                   /db_xref="GOA:D3S7M8"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M8"
FT                   /inference="protein motif:PFAM:PF06847"
FT                   /protein_id="ADC69038.1"
FT                   /translation="MDLAYIYGLICSIYGAVEDWKKREVSDFLWISMLWVGVLVHFLYN
FT                   KSLLTIFIEILAILFITISVRYEKFNKLVYVGIFLFLLSFILFKSYFALSFLIFYLIGI
FT                   FLYYLNFMGGGDCKFLMGLGYLKGMFFTFVIFLNAILFVIPYCLAILLINIKNKSYKGL
FT                   KLKNLPLLFIALKKDIDDVKKFESIMGDDENFSLIPNINEEKEDKKIYKGKVWVTPQIP
FT                   FLVFISFSYVLYMIYPFPAIFKIIELVVKSHF"
FT   gene            complement(332435..333592)
FT                   /locus_tag="MFS40622_0343"
FT   CDS_pept        complement(332435..333592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69039"
FT                   /db_xref="GOA:D3S7M9"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7M9"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0508"
FT                   /protein_id="ADC69039.1"
FT                   /translation="MVEMNKKGQFFIIGGVILSIGLILFFLLGFSSQVSDNSYLAVFKM
FT                   KDVKNSIESCLVCSLNSNSNLSEKLEMLKNNYKDEGIEINYKKIVYSNIKYEAKNLTFN
FT                   FSLYNGNFSYNISNHGFGESFNGSLNVSNPTFSKNLSLNISENSSVAGSFNISGGDYAK
FT                   VFIYDRFGNLILNETIYNNTNCWKLLYYYILNVSKEGDFAIFIMAKNTFNNSLAENVSF
FT                   INTSGYFNSYLNKTYINISINGSFSGILYVKSSQKNYTVIINSSSSFIFNDTIPPINIE
FT                   LLNNYSDVVFNYNLNESINNFTDTSYFILNESCKNNYFNVIYGNSSMLYVSLHSKEFNH
FT                   NITIFNPQKGISSKGFVLADISIITPRMFYSSLNNSFEYQSWNIG"
FT   gene            complement(333580..333945)
FT                   /locus_tag="MFS40622_0344"
FT   CDS_pept        complement(333580..333945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69040"
FT                   /db_xref="GOA:D3S7N0"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N0"
FT                   /inference="similar to AA sequence:KEGG:MJ1284"
FT                   /protein_id="ADC69040.1"
FT                   /translation="MIFNNKGFIRIIEATVASIMVIFIFSYLVASQNFDYNLSLKFIGY
FT                   NALYSAYIEEGDFENISSLYKKIELPSNIGYGFEIYKNGKLMYSDAKSGVIVERNFIFE
FT                   NNTSVNFYKLRLILWWR"
FT   sig_peptide     complement(333853..333945)
FT                   /locus_tag="MFS40622_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.640) with cleavage site probability 0.430 at
FT                   residue 31"
FT   gene            complement(333942..334499)
FT                   /locus_tag="MFS40622_0345"
FT   CDS_pept        complement(333942..334499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69041"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N1"
FT                   /inference="similar to AA sequence:KEGG:MJ1285"
FT                   /protein_id="ADC69041.1"
FT                   /translation="MELDYLLATVIFLIVSAYVVAEVVNLYSGVYDVEDARKEFLMYYN
FT                   DLKYNFSPVKGDLIFNFKVNKISYIIEGFVLKNTSESRELVRYLESLNGSYIIAYSPPK
FT                   DEFIVTKNYEFLKIVGNYNVSAEYKRGEYEDIKIIYPKNYSIEYREFQTINCNKLFEVP
FT                   FCIVDKNENISVKYYGMLDVGR"
FT   sig_peptide     complement(334434..334499)
FT                   /locus_tag="MFS40622_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.841 at
FT                   residue 22"
FT   gene            complement(334502..336232)
FT                   /locus_tag="MFS40622_0346"
FT   CDS_pept        complement(334502..336232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0346"
FT                   /product="Type II secretion system F domain protein"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   mja:MJ1286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69042"
FT                   /db_xref="GOA:D3S7N2"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N2"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ADC69042.1"
FT                   /translation="MGFFANLKLKYYKLAIKIFKIEDEKFDEILLKAGINAVSSTYLPV
FT                   VFLTSIIVGFIMFILFLILFNIFYAIFALLGGVFVTIFLGVLYPYILAEEKAKSIDENL
FT                   PYAFAFISALSSANIPVVEIFSSLSKEDIYGGMSKEAKEIVKDTKVFNYDIITTFLRRA
FT                   RITPSKKLSAVYYNIVASLIVGAEMKTIFYEIYERLMEERKLELLEAIEKVEILSEFYV
FT                   IACGMIPLFVVMTVPVASSISAILQTMSFFGDPRLLPLTFYLWVPIASIIYMGLVYGIL
FT                   PKDFKLNISLLDVLKEFDEPEIEGIKMKFKWKPIHFITLFFWMLSMIFFLLFFIGKSIF
FT                   TLHRTDFLMFGILFLILPFILTSYWRFIIENQKERYYPIFLNDLTMAVRSGMDIIRAMQ
FT                   VCARTNYGPLTKIIKKMAIQMSWGRPVNEVFADLERTERSLIAKRIASILKECAVSGGD
FT                   IKDILTSVTVHAYRLSEMKREISARQFIYVVVIYLSFFLYLGTSYIMIHSLLPTLLKNV
FT                   QGLGIEFYKNYLFQGILIYSIFSGASLGILTERSVIAGIKHILVMLIVGYLLFKLYIGG
FT                   "
FT   gene            complement(336235..337845)
FT                   /locus_tag="MFS40622_0347"
FT   CDS_pept        complement(336235..337845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0347"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   mvu:Metvu_0512 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69043"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N3"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ADC69043.1"
FT                   /translation="MEIKALKKLVSKGSEKNIKIDFNINNIKRIFKLEKDAKKDEKGDE
FT                   NYINLLKEVYEEIKNLEIYEKMTIGMADVVIGYDRVEKLKKYIVIEPILTKEEIELFLK
FT                   LRKVVQVLLDIPVEEIEKEKLEEYLKERINEIFDDLKLTLDEVTRHKLIYYLVKYLIGY
FT                   GKIDVLMKDKNLEDISCTGVGKPVYVFHRKYEHLKTNIKFETDEELDSFCISLAQRCGK
FT                   SLTLANPIVDGSLPDGSRLNVTLGKDISRYGSTFTIRKFTHTPILPTDLIRYGSISPEM
FT                   LAYLWLLIEYKNSVMVAGEVATGKTTLLNAFSLFIPPQMKIVSIEDTPEIRLYHENWIA
FT                   GTTRGGFGGKEYEITMMDLLKAALRQRPDYLIVGEVRGEEAKILFQAITTGHLALSTIH
FT                   AKSPEAVIRRLNAEPMNIPKIMLEQLNAICMQVRLIYKGKFVRRTKSITEIVEYDPKID
FT                   DIILHDVFWWNPEEDTFEFSGKSYLLRRIAEFIGISEKEIINELYNRAEFLRNLCETRP
FT                   NFEEFVKKICEYKKYHKGD"
FT   gene            complement(337851..338222)
FT                   /locus_tag="MFS40622_0348"
FT   CDS_pept        complement(337851..338222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1288.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69044"
FT                   /db_xref="GOA:D3S7N4"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N4"
FT                   /inference="similar to AA sequence:KEGG:MJ1288.1"
FT                   /protein_id="ADC69044.1"
FT                   /translation="MHIVVKAILLMGVSVLVILFASTIYYELAEVGEYRYINKVDREIS
FT                   SEVMNAVVLANEGNITLYKKIKLNCKVVFENNSFTIIFQNKTYVHKFSNNIQFAKNKLS
FT                   EISKISCEKVNNTYMIYVK"
FT   sig_peptide     complement(338157..338222)
FT                   /locus_tag="MFS40622_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.696) with cleavage site probability 0.649 at
FT                   residue 22"
FT   gene            complement(338225..338722)
FT                   /locus_tag="MFS40622_0349"
FT   CDS_pept        complement(338225..338722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0349"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69045"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N5"
FT                   /inference="similar to AA sequence:KEGG:MJ1289"
FT                   /protein_id="ADC69045.1"
FT                   /translation="MNTYISTILVITTLFAFSIIAYEWGNNIIDTTLSHVSKEKEEKNI
FT                   EIIKNLINDVICSGVNSERTFDETKIILKEQSVKISNGTDYVSFKVTTIEGIDYDVYLE
FT                   RGTLYIFIYNISAPYSDVYYIKYINSSIYDFGGNVTINYSNNIRYYYVNRSKVYVYDIL
FT                   MG"
FT   sig_peptide     complement(338657..338722)
FT                   /locus_tag="MFS40622_0349"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.714 at
FT                   residue 22"
FT   gene            complement(338719..339630)
FT                   /locus_tag="MFS40622_0350"
FT   CDS_pept        complement(338719..339630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69046"
FT                   /db_xref="GOA:D3S7N6"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N6"
FT                   /inference="similar to AA sequence:KEGG:MJ1290"
FT                   /protein_id="ADC69046.1"
FT                   /translation="MKKIIGLLILCVFGLSFIYAENISDISNTTYKNTSSVSVPYESIN
FT                   YNEILYITVKNNTAYVKDIINGTNNPYYVKSAGIILYEKIYGYNYSNLLYSNSSNSVVF
FT                   YYNFTLEKVNNTINITIPQLEDYIGSLGGPIRMRIPPSDVKIAIMAEDKLAETNGKYIL
FT                   EYNKTDKKVISLIYLDDISSICNIYYTKFFNASKFCGYSIMNVTSINENETSYIIKNPK
FT                   GTFTFKKRYNVFISNKTAYLEEPYLYVKLYDSTLNDVIVLGEENSENSTKPITGYLLCF
FT                   IGIIIGFGMIGLAIYLSRRGRR"
FT   sig_peptide     complement(339568..339630)
FT                   /locus_tag="MFS40622_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.911 at
FT                   residue 21"
FT   gene            complement(339645..340367)
FT                   /locus_tag="MFS40622_0351"
FT   CDS_pept        complement(339645..340367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69047"
FT                   /db_xref="GOA:D3S7N7"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N7"
FT                   /inference="similar to AA sequence:KEGG:MJ1291"
FT                   /protein_id="ADC69047.1"
FT                   /translation="MNNSGMSLIITMLLLIGTAIVIGTAYYLWSNNVFNDATEKITPTI
FT                   TSSIGEVIKPIEISTIDTYYFTNLDLNGDNQITNNPEERFIETIRLEFINNIKDDLIVN
FT                   TRIYCLTPNVSWASVNIDENNNSLLLDRDGNPYNYSGYYVYFNGTTYYSSMKFYDENGK
FT                   LYYAAASNGNALNTSNLLDLIDLNCPTKSFLLKGDSKKSISYYILINNTKVPNTIIFKI
FT                   VASTKYGDVEKKITFEIS"
FT   gene            340612..343752
FT                   /locus_tag="MFS40622_0352"
FT   CDS_pept        340612..343752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69048"
FT                   /db_xref="GOA:D3S7N8"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N8"
FT                   /inference="similar to AA sequence:KEGG:Metvu_0517"
FT                   /protein_id="ADC69048.1"
FT                   /translation="MKLKFIILLFALCLAIFTVNGLEIKDVDYYDSSQYLVITVSNPDN
FT                   NINANISIIGYINNKIDTQICLYNYTIPKESIYFISKKVIFKEKGMHIIQILIKDSKGN
FT                   VYVFSKKINITWAYNSKVPVYPEEIPTPIIEIEGISFGISPTYNELPFYDIMYVTVRNN
FT                   DIIPHYVNVYVSGSVIGKEYAVQNDKIVEINYQNNSALISWSPHVYVPPKSKVVVPLKV
FT                   NFEYSGEYKIIVKATDENNNHIEKTIENTSPELVSLTNNTDVKIYKINIQNPLDVYDIE
FT                   CENGYEDYCYSNWFDIKVNNTVDYDVYGTLRIFLCEKEGNYYKIFDNVTISKYFLGRGL
FT                   GEGYVIPIKLDTSKLNPYNKNFVVFVLYNTGGFKSYFYKTFKKPITINGLEVKNYPKHY
FT                   YFVDENIYYDVYVNITNNLSKRIYANISITDIYNKTYSMEVKLNRSYNIVKFRGLKINA
FT                   KELSHNGKIRLKFIITAITPPYEKYYIIKKNETPELSLIPTPPVCVQDNLNDEIFAGYY
FT                   QNISFVLKKLVGKTVYARVYITVPKEIKNSAFFDEKYLKIGTMKEIPVNIKTIFLKEYN
FT                   GPIYIHVDTEGGVRECVVTRIIKVRPIVSCYDVYLNNYSVYIKIRNRTQGFVSNEPIVG
FT                   YPVNVTVYLKSAVPNLKGIEIWAVAMDKNGKLINCSKKKKINIYGTYKKVNISVLFNDS
FT                   LEGYLIIYAKTGEVVIPLYYEPILVTYPVKFNLKYNVSYPWAKLILSHNYPVPIKVTAT
FT                   VGKFSKNITIYPFKEETVPFYVGKNRDNITVSIEVLNNISTIKKFKKTFYFRKYAFINI
FT                   SNNSANNETIIKNIIKTLNITNASKSENSTTQIQKNKTNRTKNTITPPPNIVTENTSPK
FT                   KYNISKEEWELFCNITGITALKEFIFTLKGLLYLILIGLIIIAIVSLIYEPTRSKILSI
FT                   IAFILYKLKGTHEKHEKPETIKLPEPPRVYVFDVIYLLGDTVKMEIYSEVDVSKDVYIL
FT                   SPTNKKYRIEIIKTEKNKYLGIFKIPENEVPGQYFIVYKPENLSIGGFLVVDIKKNM"
FT   gene            complement(343757..344605)
FT                   /locus_tag="MFS40622_0353"
FT   CDS_pept        complement(343757..344605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0353"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="KEGG: mja:MJ1294 fumarate hydratase; TIGRFAM:
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, alpha
FT                   subunit; PFAM: Fe-S type hydro-lyase tartrate/fumarate
FT                   alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69049"
FT                   /db_xref="GOA:D3S7N9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7N9"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ADC69049.1"
FT                   /translation="MKISDVVVELFREAVIYLPKDVKNALEEGYKKESSEISKNTLKAI
FT                   IENNEIAEEKHVPLCQDTGVPIIFLKIGKNINSSEIMKIIEEIKEGVKRATEEIPLRPN
FT                   VVHPLTRENFKTNVGLGAPFINIEFDESLDREIEIIAFPKGAGSENMSALKMLKPSDGI
FT                   EGIKNFVLETVANAGGKPCPPIVVGIGIGGTADVALKLAKKALLRKIGERHKDKEIANL
FT                   EKELLEKINSLGIGAMGLGGDITALDVFIEVAGCHTASLPVGICIQCWADRRASKRIKL
FT                   E"
FT   gene            complement(344661..345317)
FT                   /locus_tag="MFS40622_0354"
FT   CDS_pept        complement(344661..345317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0354"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: mja:MJ1295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69050"
FT                   /db_xref="GOA:D3S7P0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P0"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ADC69050.1"
FT                   /translation="MRFDFHTHTIFSDGELIPAELVRRARVLKHKAIAITDHADFSNYK
FT                   ELIEKTTIAKEELKKYWDDIIVIVGVELTHIPPKSIPKMAKKAKDLGAEIVVVHGETVV
FT                   EPVEEKTNYYASISEDVDILAHPGFIDKETAENLKENDIFVEITSRRGHNITNGHVANI
FT                   AREFGLKTLINTDTHAPEDLIDVEFAKKVGLGAGLTTKELEKTLLDYPKELLKRI"
FT   gene            complement(345322..346305)
FT                   /locus_tag="MFS40622_0355"
FT   CDS_pept        complement(345322..346305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0355"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: mfe:Mefer_1526 biotin synthase; TIGRFAM:
FT                   biotin synthase; PFAM: biotin and thiamin synthesis
FT                   associated; Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69051"
FT                   /db_xref="GOA:D3S7P1"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P1"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ADC69051.1"
FT                   /translation="MKGESLIDIESFLEKSLKNKIDFDDAIYLYNNFNTIDLLYLAFKI
FT                   KNKINNKIKLCAIINAKSGKCPEDCIFCSQSIHNKCNIPIYPLKSKNEILEYAKTFDGI
FT                   VERFSIVTSGKKINDDEFVKIVEAIELIKEETNLKVCCSLGLLDREKLKELKKLDVRLH
FT                   NNLETSKNYFKNICSTHSYDDKVKVIKEAKKLGLEVCSGGIFGLGESAEERIKMAFELK
FT                   ELGVDSVPINILHPIEGTKAYQKIKNGEIKPISISDALKSIAIYKIILPYAEIRLAGGR
FT                   IYNLRDFQSYALMALDGLMVGNYLTTKGRGLEDDLMMIRDFYNLMG"
FT   gene            346375..347076
FT                   /locus_tag="MFS40622_0356"
FT   CDS_pept        346375..347076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0356"
FT                   /product="6-carboxyhexanoate/CoA ligase"
FT                   /EC_number="6.2.1.14"
FT                   /note="KEGG: mja:MJ1297 6-carboxyhexanoate--CoA ligase;
FT                   TIGRFAM: 6-carboxyhexanoate/CoA ligase; PFAM:
FT                   6-carboxyhexanoate--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69052"
FT                   /db_xref="GOA:D3S7P2"
FT                   /db_xref="InterPro:IPR005499"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3S7P2"
FT                   /inference="protein motif:TFAM:TIGR01204"
FT                   /protein_id="ADC69052.1"
FT                   /translation="MYSIKMRASKNGKHISGAERIVNKDEIEDVARELIKRALTHENGT
FT                   PDFINIKIEEIKEDIEYIDHLPIKTIHCKNKEEAREKAREILRNEGIPDKVIDYAYEII
FT                   DKGGMRGAAILNLKGERLEPDKERGVRVKNIDTTKELKEKILKEKLGTERTVDAIAIAS
FT                   KVIHLGVIAELCTSDNKSYTTGYVATKRGYFRITNLKKEGESGGRVFFVKNDVNIEDLI
FT                   DKLENKPFIIK"
FT   gene            347089..348267
FT                   /locus_tag="MFS40622_0357"
FT   CDS_pept        347089..348267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0357"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="KEGG: mja:MJ1298 8-amino-7-oxononanoate synthase
FT                   (BioF); TIGRFAM: 8-amino-7-oxononanoate synthase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69053"
FT                   /db_xref="GOA:D3S7P3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P3"
FT                   /inference="protein motif:TFAM:TIGR00858"
FT                   /protein_id="ADC69053.1"
FT                   /translation="MFREKLRKEIETIKSNGLYRFLREKGNNILDFSSNDYLCLSKHPE
FT                   VIEAVKEGLKYGAGSTGSRLTSGNINHQRLEEKIAEFKETERALVYSSGYATNVGVISS
FT                   LCKKGDLILSDKLNHASIIDGCRLSKADVLIYNHCDVEHLINLIEESYKKYNNLFIITD
FT                   GVFSMDGDIAPLRDLKKIADEFNAILIVDDAHGTGVLGDGKGTLKHFNIKPSDNIIQIG
FT                   TLSKAIGGLGGFVCGIEEVIEYLINTSRSFIFSTALPPHVVEGCIKAFEIIEKTDIVKR
FT                   LQKNIKIANEVFKKYGFIGANEVSGELQKLLRNFCSIKEDNLTPIYPFIFKEKTMEIAE
FT                   HLIKNNIFCVGIRYPTVPKGLERIRVSINVGHKKEDFELLCEKIREIYDRYR"
FT   gene            complement(348347..348457)
FT                   /pseudo
FT                   /locus_tag="MFS40622_0358"
FT                   /product="hypothetical protein"
FT   gene            complement(348458..348571)
FT                   /locus_tag="MFS40622_0359"
FT   CDS_pept        complement(348458..348571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69054"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69054.1"
FT                   /translation="MGKENEVVIPLKTLLEEHNEEKVKTLLDTFSCSKNLI"
FT   gene            complement(348547..348723)
FT                   /locus_tag="MFS40622_0360"
FT   CDS_pept        complement(348547..348723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJECL05 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69055"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P5"
FT                   /inference="similar to AA sequence:KEGG:MJECL05"
FT                   /protein_id="ADC69055.1"
FT                   /translation="MATLLEEGVCIIKDKEVAERFLKDLENPPKEPIISEEIRLKSRRL
FT                   LKEGIEWAKKMKL"
FT   gene            complement(348769..350097)
FT                   /locus_tag="MFS40622_0361"
FT   CDS_pept        complement(348769..350097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0361"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; DUF234 DEXX-box ATPase; KEGG:
FT                   mja:MJECL04 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69056"
FT                   /db_xref="GOA:D3S7P6"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P6"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ADC69056.1"
FT                   /translation="MFVNREKELKALNEKLDSNNFEFIVIYGRRRIGKTKLALKSVENR
FT                   EHIYYLAVEGDNLKHFKRYALKVVPTIEYAKEDWEAYFNFLKDKIIIIDEFPNLIKENP
FT                   NILSLFQRIIDVHLKDTKTKLIILGSSISMMGEKVLSYKSPLYGRKTGVLKIKPLKFKH
FT                   LKEFFPKATWEELVEIYGFADGIPYYLEKIKLPFWSYLDEEIKRVDSFLRYEVDLLMRY
FT                   EFEEPTTYKKILEAIAFGNHTLGEIKNYLGLKHSDLTPYLKNLIETEFIEREIPITESP
FT                   KTKKGRYYIKDNFIAFYFRYIFPNLSAIEEGIFEIDVIKADYNQYLGFVFENVAKEFLI
FT                   ELNKIGKLPFKFLSIGRWWHKGEEIDLIALNKNDKKALFVEVKWRDLKDKDVKKIFKDL
FT                   DRKSKLVGLDDYEKYYVIIGKRVENKDFKGCLLFDLNDFDKYL"
FT   gene            350203..350847
FT                   /locus_tag="MFS40622_0362"
FT   CDS_pept        350203..350847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0362"
FT                   /product="dethiobiotin synthase"
FT                   /EC_number="6.3.3.3"
FT                   /note="TIGRFAM: dethiobiotin synthase; KEGG: mja:MJ1299
FT                   dethiobiotin synthetase (BioD)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69057"
FT                   /db_xref="GOA:D3S7P7"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P7"
FT                   /inference="protein motif:TFAM:TIGR00347"
FT                   /protein_id="ADC69057.1"
FT                   /translation="MIFITGTDTGVGKTYVSSILAENLKKMGVNVGYLKPVETGGREDT
FT                   LTLKNILKTNDDLDLMNPINLKLPLSPNIAFDVENSPLTLDEIKEKIKNAYNILKEKYD
FT                   FLIVEGAGGVCVPIKENFLMSDLIKFLGLDAVVVSRPNLGTINHTLLTVEHLRNKGINV
FT                   RGVIINCITDLSEVLYYEKTFETIEKVGNIEIIGIVKNRNDFEIDFEKILG"
FT   gene            350853..352241
FT                   /locus_tag="MFS40622_0363"
FT   CDS_pept        350853..352241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0363"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /note="TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   mja:MJ1300 adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase (BioA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69058"
FT                   /db_xref="GOA:D3S7P8"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P8"
FT                   /inference="protein motif:TFAM:TIGR00508"
FT                   /protein_id="ADC69058.1"
FT                   /translation="MENIDRNLLEKWDKEYVWHPYTQMKEYRESKNLIIERGEGNYLID
FT                   IYGNRYLDAVSSIWCNLFGHSRKEIIEAIKNQADKICHSTLLGCGNVPSILLAKKLVDI
FT                   TPKHLTKVFYSEDGAEAVEIAIKIAYQYYVLRGDKGRTKFISVKEGYHGDTIGTMSVGG
FT                   SELFHGVFKPLLFKGYHANPPYCYRCKYHNFKDTDERNEKGCDMRCLDEMINLIEKHTD
FT                   EVFCVILEGGVMGSAGMIPFPDGYIEGVAKACKENDVIFILDEVATGFGRTGKMFFCDN
FT                   EELKKLEKPDILCLGKGLTGGYLPLAATLTTDEIYNQFLGEFGESKQLYHGHTYTGNQL
FT                   LCSAALATLEIFEKENVIENIQPKIKLLHEELRKLKELEHVGDVRGRGFMIGIELVKDK
FT                   ETKEPYPYGYKAGYRVAEKLLEKGIYMRPIGNVVILVPPLSITEEEIIYLCDSLYDAIK
FT                   EADL"
FT   gene            352278..354797
FT                   /locus_tag="MFS40622_0364"
FT   CDS_pept        352278..354797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0364"
FT                   /product="stem cell self-renewal protein Piwi domain
FT                   protein"
FT                   /note="PFAM: stem cell self-renewal protein Piwi domain
FT                   protein; KEGG: ton:TON_1506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69059"
FT                   /db_xref="GOA:D3S7P9"
FT                   /db_xref="InterPro:IPR003165"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7P9"
FT                   /inference="protein motif:PFAM:PF02171"
FT                   /protein_id="ADC69059.1"
FT                   /translation="MNIILDKSVELLFVFICKTVIFINYYTRNYYCVYPITTDLQINVV
FT                   NNMEENWHYTNSFLINKHFIDIVSKNCVRIVCKINYLDKKEDIEKLLHSIAATLGGVYI
FT                   EDYNPLKNEFSFYIWKRILNKKIKDLKSEELEKRMEDLGIKDIKNKTLLDYVTKKYENE
FT                   INFKIINEEKVNWNELNYEIKEKIVLGAIKAHPAIRKLIEYKEEELLEDIGQKILTYFT
FT                   ITVESDENENYFLVVMPKHRIISSETIYEMLKSNKIDINKLKRDLLGGSVFITTSRKGV
FT                   RRKKVKIKKIISPKEREYRKYVEIINNYYKEKGIPIKVGGEDIHCYILIGEEKIDVYHT
FT                   KNALLYKGIDEKTQKIILDKGKFLHELETAKQILSKYGNLIDFDGEFSNILTKDGYVMT
FT                   QLSTVPKINIKLRTKNGIKTYNYLKLMYLFDWIFNKTLNDREIFLPLVIPPMLKEKEKI
FT                   GIYIFYSNISDVELNFIKDIFRKLSILHKLDKNIPKIEIKLEKEIDFEDYANSRAIITQ
FT                   TVLNNSEEKEQPFLICISPKLPNNEFDELKSHLFSYQQTTFHQFMYPFNLKRCLNDDDF
FT                   KKPFINSILSQFFHKMGMYLFSFSEELGDYDFIIGYDITKEKDENDKIKGIGGSAIIYN
FT                   SHGHVITTVTFEDVHTSSEIARYEKLFAKVYSELVPHLNLNNKRKIKILLLKDGRIFKK
FT                   ELEKLSLISKKYGFEIIYIDVRKSTKLRFFDIKSKKAVPEGKNAYTKFGRAYYVSSHYY
FT                   KRFLKQPIKIVEKYRIDDGSYKGVKIEEKDIKQLILLTKINFSQLMPDKMKLPAPVHYA
FT                   HKHVNAVRRGWKVDDKTILRNGCLPTI"
FT   gene            complement(354810..355313)
FT                   /locus_tag="MFS40622_0365"
FT   CDS_pept        complement(354810..355313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0365"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ1302 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69060"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q0"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC69060.1"
FT                   /translation="MIKLDELKNFAKIFLTGIYENLERIILGSERYTSLEMREAILSGK
FT                   VKIPKTVIEELCIGCEGCANVCPTKAIEMIPIEPVKITENYVKDKIPKINPEKCIYCLY
FT                   CHDFCPVFSVFNEISPIHPRDVGEEYIEVDVSKLLQKKVEISEEQINKISSLLSINLRR
FT                   IIKE"
FT   gene            complement(355306..356709)
FT                   /locus_tag="MFS40622_0366"
FT   CDS_pept        complement(355306..356709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0366"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ1303 polyferredoxin (MvhB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69061"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q1"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC69061.1"
FT                   /translation="MIITILDKCRVDEKCQSCPFSQTSKCMEACPTDAIFLLNNKSFSC
FT                   LTCGECARNCPNKAIKRNEFGGYYVDRRRCNGCGICANVCPIGIIKIVEKDGKKFPMGI
FT                   CSMCGVCVEVCPYNARVSSYELLNTKREGLAERYLKVLENLMKVKLFRVEEKSGRAVEK
FT                   VERKSIKIDRDNCVGCLRCSYLCPRETIIPDSIDACTSCNLCGEICPKDAIKDGEVDYN
FT                   KCILCLKCIEVCPNDALKVKNFKVVKVKEDKKSQPTSYCINCGLCAEHCPSGALRFEEG
FT                   HLYYSPDICWKCLKCVEICPNDVRRIKDDRVVGGCSLCGICINNCPEEAISITTVKLEK
FT                   IRDENCILCGTCSNVCPRDAIIIDRSNKEILFTDNCIACETCAIHCPRDVIPNTTGYKK
FT                   IVDRENSFIRTDMDFCIKCGLCNKVCPNNCIDYGVIDKERCEFCGACYNICPTKAIYLH
FT                   RKWKVKCGD"
FT   gene            complement(356752..357003)
FT                   /locus_tag="MFS40622_0367"
FT   CDS_pept        complement(356752..357003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1306 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69062"
FT                   /db_xref="GOA:D3S7Q2"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q2"
FT                   /inference="similar to AA sequence:KEGG:MJ1306"
FT                   /protein_id="ADC69062.1"
FT                   /translation="MIEAILNNYLYYPSILAFLFGVLIGAKYRHRIGNIVGYLILTVVI
FT                   AYFLKAFPYYDLLPLSCSYLSAVIGIIVGNRLFGGKMP"
FT   gene            complement(357020..357808)
FT                   /locus_tag="MFS40622_0368"
FT   CDS_pept        complement(357020..357808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0368"
FT                   /product="Na+/H+ antiporter MnhB subunit-related protein"
FT                   /note="PFAM: Na+/H+ antiporter MnhB subunit-related
FT                   protein; KEGG: mja:MJ1307 putative monovalent cation/H+
FT                   antiporter subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69063"
FT                   /db_xref="GOA:D3S7Q3"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q3"
FT                   /inference="protein motif:PFAM:PF04039"
FT                   /protein_id="ADC69063.1"
FT                   /translation="MNSKRDLAVAISFFVFGASILYSLANMQVNPGVNEVYLTHYIIPN
FT                   YVCAVIFDWRAYDTLGECLVLVVAVMVSWIVFGKSLYDNTYLKELFHAPESDDYITLQR
FT                   WGEHTPIIKFLAFPMSVLMVALGIITILGGHITPGGGFQGGALIAAAFILSVIAFGSNS
FT                   PLWFEHKFLEKLEALGALGYLLLGVAGMVIGGYYLFNFTEINGFTIFPAPKDVVTAGII
FT                   PYLNIVVGLKVLAGLSTAAFLLSCEKVIIEKISKSEEELK"
FT   sig_peptide     complement(357731..357808)
FT                   /locus_tag="MFS40622_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.944 at
FT                   residue 26"
FT   gene            complement(357810..358124)
FT                   /locus_tag="MFS40622_0369"
FT   CDS_pept        complement(357810..358124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69064"
FT                   /db_xref="GOA:D3S7Q4"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q4"
FT                   /inference="similar to AA sequence:KEGG:MJ1308"
FT                   /protein_id="ADC69064.1"
FT                   /translation="MDYNDFQKKLDKEEHGDGITVGAVFTGEFSLYLLFIFGALIIGRV
FT                   YGKTLMTLFGLAALAFSLAVSPLIFKFKEENSNAINYQLFWLSIFLGAMAFCIYMTTRW
FT                   "
FT   gene            complement(358139..359584)
FT                   /locus_tag="MFS40622_0370"
FT   CDS_pept        complement(358139..359584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0370"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mja:MJ1309 hydrogenase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69065"
FT                   /db_xref="GOA:D3S7Q5"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q5"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ADC69065.1"
FT                   /translation="MNYLPMIIVFPLIMAIIMNLLHGKEKAVKYITFITAIILIILPFI
FT                   SQYGYYYFGGHGVVDGWVSGIAYLYNPAKQAVIVTLSLIASLVLITGMGEKLKNNMFVT
FT                   LSLMGFASIAAIVLADDIFNLYVFFEIVSIVQAGLVFLSGTEEAYKAGLRYMIMGNVAA
FT                   ALMLLGIAFLLASTGTLNITDMKNYLLTDNPMIYGGLLLLIVGLAYGAGLPPFHNVKAD
FT                   LYARSKGFISAMLQTYSKFVLVGLMLIILKLFNGLDYFASAHAVLIALGVLAMVFGVVM
FT                   ALLQSDYKKLLAYHAISQGGYVATGLALGTPLGIVAGIFHAINHVIYKSALFLGAYIVS
FT                   CKRGSNLHKLGGLLPLMPSVAFMVLCAKLAISGIPPFNGFQSKWMLAQAAMQVNMPEVA
FT                   IIMIIVSIGTFVSMMKAFYLIYLKPVDEKTLEEYQNKEVPKLAVFSLFVLTALCIIIGI
FT                   YPDIVTSYLWDYAKELGVNYYLK"
FT   gene            complement(359624..359980)
FT                   /locus_tag="MFS40622_0371"
FT   CDS_pept        complement(359624..359980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0371"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   mja:MJ1310 putative monovalent cation/H+ antiporter subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69066"
FT                   /db_xref="GOA:D3S7Q6"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q6"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADC69066.1"
FT                   /translation="MDFQMASFITSGLLVVIGLYGVFFVDNVLKKIIALEILGSGVNLA
FT                   LITIGYNGGTIPIKLPGVSVEVFAKESAYPLTHALVLTNIVIEASMLAVMLGVSIILYK
FT                   KYKTLKSSVILRED"
FT   gene            360220..360687
FT                   /locus_tag="MFS40622_0372"
FT   CDS_pept        360220..360687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mae:Maeo_0231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69067"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q7"
FT                   /inference="similar to AA sequence:KEGG:Maeo_0231"
FT                   /protein_id="ADC69067.1"
FT                   /translation="MEIFTNNEEKYLLITSCSKAKKKLDNVPAIELYDGPAFKIIRKYK
FT                   PPNVDVLILSAKYGLIDENTIINYYDMEMSKERAIELKNEVFKKFFQLKLDDYGEIFIN
FT                   LGKIYHIAFEDCLNHLENSTNVIVAQGTIGIRLKTLKEWIVNIGSGSNGSK"
FT   gene            360674..362878
FT                   /locus_tag="MFS40622_0373"
FT   CDS_pept        360674..362878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0373"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: mae:Maeo_0230
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69068"
FT                   /db_xref="GOA:D3S7Q8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q8"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADC69068.1"
FT                   /translation="MDLNEFMEIIHPMLPSGGLDENQMNVVIHGQGPLWVIAGPGSGKT
FT                   ETLVIRTLKLIFVDNVNPKSIVITTFTEKAAKNIKDRISNYAYLIYQKYPELQRNLDVN
FT                   DIYIGTLHSLCNQIMLEYRYPGYENYRLMDDIEQYLFVHEHSDAVKHHHKYQDMWNHFK
FT                   YLENKWNRSFNSRWGRTQVATTLFNRIVEYLIDIEELKQSDEKWAVQLADAYENYVQLL
FT                   EIHHRCDFSHLQKKFLEFLNTKLGELFIKGDGSLRHPGISHVLVDEYQDTNPIQEAIYF
FT                   KMAENTHNLCVVGDDDQALYRFRGGTVECMVNFGNACHREWGITLERVNTVFLNNNYRS
FT                   HREIVNYCNKFITSFPVMQKIGARVKDKPELNPKSDISGNYPAVAYITGRTIEETANNF
FT                   ANFVRYLLDEGVVSKPSDCALLMKSVRENRNWAEPFKKALNKVGIEVYNPRSRKFLEQE
FT                   EVMAALGAFITIIDPKQNALRKVCNENIQRLVNRWVDTYRNVASESPELRKYVDCSIKS
FT                   IAKRNLGERLNINISEILYRILAHPPFSDWLDDPERSYRLGKLTQLFEKYSSIPYDTPG
FT                   STRGLLKMSSKNNGEISFRWRQNFYNSFIGLLSTEGLNDPEDEEIICPPDRLPIMTIHQ
FT                   AKGLEFPFVFVYGLRLKGDKPNESAIIEEDLYKYRKIKYSINFTPLERTQQDLIRLYYV
FT                   AYSRAKYALIHLVPRNHMGSKGFGFIGNNFSLFSAIVKKI"
FT   gene            362892..363845
FT                   /locus_tag="MFS40622_0374"
FT   CDS_pept        362892..363845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mae:Maeo_0229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69069"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Q9"
FT                   /inference="similar to AA sequence:KEGG:Maeo_0229"
FT                   /protein_id="ADC69069.1"
FT                   /translation="MEKWRSYKGIKISEKPVQKLKEKYSATADIVSFQICPRQYGFFKI
FT                   RKYQPAHIVQIWYGTVIHQVLDKLHMHYKGLLDPSTEGSIPTDQDVERYFLEVENSLLA
FT                   SKGIRAITENVRNSALKVLQRFNRLEGPTLYPLVEDTECEFQSDRGSYILSGRVDVLRD
FT                   ISTMGKVPKGYDAKEIWDYKGTHYPDTSTKSGREKLKRYRFQMLVYAELYKEKYGLYPL
FT                   KGVIYFMNELLDASSEPTVRPPQAVYEIDFRDPRNLDDIEEAMELFDKTVEEIEDKKRK
FT                   DVWEPPKIPPDKETCDICDLRWSCPLMKSKYRMRYP"
FT   gene            363869..365110
FT                   /locus_tag="MFS40622_0375"
FT   CDS_pept        363869..365110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0375"
FT                   /product="Queuine/other tRNA-ribosyltransferase"
FT                   /note="PFAM: Queuine/other tRNA-ribosyltransferase; KEGG:
FT                   mae:Maeo_0227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69070"
FT                   /db_xref="GOA:D3S7R0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R0"
FT                   /inference="protein motif:PFAM:PF01702"
FT                   /protein_id="ADC69070.1"
FT                   /translation="MKFFLPDWEDRVDPWYDFKNDKYSSSHKKSPYENDIYAHQLFDVP
FT                   PYDGILVSLGVFKSKITLKDDKNPEIRGKNNIKDFLKIDNGKIEVMGDCGAFTYVHEKN
FT                   PPPFYSVERVANLYERLGFDYGVSVDHLVLDYVTKRVNGEKKRIEISKREKNRRIKLTL
FT                   KNAEKFLKLHKQNKFNFEPIGVAQGYDIETYTKSVKKLVDLGYEYIALGSLVRYKTEEI
FT                   VGILESIEPYTENVKIHLFGVLRPEAIKIFRKLGVTSFDSASYLRKAWLRSGRNYLAYN
FT                   GMWYSAIRVPYSDDPRLVNNGKVNGYSIPELKKMESKALKLLFKYDQGEATITEVLNAV
FT                   LKYDQLLLRDSENMDKFEEKYIKTLEDKPWKQCNCNVCKSIGINVIIFRGTNRNKRRGF
FT                   HNIWVFKNVLMNKL"
FT   gene            365278..366144
FT                   /locus_tag="MFS40622_0376"
FT   CDS_pept        365278..366144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0376"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SMART: AP endonuclease family 2; KEGG: mja:MJ1311
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69071"
FT                   /db_xref="GOA:D3S7R1"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R1"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ADC69071.1"
FT                   /translation="MIDKIKRKVLDMKFGISSLVFLPESLTSSMEKIAEHNFDAWEIVC
FT                   EGTHYLSPKNIKYLMELRDKYEVEIVVHAPFSDLNPASMNERVRRLTIECIRDAIEGAF
FT                   ELDSEIVVVHPGYIPELWSNYVNDILDNNFSTLSEIVEIAEDYGIKIGLENMPNFRGLL
FT                   GITPESLLEIVKDIDSKNLGVTFDIGHANTAGNPAEFVEKLQNIGIGIIHVHAHDNNGY
FT                   DDEHLKIGEGNINFIEVLEKLKEIGYDGVITIENKNVRDAVKSKEMLKEYLEIVNEKVA
FT                   EKKKIEE"
FT   gene            366192..367151
FT                   /locus_tag="MFS40622_0377"
FT   CDS_pept        366192..367151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0377"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mja:MJ1312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69072"
FT                   /db_xref="GOA:D3S7R2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040084"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADC69072.1"
FT                   /translation="MVNIAFGPVPSRRLGKSLGINNIPCKFCSYDCIYCQVGRTINKTI
FT                   ERRVFYNPEDIFKSVKEKINKLSNEKIDYLTFVADGEPTLDINLSKDVEMLRDFGIPIA
FT                   IITNSSLIWREDVREDLLNFDLVSFKVDSADEKIWREINRPHENLSLDKILEGMIAFRD
FT                   NYKGKLITETMILGNINYTEDSIIKTAEFLKELKPDKCYLNTPIRPPSEKYIKPPKIEV
FT                   ITKILSIFNEIIGKDKVELLGKFEGNDFVFSENVEEDILAITSVHPMREEVIKELLNKA
FT                   NISFDIIEKMVDEGKLIKLEYNGEIFYMKKIESRDNIW"
FT   gene            367156..368370
FT                   /locus_tag="MFS40622_0378"
FT   CDS_pept        367156..368370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0378"
FT                   /product="protein of unknown function DUF521"
FT                   /note="PFAM: protein of unknown function DUF521; KEGG:
FT                   mja:MJ1313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69073"
FT                   /db_xref="InterPro:IPR007506"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R3"
FT                   /inference="protein motif:PFAM:PF04412"
FT                   /protein_id="ADC69073.1"
FT                   /translation="MYLTKEEEKILDGEYGEVLRRCMNLLVSLGDIYGAEKLIPIKSAQ
FT                   ISGVSYKTIKDIGLEFLEDFAKENVKVKVYSTLNPAGMDLDIWKELGIDEEFAKKQLRI
FT                   IEAFKKMEVEIGCTCTPYLVGNLPKFGEHISWAESSAVSFANSVLGAKTNREGGPSALA
FT                   AAIIGKTPYYGYHLDENRKATHIIELDSQLISNINDVGESFYGALGYLVGKIVKNGVPY
FT                   FENLYKLNPNNDNLKSLGAAMAASGGIALYHAKNLTAECRVKEVIDDKVEKISVGIEDI
FT                   KEAYEKLNTTNEEPDLICIGCPHCSLMEIKKIAELLKDKKLNADLWVCCSLHIKAIADR
FT                   MGYTKIIEKAGGKVVKDTCMVVSPIEDLGYKKVATNSGKAAVYLPSFCKSEVIFGDIEE
FT                   LVKGR"
FT   gene            368370..369296
FT                   /locus_tag="MFS40622_0379"
FT   CDS_pept        368370..369296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0379"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: mja:MJ1314
FT                   cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69074"
FT                   /db_xref="GOA:D3S7R4"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R4"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ADC69074.1"
FT                   /translation="MLNPIILFLAIIFDRIIGELPEKIHPTVWIGKLITFLENTFKSTN
FT                   CKNKYRDFLFGILTTTITISIVGIVAIFIEKFILSLPFPLNYLIYAFLLSTTIGYKSLF
FT                   EFCKKPIEYIKNGDIDKAREAVQHIVSRDASKLDEEHILSAAVESLSENITDSIIGALF
FT                   YAVIFGLPGAFVYRAINTLDAMIGYKNEKYLWYGKLAARLDDIANFIPSRIAGILLIIT
FT                   APFYKGSIKKAIYGFLKEANKVPSPNSGYTMATLANALNITLEKIGYYKLGSGKIDVEK
FT                   SLNAFKAVDYVVIMFLIIYTLIWWALW"
FT   gene            369290..370363
FT                   /locus_tag="MFS40622_0380"
FT   CDS_pept        369290..370363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0380"
FT                   /product="NUC156 family protein"
FT                   /note="PFAM: NUC156 family protein; KEGG: mja:MJ1315
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69075"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032319"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R5"
FT                   /inference="protein motif:PFAM:PF08160"
FT                   /protein_id="ADC69075.1"
FT                   /translation="MVNKAYYTAEVPEDRFEALSCIRDLVKPLKIILLGGVDSGKTTLA
FT                   TFLANELLNLGFRVAIIDSDIGQKSILPPATISLAFPETNFNNLYEIKPYKSYFVGSTA
FT                   PIQFFGEMITGTKLLCDYAEDKADVVIVDTTGLISGSGADLKRMKIEMIKPDVIIALQK
FT                   RNELRQILKPFENKIRVFYLKVYENAKSFSREERKEIRAEKWKEYFKDSKIYSIGFNDV
FT                   IISGTKVFQGEKILEDEKYLLESIFKWKILYGSKCEGRYTIVKRDLVNMPRQIDKNILY
FT                   YIEPERFNNLIVGLIDEEGFCIGLGILKAIDFENETLEILTPINEDEIKNIKEIRFGRI
FT                   KVDENGEELGLLDRDLI"
FT   gene            370373..370603
FT                   /locus_tag="MFS40622_0381"
FT   CDS_pept        370373..370603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0381"
FT                   /product="Protein of unknown function DUF504"
FT                   /note="PFAM: Protein of unknown function DUF504; KEGG:
FT                   mja:MJ1316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69076"
FT                   /db_xref="InterPro:IPR007547"
FT                   /db_xref="InterPro:IPR040459"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R6"
FT                   /inference="protein motif:PFAM:PF04457"
FT                   /protein_id="ADC69076.1"
FT                   /translation="MLKEILNKIFWHPDYKKEDFEVIILHRGAEENKKVISLDDVELRG
FT                   NYLVYFDTYIPLHRILEIRNKKTGEILYKKK"
FT   gene            complement(370586..371776)
FT                   /locus_tag="MFS40622_0382"
FT   CDS_pept        complement(370586..371776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0382"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mja:MJ1317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69077"
FT                   /db_xref="GOA:D3S7R7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADC69077.1"
FT                   /translation="MVRKLAESNLQKNNNRKLAKNVYLLGFTSFLNDMSSEMIMPILPM
FT                   LITSVGGGSLSIGLVGGLREFISNILMVLIGYCSDKVRKRKIFVVLGYLTSSMFKLLLG
FT                   LSKSWLGAVVFSSLERMGKGIRTAPRDAIISESMPKTLGKGFGIQRAFDTAGAILGSTL
FT                   SLLFILYFQYTFNQIILIAAIIGFLTLIPLYFVKEKTTTSYNKITFRVGIKNLSKELKL
FT                   FILISAIFTLSNFSYMFYILRAQEFLMIVDEKMAIIIPIALYILYNIFYATFSIPFGIL
FT                   SDKIGRRRVLTMGYIVYGITSLGFAYFISQKSLILLFALYGIAYALFAGNQKAYVSDLS
FT                   SEDIRATALGLFYTVVGLTSLPASLIAGYLWKISPEMTFLFGGVLAIISGLLLLFI"
FT   gene            complement(371903..373693)
FT                   /locus_tag="MFS40622_0383"
FT   CDS_pept        complement(371903..373693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69078"
FT                   /db_xref="GOA:D3S7R8"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R8"
FT                   /inference="similar to AA sequence:KEGG:MJ1318"
FT                   /protein_id="ADC69078.1"
FT                   /translation="MRKILVLLLAIFLLNSTFAVIIKAPAVSLTDKGYVGVPINIQINV
FT                   TKGDGHVFMDTMPLTELDMQGSARIAAKVAGEVTGKDMNKYNIYITVRSDVPVVGGPSA
FT                   GGTMTIGIICELMNWSLNKHVMMTGMINPDGSIGPVGGILEKIEAAKKANCTIMLIPKG
FT                   QRYVEVNGKKVDAVEFGKKLGVKVIEVGSIYEAIPYFTNKKIVIKEYPENISIEEKYKN
FT                   IMKKLSENVLKMANEKYENISKELSNNYYVDYEYQTMLLNELNASKNLLDKANNEYITS
FT                   EYYAATCSAFNALIKLETIQHTIGYLTGKEDISTFLTNVQDEIESDEKIVYSKKVTTNN
FT                   FEEILAGRIRIVEAKKLLYNAWKSYYLGNYDEAIKYGSFAKLRGDSAVWWVSLKENDNN
FT                   SEIINESKLKPLAQQYLDNAETISTYVETIFPNLPTDGLENDLESAKEAYKQGDYLLTI
FT                   AESIDTCVKAEIPLVIFGDIKYFKKYARNKINLAENLGITPISALGYYEYADSLNDSIS
FT                   KIMYYKYSSYYAQMDIDVMKVLNKTNKENISEINIVTNEKVNSEETATTKGNNVGVIIS
FT                   AVIGGLIGFAGGYLARRAST"
FT   sig_peptide     complement(373634..373693)
FT                   /locus_tag="MFS40622_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.706 at
FT                   residue 20"
FT   gene            373799..375265
FT                   /locus_tag="MFS40622_0384"
FT   CDS_pept        373799..375265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0384"
FT                   /product="sodium:neurotransmitter symporter"
FT                   /note="PFAM: sodium:neurotransmitter symporter; KEGG:
FT                   mja:MJ1319 sodium-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69079"
FT                   /db_xref="GOA:D3S7R9"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7R9"
FT                   /inference="protein motif:PFAM:PF00209"
FT                   /protein_id="ADC69079.1"
FT                   /translation="MERESWSSNLGFILASVGSAIGLGNIWRFGYMVYTNGGGAFLIPY
FT                   IVALLCVGIPLMILEFAIGHYTKKSAPLALEKLHNGAEWAGWFAVISGFIITSYYAVII
FT                   AWCLYYLIILAIYGYPSDPNAYFFHNILQISSGVEDIGGVSYGILISTLAVWGIIALIL
FT                   SAGVKNGLEKANKIMIPFLLFLVILLVLNALTLPGALTGIEWYLTPDFSALFDYNVWLS
FT                   AFSQIFFSLSLGFGILIAYASYLPKKSDLTINAVTISLLNCGFSFLAGFAVFGTLGYMS
FT                   YTSGIPLDKAVSEGIGLAFVTFPKALSLLPFASRLFGIIFFLALVFAGISSAVSIVEAS
FT                   VSAIMDKFSLSRKKALLAVLTLFVILSPIFTTGAGLYYLDIIDHFASGYLLPIAAILEI
FT                   IIAIWLFGGDKLREHINKLSEMKLGVWWKYLAGVVSPIILTAVVLLDASNVLTSGYGDY
FT                   KTTYVMFGALIIPLAFVVSVVLQKMKTVKG"
FT   gene            375271..375390
FT                   /locus_tag="MFS40622_0385"
FT   CDS_pept        375271..375390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69080"
FT                   /db_xref="GOA:D3S7S0"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S0"
FT                   /inference="similar to AA sequence:KEGG:Mefer_1414"
FT                   /protein_id="ADC69080.1"
FT                   /translation="MNLGAIAMFIFGAVILWGGAIYFLWRSIKSKNNKEDIEE"
FT   repeat_region   complement(375752..376611)
FT                   /rpt_unit_range=375753..375783
FT                   /note="CRISPRS"
FT   gene            complement(376860..377255)
FT                   /locus_tag="MFS40622_0386"
FT   CDS_pept        complement(376860..377255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0386"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc; KEGG: mja:MJ1320 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69081"
FT                   /db_xref="GOA:D3S7S1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S1"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADC69081.1"
FT                   /translation="MYKIVPDTNFLIYVFKHKINFDYEIERALNAKFEIIILSPVKEEL
FT                   ERLLKSGDLKGKEKLAVNLALAKIKNYKLIDYNANYADEAILNYAKENKNVIVATNDKE
FT                   LKEKLIENNIPVMVVRQKKYFEVFGMI"
FT   gene            complement(377267..380287)
FT                   /locus_tag="MFS40622_0387"
FT   CDS_pept        complement(377267..380287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0387"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; Rad50 zinc hook domain
FT                   protein; KEGG: mfe:Mefer_0661 SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69082"
FT                   /db_xref="GOA:D3S7S2"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR022982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S2"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADC69082.1"
FT                   /translation="MILKEIKMNNFKSHENTRITFDEGIIAIIGENGSGKSSIFEAVFF
FT                   ALFGADALRRMGLSYDEVITKGKKVMSVELEFKINGVKYRVVREYDGRSSAKLYKNGKP
FT                   YATTISEVNKAINEILGVDRDMFLNSIYIKQGEIANLLNLPPHERKELIGKLLGIDDFE
FT                   KCYQKMKDVIDEYKRQLEGIKGYLSNREEYEKELNNKISDLEKKEKELKILKEKLDKVR
FT                   EEFKIAEKTFEEWNNKKSLYEKLIGKLEERKKALELENNKLKNLKYDLDAVIEAENTLN
FT                   RYREEFEEYKSLSDKIKTVEDRLGELSPIYEEYLKLSNTLKNLENDINSLKETIEKSKY
FT                   RDRVNELDKLLEEINNKIKNLEKIKDHLIELDNLYTKLNEIEKYKKTADELRAYYDKYK
FT                   QLDEALEKYNKMMLNYAKLLQSKKSLESNIESLKSEIRNIKDELGKINIDEVKKALEDI
FT                   DKKKIELETLQKQKEDIKQKIGEINNEINRIKKVLNELKDVEGRCPLCKTPIDDIKKQE
FT                   LINSHKSQLNSKYKELEELNKKINEIDKKIIEINKIIRREKELRELETKYYEKLKTLQN
FT                   LKSKLEELENTLIDIENQLKSYIIDGKPVNEIVDEIKKQLNEIEDKYNKYISAIDYLKN
FT                   ADEDKIRKRIKELEDVVKGWDKDKCIEEINKLREEEKEIINLKDKVTQLKSKELKFKEV
FT                   ENKMLSKLGLYKEYISLKDAVDKYKAKLYELEEIYKKCNSAEVTLNNLRKEYGVDDIKS
FT                   YLNDMIVKVNENIKDIEERISYIKQKLDEINYSEDKYREIEEEFKKKQEELNIIERELK
FT                   VVENSIEYLKEEIEKIKEKLQSLSELEKEKVKLERFVEYLTKIRKLFGKDGFQRYLRRK
FT                   YIPIIQRHLNEAFNEFDLPYSFVELTEDFDVKVHSPNGILTIDNLSGGEQIAVALSLRL
FT                   AIANALVGNRVECIILDEPTVYLDENRRAKLAEIFKKIDNVPQMVIITHHRELEDVADT
FT                   IINVTKEGGVSKVKTNE"
FT   gene            complement(380291..381388)
FT                   /locus_tag="MFS40622_0388"
FT   CDS_pept        complement(380291..381388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0388"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mja:MJ1323 DNA
FT                   repair protein RAD32 (rad32)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69083"
FT                   /db_xref="GOA:D3S7S3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032885"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S3"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ADC69083.1"
FT                   /translation="MMFVHIADNHLGYRQYNLDEREEDIYNSFISCIKKILEIKPDVVL
FT                   HSGDLFNDLRPPVKAIRLAMQAFKKLHEKNIKVYIIGGNHEMPKRLGRESPLALLKDYV
FT                   KILDGKDVINVNGEEIFICGTYYHRKSKREELLDKLKKFEVESQNYKKRILMLHQGVNP
FT                   YMPFDYELEHFDLPKFSYYAFGHVHKRILERFNDGILAYSGSTEIIYRDEYEDYKKEGK
FT                   GFYLIDFSGNDLDINDIEKIDVECREFVEVNIRDQKSFNEAIDNISKCKNKPVVFGKIK
FT                   REFKPWFESLKDKILINKAVVVDDEFIDLPDVDIESINIKELLVDYANKQGIDGDLVLS
FT                   LYKALINNENWKDILDEYYNTKFRG"
FT   gene            381487..382227
FT                   /locus_tag="MFS40622_0389"
FT   CDS_pept        381487..382227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0389"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; Fe-S cluster domain
FT                   protein; KEGG: mja:MJ1324 molybdopterin-guanine
FT                   dinucleotide biosynthesis protein B (MobB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69084"
FT                   /db_xref="GOA:D3S7S4"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S4"
FT                   /inference="protein motif:TFAM:TIGR00176"
FT                   /protein_id="ADC69084.1"
FT                   /translation="MRVIGVIGYKDSGKTTLIEEILKHSDKKIAVIKHTIEDVEVDREG
FT                   SDTYRFSNAGAKITVLATDNKTVFFTDRMDLENILSILSDYDIDFVIIEGFKEALKRLN
FT                   IPKIVMLKDKDGSDLIDEHTAMIIEDYNYNIDDVLKVIYEKAIIPTMNLNCKHCGYNCK
FT                   TFVKAVVEGEAKWDDCVLAKGIKIIVDGKIIPAVPFVSQIVGNTIKAMIETLKGVDNPK
FT                   IIKVEIDTSKLNRTFTGKKFSEKN"
FT   gene            382741..383010
FT                   /locus_tag="MFS40622_0390"
FT   CDS_pept        382741..383010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0390"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: mvu:Metvu_0201 transcriptional
FT                   regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69085"
FT                   /db_xref="GOA:D3S7S5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S5"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADC69085.1"
FT                   /translation="MEKYEKAAEIFKAFGDPTRLMILKLLCDNGSMCVCKIIDELKKPQ
FT                   PTISHHLNILKKAGIVRARKEGTWNFYYIVDDRVKEIIKLVDEL"
FT   gene            383302..384405
FT                   /locus_tag="MFS40622_0391"
FT   CDS_pept        383302..384405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0391"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM: TGS domain
FT                   protein; GTP-binding protein HSR1-related; KEGG:
FT                   mfe:Mefer_1519 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69086"
FT                   /db_xref="GOA:D3S7S6"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S6"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ADC69086.1"
FT                   /translation="MGIEEEIRRIEEELKRTPYNKATQKHIGRLKAKLAKLREQAQSRG
FT                   GGGGGKGYAVKKSGDATAAFVGFPSVGKSTLLNKLTNAKSEVGAYAFTTLTIVPGVMEH
FT                   KGAKIQLLDAPGIIVGASSGKGRGTEVLSAVRSADLILLTVDIYTLEHLPVIEKELYNV
FT                   GIRLDQRPPDVKIKVKDRGGINVSSTVPLTHIDEDTIEAILNEYRIHNADVVIREDITL
FT                   EQFIDVVAGNRVYIPSLVVVNKIDLADEEYLKYIKQKLEEFGKEYVLVSGNKGINLDLL
FT                   KDKIYEKLGFIKIYLKPQGKKPDFDEPLIMRRGATVKDVCEKLHKDFVRNFRYAQVWGK
FT                   SAKHPGQRVGLDHKLEDEDILTIVIKR"
FT   gene            384431..385315
FT                   /locus_tag="MFS40622_0392"
FT   CDS_pept        384431..385315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0392"
FT                   /product="methionine aminopeptidase, type II"
FT                   /EC_number="3.4.11.18"
FT                   /note="KEGG: mja:MJ1329 methionine aminopeptidase; TIGRFAM:
FT                   methionine aminopeptidase, type II; PFAM: peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69087"
FT                   /db_xref="GOA:D3S7S7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002468"
FT                   /db_xref="InterPro:IPR018349"
FT                   /db_xref="InterPro:IPR028595"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S7"
FT                   /inference="protein motif:TFAM:TIGR00501"
FT                   /protein_id="ADC69087.1"
FT                   /translation="MEIEGYEKIIEAGKIASKVREEAKKLIKPGVKLLEVAEFVENRIR
FT                   ELGGEPAFPCNISINEIAAHYTPKLNDNLEFKEGDVVKLDLGAHVDGYIADTAITIDLS
FT                   NSYKDLVKASEDALYTVIKEINPPMNIGEMGKIIQEVIESYGYKPISNLSGHVMHRYEL
FT                   HTGISIPNVYERTNQYIDVGDLVAIEPFATNGFGMVKDGKIGNIYKFLAKRPIRLPQAK
FT                   RILDVIAKNYPYLPFAERWVLKSESERLALNSLIRASCIYGYPVLKERENGIVSQSEHT
FT                   ILITENGIEITTK"
FT   gene            385332..386765
FT                   /locus_tag="MFS40622_0393"
FT   CDS_pept        385332..386765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0393"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: mja:MJ1075 anthranilate synthase component I
FT                   (TrpE); TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Chorismate binding-like; Anthranilate synthase component I
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69088"
FT                   /db_xref="GOA:D3S7S8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR010116"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S8"
FT                   /inference="protein motif:TFAM:TIGR01820"
FT                   /protein_id="ADC69088.1"
FT                   /translation="MIIKKIKMDVCPLDVYEQIRGENTFLLESAEGVPKVARYSILGRA
FT                   EGKLAFKEGKLKVESFTEFGDKVKDLEGKYECPLDALREVRNEYLKYIDISNIEPIPRF
FT                   KGGLVGYLSYDIIRYWIDLSNINPKPINDLKFPDAEFFIVKDFISFDLKEKVINLIAED
FT                   EEGIRELEKIVEKGKTKDSKEKEEKPIKHKEELKIKSNMSKEEFIEAVKKAKEYIFAGD
FT                   IFQVVLSRRIEIDLDNLDHLEIYKKVREINPSPYMYYLDFGDRKIIGSSPEILVRTDYK
FT                   DGKRLVITRPIAGTIRRGKTEEEDKELEKKLLSDEKERAEHVMLVDLARNDIGKISKFG
FT                   TVEVTDFMIIEKYSHVQHIVSNVVGELKDNYDSFLAVKATFPAGTLSGAPKVRAMEIIE
FT                   ELEKTWRGPYGGGVGYFGWDDLMDLAITIRTFVISKDKGYIQVGAGIVADSIPENEWEE
FT                   TERKGMANVKTIESLVKFK"
FT   gene            386802..387230
FT                   /locus_tag="MFS40622_0394"
FT   CDS_pept        386802..387230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69089"
FT                   /db_xref="GOA:D3S7S9"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7S9"
FT                   /inference="similar to AA sequence:KEGG:MJ1107"
FT                   /protein_id="ADC69089.1"
FT                   /translation="MAAVVYSKLYELIKNVKDEKEAEEICKIIEEYFAKKCKEEVSKNF
FT                   EEQKPVFKAELKDELKDELATKKDIALLEERMNSMEERILRYVDDKFHYLDKKIDESFY
FT                   KLDKKMTIGFIILILLYILTNPNAIELIRGLSNVSVGE"
FT   gene            387642..388568
FT                   /locus_tag="MFS40622_0395"
FT   CDS_pept        387642..388568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0395"
FT                   /product="Non-specific serine/threonine protein kinase"
FT                   /EC_number="2.7.11.1"
FT                   /note="KEGG: mja:MJ1073 hypothetical protein; PFAM:
FT                   RIO-like kinase; RIO2 kinase, winged helix domain protein;
FT                   SMART: protein of unknown function RIO1"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69090"
FT                   /db_xref="GOA:D3S7T0"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T0"
FT                   /inference="protein motif:PRIAM:2.7.11.1"
FT                   /protein_id="ADC69090.1"
FT                   /translation="MIKKLIEALRQAQDEDFKILKIIELSMRYHEWVPLDEIVRKAKMP
FT                   EKDVLYRLKRLNKFGFVVRSTYGYAVSMGGYDALAVNAFVKKGILKAIGNKLGVGKEGD
FT                   VYTVLLSDGREAVLKFHKHGRTCFTRGKRYRGYLADKHHISWLYVSRLTAEREFEILNE
FT                   LFPTVKVPEPIEWNRHAIIMGKVVGEELKRLDLSEFMSKEEIKDLFWKIIEEVKKAYEI
FT                   GYIHGDLSEFNILLDENGDFVIIDWPQAVPKYHPDAEFYLKRDIWNVIRYFKKYKIDKE
FT                   DERIDVDKIFAYITGKGLSQDKYSIVY"
FT   gene            388767..389192
FT                   /locus_tag="MFS40622_0396"
FT   CDS_pept        388767..389192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69091"
FT                   /db_xref="GOA:D3S7T1"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T1"
FT                   /inference="similar to AA sequence:KEGG:MJ1074"
FT                   /protein_id="ADC69091.1"
FT                   /translation="MAIAYAKLYELIYKNIKDEKKAEELYKIVEEFIKENEQRIEDKFK
FT                   NEKVIIKNELKDELKNELATKEDILLTKTELKNEIDLVREEMKAMEERILRYVDNKIYE
FT                   VRNDITQIKILVIITLLAVVILNPYAYEIVKTLIGLK"
FT   gene            389209..390150
FT                   /locus_tag="MFS40622_0397"
FT   CDS_pept        389209..390150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69092"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T2"
FT                   /inference="similar to AA sequence:KEGG:MJ1071"
FT                   /protein_id="ADC69092.1"
FT                   /translation="MAFDKICDEIILDYEDAKDFAYILKLSYLNEFEKIKNLNLDKFGI
FT                   VEKDDLLFYGKNYPLFKSLLFFNEIPVFREEKESILFLKNIELSPRNTLNSLTYDEKIR
FT                   LGNEFLKRCINIVPKEYISDIPQLIFGKEYYFKGVCLKEYVSALNGLYKIGKKNKVKKL
FT                   IINRELPDEKDVKKYKKKLAKKISLFKKKLDNYEINYFNLKFNNKNFKCQYIYVRQSIW
FT                   DKILSLFGEEIELKYYPTLVNVAYSHEKVDFLRPLFIFVNKGDISVYAKVPKLIYLKDG
FT                   LTLNHLNLRGKCIYFGNWEKERFLEIIEKGVL"
FT   gene            390147..390638
FT                   /locus_tag="MFS40622_0398"
FT   CDS_pept        390147..390638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69093"
FT                   /db_xref="GOA:D3S7T3"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T3"
FT                   /inference="similar to AA sequence:KEGG:MJ1070"
FT                   /protein_id="ADC69093.1"
FT                   /translation="MRKYLIILALILFLNSSFGYYLGYIEVTESNPAKTITFNMNKVEN
FT                   YTYKLSFVHYGNIKENMQVNIYLNENLVYTIDDSDDTSPAYKKNISIDITDYLKNGENV
FT                   LKVEGVNLIGNESYNPYYVLKDVYINEPTKTPISFELMIYTLLIISYLIYIFNENIKRE
FT                   "
FT   sig_peptide     390147..390206
FT                   /locus_tag="MFS40622_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.655 at
FT                   residue 20"
FT   gene            390678..391712
FT                   /locus_tag="MFS40622_0399"
FT   CDS_pept        390678..391712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0399"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; SMART: AAA ATPase; KEGG: mja:MJECL26
FT                   putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69094"
FT                   /db_xref="GOA:D3S7T4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T4"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ADC69094.1"
FT                   /translation="MKFYNRDKELHYLKNYVQLEPNSILFVYGPKSSGKSTVMRRVIKE
FT                   LENSDIIFFYYNLREHATYSKEEFLEVFFEKDRMKYVKNNLILDLKVFKIGIEENYDFS
FT                   KLSLNDVFKKIKSSINAVIEDGKRPVLIIDELQKLKNIYFNGDGNGDKSLLNELFNLFV
FT                   SLTKMEHLCHVICITSDTLFIDEIYRNSTLKNASEYYLIDWLRKGAIRNILKEEDFSEE
FT                   EINYCLNYLSLPYEISQLINNKKLGLSVEQTIKQWINVEKDGLKYLIDTTDLDEDKIYG
FT                   VLSKFKDKIKISYHREVTKEEMKYIKFLIENEILFYDVINGIIKPTSIIEWHAIREIIG
FT                   LLQE"
FT   gene            391903..393021
FT                   /locus_tag="MFS40622_0400"
FT   CDS_pept        391903..393021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0400"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   mfe:Mefer_0512 glycosyl transferase family 9"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69095"
FT                   /db_xref="GOA:D3S7T5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T5"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADC69095.1"
FT                   /translation="MNKISILRSVDKYIGNLIISLLSIFKTKTHKNLTDKKPKNVLIIR
FT                   LWTLGESLLTLPMIKKLKDEGYNVSVLVTKRSKGVFENVDFVDEIIDFENFWEVLKKFK
FT                   KYDVVIDTEPYLNISAILGWFLGRDVIGFKGLFRDKLYDFKIEYNDKIHAVYNFCNMLK
FT                   PFDIDYKPEKLVPLKYTEKDKENVNKLLKEYDLDDKKLIGIHCGTAETAPWRSWKKEKF
FT                   AKLIEKLVEDGFYVVLTGSMGDYEINEKILNLVNNKYRDRVFNFACKTNLREFAYLLTK
FT                   FKVFVSNDTGPMHLSAAMGTKTIGLFGPNLPERFAPFGKGNIAIYKARSLDCSPCINVH
FT                   KGEFKECKLNGKCMDLIEVEDVYNVIVDLVKN"
FT   gene            393021..393884
FT                   /locus_tag="MFS40622_0401"
FT   CDS_pept        393021..393884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0401"
FT                   /product="methyltransferase FkbM family"
FT                   /note="TIGRFAM: methyltransferase FkbM family; KEGG:
FT                   pub:SAR11_1018 methyltransferase FkbM"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69096"
FT                   /db_xref="GOA:D3S7T6"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T6"
FT                   /inference="protein motif:TFAM:TIGR01444"
FT                   /protein_id="ADC69096.1"
FT                   /translation="MGDSMSIRSTLGLINELWRYSNYNIDFLIRISILELWNCLKGRTK
FT                   LDFFKKYDFKFKTMLNKEFLFNTPYGKFIASSIDGWYAMQNNYEKYVQEVFNDNYQKYK
FT                   MNKDKIFLDIGANIGRFTVLNALRGYKVYAFEPAEPIFKQLERNVKLNNLNNVVLIPYA
FT                   LSDEENEFEFEYFEGFECSSRIREKRDEFSKYAKILKIKTKRLDEIVKEYNINIDKIRL
FT                   IKIDVEGHEYGVIKGGIKTFKKLNNVDITMEIWDSNPNKEKTLKLMRELGFKCEQISKD
FT                   DWHFWK"
FT   gene            393890..395080
FT                   /locus_tag="MFS40622_0402"
FT   CDS_pept        393890..395080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0071 glycosyl transferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69097"
FT                   /db_xref="GOA:D3S7T7"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69097.1"
FT                   /translation="MNKKLLYFLLKLSILISNISYNILFKKRRLNIDLTKTLILFNRTD
FT                   RIGDAIVTLPFFLALKNKGIKFKVLCSPYNKWVLEPFVEIEEIKDFKFSDFEFSIKSLL
FT                   FNILSSIATYLKNLFIEKNKNITFVDLKGDFHLSERFKNYYQIHFKSFLLNLKYSDYVF
FT                   NDFYVFGSKMQLIEKYSMIFDNLEDIEEFPKELKEYIINNHNKEIDTLINSLKDFIIIF
FT                   VGNKEFRNLNIEQWKYLIENINYEGKIVVIDDPSQNYLKRLKSIIKKENVIFLEKVYDL
FT                   WSLMYLAMHSKLVIGVDGGGFNFLQLPTNAFEIILYTNEKVWRPFSKNEYQIIRKDRKH
FT                   IIEKSITSQNLKKYIYYIDWDYKVVYEILQEKNNDFVDKIRVDLIVEEINKILFEV"
FT   gene            complement(395082..396617)
FT                   /locus_tag="MFS40622_0403"
FT   CDS_pept        complement(395082..396617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0403"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   mvu:Metvu_0060 polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69098"
FT                   /db_xref="GOA:D3S7T8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T8"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADC69098.1"
FT                   /translation="MVNKLSYKERAIKGIGWNFLLLILAAPIGYLVRMLYANEIPKLEV
FT                   GLFYAVLDFCCMVAIFKDLGLSAALVRYIPKFLHERRKDLIKSAIVSVGILQSSVSLII
FT                   TILIILLAPFIAEFYINNQGQFTGHLDLVINVLIILSIGYWFQSIMDVISNSIQGFQNQ
FT                   KYFGTINFVRIFLILVLSVVFIYIFGMHSVFTPTYAYTLAPILMILVYGYIFIKKIFSE
FT                   FFKERFLFSKKLVKDLFSYGLPLMIGSAGSLVLGYVDGICLTYFTGLNAVADYRNVAMP
FT                   TVSILGYFASAVGAVLFPMSSELWEKGYKEALGYGVERICLYSFVLVLPMAILMAYFPE
FT                   VIINLFFNPQYLSAAPAIRILSLGTVFLTLNNIGFTVLNGIGKPHLSTKILYGGAIFNL
FT                   VFNILLIPKFGIVGASLTTIFSYLIMWILQAWYLSRFLNYSFLIKKWILAVLVGIFSLI
FT                   PLMLVTKIISNVVLQLIVGGVVYFGVYLIGILGLKIININEIKNIVSSLKIKN"
FT   gene            complement(396624..397694)
FT                   /locus_tag="MFS40622_0404"
FT   CDS_pept        complement(396624..397694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0404"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; SMART: AAA ATPase; KEGG: mja:MJ0147
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69099"
FT                   /db_xref="GOA:D3S7T9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7T9"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ADC69099.1"
FT                   /translation="MKFFNREKEIKEILSILEGEPNNIYFIYGPLNSGKTTLIKYIIEN
FT                   RISDDYKVFYINFRTYLISEKKEFIEAIFTTKKDDFFEKIKDKSEVLNLITKGAKILTG
FT                   IPIPEIEFDKLFEEKINDVFQYLNTLLLEVKKSGKQPILIFDEFQMIKDVVLNGQKYLL
FT                   KELFQFLVSLTKEQHLCHVFCLSSDSLFIEYIYGKAELKGRVDYILVDDFDKDTALKFI
FT                   DFLSGDLLNRHLSNDDKELIYNYVGGKAKDIYDVIVKLKLGKDLKEVLETKLGEELNHL
FT                   EELLEKVEEDYESVNYDEVLEVLKLFKDNYEVPKNKIKRKIRIFLIKENILFLNSQKRI
FT                   LKPQSFLVWNAIKRLL"
FT   gene            complement(397716..397832)
FT                   /locus_tag="MFS40622_0405"
FT   CDS_pept        complement(397716..397832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69100"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U0"
FT                   /inference="similar to AA sequence:KEGG:MJ0604"
FT                   /protein_id="ADC69100.1"
FT                   /translation="MVEYGILINVIIKSENEFNKLRYSSFYSTILNEGVEIL"
FT   gene            complement(397906..399105)
FT                   /locus_tag="MFS40622_0406"
FT   CDS_pept        complement(397906..399105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0406"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; KEGG: tko:TK1842 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69101"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U1"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADC69101.1"
FT                   /translation="MSNEYLETIKLTARFKIKQTPNEIVGLFSTYKTIVNELLNYAFEN
FT                   NITSFKRLKSEKYKELREKYQKLPSHYLYTACQITTSIFKSWRKRHRKGRASKKPDFKG
FT                   SVIMLDDHLFRLDLDNGLARISTPKGRVEVELFVSEYHKKFKDWKVGQAWIVRRKDAYY
FT                   LNVVFSKNVLIKEGESVVGVDLNENNVTIATTNGIIQIITNERTVRTSYYVKRRKIQKK
FT                   VENEDKKKELLEKYGNRERNKITDIYHKVVNKIIEIAKSVNGVIALEDLKEIRNKIKYS
FT                   KKLNGRLHRWSFRRLQEVIKYKAKLNGIKVIFVNPHYTSSRCPICGGKMSPNGHRVLKC
FT                   EDCGCILDRDVVGSLNIMLRGFKLLFNKPKDVGSPVPPESPLLGEDSPLQIIQQIIQMF
FT                   "
FT   gene            complement(399247..399753)
FT                   /locus_tag="MFS40622_0407"
FT   CDS_pept        complement(399247..399753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0407"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   mfe:Mefer_0530 histidinol-phosphate phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69102"
FT                   /db_xref="GOA:D3S7U2"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U2"
FT                   /inference="protein motif:TFAM:TIGR01656"
FT                   /protein_id="ADC69102.1"
FT                   /translation="MNKAIFLDRDGVINKRLIGNYVKKIEEFELLPKVREALIEFKKMG
FT                   YLLIVVTNQQGIAKGVMTEEDLKVVHDYMLKLLPEIDDIFYCPHLEGTCNCRKPRNGML
FT                   LKAKEKWNIDFKKSWMIGDSERDIICGKSVGCKTIRILYEDEETEADFIAKSLYDCVEI
FT                   IRKSG"
FT   gene            complement(399872..400786)
FT                   /locus_tag="MFS40622_0408"
FT   CDS_pept        complement(399872..400786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0408"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mfe:Mefer_0531 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69103"
FT                   /db_xref="GOA:D3S7U3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U3"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADC69103.1"
FT                   /translation="MIIVLGEVMLDKYTYGKVERINPEAPVPILNVVEERYTLGGAGNV
FT                   ANNIASLNHDVFLISISNNDEFGKCIEELCNENNIKYCFVSDGRPTIVKHRFVAMGYNQ
FT                   QLLRVDYEKIYPINDELSSKILEVIKNLNGKSNILIISDYAKGLITKELMEGIKKEFKG
FT                   KILVDPKPKNIEFYRDVYLIKPNLKEASQILGREIENKDEELEKAGLELVDKYNSNFVI
FT                   TRSEKGATLITLDGEIFHIPTKVKEVHDVSGAGDTFIAVLGYALDKGYDLIEAVKLANK
FT                   ASSIVVGKVGTATVSLEELFSEK"
FT   gene            complement(400942..401415)
FT                   /locus_tag="MFS40622_0409"
FT   CDS_pept        complement(400942..401415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0409"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; KEGG: mvu:Metvu_0055 RfaE
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69104"
FT                   /db_xref="GOA:D3S7U4"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U4"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ADC69104.1"
FT                   /translation="MIIEDRRLLEDIVRELKNQNLKIVFTNGCFDIIHRGHVEYLNKAK
FT                   KLGDILIVGINSDKSIKKIKGNKRPIIPLYSRAYVLDNLKAVDFVVPFDEETPIELIKI
FT                   IKPDIHVKGGDYKEEDLPEAEIVKSYGGEIKIIPLIEGFSTTKIIEWVLEKYK"
FT   gene            complement(401447..401749)
FT                   /locus_tag="MFS40622_0410"
FT   CDS_pept        complement(401447..401749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_1561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69105"
FT                   /db_xref="GOA:D3S7U5"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U5"
FT                   /inference="similar to AA sequence:KEGG:Mefer_1561"
FT                   /protein_id="ADC69105.1"
FT                   /translation="MAISYAKLYELILKKVKDEKEAREIYDIIIELNKENKIIIKNELK
FT                   DELRSELATKEDIKYLDEKIEKEIKLLRRDMIIIALIIILSIYAPEIIGKLLLFK"
FT   gene            complement(401823..402377)
FT                   /locus_tag="MFS40622_0411"
FT   CDS_pept        complement(401823..402377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0411"
FT                   /product="phosphoheptose isomerase"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   mvu:Metvu_0054 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69106"
FT                   /db_xref="GOA:D3S7U6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U6"
FT                   /inference="protein motif:TFAM:TIGR00441"
FT                   /protein_id="ADC69106.1"
FT                   /translation="MKKYFEESANVKLKFIEENEGKLKKAIDIIYNALKNGNKILICGN
FT                   GGSAADSQHFAAEIVGRFKLERKGLPAIALTTDTSILTAIGNDYGFDKIFERQVEALGK
FT                   EGDVLVGISTSGNSENVIKAVNKAKEMGIYTIGLLGKDGGKLKDIVDLALIVPSNNTAR
FT                   IQECHLTIYHVICEEVEKRLF"
FT   gene            402466..403320
FT                   /locus_tag="MFS40622_0412"
FT   CDS_pept        402466..403320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0412"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   mja:MJ1334 UDP-glucose pyrophosphorylase (GtaB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69107"
FT                   /db_xref="GOA:D3S7U7"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U7"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ADC69107.1"
FT                   /translation="MIKKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVE
FT                   AGVKDILFVTGKGKQAIENHFDVNYELECKLEKSGKYELLKIIKEIDNLGNIFYVRQKE
FT                   QKGLGDAILYGEEFVGEEYFIAMVGDTIYSKNIVKDLIKAHEKYGCSVIALERVPKEDV
FT                   YKYGVIDGEKIEEGIYRIKNMVEKPKVEEAPSNLIITGAYLLSPKIFEKIRETPPGRGG
FT                   EIQITDAMNLLLKEEEIIGVEINCKRYDIGDVLGWLKANVEIGAEKFPEFREFLKEFVK
FT                   NLL"
FT   gene            403601..404014
FT                   /locus_tag="MFS40622_0413"
FT   CDS_pept        403601..404014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0413"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mfe:Mefer_0535 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69108"
FT                   /db_xref="GOA:D3S7U8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADC69108.1"
FT                   /translation="MDIAIILGLLVAVFYGVGTFFAKIVCEKNPLFQWIVVNIVGIILC
FT                   LIILIKYKNIIITEQKILSYAIISAILVVIGSLLLYYALYKGKASIVVPLSSIGPAITV
FT                   ALSIMFLKESLTISQMIGIVFIIVGIILLSISN"
FT   gene            complement(404029..405498)
FT                   /locus_tag="MFS40622_0414"
FT   CDS_pept        complement(404029..405498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0414"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: protein of unknown
FT                   function DUF224 cysteine-rich region domain protein;
FT                   ferredoxin; KEGG: mja:MJ0092 succinate
FT                   dehydrogenase/fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69109"
FT                   /db_xref="GOA:D3S7U9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7U9"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ADC69109.1"
FT                   /translation="MIKIKVKRFDGKKEYFESYEVPENITVLGALEYINKNYGANILFR
FT                   ASCRNGQCGSCALTINGEPRLACETKVEDGMIIEPLKGFKVIRDLIVDRESYYKKLLGI
FT                   RNYLIRKNYPEGLEIIPQKYVEENKELRGCIDCLSCLSVCPAREVSDYPGPTFMRQLAR
FT                   FAFDKRDEDSREITAYFENIYNCTTCAKCVEVCPKEIDIVHKAIERLRALAFSKGYYID
FT                   NHLKVRENVLKYNRSVVEEDLPLLKQVDDFYPAENEKLRVAFFTGCLVDFRLQNVGKDA
FT                   IKVLNAHGVSVVIPKNQVCCGSPFFRTGQRDVAEMLKKKNLEIFNKLDVDCVVTICAGC
FT                   GSTLKNDYKEREFEVKDITEVLTEVGLLKYKPLKMRVTYHDPCHLRRGQGIYEQPREIL
FT                   KSIPELEFVDIEARCCGAGGGVRSGKPDIANLIGKRRAKMIYNANVDAVITVCPFCEYH
FT                   IRDSLKRFKEENKLDKEIDVMNIVSLLAKVI"
FT   gene            complement(405498..406415)
FT                   /locus_tag="MFS40622_0415"
FT   CDS_pept        complement(405498..406415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0415"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: mja:MJ0091
FT                   Na+/Ca+ exchanger protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69110"
FT                   /db_xref="GOA:D3S7V0"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V0"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ADC69110.1"
FT                   /translation="MMLILGIGYFLLGLILLYYGSDWFVLGSERIARHFNVSNFVIGAT
FT                   VMAIGTSLPEILTSAYASYMHAPGISIGNAIGSCICNIGLVLGLSAIISPIVVDKNLQK
FT                   NILAYLLFVVFTAVIGIDGFSWIDGIILLILFAFYLRWTIKNGSVGEIEENNNKNSGHS
FT                   IVFSLVLLIIGLVGVLVGAELFVDGAKKIATALNISDKVIGFTLVAFGTSVPELMVSLA
FT                   AAKRNLGGMVLGNVVGSNIADIGGALAVGSLFMYLPPAPIQMGVLTVMSLLLYLFAKYS
FT                   KIGRWQGLLFLTLYIIAIALLRMG"
FT   gene            complement(406427..407641)
FT                   /locus_tag="MFS40622_0416"
FT   CDS_pept        complement(406427..407641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0416"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: mja:MJ0090 collagenase
FT                   (PrtC)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69111"
FT                   /db_xref="GOA:D3S7V1"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V1"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADC69111.1"
FT                   /translation="MVELLSPANDLTCLKTAIDYGADAVYCGLKELNMRANAKNFTREE
FT                   LIEGIKYAHDNNRKVYLCTNTVIYENDLKKVEEILDFANSAEVDAVIVSDLGTMQLANE
FT                   LGLRVHASVQCNITNSLTAKFYSKFAKRVILSRELTLNQIREIRENLKKDGVNLELEGF
FT                   VHGALCVAISGRCFLSSYLFGRHANCGDCLQPCRRKWKLINEHHDGTYEVVCEGKYLLS
FT                   PKDLCMIEHIPALMEVFDSFKIEGRAKNADYVMRTTKVYREAIDSVLDGTYYDKLEYFK
FT                   KELQKVYNRGYDTGFYFRDINKNHDFQYEIEGNASKYRKIEIGRVVNFYKKVSVAEIEL
FT                   WGDLKIGDTILIMGKTTGCVEEVVKSMQINHKDVNIAKKGDRVGVKLNHLVREGDRVYL
FT                   LKEIE"
FT   gene            complement(407771..408526)
FT                   /locus_tag="MFS40622_0417"
FT   CDS_pept        complement(407771..408526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0417"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ0089 ferric enterobactin transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69112"
FT                   /db_xref="GOA:D3S7V2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC69112.1"
FT                   /translation="MILSVDGVEFAYRSRKVLNNIKFEVKRGEVVSILGVNGAGKSTLL
FT                   KCINKILKPKRGTILIDNFDIRQLDNLELAKKVGYVPQRAEGNYMTVFDAVLLGRKPHI
FT                   KWEVSDKDIEITHKVLKLLNLEDYALRYTNELSGGELQKVIIARALVQEPQILLLDEPT
FT                   NNLDLKNQLEVMRIIRDISKSQNIASIVVMHDLNLALRYSDKFIMLKDGVIYAEGGKEI
FT                   ISPENIKAVYGVDAYVENVRGIPVVIPIR"
FT   gene            complement(408536..409090)
FT                   /locus_tag="MFS40622_0418"
FT   CDS_pept        complement(408536..409090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69113"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V3"
FT                   /inference="similar to AA sequence:KEGG:MJ0088"
FT                   /protein_id="ADC69113.1"
FT                   /translation="MPNIWGEMLENTAKITFIFESEKRLSWEEYVNYLIFAHYFKLIYI
FT                   LLRNNKELLEKILEVSLDNKDDYYKLGKYLHHDIMGYIRRHGYLSFLPFTPLPFYKELC
FT                   QKFMVKIPEKPIIDYKCLEKIENNKIVFEFEGEAECLKCLMYLKDLSAEIKLHEDIKVV
FT                   KPEKMAIKILAVLLYILHNLA"
FT   gene            complement(409127..410176)
FT                   /locus_tag="MFS40622_0419"
FT   CDS_pept        complement(409127..410176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0419"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mja:MJ0087 hemin permease (HemU)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69114"
FT                   /db_xref="GOA:D3S7V4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADC69114.1"
FT                   /translation="MDIPQKYKAYTKKKIAFGFILLITLFLSAIYALCVGDYKLTVNEV
FT                   INALLGYGSSNINLVIWNIRLPRIFAAIIAGISLAVAGAVMQCILRNPLASPFTMGISH
FT                   GAMFGACFAIIMFGFGGAESTGRIFINNPYVITIFAFLGALIGVVVILLLAKLRGLTPE
FT                   AMILAGVAMSSLFTAGTMLIQYFADDLQLAAMVYWTFGDLGRPIWTEIYIMTAVMIPSL
FT                   IYFIYKRWDYNALEAGEETAKSLGVNTEKTRLIGMLVASLLTSVNVAFLGIIGFVGLIC
FT                   PHIVRICIGGDYRFLIPISALFGAVLLLIADTFARTIIAPIVLPVGILTSFLGAPMFLY
FT                   LLLKMYKRV"
FT   gene            complement(410302..412827)
FT                   /pseudo
FT                   /locus_tag="MFS40622_0420"
FT                   /product="hypothetical protein"
FT   gene            complement(410497..411741)
FT                   /locus_tag="MFS40622_0421"
FT   CDS_pept        complement(410497..411741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0421"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; putative transposase
FT                   IS891/IS1136/IS1341 family; KEGG: mja:MJ1635 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69115"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V5"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADC69115.1"
FT                   /translation="MPNKTKSKNSQELSYQIVLSYKVRHNHLLKTFLIECRNKLNTAID
FT                   IIWNNIEYSKERKPKIPKSNKFKRDLRNKLLKDWNYASHYIDGVIKTAYSILESWASNY
FT                   KKGYRTKTKPIVKRLFVRVKTTLIKYDKEKGEVRITIKPRKEYLILNIKDEWFFDKVKD
FT                   LTIGEIILKENEAFLTFKDNLNYSDKEIIVGVDSNLKSLDLYHPIKGWIRIDLSELHRL
FT                   KEVYDRKIDFLKKLLKKCPLRSLRKIKRLFERRRNRVNDFLHKLTIQLSQLFPNAIFVF
FT                   EDLDKRRMYKHKTFNRKLDRVNWNGIIEKLSYKTIVILVNPAYTSTTCPVCGSRMESQE
FT                   GQVMYCYNCLSSFNRQLVGCFNIFRRGLGKIKELMGGSGVTTTGAEVSFGKLMTPNPNV
FT                   VYKVDYNGKYLMRIT"
FT   gene            complement(412958..413707)
FT                   /locus_tag="MFS40622_0422"
FT   CDS_pept        complement(412958..413707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0422"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   mja:MJ0084 CODH nickel-insertion accessory protein (CooC)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69116"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR014433"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V6"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADC69116.1"
FT                   /translation="MKISICGKGGCGKSSVTTLLAKEFAKKGYNVLVIDGDESNLSLHK
FT                   LLGMDLPKDFIEYLGGRKEFMKKLREKMEGKEVELFEGEISIASLPKEYLVEKDNIKLL
FT                   AIGKIHDFGEGCACPMGALLREFLKSLKLNDKEVVIVDTEAGIEHFGRGVEGGCDVIIA
FT                   IVDPTYESIRLSKKIEEIGEKLGKKVYFIVNKVDDETKDLILENINKDKVIAVIPNNKE
FT                   IMRCGLKGEELSVEIPEIKHIVEILAK"
FT   gene            complement(413743..414963)
FT                   /locus_tag="MFS40622_0423"
FT   CDS_pept        complement(413743..414963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0423"
FT                   /product="LOR/SDH bifunctional protein conserved domain
FT                   protein"
FT                   /note="PFAM: LOR/SDH bifunctional protein conserved domain
FT                   protein; KEGG: mka:MK0866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69117"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V7"
FT                   /inference="protein motif:PFAM:PF04455"
FT                   /protein_id="ADC69117.1"
FT                   /translation="MNFEVVELEGHIIDSNILSKVLDKIISMGGDFEIEKLEVGKTNED
FT                   KSYARILVKGKDGEHLDNILREIQQLGAVVSTDDVETKKAPRDKVLPDDFYGTTNLPTY
FT                   VKIDGVWKEVEDIEMDCVIVIENRNGEKVPVCKRMGLIKEGDEVVVGYKGIRVVPLERS
FT                   REKDIFGFMQSEVSPEKPLDYYSKMIAEEIKRIKKNNGKIVWVVGTAIAHTRAHKILEK
FT                   FVRDGYVDALFCGNGFATMDIEYALFGTTLGMDDTCNIVKGGYKSHLVAINEMWKAGGI
FT                   KEAVKKGILKKGVLYECVKNNVPYVIGGSLRDDGPLPDTITDVMVAQDEMRKHAKNADM
FT                   CIILATMLHGIATGNILPARVKTVCIDMNPYVVTRLQDRGTHQAVGIVSDPCAFLHLLE
FT                   KDLYGKE"
FT   gene            complement(415039..416697)
FT                   /locus_tag="MFS40622_0424"
FT   CDS_pept        complement(415039..416697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0424"
FT                   /product="methyl-coenzyme M reductase, alpha subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="KEGG: mja:MJ0083 methyl coenzyme M reductase II,
FT                   subunit alpha (MtrA); TIGRFAM: methyl-coenzyme M reductase,
FT                   alpha subunit; PFAM: methyl-coenzyme M reductase alpha
FT                   subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69118"
FT                   /db_xref="GOA:D3S7V8"
FT                   /db_xref="InterPro:IPR003183"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR015811"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR016212"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V8"
FT                   /inference="protein motif:TFAM:TIGR03256"
FT                   /protein_id="ADC69118.1"
FT                   /translation="MEVEKKLFLKALKEKFEEDPKEKYTKFYIFGGWRQSARKREFVEF
FT                   AQKLIEKRGGIPFYNPDIGVPLGQRKLMTYKISGTDVFVEGDDLHFCNNAAIQQLVDDI
FT                   KRTVIVGMDTAHAVLEKRLGVEVTPETINEYMETINHALPGGAVVQEHMVEVHPGLVWD
FT                   CYAKIFTGNDELADEIDKRFLIDINKEFPEEQAEQIKKYIGNRTYQVSRVPTIVVRCCD
FT                   GGTVSRWSAMQIGMSFITAYKLCAGEAAIADFSYAAKHADVIQMGMILPARRARGPNEP
FT                   GGVPFGIFADIIQTSRVSDDPAQVTLEVIGAAATFYDQVWLGSYMSGGVGFTQYASATY
FT                   TDDILDDFVYYGLDYVEKKYGLCGVKPSMDVVKDIATEVTLYGLEQYDEYPALLEDHFG
FT                   GSQRAGVTAAAAGCSVAFATGNSNAGINGWYLSQILHKEYHSRLGFYGYDLQDQCGAAN
FT                   SLSIRSDEGLLHECRGPNYPNYAMNVGHQPEYAGIAQAPHAARGDAFCLNPIIKVAFAD
FT                   DNLIFDFKWPRKCIAKGALREFEPAGERDLIIPAA"
FT   gene            complement(416697..417497)
FT                   /locus_tag="MFS40622_0425"
FT   CDS_pept        complement(416697..417497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0425"
FT                   /product="methyl-coenzyme M reductase, gamma subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="KEGG: mja:MJ0082 methyl coenzyme M reductase II,
FT                   subunit gamma (MtrG); TIGRFAM: methyl-coenzyme M reductase,
FT                   gamma subunit; PFAM: Methyl-coenzyme M reductase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69119"
FT                   /db_xref="GOA:D3S7V9"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7V9"
FT                   /inference="protein motif:TFAM:TIGR03259"
FT                   /protein_id="ADC69119.1"
FT                   /translation="MAYKPQFYPGNTLIAENRRKHMNPNVELKKLRDIPDDEIVKILGH
FT                   RNPGESYKTVHPPLEEMDFEEDPIKDIVEPIQGAKEGVRVRYIQFADSMYNAPAQPYDR
FT                   ARTYMWRFRGIDTGTLSGRQVIEMRELDLEKISKNFLIDTEFFDPATCGIRGATVHGHS
FT                   LRLDENGLMFDGLQRYIYDEKTGHVLYVKDQVGRPLDEPVDVGEPLPHDYLAKITTIYR
FT                   KDNIGMREDEEALEVVQIIHEARTKGGFGLEVFKKDLKKRLGEE"
FT   gene            complement(417508..418851)
FT                   /locus_tag="MFS40622_0426"
FT   CDS_pept        complement(417508..418851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0426"
FT                   /product="methyl-coenzyme M reductase, beta subunit"
FT                   /EC_number="2.8.4.1"
FT                   /note="KEGG: mja:MJ0081 methyl coenzyme M reductase II,
FT                   subunit beta (MrtB); TIGRFAM: methyl-coenzyme M reductase,
FT                   beta subunit; PFAM: Methyl-coenzyme M reductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69120"
FT                   /db_xref="GOA:D3S7W0"
FT                   /db_xref="InterPro:IPR003179"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR022679"
FT                   /db_xref="InterPro:IPR022680"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W0"
FT                   /inference="protein motif:TFAM:TIGR03257"
FT                   /protein_id="ADC69120.1"
FT                   /translation="MLHYEDKIDLYDERGKLLEENVPLEAISPLKNPTIERIVNDIKRS
FT                   VAINLAGIENALRTGAVGGKACFCPGRELDLPIVENAEIIAEKIKKMVQIEEDDDTVVK
FT                   LINGGKQLLLQLPSKRLRVAADYTVSALIGGGATVQAIVDTFEVDMFDAPVVKTAVMGR
FT                   YPQTVDFHGANIATLLGPPVLLEGLGYGLRNIMANHIVAVTRKKTLNAVALASILEQTA
FT                   MFETGDALGAFERLHLLGLAFQGLNANNLTFELVKKNGKDGTVGTVVASVVERALEDGV
FT                   IRPVKTLPSGFTVYEPVDWALWNAYAASGLVAAVIVNVGAARAAQGVASTVLYYNDILE
FT                   YETGLPSVDFGRAEGTAVGFSFFSHSIYGGGGPGTFHGNHVVTRHSKGFAIPCAAAAMC
FT                   LDAGTQMFSVERTSALVGTVYSAIDHLREPLKYVAEGAVEVKEKEKVI"
FT   gene            419348..419731
FT                   /locus_tag="MFS40622_0427"
FT   CDS_pept        419348..419731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0427"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; NikR nickel binding; KEGG: mja:MJ0080 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69121"
FT                   /db_xref="GOA:D3S7W1"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W1"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ADC69121.1"
FT                   /translation="MERISLTIEKNLLKEVDEIIDKERISRSEFIRRALEYYVKKYDWL
FT                   SRIESKVGEITVIYNSKAVNDIVELESQYRDIVITSLEIPFERKIIRMIAIKGQRDRII
FT                   EFTNKLKGISNVELAQLTTISIE"
FT   gene            419736..420866
FT                   /locus_tag="MFS40622_0428"
FT   CDS_pept        419736..420866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0428"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: mja:MJ0079
FT                   regulatory protein, putative (MoxR)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69122"
FT                   /db_xref="GOA:D3S7W2"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041538"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W2"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADC69122.1"
FT                   /translation="MHKLEKIREELNSYFLERREEIDIALTSILANEHTVFLGNPGVAK
FT                   SQLIRAIASHINANYFEKLITRFTTEDELFGPLSIKELKDNDRFVRKTSGYLPTAEIAF
FT                   LDEVFKANSSILNALLSIINERIYHNGDRIEKVPLISLFGASNELPEENELLAFYDRFL
FT                   FRKVVKGIRSCENLIKLIKLEDEYKPKTTITVKELKKMQEEANEVDIENIIGYLVDIKK
FT                   RLSQNHIYISDRRFKKSVKAIKCFAYLNGRKEAEIEDLEILRHIFWDDVDDILIVSKVI
FT                   FDITNKYAEQVLDKVEIIKNLKNELKYIDIKKIGECKKDYNKLIEILCKMAYIRLELKK
FT                   IRNEALINKRKTDFIDEVIKETDEFNNYVEGILNEL"
FT   gene            420856..421491
FT                   /locus_tag="MFS40622_0429"
FT   CDS_pept        420856..421491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69123"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W3"
FT                   /inference="similar to AA sequence:KEGG:MJ0078"
FT                   /protein_id="ADC69123.1"
FT                   /translation="MNCEEYRKKLKLNYGNREKLKVLKELYQMEVDEITKLNILDDVFE
FT                   LLTSTKERGFEDIISTHYTSDSKNKAIIYYCIKIIEKVGVKYPNLVYIYIPYLIKLLDS
FT                   EFECIRFASAEALANIPSKLTIYAYPKLIRRLDNEVYAKVLVKLIMKSDNKEAILLKLF
FT                   ENFNEYSLCVIKELYKYDKKLVYEFIPLILRDFGDRGLIMMREIKADL"
FT   gene            complement(421460..421801)
FT                   /locus_tag="MFS40622_0430"
FT   CDS_pept        complement(421460..421801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69124"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W4"
FT                   /inference="similar to AA sequence:KEGG:MJ0076"
FT                   /protein_id="ADC69124.1"
FT                   /translation="MEVSLLSISIKPPIKIPKNKTVELNVDWNIEYKKLDTKKFNFVCN
FT                   IKAYGEFSFEANIEGEINTEKDYNNIPEFISVSIVENLMKSIPKLVSYAQQFRIEENAF
FT                   INQPLSLAS"
FT   gene            421882..423030
FT                   /locus_tag="MFS40622_0431"
FT   CDS_pept        421882..423030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0431"
FT                   /product="von Willebrand factor type A"
FT                   /note="SMART: von Willebrand factor type A; KEGG:
FT                   mja:MJ0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69125"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W5"
FT                   /inference="protein motif:SMART:SM00327"
FT                   /protein_id="ADC69125.1"
FT                   /translation="MIKYDKYDKMVWERCKDKIAFYLSERETEMVFYLFFKYEIEILEE
FT                   NDLIKKIIRDRRFKNIKSITTLDENYSLIATEFFCEKLKELKEKSREEDISELLDELES
FT                   YMENITSSFGSYGSGEGYKSYTDPKRKLELTEKLLKNSKLKEFMKVLGKFKRMAIKKYR
FT                   TKIKHFSGEKYSINLGNNLVNLLSSEYKNFAEEILFVDLLRRYNENKLLNYKILENDEN
FT                   CGDFVVCLDLSGSMRGNKEVWAKAIALCLMDISLKRNKRYIAILFDDGVRDIRVYEKKV
FT                   SFDEILEFASIFYGGGTNFEKPLREALKFNGDIVFITDGECEIPIEFLEKIKEEKQRRK
FT                   IKIYSICINTKPTLSLKQISDMAVTIYELTSKTAEKIFDILI"
FT   gene            complement(423027..423476)
FT                   /locus_tag="MFS40622_0432"
FT   CDS_pept        complement(423027..423476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0432"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mfe:Mefer_0412 HAD fAmily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69126"
FT                   /db_xref="GOA:D3S7W6"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W6"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ADC69126.1"
FT                   /translation="MIILLDLNGTIAADGKIKEGVKERLAILKEKAEIYILSADTFGTL
FT                   NDIAKNLNVKGMKVDREKYGSEKIAKLKILEELKKLNPDKKIIAIGNGNNDELLLKNAD
FT                   LGICVIGDEGAWSKTILSSDIVVKDINDALDLLLNENRLKATSRD"
FT   gene            complement(423552..423824)
FT                   /locus_tag="MFS40622_0433"
FT   CDS_pept        complement(423552..423824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0433"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG: mja:MJ0071
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69127"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W7"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ADC69127.1"
FT                   /translation="MKFNVEIHKRVLKDLKDLPKSNLEKFKELIETLKTNPIPKEKFDI
FT                   KRLKGSDDVYRVRIGKFRVQYVVLWDDKTVVIRKVSRREGAYKNP"
FT   gene            complement(423821..424069)
FT                   /locus_tag="MFS40622_0434"
FT   CDS_pept        complement(423821..424069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0434"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69128"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W8"
FT                   /inference="similar to AA sequence:KEGG:MJ0070"
FT                   /protein_id="ADC69128.1"
FT                   /translation="MLNINKEIAQLETELNELKKLRDDLSERIERLEIKLLKLKALTIP
FT                   EEEFEEDYEEIIEDVKKSLDKKETVSAEEALKELGLL"
FT   gene            complement(424119..425009)
FT                   /locus_tag="MFS40622_0435"
FT   CDS_pept        complement(424119..425009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0435"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: mja:MJ0069 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69129"
FT                   /db_xref="GOA:D3S7W9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7W9"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADC69129.1"
FT                   /translation="MIEMIEKAEILMEALPFIQKFYGKIFVIKYGGHAMIDEKAKNWTA
FT                   QDVVLLKYVGINPVVVHGGGPEINKAMEKMGKKPEFVHGLRVTDEETLDIVEMVLAGKI
FT                   NGDIVSKLSKFGGKAVGLSGKSGRIILAKKKLKKIKTEKGEEIEVDLGRVGETVEVNTE
FT                   LLEILINNGYIPVVSPIGLDEKGEAYNLNADTVAGDIAGALKAEKLILITDVDGIMDDI
FT                   NNPETLHRKLTASELKEMIEDGRIKGGMIPKAESALYALEHGVKSVHIINGKIPHALLL
FT                   EIFTEEGIGTMITRD"
FT   gene            425166..425513
FT                   /locus_tag="MFS40622_0436"
FT   CDS_pept        425166..425513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0436"
FT                   /product="Protein of unknown function DUF555"
FT                   /note="PFAM: Protein of unknown function DUF555; KEGG:
FT                   mfe:Mefer_0415 protein of unknown function DUF555"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69130"
FT                   /db_xref="InterPro:IPR007564"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X0"
FT                   /inference="protein motif:PFAM:PF04475"
FT                   /protein_id="ADC69130.1"
FT                   /translation="MPNYHVTLQAAYIVRNVDDVEDAISVTISQIGKMLNKEGLNYVDI
FT                   DIGLTICPKCGELVDCVLVVARTALVGVLLSMKVFNAESPEHAIRIAKATIGKVLKNIP
FT                   LEPVDVVELEK"
FT   gene            complement(425561..425872)
FT                   /locus_tag="MFS40622_0437"
FT   CDS_pept        complement(425561..425872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0437"
FT                   /product="FUN14 family protein"
FT                   /note="PFAM: FUN14 family protein; KEGG: mja:MJ0067
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69131"
FT                   /db_xref="GOA:D3S7X1"
FT                   /db_xref="InterPro:IPR007014"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X1"
FT                   /inference="protein motif:PFAM:PF04930"
FT                   /protein_id="ADC69131.1"
FT                   /translation="MIILDFSQFLPDIGSGFVIGFVVGWAAKKAIKIVAFLIGIYILSL
FT                   LYLAKIGVITINKEAFSALLGNLENSLLVFGDKIVGLVHSLSFGTSFLIGFGLGFKKG"
FT   gene            425936..427360
FT                   /locus_tag="MFS40622_0438"
FT   CDS_pept        425936..427360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0438"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase; PUA
FT                   domain containing protein; SMART: PUA domain containing
FT                   protein; KEGG: mja:MJ0066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69132"
FT                   /db_xref="GOA:D3S7X2"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X2"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADC69132.1"
FT                   /translation="MKTYIGKIHLKWCKNCNIPLLGRVCEVCGSKAVDVKLTPPGDPRL
FT                   GFKYDIDFMNDILEEEFGAKNVLNGKIILLNKIPGNEEAYEVIVDGEVKYLLYFDEDRE
FT                   RWKIKLKLNGARDLIEKGAYKKIIKIKDDVVEVLKNKKGSILRPGIIEFTDDIEERDDV
FT                   IIVDESGRVVGVGLAVVSSKDIKNMEKGKVVKVRFFIKDDKDDYKAGKVYDSLEEAFEL
FT                   MVKANKGVIDAFERNAIGFIKNTYEKLKKPVMVAFSGGKDSLATLILTLKALGKDIDVV
FT                   FIDTGLEFEETLKNVEEVEKHYGIKIIRLKGEDFWEKVKEYGIPARDYRWCSEVCKLEP
FT                   LKKFIEERYENDVLSFVGIRKYESFSRATKKRIHRNTYIRKQINALPIFHWSSLHVWIY
FT                   LLREKAPYNKLYEKGFDRIGCFMCPAMEMGEIYKIKKEFPELWEKWENILREYAKKHNL
FT                   GEEWIKKGLWRWKYKV"
FT   gene            427435..428526
FT                   /locus_tag="MFS40622_0439"
FT   CDS_pept        427435..428526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mja:MJ0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69133"
FT                   /db_xref="InterPro:IPR012032"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X3"
FT                   /inference="protein motif:PFAM:PF09890"
FT                   /protein_id="ADC69133.1"
FT                   /translation="MKIGVVIHGPEIIDSGYALKIINLLKRFGEVKAKLGGTMGRVAVI
FT                   DNNLQDIIDISEKLMPSQSLKKLADNDVLILMNYGKSKITGHTFGKIVVERANLNKPII
FT                   QIERPGEEDGTIIIWNDDNSEVVKDIANYLSKELNLKIERCVSNGLEVWEENGRVFRKV
FT                   HGVDVGEAILVNGIVVGRAKSREVILVAENGKLIDIIGGELKEGGVKKLKNVDLKKAVI
FT                   KTGVLRRHPTNPKIESREIDKGYTVIVNHAGEDVIEMIKNKEVVAVITIGDDTTTICGD
FT                   ILARFGIRVIGITDGDRDDILKNPVILKGSVVFLIKNMRDDDAGEILKKNLNLNKKYGY
FT                   QEILDEIKKIFNDNNICYEEFVY"
FT   gene            complement(428644..429204)
FT                   /locus_tag="MFS40622_0440"
FT   CDS_pept        complement(428644..429204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69134"
FT                   /db_xref="GOA:D3S7X4"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X4"
FT                   /inference="similar to AA sequence:KEGG:MJ0064"
FT                   /protein_id="ADC69134.1"
FT                   /translation="MNDKQTDWLNKLIEELDKSSSSVLETEVVLDEIITKLNNLISEIN
FT                   NYITEIHYGLRITNERINLSVSELDELEKKLKEYLDFAENMKKSVENTHNAIIAVKNEM
FT                   RDIKHSLEESSLKISNRYNLMEDTLRHHSKKIENLSNSIKSLSKNQESIINSINSIKML
FT                   LYVMMALTIVNLIISLKTSGILG"
FT   gene            complement(429256..429792)
FT                   /locus_tag="MFS40622_0441"
FT   CDS_pept        complement(429256..429792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69135"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X5"
FT                   /inference="similar to AA sequence:KEGG:MJ0063"
FT                   /protein_id="ADC69135.1"
FT                   /translation="MENKNDELLIKLDNSIKSLLRSAREFKKENENISNILLQLAEMLD
FT                   NIDKTLEIIEKNFQLIIKNRESGKFSNNEIIKKFVKPLENLIKVIENIENTSNNLKNEI
FT                   ENCASSIPTLKEITDKLKIINIASSTQAIEEFKIAYDMLENNRKKLDELIDKTKILKDK
FT                   LENLLLQIDDFLNKH"
FT   gene            complement(429915..430565)
FT                   /locus_tag="MFS40622_0442"
FT   CDS_pept        complement(429915..430565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0442"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; KEGG: mja:MJ0062 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69136"
FT                   /db_xref="GOA:D3S7X6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X6"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADC69136.1"
FT                   /translation="MELKDKIIKIYELDENERKKVLDFLKEEILNGKIIICGTDTLYGI
FT                   SANALDEKAVKKVYEIKRRDFSKPLSICVKDKSEIEKYAYVNDLAKKIIDKFLPGALTI
FT                   ILKKKPVIPDIVAKDYVGIRIPDEPIIRELSIVPLTTTSANISGKESPTSVNEIDEEIL
FT                   KNVDYVVDIGKCKYSKPSTIIKIEDDKIIPIREGVIPFSKIRKVANIMGLSQE"
FT   gene            complement(430577..430849)
FT                   /locus_tag="MFS40622_0443"
FT   CDS_pept        complement(430577..430849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0443"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0061 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69137"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC69137.1"
FT                   /translation="MPLSANFGDNMLSKILSIFKGKKDIREKSNKIIEIDYNKCKNCLS
FT                   CYRTCKNNVFAIENNRVVVKNEENCTKCGECLKACRYGAIILYDS"
FT   gene            complement(430833..431591)
FT                   /locus_tag="MFS40622_0444"
FT   CDS_pept        complement(430833..431591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0444"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /note="TIGRFAM: methylthioadenosine phosphorylase; PFAM:
FT                   purine or other phosphorylase family 1; KEGG: mja:MJ0060
FT                   methylthioadenosine phosphorylase (MtaP)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69138"
FT                   /db_xref="GOA:D3S7X8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X8"
FT                   /inference="protein motif:TFAM:TIGR01694"
FT                   /protein_id="ADC69138.1"
FT                   /translation="MIGIIGGTGIAEILKGDKEEIVDTKYGKAKVIIDKENEVVLLFRH
FT                   GVKHNIPPHKINYRANIYALKKLGVERILAINSVGSLKEHLKPGMFFIPNDFIEFTKKR
FT                   EETFYDEGKVVHIDMTEPYCPELREILKSILDKNNFAYGEGVYVCTEGPRFETKREIAI
FT                   YKNWGDVVGMTGYPEVVLARELEMCYVSLCNITNYACGISKHILTVDEVLEKIKEMEDK
FT                   ILKVVENFINYDFGERKCICKDALKHAVIG"
FT   gene            complement(431920..432258)
FT                   /locus_tag="MFS40622_0445"
FT   CDS_pept        complement(431920..432258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0445"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   mja:MJ0059 nitrogen regulatory protein P-II (GlnB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69139"
FT                   /db_xref="GOA:D3S7X9"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7X9"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADC69139.1"
FT                   /translation="MRKVEAIIRPEKLEIVKKALSDAGYVGMTVSEVKGRGVQGGIVER
FT                   YRGREYIVDLIPKVKIELVVREEDVDNVIDIICENARTGNPGDGKIFVIPVERVVRVRT
FT                   KEEDEKAL"
FT   gene            432481..433641
FT                   /locus_tag="MFS40622_0446"
FT   CDS_pept        432481..433641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0446"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: ammonium
FT                   transporter; KEGG: mja:MJ0058 ammonium transporter (AmtB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69140"
FT                   /db_xref="GOA:D3S7Y0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y0"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ADC69140.1"
FT                   /translation="MEGVDVFFFMWAASLIFFMKAGFIALEIGQFRAKNVSYHCVLKLL
FT                   DLAAVFIAYLFIGYGISYGLENIVPLLTGTFNAYLGAWWMKMVMFAAAAVTIITGGVAE
FT                   RIKILPYFIGALIVGGILYPIVEHLVWGGGFADLLGITFHDYAGSGAVHLFGGLVGLMA
FT                   AYVLGPRIDKYINGKPQAIPGHNIPIAVLGAFILAFGWYGFNIGSASGISNGVELASVA
FT                   IATTMALAGGIIGGALSSRNDPLYTANGMCAGLVAVCSGVDLFTPIGAFIVGLLAGIQQ
FT                   PFTYKFIEEKLKIDDVCAIGPVHAMSGLIGVICAGIPFLLKSDAVSKVSLMGQIIGAIV
FT                   IALIAIVGGLIIYKGLDLTIGLRVSEEAEKTGLDTAILQTTAYSEE"
FT   gene            433786..435065
FT                   /pseudo
FT                   /locus_tag="MFS40622_0447"
FT                   /product="hypothetical protein"
FT   gene            435206..435604
FT                   /locus_tag="MFS40622_0448"
FT   CDS_pept        435206..435604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0448"
FT                   /product="CTP-dependent riboflavin kinase"
FT                   /EC_number="2.7.1.161"
FT                   /note="PFAM: protein of unknown function DUF120; KEGG:
FT                   mja:MJ0056 riboflavin kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69141"
FT                   /db_xref="GOA:D3S7Y1"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023470"
FT                   /db_xref="InterPro:IPR023602"
FT                   /db_xref="InterPro:IPR039063"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y1"
FT                   /inference="protein motif:PRIAM:2.7.1.161"
FT                   /protein_id="ADC69141.1"
FT                   /translation="MIIEGEIVSGLGEGRYFLSLPPYKEAFKKILGFEPFEGTLNLKLD
FT                   KEFDISKFEYIETEDFEFNGRRFFGVKVLPIEILINNKKIDGAIVVPKKTYHSGNIIEI
FT                   IAPIKLREQFNLKDGDTIKILIKGDKNE"
FT   gene            435597..436280
FT                   /locus_tag="MFS40622_0449"
FT   CDS_pept        435597..436280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0449"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: mja:MJ0055 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69142"
FT                   /db_xref="GOA:D3S7Y2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y2"
FT                   /inference="protein motif:TFAM:TIGR00506"
FT                   /protein_id="ADC69142.1"
FT                   /translation="MNSVEKAIEALRRGEIILVYDSDEREGETDMVVASQFITPEHIRR
FT                   MRKDAGGLICTAIHPDICNKLGIPFMVDILEFASQKFKVLKELYPNDIPYDEKSSFSIT
FT                   INHRKTFTGITDNDRAFTIKKLAELVREERFNDFGKEFRSPGHVTLLRAAEGLVKNRQG
FT                   HTEMTVALAEMAGLIPITTICEMMGDDGNAMSKTETKRYAERHNLVYLSGEEIINYYLE
FT                   KYLRE"
FT   gene            436339..437184
FT                   /locus_tag="MFS40622_0450"
FT   CDS_pept        436339..437184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0450"
FT                   /product="methanogenesis marker protein 8"
FT                   /note="TIGRFAM: methanogenesis marker protein 8; PFAM:
FT                   conserved hypothetical protein; KEGG: mja:MJ0054
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69143"
FT                   /db_xref="InterPro:IPR009181"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y3"
FT                   /inference="protein motif:TFAM:TIGR03275"
FT                   /protein_id="ADC69143.1"
FT                   /translation="MDRHVMEALGKARVVVENGRVVEITEPKIKYCPLFAKHRGIKEIT
FT                   KESIKENIEFRIKDFGLFTKNRVVEESRYIVPFGASEILMSALKRKIIDAAVIVADCAG
FT                   TVITANPNLVQGLCGRISGIIETSPILEVIKRIEKAGGIVLDKDTAKINQFEGVKKAIE
FT                   LGYKKIAVTVTNLEDAKRCKSLENDNIKILTFGVHTTGIEENDEIADYFDLITACASKF
FT                   LREGLKGRIKAQIGKTIPIFALSDFGKEVLLERAKELDNILITIEDLPALNDNQPKPLI
FT                   "
FT   gene            437270..437995
FT                   /locus_tag="MFS40622_0451"
FT   CDS_pept        437270..437995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69144"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030815"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y4"
FT                   /inference="similar to AA sequence:KEGG:MJ0053"
FT                   /protein_id="ADC69144.1"
FT                   /translation="MTYISVFNNIFILKVRIKFNGENMIIFGLFGKTGCGKTEILNELK
FT                   KHHPVIDIEEIARTRGSILGDLYHLSMRSQEEFDYLINKEIEKAKQIGYAVVEYEGRKI
FT                   GGEKKLKIPELLADIKNYTYKILIDCPYECQINRLVSIYKPKNEREKEILINKFLILKK
FT                   SFKKPEMIEAVEKIIELIKQDKYYEAAKLIEEKLYREHYMRNVKKIEPDLVVYNEDVKK
FT                   SAKIIDEFIKEKLKEHNLI"
FT   gene            438006..438674
FT                   /locus_tag="MFS40622_0452"
FT   CDS_pept        438006..438674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0452"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: mja:MJ0052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69145"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR030818"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y5"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ADC69145.1"
FT                   /translation="MDEEILSRLITFTEDVVLCIVLNDGRKMITNGKKILAGKIEGDLA
FT                   SFILTASKEFLKDKKIGVKKFKDYDIYFERISIDKFLKSIGGEFVKNAITVNELLELIE
FT                   KEDVIIVDTRSPREFKEETIPGAINIPLFLDEEHALIGKTYKQEGREKAIEIATDIVEK
FT                   SLKRILNEAKKLDRDKLIVVFCARGGMRSQTMALILQLLGFKVKRLIGGFKAFKHAINK
FT                   "
FT   gene            complement(438679..439020)
FT                   /locus_tag="MFS40622_0453"
FT   CDS_pept        complement(438679..439020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0453"
FT                   /product="Aminoacyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="PFAM: protein of unknown function UPF0099; KEGG:
FT                   mfe:Mefer_1284 aminoacyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69146"
FT                   /db_xref="GOA:D3S7Y6"
FT                   /db_xref="InterPro:IPR002833"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="InterPro:IPR034759"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y6"
FT                   /inference="protein motif:PRIAM:3.1.1.29"
FT                   /protein_id="ADC69146.1"
FT                   /translation="MVIVIRNDLGMGKGKMVAQGGHAVIEAFLEAKKKNPKVVEEWLRE
FT                   GQKKVVVKVNSEQELIDIYNKARSEGLPCSIIRDAGHTQLEPGTLTAVAIGPERDEKID
FT                   KITGHLKLL"
FT   gene            complement(439031..440808)
FT                   /pseudo
FT                   /locus_tag="MFS40622_0454"
FT                   /product="hypothetical protein"
FT   gene            440925..442106
FT                   /locus_tag="MFS40622_0455"
FT   CDS_pept        440925..442106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0455"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: mja:MJ0050
FT                   L-tyrosine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69147"
FT                   /db_xref="GOA:D3S7Y7"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020931"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y7"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ADC69147.1"
FT                   /translation="MQEKGVSEREIFEELRKYRDLDLKYEDGKIFGSMCSNVLPITRKI
FT                   VDMFLETNLGDPGLFKGTKLLEEKAIALLGEMLNNKDAYGHIVSGGTEANLMALRCIKN
FT                   IWREKRKKGLSKNEHPKIIVPITAHFSFEKGREMMDLDYIYAPIKKDYTIDEKFVKDAV
FT                   EDYDIDGIIGIAGTTELGTIDNIEELSRIAKEYDIYIHVDAAFGGFVIPFLDDKYKKKE
FT                   VNYNFDFSLGVDSITIDPHKMGHCPIPSGGILFKNIDYKKYLEVDAPYLTETKQATILG
FT                   TRVGFGGACTYAVLRYLGREGQKKIVSECMENTLYLYKKLKENGFKPVIEPILNIVAIE
FT                   DENYKEVCKKLRDKGIYVSVCNCVEALRIVVMPHIRKEHIDNFIEILKTIKKD"
FT   gene            442293..442472
FT                   /locus_tag="MFS40622_0456"
FT   CDS_pept        442293..442472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69148"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y8"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1092"
FT                   /protein_id="ADC69148.1"
FT                   /translation="MEENWREITIKNIREINQKITRLEWLLNSYKNDREAEYINKKINE
FT                   LRIKRDEYIKSLKE"
FT   gene            442708..442959
FT                   /locus_tag="MFS40622_0457"
FT   CDS_pept        442708..442959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0457"
FT                   /product="Ribosomal protein L31e"
FT                   /note="PFAM: Ribosomal protein L31e; KEGG: mja:MJ0049 50S
FT                   ribosomal protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69149"
FT                   /db_xref="GOA:D3S7Y9"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Y9"
FT                   /inference="protein motif:PFAM:PF01198"
FT                   /protein_id="ADC69149.1"
FT                   /translation="MMEERIYTIPLRDVINKSVRTKRAPRAIKKIKQFLKRHMKADIVK
FT                   IDNELNEKIWERGIQKPPARVRVKAVKEGNVVIATLAE"
FT   gene            442971..443651
FT                   /locus_tag="MFS40622_0458"
FT   CDS_pept        442971..443651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0458"
FT                   /product="translation initiation factor eIF-6"
FT                   /note="KEGG: mja:MJ0048 translation initiation factor IF-6;
FT                   TIGRFAM: translation initiation factor eIF-6; PFAM:
FT                   translation initiation factor IF6; SMART: translation
FT                   initiation factor IF6"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69150"
FT                   /db_xref="GOA:D3S7Z0"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z0"
FT                   /inference="protein motif:TFAM:TIGR00323"
FT                   /protein_id="ADC69150.1"
FT                   /translation="MIIRKYFSGIPTIGVLALTTEDLTLLPIFLDKNDVNEVSEVLETK
FT                   CLQTNIGGSSLVGSLSAANKYGLLLPKIVEDEELTQIKNFLRENDLDLNVEIIKSKNTA
FT                   LGNLILTNDKGALISIELKDFKKDIEDILNVEVEIGTIAELPTVGSNAVVTNKGCLTHP
FT                   LVEDDELEFLKSLFKVEYIGKGTANKGTTSVGACIIANSKGAIVGGDTTGPELLMIEDA
FT                   LGLI"
FT   gene            complement(444026..445078)
FT                   /locus_tag="MFS40622_0459"
FT   CDS_pept        complement(444026..445078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0459"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="PFAM: Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; KEGG: mja:MJ1598 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69151"
FT                   /db_xref="GOA:D3S7Z1"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z1"
FT                   /inference="protein motif:PFAM:PF02277"
FT                   /protein_id="ADC69151.1"
FT                   /translation="MGIITINENNFLDKIKGKTPLFTCVISSIETTLSIPISGVHRDVI
FT                   KYTPSADVELVFYGKSLTLKTPPIDATGSPTPATITRACVELKNIKNLHIDAGAFVKPK
FT                   IPFIEVDEKPTGKIEEGKAMNNSKELYMKGYLLGKNLDAEMLIVGESVPGGTTTALGVL
FT                   LGLGYDAEGKVSSGSINNPHELKIKVVREGLKKANINENSSVFDVLNAVGDKMMPVVAG
FT                   LAISFAEKNKPVILAGGTQMSAVLAVIKEINKEVLDKNLIAIGTTEFVLNDRKGDLKGI
FT                   VEQIGEVPILASKFYFEKAKIEGLKNYCKGSVKEGVGAGGVAVYSIANGLEPAKIREFI
FT                   ENKFNEWYKK"
FT   gene            complement(445095..445928)
FT                   /locus_tag="MFS40622_0460"
FT   CDS_pept        complement(445095..445928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0460"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: mja:MJ1599
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69152"
FT                   /db_xref="GOA:D3S7Z2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR012121"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z2"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADC69152.1"
FT                   /translation="MRCSICVHTSKTKKIINYEGKPICVDCLTMLKYPPNFEKMKKEVE
FT                   EILYNLKKEGWKYHCVLAFSGGKDSVLALKLLREEFKLNPLCVMVDNKYMAKEAIENAL
FT                   NVTKHYNVDLMILNRDYTDLFEDAIKRGESPCRRCSRLILREVWRIAKMLGLKYVITGH
FT                   ELPFGHSAVRDMKEGIKMIRLLAPYKFKEEEKYKMLEDLPWKKPNLGGYTTNCLVLGVA
FT                   LERFYDKYGFSFEIDRVATLVRLGLLSKDRAEEALERPKVPKEVYEELKRRGLNI"
FT   gene            446006..446539
FT                   /locus_tag="MFS40622_0461"
FT   CDS_pept        446006..446539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0461"
FT                   /product="protein of unknown function DUF46"
FT                   /note="PFAM: protein of unknown function DUF46; KEGG:
FT                   mja:MJ1600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69153"
FT                   /db_xref="GOA:D3S7Z3"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z3"
FT                   /inference="protein motif:PFAM:PF01864"
FT                   /protein_id="ADC69153.1"
FT                   /translation="MFYRLLFASLWYILPAYVANASACIFGGGTPVDLGKNFIDGRRLI
FT                   GNGVTYRGCIFGIICGTLVGLIQGILVDFNIFNSLDFYGTVLDHVILAFFLSTGAIVGD
FT                   AVGGFIKRRLNIERGKPAPLLDQLDFVIGALAFGYIVAPIPYEMIIIICLFTVFIHLLG
FT                   NIIAYKLGIKDVWW"
FT   sig_peptide     446006..446077
FT                   /locus_tag="MFS40622_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.748 at
FT                   residue 24"
FT   gene            446542..447024
FT                   /locus_tag="MFS40622_0462"
FT   CDS_pept        446542..447024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0462"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   mja:MJ1601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69154"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z4"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADC69154.1"
FT                   /translation="MITIDIELKDKPGELLKVLTPISKHGANVISVIHSREEKRGGKVP
FT                   VRIVIDVEDKEKLKNILEDLEKEGAIIKKIDGKDKKVYLDVVVIGHVVDTNVRDTIDRI
FT                   NEIGLVEDLDLIMPHPDKESSAMMRIIIDEDKIEELFYLFEELEKEKGLLFIKSIF"
FT   gene            447045..448055
FT                   /locus_tag="MFS40622_0463"
FT   CDS_pept        447045..448055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0463"
FT                   /product="Homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase NAD-binding; KEGG: mja:MJ1602 homoserine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69155"
FT                   /db_xref="GOA:D3S7Z5"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z5"
FT                   /inference="protein motif:PRIAM:1.1.1.3"
FT                   /protein_id="ADC69155.1"
FT                   /translation="MDIIIVGFGAIGKGVARVLYEKREYLKKNYEEFRVVAITDSSGAA
FT                   IDEDGLDLLKAIEVKEKTGKIKNYPEKGREVSSIDVIRNVDADVVVEVTPSNLETGEPA
FT                   KTHILESFKNKKHVVTANKGPLALCYRELIEEAKKYNVIFRHEASVGGAMPIINLAKET
FT                   LAGNEILSIRGILNGTTNYILTKMEKEGLDFETALKEAKELGIAETDPTQDIEGLDTAA
FT                   KIVILANSIMGMNKTIKDVKVKGIKRITPEALFLANKRGYTIKLIGQIKDGYLIVEPML
FT                   VPIDSPLNVKGTLNVAMFETDLAKEVVVVGRGAGPIETASAILSDLIHIYLSTKK"
FT   repeat_region   complement(448510..449012)
FT                   /rpt_unit_range=448511..448541
FT                   /note="CRISPRS"
FT   gene            449281..450528
FT                   /locus_tag="MFS40622_0464"
FT   CDS_pept        449281..450528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0464"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: mja:MJ1388 S-adenosyl-L-homocysteine
FT                   hydrolase; TIGRFAM: adenosylhomocysteinase; PFAM:
FT                   S-adenosyl-L-homocysteine hydrolase;
FT                   S-adenosyl-L-homocysteine hydrolase, NAD binding"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69156"
FT                   /db_xref="GOA:D3S7Z6"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z6"
FT                   /inference="protein motif:TFAM:TIGR00936"
FT                   /protein_id="ADC69156.1"
FT                   /translation="MYAVRDINLWKEGERKIEWAKQHMPVLNLIRERFKEEKPFKGITI
FT                   GMALHLEAKTAVLAETLMEGGAKIAITGCNPLSTQDDVAAACAKKGMHVYAWRGETVEE
FT                   YYENLNKVLDHEPDIVIDDGCDLIFLLHTKRTELLDNIMGGCEETTTGIIRLKAMEKEG
FT                   ALKFPVMDVNDAYTKHLFDNRYGTGQSALDGILRATNLLIAGKTVVVAGYGWCGRGVAM
FT                   RAKGLGAEVVVTEVNPIRALEARMDGFRVMKMEKAAEIGDIFITTTGCKDVIRKEHILK
FT                   MKNGAILANAGHFDNEINKKHLQELAKSVREVRNCVTEYDLGDKKIYLLGEGRLVNLAC
FT                   ADGHPCEVMDMSFANQALAAEYILKNHDKLEPRVYNIPYEQDLMIASLKLKAMGIEIDE
FT                   LTEEQKKYLEDWREGT"
FT   gene            complement(450624..451022)
FT                   /locus_tag="MFS40622_0465"
FT   CDS_pept        complement(450624..451022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0465"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG: mja:MJ1389
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69157"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z7"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ADC69157.1"
FT                   /translation="MIAIENKKVNEVNETLSHLLKDLKNVEGFVIVSKDSFVKVGNIDG
FT                   EDLERISRHIAVVMGSSEMLYKRFDDEIEYIEIKGKKHKIVLYNLDDFVFAVIGNVNAG
FT                   EIKEKVMGLKFNNIESLTAENVIEDIAL"
FT   gene            complement(451194..451502)
FT                   /locus_tag="MFS40622_0466"
FT   CDS_pept        complement(451194..451502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0466"
FT                   /product="DNA-directed RNA polymerase, subunit I (RpoI)"
FT                   /note="KEGG: mja:MJ1390 DNA-directed RNA polymerase,
FT                   subunit I (RpoI)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69158"
FT                   /db_xref="GOA:D3S7Z8"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z8"
FT                   /inference="similar to AA sequence:KEGG:MJ1390"
FT                   /protein_id="ADC69158.1"
FT                   /translation="MEKYEKIINDLNIINSKAKFLGIKIIMVRRIIDIYKDNDELIKKV
FT                   LESIKDTELYDLVLRACPELRGEKIRNVHFKRDDYFDIIEKIMNSGNPLLEKALNSN"
FT   gene            complement(452084..453340)
FT                   /locus_tag="MFS40622_0467"
FT   CDS_pept        complement(452084..453340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0467"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   mja:MJ1391 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69159"
FT                   /db_xref="GOA:D3S7Z9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3S7Z9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADC69159.1"
FT                   /translation="MDSYIQNLFAERIGGKKFGKEDVIYKFEKIKRAKQEAMKKHPDME
FT                   LIDMGVGEPDEMADPEVIKVLCEEAKKWENRGYADNGIQELKDAVPPYMEKVYGVKDID
FT                   PVNEVIHSIGSKPALAYITSAFINPGDVTLMTVPGYPVTATHTKWYGGEVYNLPLLEEN
FT                   DFLPDLDSIPEDIKKRAKILYLNYPNNPTGAQATKKFYKEVVDFAFENEVIVVQDAAYG
FT                   ALVYDGKPLSFLSVKDAKEVGVEIHSFSKAFNMTGWRLAFLVGNELIIKAFATVKDNFD
FT                   SGQFIPIQKAGIYCLQHPEITERVRQKYERRLRKMVKILNEVGFKAKMPGGTFYLYVKS
FT                   PTKANGIEFKTAEDFSQYLIKEKLISTVPWDDAGHYLRLAACFVAKDENGNPTTEEKYE
FT                   DIVLEEFKRRLEGMDLEFE"
FT   gene            complement(453886..454182)
FT                   /locus_tag="MFS40622_0468"
FT   CDS_pept        complement(453886..454182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0468"
FT                   /product="Protein of unknown function DUF357"
FT                   /note="PFAM: Protein of unknown function DUF357; KEGG:
FT                   mja:MJ0273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69160"
FT                   /db_xref="InterPro:IPR023140"
FT                   /db_xref="InterPro:IPR036809"
FT                   /db_xref="UniProtKB/TrEMBL:D3S800"
FT                   /inference="protein motif:PFAM:PF04010"
FT                   /protein_id="ADC69160.1"
FT                   /translation="MNKEITEEKLNNYFKRTEEAIKIIKKGMPPKRSLLYDVAKDFLLM
FT                   IESYFEDAKAFKERGDYVTAFASLNYAYGWIDAGVRLGLFDVGDDDVRFTLAK"
FT   gene            complement(454175..454648)
FT                   /locus_tag="MFS40622_0469"
FT   CDS_pept        complement(454175..454648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0469"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tgr:Tgr7_1703 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69161"
FT                   /db_xref="GOA:D3S801"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3S801"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADC69161.1"
FT                   /translation="MVMFMITIDTAKKEDIEDMINLLKQLFEIEKDFIPNYEKQRKGLE
FT                   LLLDREDAVIFVARYNGRVIGMCSIQMLISTAEGGKVGLLEDLIVNEKFRGRGIGTKLL
FT                   LEAERYCKENGFLRLSLLADKDNIKALEFYKLRGWKFTNLICLRKFFGGDRVE"
FT   gene            complement(454651..454851)
FT                   /locus_tag="MFS40622_0470"
FT   CDS_pept        complement(454651..454851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0470"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: mja:MJ0272 repressor
FT                   protein, putative (yorfE)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69162"
FT                   /db_xref="GOA:D3S802"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D3S802"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADC69162.1"
FT                   /translation="MKNKLKIYRAMYNLTQEDLAKKLGVSRQTIIAIEKGKYDPSLKLA
FT                   FKIAKFFGVKIEDIFIYEKDE"
FT   gene            complement(454859..455401)
FT                   /locus_tag="MFS40622_0471"
FT   CDS_pept        complement(454859..455401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69163"
FT                   /db_xref="GOA:D3S803"
FT                   /db_xref="UniProtKB/TrEMBL:D3S803"
FT                   /inference="similar to AA sequence:KEGG:MJ0271"
FT                   /protein_id="ADC69163.1"
FT                   /translation="MNLKTKIKFILAFDFLAVLLLSIFIKNFKMALAFLLVIFVIWLFV
FT                   DKKDINERLYENLLAISIGFIEGILIFLGIVYSRTFLDITTGISALILLIIMGVLFPKY
FT                   KLIFEVFDEFVENLKQKSGFLTLISILGLLLTVYLFLLIFPSKEFCIKAVDFIRAIILV
FT                   IAANMFIIEFYTFKKFL"
FT   gene            complement(455410..455958)
FT                   /locus_tag="MFS40622_0472"
FT   CDS_pept        complement(455410..455958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpc:Cpar_1446 membrane protein required for
FT                   N-linked glycosylation-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69164"
FT                   /db_xref="GOA:D3S804"
FT                   /db_xref="UniProtKB/TrEMBL:D3S804"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69164.1"
FT                   /translation="MNKAFIGFLIGVLWVVLYYFLALFNLRVLAIIILFLAIVVFFAKE
FT                   MQNIYPLFGDWKEISLILSCGLVGGVILYFTFYYSQQIDIGFLFIGLIFMCIGIIPLIF
FT                   KETREDTDIDERKVVIYEKSAYKTIMSFILSITIFWCVVCYLGNYDIKIALINFFAGII
FT                   SVITLPFMIFTTYYTKKFS"
FT   gene            456140..456535
FT                   /locus_tag="MFS40622_0473"
FT   CDS_pept        456140..456535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0473"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mja:MJ0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69165"
FT                   /db_xref="GOA:D3S805"
FT                   /db_xref="UniProtKB/TrEMBL:D3S805"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69165.1"
FT                   /translation="MTLKQKSVLTFIIILMIILILLITIDILANKIIIKIDGHYYDGLG
FT                   QGLAMRDAILLCPSFNEINISVGEIYEIPLNGSYEITIHDNNSTIKLFKNQSGYYIEGV
FT                   KKGTANISFSKTTEKEVVSIFYIVNVN"
FT   gene            456685..457224
FT                   /locus_tag="MFS40622_0474"
FT   CDS_pept        456685..457224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0474"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: Pyruvate/ketoisovalerate
FT                   oxidoreductase; KEGG: mja:MJ0269 pyruvate ferredoxin
FT                   oxidoreductase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69166"
FT                   /db_xref="GOA:D3S806"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:D3S806"
FT                   /inference="protein motif:TFAM:TIGR02175"
FT                   /protein_id="ADC69166.1"
FT                   /translation="MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGA
FT                   PVMAFTRIDDKKITLRCQIYEPDYVVVQDATLLESVNVVEGLKKDGAVIINTVKDDLDL
FT                   GYKTYTIDATGIALDVLGVPIVNTAMVGAFAGVTGIVSIESVKKAILDTFKGKLGEKNA
FT                   KAAEVAYNEMLKKYKK"
FT   gene            457244..457504
FT                   /locus_tag="MFS40622_0475"
FT   CDS_pept        457244..457504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0475"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: mja:MJ0268
FT                   pyruvate ferredoxin oxidoreductase, subunit delta (PorD)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69167"
FT                   /db_xref="GOA:D3S807"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S807"
FT                   /inference="protein motif:TFAM:TIGR02179"
FT                   /protein_id="ADC69167.1"
FT                   /translation="MVTIAAIIYEPGNSIKNKTGSWRTFRPILDNEKCVKCENCYIFCP
FT                   EGAIQEDENGNFKINYDYCKGCLICMNECPVNAITKVREEK"
FT   gene            457516..458676
FT                   /locus_tag="MFS40622_0476"
FT   CDS_pept        457516..458676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0476"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: mja:MJ0267 pyruvate ferredoxin
FT                   oxidoreductase, subunit alpha (PorA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69168"
FT                   /db_xref="GOA:D3S808"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D3S808"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ADC69168.1"
FT                   /translation="MCEVKVITGTSAAAEAAKLADVDVVAAYPITPQTTCVEKLAEFVA
FT                   NGELDAEYIKVESEHSAMSACIGAAATGARTFTATASQGLALMHEMLFIASGMRLPIVM
FT                   MVANRALSAPINIWNDHQDSIAERDTGWIQIYVEDNQETLDSIIQAYKIAENEDVLLPV
FT                   MVCLDGFILTHTVEPVTIPKAERVREFLGVYEPKHAYLDPDRPITQGPVGVPDCYMETR
FT                   KQIEEAMERAKKVIKDVNEEFAEWFKRKYGNGLVEAYNLENADTVLVAIGSVCGTIKYV
FT                   IDELKKEGKEVGLLRIRTFRPFPKKDVKELLKDANNIAVLDKNISLGVNKGALGIEMAS
FT                   ILKNKKVCNYIVGLGGRDVKIEDIKAIINHVEKSEDDATLWVGLKE"
FT   gene            458705..459592
FT                   /locus_tag="MFS40622_0477"
FT   CDS_pept        458705..459592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0477"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: mja:MJ0266 pyruvate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69169"
FT                   /db_xref="GOA:D3S809"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3S809"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADC69169.1"
FT                   /translation="MQFPREELFAPGHRGCAGCGAAIVARLLLKAAGKNTIISNATGCL
FT                   EVMTTPYPETSWRVPWIHTAFENAAATASGIEAAIKALKRKRGKYADKKINVIAIGGDG
FT                   GTADIGFQALSGAMERGHNILYVMYDNEAYMNTGIQRSSSTPFMAATTTSPAGSKIRGE
FT                   DRPKKDMTMIMAAHGIPYVATACISYPEDFMRKVKKALSIEGPKFIQVLQPCTTGWGYP
FT                   PEKTIEIGRLAVETGVFPLYEIENGDFRITYKPAKRKPVREYLKMQKRYRHLTDEDIER
FT                   IQRYIDEKCKLLGL"
FT   gene            459651..460145
FT                   /locus_tag="MFS40622_0478"
FT   CDS_pept        459651..460145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0478"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0265 carbon monoxide dehydrogenase,
FT                   iron sulfur subunit CooF-1 (cooF2)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69170"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S810"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC69170.1"
FT                   /translation="MKKIIMTNFNCDNCGDCVKACMEKNKVGRIAIMEKDGKYIPIICQ
FT                   HCASAPCKEVCPVSAIEHKDGYVYLNEEICIGCGLCALACPFGAIIMEDKAYKCILCNG
FT                   DEPACVKACSKRCLELVDVNDLIFAKRDKSLDLFSKMTLPTQKTDNSLISKITINAKVQ
FT                   P"
FT   gene            460174..460599
FT                   /locus_tag="MFS40622_0479"
FT   CDS_pept        460174..460599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0479"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0264 carbon monoxide dehydrogenase,
FT                   iron sulfur subunit CooF-1 (cooF1)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69171"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S811"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC69171.1"
FT                   /translation="MVVVNVGSCIGCRRCERSCPVNGITFNEFPIKCMHCDKNPCLYAC
FT                   PENAIERINDKVVVIKDKCIGCGLCALACPFGAIRIDGVAIKCNGCYKRDVEICKEVCP
FT                   TGAINNLEEILSNKLCNTLDKFSKLYAIYGGFKGAAK"
FT   gene            460846..461790
FT                   /locus_tag="MFS40622_0480"
FT   CDS_pept        460846..461790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0480"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   mja:MJ0263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69172"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3S812"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ADC69172.1"
FT                   /translation="MIKTLEILKNVIKAIEFSDKGEFENAIKCLDEVLSLDPKNTLVLY
FT                   VKGIILKIMGDMDKSMEQFEKIDNNKEKSPLSWTNLICLNFVKGDYEKTLKYIDKLSKI
FT                   SSKCYLSPFHKALIFIELGKYEEVLKYFDELLKVNDKLSSIWRQKAILLGDLGRLNEAL
FT                   ECLDRVIEINKNDTYAWYLKGKMLKKLGNYKEALKCLYTAIGLNKDWIHTYKDIGYLEL
FT                   LSGNYDEALKYLSKYLQKFPEDIEAKFYKALVYEHLNKLDDALKIYDEIISKLKDNNFI
FT                   FKSSLINKARILEKLGKIEEAVETYNKALDNNI"
FT   gene            complement(461810..465277)
FT                   /locus_tag="MFS40622_0481"
FT   CDS_pept        complement(461810..465277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0481"
FT                   /product="translation initiation factor aIF-2"
FT                   /note="KEGG: mja:MJ0262 translation initiation factor IF-2;
FT                   TIGRFAM: translation initiation factor aIF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; SMART:
FT                   Hedgehog/intein hint domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69173"
FT                   /db_xref="GOA:D3S813"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004544"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR029459"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:D3S813"
FT                   /inference="protein motif:TFAM:TIGR00491"
FT                   /protein_id="ADC69173.1"
FT                   /translation="MAKKNTKKDNRNQNLRCPIVCVLGHVDHGKCLMPYEKVLTEHGEV
FT                   KIEELFKKGNEVIEEDELKEIRKLDIKVCSLNKNGEIELINAPYVWRLKHKGKMIKIKL
FT                   KNWHSITTTPEHPFLTNNGWVKAENIKKGTYIAIPRKVYGNDNFEKFIEFINSKILNSE
FT                   LIAKVDESDLENIELPSAKSYKKEKNVFRSEDVIEYNLNIEKIAFSPRIHRCGKPKHYI
FT                   KLPKSLDEWKSLFYLAGVMFGDGCKDKIANNDEEVFNKLKSLNSLGIEVERIKRKSSYE
FT                   IIFKNGKNALINLIKVLFDYPSEKKSYNIKIPQILYVAPKELVAEFIRGYFDADGHVNL
FT                   RQNRIEIVSASKEFIEGLSVLLLRFEITSKIYEIKKSYNGVKKKYYQLNIVGKRNLKNF
FT                   KNIGLSIKYKEENLNKIIEKSKKSEKYPINKDMKRLRILFGMTKNEVNISYYSKYENGE
FT                   EIPSYEIVEKFLNSLKPNNLDKKIKVLEGKEKDVNYLKAFESDGLIKDGKLTELGKEAL
FT                   NIWKNQDFGEEDIEYIKSLIQNIAFVEVEDIEVIDYDGYVYDLTTETHNFIANGIIVHN
FT                   TTLLDKIRKTRVAKREAGGITQHIGASEIPIDVIKRLCGDLLKMLKAELKIPGLLVIDT
FT                   PGHEAFTSLRKRGGALADIAILVVDINEGFKPQTVEAVNILRQCKTPFVVAANKIDLIP
FT                   GWNSKEGPFILNFNEKAQHPNALTEFEIRLYENIIKPLNELGFDADLYSRVQDVTKTVC
FT                   IIPVSAVTGEGIPDLLMMVAGLAQKFLEDRLKLNVEGYAKGTILEVKEEKGLGTTIDAI
FT                   IYDGIARRGDYLVVGLPDDVLVTRVKALLKPKPLDEMRDPRDKFKPVNEVTAAAGVKIA
FT                   APDLDKVIAGCPIRIVPKDKIEEAKEEVMKEVEEAKIEVDDEGILIKADTLGSLEALAN
FT                   ELRKAGVKIKKAEVGDVTKKDVIEVASYKQSNPLHGAIVAFNVKILPEAQKEIEKYDIK
FT                   VFVDNIIYKLVEDFTEWVKKEEERIKYGEFEKLIKPAIVRILPDCIFRQKDPAICGVEV
FT                   LCGTLRVGAPLMREDGMQLGYVREIKDRGENVKEAKAGKAVSIAIDGRITLKRHVDEGD
FT                   CMYVAVPESHVRELYHKYMDRLRNDEKEALLRYMELMQKLTNNIFWGR"
FT   gene            465448..466101
FT                   /locus_tag="MFS40622_0482"
FT   CDS_pept        465448..466101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0482"
FT                   /product="protein of unknown function DUF84"
FT                   /note="PFAM: protein of unknown function DUF84; KEGG:
FT                   mja:MJ0261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69174"
FT                   /db_xref="GOA:D3S814"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D3S814"
FT                   /inference="protein motif:PFAM:PF01931"
FT                   /protein_id="ADC69174.1"
FT                   /translation="MEFKNKKCEICGEKAEIFLFGRFLCKNEKCIEKAKKLSMARHKLR
FT                   VVAVGSTNPVKTEAVREGFEKVLGAVEVVGVDVNSNVSSHPIGLEETYLGALNRAKNAF
FT                   EKVQCSYGVGIEAGLIKVGEHYIDVHVCVVFDGIRETVGLSQGFEYPKIVAEKVLEGIE
FT                   GGKIAEKISGIKDIGKNIGLIGYLTDNNITRKDLCRESVIMALIPRMMKNAHLY"
FT   gene            466216..466773
FT                   /locus_tag="MFS40622_0483"
FT   CDS_pept        466216..466773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0483"
FT                   /product="signal sequence peptidase I, SEC11"
FT                   /note="KEGG: mja:MJ0260 signal sequence peptidase I, SEC11"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69175"
FT                   /db_xref="GOA:D3S815"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D3S815"
FT                   /inference="similar to AA sequence:KEGG:MJ0260"
FT                   /protein_id="ADC69175.1"
FT                   /translation="MYPIMKRGDLVIVENAGFEFNPNDVDVGDIVVYKAHWPYYQYLLS
FT                   EADYKLNLNPYKTLCIFNEGDFKDISIKVLGEIETDNGDYKILEADIPKSPTKPVIHRV
FT                   IDKVGFNNKTYFIIKGDNNPIHDPELVSVNQIKQRVIVIDGHPLVIPYVGYLSIWVKEY
FT                   WYLVVLFILLYYTYNYLKGGRK"
FT   gene            466770..467384
FT                   /locus_tag="MFS40622_0484"
FT   CDS_pept        466770..467384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ0259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69176"
FT                   /db_xref="UniProtKB/TrEMBL:D3S816"
FT                   /inference="similar to AA sequence:KEGG:MJ0259"
FT                   /protein_id="ADC69176.1"
FT                   /translation="MKKILLIIGIIALITSVSMCLNNKYNSLNNLNLKKEIVIEVNGTP
FT                   VEIPLRATIGEAKEVKLVNTTDKEIYDYYHSKILIYIYGNMSLKPDEGGVSIVDLITKL
FT                   EWFNQFYPHNIIVELNRTNSTVNIKAIFANGQTSITKLKINQSKYLMHNNKTMVIEIIK
FT                   TQNNATITKINNTFIIEGNSLKEMDKAETRFIIALFKGGIN"
FT   gene            467534..468736
FT                   /locus_tag="MFS40622_0485"
FT   CDS_pept        467534..468736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0485"
FT                   /product="Mur ligase middle domain protein"
FT                   /note="PFAM: Mur ligase middle domain protein; KEGG:
FT                   mja:MJ0258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69177"
FT                   /db_xref="GOA:D3S817"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D3S817"
FT                   /inference="protein motif:PFAM:PF08245"
FT                   /protein_id="ADC69177.1"
FT                   /translation="MLIIDVNHGALTLAEEYLNLGYDVDVWDIYQKIKKSEDFKVKYQR
FT                   LKEKFENKLNLFFEQPNFEKYDRIIAPIHCPIDVNFIPFTDAVSEILKEKFGDIYKKII
FT                   NITGVKGKTTTTSLINHILKDKYSTYLHNSNSGSIAPPTILKILDNLDIDKYDFFIFET
FT                   SLGLVKCKYGAITNVLENYKTAGGRRDALTAKFSSLKNAEMAFINRRDIKRYNLNISHK
FT                   CLNVVNVDRAKILNEYPLKFEYFDEIFEFSKNIFGLHFVENSLFAIEVCKNLVDMDEIK
FT                   ERLKTFTIKNRMEIKEIDGKVLVKNINPGLDVKAISYAIKDFLEVFGGDIYIGGDFGVV
FT                   CEEIDVKKLAEILKNFNCQYIFVGEIGRELLNYLNGEYIDRFNENKIKKNSLVILREKI
FT                   G"
FT   gene            complement(468742..469089)
FT                   /locus_tag="MFS40622_0486"
FT   CDS_pept        complement(468742..469089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0486"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: mja:MJ1121
FT                   virulence associated protein C (VapC)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69178"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3S818"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADC69178.1"
FT                   /translation="MLWYATKTKKLFQTLYQICDYNCKITSITVFELHCGNLKENEMIM
FT                   IDNLPKLNFDNKSAKIAGSIFKKLKKEGKIPPVKDLLIASICISNNVLLLTYDNDFKLF
FT                   EKFGLKVKILE"
FT   gene            complement(469377..469601)
FT                   /locus_tag="MFS40622_0487"
FT   CDS_pept        complement(469377..469601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0487"
FT                   /product="Protein of unknown function DUF217"
FT                   /note="PFAM: Protein of unknown function DUF217; KEGG:
FT                   mja:MJ1122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69179"
FT                   /db_xref="InterPro:IPR003847"
FT                   /db_xref="UniProtKB/TrEMBL:D3S819"
FT                   /inference="protein motif:PFAM:PF02697"
FT                   /protein_id="ADC69179.1"
FT                   /translation="MATISIDDDVYKELLKLKGNKSVSEFIRELLEERKRKNLDVFMIA
FT                   FGSRSEEEIEKLKKELKEVEKWMQSLIQV"
FT   gene            complement(469630..470574)
FT                   /locus_tag="MFS40622_0488"
FT   CDS_pept        complement(469630..470574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0488"
FT                   /product="Wyosine base formation domain protein"
FT                   /note="PFAM: Wyosine base formation domain protein; Radical
FT                   SAM domain protein; KEGG: mja:MJ0257 tRNA-modifying enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69180"
FT                   /db_xref="GOA:D3S820"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:D3S820"
FT                   /inference="protein motif:PFAM:PF08608"
FT                   /protein_id="ADC69180.1"
FT                   /translation="MIPEEIYKILRKQRYQIDNHTAVKLCGWVRKKMLEDKNCYKSKFY
FT                   GIETHRCIQCTPSVIWCQQNCIFCWRVLPRDIGINIKEIKEPEWEEPEVVYEKILAMHR
FT                   RIIMGYAGVLDRVGEKKFKEALEPKHVAISLSGEPTLYPYLDELIKIFHKNGFTTFVVS
FT                   NGILTEVIEKIEPTQLYISLDAYDLDSYRRICGGKKEYWDSILNTLDILKEKKRTCIRT
FT                   TLIRGCNDDILKFVELYERANVHFIELKSYMHVGYSQKRLKKEDMLQHDEILKLAKMLD
FT                   ENSSYKLIDDSEDSRVALLQNENRKINPKIFEE"
FT   gene            complement(470621..471187)
FT                   /locus_tag="MFS40622_0489"
FT   CDS_pept        complement(470621..471187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0489"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: mja:MJ0256 sulfopyruvate decarboxylase
FT                   subunit ComD"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69181"
FT                   /db_xref="GOA:D3S821"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR022494"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3S821"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ADC69181.1"
FT                   /translation="MYPKRIEIIKKIVENIGEKEIIVSNIGIPSKELYYVKDRERNFYM
FT                   LGSMGLASSIGLGLALNCEDKVIVIDGDGSILMNLGSLSTIGYMNPKNYILVIIDNSAY
FT                   GSTGNQKTHTSKNTNLEEIAKGCGLDAITTESLEEFEKEFKKALNEEKCKVIIAKAIPY
FT                   NEKCPNIEIPPVVLKYRFMEAIKKN"
FT   gene            complement(471202..471711)
FT                   /locus_tag="MFS40622_0490"
FT   CDS_pept        complement(471202..471711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0490"
FT                   /product="sulfopyruvate decarboxylase subunit ComD"
FT                   /note="KEGG: mja:MJ0255a sulfopyruvate decarboxylase
FT                   subunit ComD"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69182"
FT                   /db_xref="GOA:D3S822"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR022502"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3S822"
FT                   /inference="similar to AA sequence:KEGG:MJ0255a"
FT                   /protein_id="ADC69182.1"
FT                   /translation="MRGSLAIYNALKEANIDFICSVPCANLKNLLKLIDEDKNLTHIPT
FT                   TREEEAFGICAGAYLAGKKTAILLQNSGIGNSINAIASLYKTFQIPTLLIISHRGDLKE
FT                   QIPAQIPMGRWIEKLLDVCEIPTYKPKTPEEAYKLIKYASSYMYKISYPVALLFDALYW
FT                   EYDLEE"
FT   gene            471859..472614
FT                   /locus_tag="MFS40622_0491"
FT   CDS_pept        471859..472614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0491"
FT                   /product="Phosphosulfolactate synthase"
FT                   /EC_number="4.4.1.19"
FT                   /note="PFAM: (2R)-phospho-3-sulfolactate synthase ComA;
FT                   KEGG: mja:MJ0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69183"
FT                   /db_xref="GOA:D3S823"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022370"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:D3S823"
FT                   /inference="protein motif:PRIAM:4.4.1.19"
FT                   /protein_id="ADC69183.1"
FT                   /translation="MRAFEFLYEDFQRGLTVVLDKGLPPKFVEDYLKVCGDYIDFVKFG
FT                   WGTSAVINRDVIKEKINYYKDWDIKVYPGGTLFEYAYAKGKFDEFLNECEKLGFEAVEI
FT                   SDGSSDISLEERKKAIEKAKDNGFIVLTEVGKKLPEKDKQLTIEDRINLINFDLDAGAD
FT                   YVIIEGRESGKGIGLFDREGKVKEDELDILSKNVDINKVIFEAPQKSQQVAFILKFGSS
FT                   VNLANIAFDEVISLETLRRGLRGDTFGKV"
FT   gene            complement(472611..473249)
FT                   /locus_tag="MFS40622_0492"
FT   CDS_pept        complement(472611..473249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0492"
FT                   /product="DNA repair and recombination protein RadB"
FT                   /note="TIGRFAM: DNA repair and recombination protein RadB;
FT                   SMART: AAA ATPase; KEGG: mfe:Mefer_0103 DNA repair and
FT                   recombination protein RADB"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69184"
FT                   /db_xref="GOA:D3S824"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011939"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S824"
FT                   /inference="protein motif:TFAM:TIGR02237"
FT                   /protein_id="ADC69184.1"
FT                   /translation="MLREILRGNVEKGIITQIYGLPGVGKTNICIINSINAIDFGKVIY
FT                   IDTEGGLSIERIKQIAPDNYQKVLESMIIYNVFDFYEQDKIIQKELPLIANNASLIVVD
FT                   NITSLYRLELSDEANKNIMLNKMLGNQVRTLLKLAKTNNLAVIITNQVRETVNGFEASG
FT                   GRLLEYWSKCIVRLEKLNGDRLAILEKHLHAGEEKVRFRIVERGIEIID"
FT   gene            complement(473265..473729)
FT                   /locus_tag="MFS40622_0493"
FT   CDS_pept        complement(473265..473729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0493"
FT                   /product="coenzyme F420-reducing hydrogenase delta subunit"
FT                   /note="TIGRFAM: coenzyme F420-reducing hydrogenase delta
FT                   subunit; hydrogenase maturation protease; PFAM: peptidase
FT                   M52 hydrogen uptake protein; KEGG: mfe:Mefer_0104 coenzyme
FT                   F420-reducing hydrogenase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69185"
FT                   /db_xref="GOA:D3S825"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR004411"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D3S825"
FT                   /inference="protein motif:TFAM:TIGR00130"
FT                   /protein_id="ADC69185.1"
FT                   /translation="MKKKDILIVGCGNLLFGDDGFGCEVISKLEKMELPDNVEVIDAGA
FT                   SGAYYLMTLVDEDIKKIIVVDAIDFGLEPGTIKKIDVDELPNIKKYSFDAHNVPLAPFL
FT                   KDLHDNGVEVVVIGCQGKEFTMPDIKPGLSEEVAKAVDKAIEMILEEINK"
FT   gene            complement(473734..474375)
FT                   /locus_tag="MFS40622_0494"
FT   CDS_pept        complement(473734..474375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0494"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /note="TIGRFAM: orotidine 5'-phosphate decarboxylase; PFAM:
FT                   Orotidine 5'-phosphate decarboxylase; KEGG: mfe:Mefer_0105
FT                   orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69186"
FT                   /db_xref="GOA:D3S826"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:D3S826"
FT                   /inference="protein motif:TFAM:TIGR01740"
FT                   /protein_id="ADC69186.1"
FT                   /translation="MPKLMLALDVLDKEEALKIAEDVKDYVDAIKVGYPLVLSSGIEII
FT                   GDIKKLCNKEVICDFKVADIPATNEKIAKITLKYADGIIVHGFVGEDSVKAVQDVAKKL
FT                   NKKVIMVTEMSHPGAIQFLQPIADKLAEMAKKLKVDAIVAPSTRPERLKEIKNIAGLPI
FT                   ITPGVGAQGGKVEDIINILDDNDYVIVGRAIYQSENPKEAAKKYKEMLNK"
FT   gene            474497..474922
FT                   /locus_tag="MFS40622_0495"
FT   CDS_pept        474497..474922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0495"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mja:MJ0251 ferredoxin II"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69187"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3S827"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC69187.1"
FT                   /translation="MIKEIELLKKIREFLILNLEIKKLMQELDVDKDIYEAYEEVTKIV
FT                   REPNIKLYRQYYDAIKEMFYEEYGKKRKDIPWFPKIDYSKCKNCKKCISFCPRGVYDVE
FT                   NGRVVVKYPYSCIVNCNACSIMCCENKAITFPDEKIS"
FT   repeat_region   475334..476335
FT                   /rpt_unit_range=475335..475365
FT                   /note="CRISPRS"
FT   gene            complement(476775..477944)
FT                   /locus_tag="MFS40622_0496"
FT   CDS_pept        complement(476775..477944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0496"
FT                   /product="phosphoribosylglycinamide formyltransferase 2"
FT                   /note="TIGRFAM: phosphoribosylglycinamide formyltransferase
FT                   2; PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein ATP-grasp; KEGG: mja:MJ1486
FT                   phosphoribosylglycinamide formyltransferase 2"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69188"
FT                   /db_xref="GOA:D3S828"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D3S828"
FT                   /inference="protein motif:TFAM:TIGR01142"
FT                   /protein_id="ADC69188.1"
FT                   /translation="MAIGTPLLKGSVKFLLLGSGELGKEVVIEAQRLGIECIAVDRYQN
FT                   APAMQVAHKSYVIDMKDYDALMAIIEREEPDYIVPEIEAINTDALIDAEKEGYNVVPTA
FT                   EATKITMNRELIRRLAAEKLGLRTAKYAFADSLEELRDAVEKLGLPCVVKPIMSSSGKG
FT                   QSVVRSEEDIEKAWKIAKEGARGIGNRVIVEEFINFDYEITLLTARTAEGTKFCEPIGH
FT                   IQIDGDYHESWQPHDMSDELKKKAQDIAKKVTDALGGYGIFGVELFVKGDEVIFSEVSP
FT                   RPHDTGMVTMITQEMSEFEIHVRAILGLPVSTKLIHPGASHVIKAEINKYAPKYHIEEA
FT                   LKVPNTKLRLFGKPNAKVGRRMGVALAYADSVEKARELAEKCAHAVKIE"
FT   gene            478065..479345
FT                   /locus_tag="MFS40622_0497"
FT   CDS_pept        478065..479345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0497"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; cobalamin
FT                   B12-binding domain protein; surface antigen variable number
FT                   repeat protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   mfe:Mefer_1154 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69189"
FT                   /db_xref="GOA:D3S829"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:D3S829"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADC69189.1"
FT                   /translation="MEENTALVVYYTKLHKNSFNALIGALEVDEYFDNFPIYFANKKDI
FT                   FNLEGILKKHDKVVIAISFFTTELWKTYDLINELKSKYQNYRDKIIYLAGGPHPTGDPK
FT                   GTLKLGFDVVCIGEGEETFPELIKAVNENEDYKKVKGIAYLDDNKFIYTGKRKHVDLNK
FT                   YPPFPVKHNKFGHIEITRGCPYGCYFCQTPRIFGKNVRHRSIENICKYVEIMAERNLKD
FT                   IRFITPNAFGYGSKDGKTLNIDKVEKLLENIREILGNNGRIFFGTFPSEVRPEHVNDET
FT                   VDLILKYADNKSLVVGAQSGSQRILDLCHRGHTVEDIYNAVTTAIKKGISVSLDFIFGL
FT                   PGETEEDVEKTIKVMKDLIKMGAKIHAHTFMPLPQTPFAKANPGVVNKKIIRAMRHEIP
FT                   KGIFYGTWHNQQILAEKISKYLQTGEL"
FT   gene            479354..480541
FT                   /locus_tag="MFS40622_0498"
FT   CDS_pept        479354..480541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69190"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3S830"
FT                   /inference="similar to AA sequence:KEGG:MJ1488"
FT                   /protein_id="ADC69190.1"
FT                   /translation="MVDIMRIGIVGAGLGGLLAGALLSKNHEVVVFEKLPFLGGRFTNL
FT                   EYEGFQLTTGALHMIPHGNDGYLAQALRKAGANVKIVNSEPDGTFLVNGKEYLYRELFS
FT                   LLGFKEKAKAIALATKLKLGKVDKNISFGEFLEDVDLALKVGNAFTGWALSLTAYETPM
FT                   SEIIEIAKNYHKFGGPGIPIGGCKAVIDELSRIIKNNNGRIIKEYEVKSIEIDEKAYID
FT                   DYEFDVVVSNISPVETQKLCNIKFLKSKPKPSKGIKISIATKEGIIKHSGVLFTPECER
FT                   INGLNQVTNVDKSLAPEGWHLVMTHQTQLTNNIKKEIDLGLEDIENLFKGKDYRILHIQ
FT                   SYRDDWPVNHASNGTDIDNIVNDKLYLVGDGAKGRGGIEVEGIAMGVLKVVNYIA"
FT   gene            480759..482231
FT                   /locus_tag="MFS40622_0499"
FT   CDS_pept        480759..482231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0499"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase IS605 OrfB; KEGG: saf:SULAZ_1161 putative
FT                   transposase DNA-binding domain family"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69191"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D3S831"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ADC69191.1"
FT                   /translation="MKVITRIYIYDNRVKNITSFIIQLAHFRNMLIILIHKLKEQLGYY
FT                   PNNEALLYSLLAEKLNLKRTKDKNKIEKLNKLLEIIKSDNFLSELLNSMKKLKNELNNN
FT                   PALQSIIRQVCKDFKSYRKAYEEYLANSNKFTGKPKPPKAKKLKNIDKFTIELNKMSFK
FT                   VNNKILHVKLHKNKQIRIKLPEFIKKPSSIRITYYLGFAYVDIVHDKYIGELKPLSNYK
FT                   AGIDLGVENFATIVSTNDNIPSIVIKSSHLKAFNQWYNKLLAKLRSRIDKVKNLLKENS
FT                   EDKNLLSELEVLTRRIRKLHLYRKKWMENVAHQVSKAIALYLHKTGHDKVFIGKNILEA
FT                   KNGSNLSKRVNQNFVQIPFRLFIDKLAYKLKWFGIKLVEVDESFTSKSSCVSDDIIEIQ
FT                   KSKGKVSMSGDRICRGLYFDKVINLIFHADVNGAFNILRVGLKRKRLFKKIDRIAKVKL
FT                   CRPKTVRLFEFCRVVLGNLCPPNWAVEVGLSR"
FT   gene            482480..484501
FT                   /locus_tag="MFS40622_0500"
FT   CDS_pept        482480..484501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0500"
FT                   /product="MCM family protein"
FT                   /note="PFAM: MCM family protein; SMART: MCM family protein;
FT                   KEGG: mja:MJ1489 cell division control protein 47 (cdc47)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69192"
FT                   /db_xref="GOA:D3S832"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR008047"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018525"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031327"
FT                   /db_xref="InterPro:IPR033762"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041562"
FT                   /db_xref="UniProtKB/TrEMBL:D3S832"
FT                   /inference="protein motif:PFAM:PF00493"
FT                   /protein_id="ADC69192.1"
FT                   /translation="MELRDEDLILEEVRDYLTAYLRNIHQEDIILDSERVVVDLNQLYN
FT                   SGLMEFVEFLINKPQKGIDFIKECYNEAYYTLRNEYPTNVIIAVKNLPEIFKTTKKGRI
FT                   FTIEDIKSDTLGRLIEFEGIIAKASKIKPMLKKAYYICPKCGREVVKEIDIFITNPEKA
FT                   LCECGAELNLIDDKCSYTDFQEIKVQQPPDLMENPDDPPKYITTFLENSPGIYAGRVKI
FT                   TGIPIRVKKSKKLPIYDIYVKAINCEVLDGEVKIDLTNSDIEKIKKIAKRKDVVDLLAD
FT                   RLIPEIKGHSAIKKAVFLQQIKGVKKPGKRADIHILLITDPGIGKTVILRKIAEIPGNL
FT                   YGSVTTATGVGLTAAVVREKTEIGEDTWVIKPGLLVKAHKGTACIDELTVNKELQSYVL
FT                   EAMESQTIHISKGGINAKLPAECAILAACNPRWGRFNPDVSVAEQINIPAPLLSRFDLI
FT                   FPIRDVSDKDRDKDIAEYIVDLHRAYLDEEINKKIGLDYLEVDGVKIDKEFIIKYIYYA
FT                   RQQKPIISDRAKELFVNYYVEMRKKHQITARQLEAAIRIAEAHAKAKLKDVVDEEDAKE
FT                   AINIITECLKEIAYDPETGIFDVDKILGVSKKERDKLTTVYEIIKELSEKSELVEHEDI
FT                   VEMAKQKGIKEDELENIIKKLVKYGDIDEPKPGRYRLL"
FT   gene            484543..485814
FT                   /locus_tag="MFS40622_0501"
FT   CDS_pept        484543..485814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0501"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; KEGG: mja:MJ1490 dihydroorotase
FT                   (PyrC)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69193"
FT                   /db_xref="GOA:D3S833"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3S833"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ADC69193.1"
FT                   /translation="MLLKNCRIVKDNKIIEGDILINDNGVIEKIAKDIKVDDETIDIRG
FT                   YLVIPGVIDAHVHFRWGEEEKEDFLSGSLAGINGGVCFAIDMPNNKPPIATKQLFYKKL
FT                   KDCKRYSKINVFLNFGVTEKNYFEIIEEAKAYKIFMVKSVGDLFIEDYSKLKDILNQNK
FT                   VFCIHAEHKDIINENLKKYSLNSWTDHCKIRDKKSEVEAVKEVIKNLRIIDKYNDKKPH
FT                   IHFCHISTKEALYLIKKAKKDLKNIRITVEATPHHIYLNKDMAEELKGFGKFNPPLRDK
FT                   DDNIALIKGIINRDVDIIASDHAPHLLEDKLKDVKNCPSGIPGIETIVPLTLNLVNKKL
FT                   ITLFDAIRVLSQNPAKIFDINNKIEEDNLANLTIIDLKKEGKINVELFKSKAKFSPFDK
FT                   WEVKGFPIYTVVNGKVYEAYGFYY"
FT   gene            485904..486278
FT                   /locus_tag="MFS40622_0502"
FT   CDS_pept        485904..486278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_1422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69194"
FT                   /db_xref="GOA:D3S834"
FT                   /db_xref="UniProtKB/TrEMBL:D3S834"
FT                   /inference="similar to AA sequence:KEGG:Metvu_1422"
FT                   /protein_id="ADC69194.1"
FT                   /translation="MVSFDQEKMLKPAIIGGIINIVLDVVCCLGIIVGGAIAAHLYVNA
FT                   GGVCDYENCGLVGAISGVIGGFFGSILNYLLMAQLMVMFGGYHPYGMGTSLIISMISGI
FT                   IFGAILGAVGGVIYVVIKNR"
FT   gene            486287..486784
FT                   /locus_tag="MFS40622_0503"
FT   CDS_pept        486287..486784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0503"
FT                   /product="Protein of unknown function DUF2085,
FT                   transmembrane"
FT                   /note="PFAM: Protein of unknown function DUF2085,
FT                   transmembrane; KEGG: mja:MJ1492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69195"
FT                   /db_xref="GOA:D3S835"
FT                   /db_xref="InterPro:IPR019206"
FT                   /db_xref="UniProtKB/TrEMBL:D3S835"
FT                   /inference="protein motif:PFAM:PF09858"
FT                   /protein_id="ADC69195.1"
FT                   /translation="MKKYYVLILVSFLIFYLGIFLAPYFAFLGEHSNFWKLISICFYSI
FT                   YSPICHQMPQRSFFIFGHKMAVCARCFGIYTGFLIGMLIYPFFKKLDDFKIPNRWYLII
FT                   SSIPMAVDGTTQLIGLRESFNELRFITGFIVGFTITFYILPIFFKLLSKYKIKHANIKI
FT                   YK"
FT   gene            486904..487206
FT                   /locus_tag="MFS40622_0504"
FT   CDS_pept        486904..487206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_1506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69196"
FT                   /db_xref="GOA:D3S836"
FT                   /db_xref="UniProtKB/TrEMBL:D3S836"
FT                   /inference="similar to AA sequence:KEGG:Mhun_1506"
FT                   /protein_id="ADC69196.1"
FT                   /translation="MEGVKIKEIKRIDVLSLAVFGGVFNTLLVVIWWLLLMLILSPLLA
FT                   YSGSNVAVGFLGWGILGLIIYSIVGFVFGFIGGAITAIIYNIVASIVGGIKIVLK"
FT   gene            487279..487965
FT                   /locus_tag="MFS40622_0505"
FT   CDS_pept        487279..487965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0505"
FT                   /product="zinc finger SWIM domain protein"
FT                   /note="PFAM: zinc finger SWIM domain protein; KEGG:
FT                   mja:MJ1493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69197"
FT                   /db_xref="GOA:D3S837"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D3S837"
FT                   /inference="protein motif:PFAM:PF04434"
FT                   /protein_id="ADC69197.1"
FT                   /translation="MNYDQKIIERGKLYYRNNLVKYCIKYKNFLFGEVIGSETYKVKVD
FT                   LDDNYFGLCTCPYKYNCKHAYALIEAYKNNNYIDAEKIFKEIENKPKEEILEVLKNLII
FT                   KYYLWDEFLDTNSLLNKAIGLIKLIPLEKKNIHTFKSFLRNQFVKNADDEELIKIIDEM
FT                   IKADLDFNNSDIIEALTIILDEIFKRENKGIIKKLINLYRKYKKELWIVGDYLIIHYDN
FT                   YFDYEG"
FT   gene            complement(487962..489077)
FT                   /locus_tag="MFS40622_0506"
FT   CDS_pept        complement(487962..489077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0506"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: mja:MJ1494 AAA ATPase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69198"
FT                   /db_xref="GOA:D3S838"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S838"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADC69198.1"
FT                   /translation="MSKIGFNPIKIKSFSKIKTYDDTLPSLKYVVLEPAGFPIRVSSEN
FT                   VKVSTDDPILFNIYARDQWIGEIVKEGDYLFDNSILPDYAFKVISTYPKEGGMITSETV
FT                   FKLQTPKKILRTQFKKAKFSEIIGQEEAKKKCRIIMKYLENPKLFGEWAPKNVLFYGPP
FT                   GTGKTLMARALATETNSSFILVKAPELIGEHVGDASKMIRELYQRASENAPCIVFIDEL
FT                   DAIGLSREYQSLRGDVSEVVNALLTELDGIKENEGVVTIAATNNPAMLDPAIRSRFEEE
FT                   IEFKLPNDEERLKIMELYAKKMPIPVKANLKEFVEKTKGFSGRDIKEKFLKPALHKAIL
FT                   EDRDYISKEDLEWALKKIVSNRREAPQHLYL"
FT   gene            489183..490019
FT                   /locus_tag="MFS40622_0507"
FT   CDS_pept        489183..490019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0507"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114; KEGG:
FT                   mja:MJ1495 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69199"
FT                   /db_xref="GOA:D3S839"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3S839"
FT                   /inference="protein motif:PFAM:PF01972"
FT                   /protein_id="ADC69199.1"
FT                   /translation="MTSMDMLFFLFIFLLFIYPEMMLRYRIMRRLRCIREIERERGTRV
FT                   IAMIHRQEALTFLGIPIYKFITIEDSEEILRAIRLTPEDMPIDLIIHTPGGLALASEQI
FT                   ALALKEHKAKTTVIIPHYAMSGGSLIALAADEIIMDKNAVMGPVDPQIGQYPAASILEA
FT                   YYRKGEKVDDETLILVDISKKAIKQMEEFVYELLKDKYGDEKAKEIAKKLTSGTWTHDY
FT                   PLTVNKLKELGIEVNTNVPRKVYELLELYPQPMGAKPSVYYIPIPYSKKESEKNAK"
FT   gene            490009..490356
FT                   /locus_tag="MFS40622_0508"
FT   CDS_pept        490009..490356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0508"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   mja:MJ1496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69200"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D3S840"
FT                   /inference="protein motif:PFAM:PF02643"
FT                   /protein_id="ADC69200.1"
FT                   /translation="MQNKKIKKVRVGELEFDVVLADNFIKRAFGLMLRDIGDKAMLFLY
FT                   KRRKIAMHTFFMLYPIDVIFIDKDVVVEAVRLKPWKTYKCKNYSTAMLEFKCRDVELNK
FT                   LIGKKVEFMRG"
FT   gene            490359..491390
FT                   /locus_tag="MFS40622_0509"
FT   CDS_pept        490359..491390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0509"
FT                   /product="peptidase dimerization domain protein"
FT                   /note="PFAM: peptidase dimerisation domain protein;
FT                   peptidase M20; KEGG: mja:MJ1497 acetylornithine deacetylase
FT                   (ArgE)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69201"
FT                   /db_xref="GOA:D3S841"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3S841"
FT                   /inference="protein motif:PFAM:PF07687"
FT                   /protein_id="ADC69201.1"
FT                   /translation="MDYLKILEDLVKIRTDNRIGVKKAFKYLSNLFNNLGIKNTTIENC
FT                   FVAYKEKENFDLILNSHIDTVKVQSNFKKDDNNFYGTGVIDAKGNVVLMIHAFLNSNNS
FT                   LLVISPDEETESNGIYNFCQYLRNKNKIKKDIKCIVGEPTDLKVCIGHKGRFEYIVEAF
FT                   GKARHASSQGLNPIEILSRVILDLRQMPLEKIKVDKIYSSSITPTIIKGGIQSNIIPDY
FT                   AYVLFDVRSVEKDIIKKIDNFLSQKHYSKHIKSGLNPGRHYADFYMLENKELIDKLSKH
FT                   FKISFFNATCEAYYFNKFLKADTVIYGVGRLELAHSKEEYLNLNDFDKGIKEVEKLAEL
FT                   MLS"
FT   gene            complement(491387..492058)
FT                   /locus_tag="MFS40622_0510"
FT   CDS_pept        complement(491387..492058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0510"
FT                   /product="NADPH-dependent F420 reductase"
FT                   /note="TIGRFAM: NADPH-dependent F420 reductase; PFAM: NADP
FT                   oxidoreductase coenzyme F420-dependent; KEGG: mja:MJ1501
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69202"
FT                   /db_xref="GOA:D3S842"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3S842"
FT                   /inference="protein motif:TFAM:TIGR01915"
FT                   /protein_id="ADC69202.1"
FT                   /translation="MKIAILGGTGDQGFGLALRLAKNNKIIIGSRKKEKAEEAAKKAKE
FT                   ILNQRGIEADIIGLENKEAAKEGDVVILSIPYEYTLSTIKQLKEDLKGKIVVSIGVPLA
FT                   TAIGDKPTRLLFPPDGSVAEMVQNVLKESKVVSAFQNVCHAVLEDLDNPVDCDILVCGN
FT                   DEEAKKVVIDLANQIDGVRAIDCGNLEKSRIIEAITPLLIGLNIKYKSKGTGIRITNLE
FT                   I"
FT   gene            complement(492055..493017)
FT                   /locus_tag="MFS40622_0511"
FT   CDS_pept        complement(492055..493017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0511"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="TIGRFAM: ribonuclease Z; KEGG: mja:MJ1502
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69203"
FT                   /db_xref="GOA:D3S843"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3S843"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ADC69203.1"
FT                   /translation="MIIMKLIFLGTGAAVPSKNRNHIGIAFKFGGEVFLFDCGENIQRQ
FT                   MLFTEVSPMKINHIFITHLHGDHILGIPGLLQSMGFFGREKELKIFGPEGTKEVIENSL
FT                   KLGAHYIEFPIKVYEIYAKEPITVYNEENYEIIAYPTEHGIPSYAYIFKEIKKPRLDIE
FT                   KAKKLGVKIGPDLKKLKNGEAVKNIYGEIVKPEDVLLPPKKGFCLAYSGDTIPLEDFGK
FT                   YLKELGCDVLIHEATFDDFSKDIAKENMHSTIGDAVNIAKLADVKILILTHISARYDKE
FT                   EYFNLYKMNVKQYNESFKIIISEDFMVYDIKKEIVEVKK"
FT   gene            complement(493021..493416)
FT                   /locus_tag="MFS40622_0512"
FT   CDS_pept        complement(493021..493416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0512"
FT                   /product="transcriptional regulator, TrmB"
FT                   /note="PFAM: transcriptional regulator TrmB; KEGG:
FT                   mja:MJ1503 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69204"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S844"
FT                   /inference="protein motif:PFAM:PF01978"
FT                   /protein_id="ADC69204.1"
FT                   /translation="MSKLLLKTPCTTWTFDSLMACVFGIKVSDVKVYFDILKNGPSKIN
FT                   DIAERINRDRSTVQRSVQNLMNAGLVKRKQVNIKDGGYYYVYEAIPFEETKKIIKKTME
FT                   EWCNNMKKWVEELEFEDVVKEYLENEE"
FT   gene            complement(493475..494587)
FT                   /locus_tag="MFS40622_0513"
FT   CDS_pept        complement(493475..494587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0513"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: mja:MJ1504 lipopolysaccharide biosynthesis
FT                   protein (WbpI); TIGRFAM: UDP-N-acetylglucosamine
FT                   2-epimerase; PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69205"
FT                   /db_xref="GOA:D3S845"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3S845"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADC69205.1"
FT                   /translation="MKLSIILGTRPEIIKLSPIIRILEKTNIDWHIIHTNQHYSENMDK
FT                   IFFEELNLPKPKYNLNIGSGTHGEQTGRMLIEIERVLLNEKPDVVIVQGDTNTVLAGAL
FT                   TASKLKIDIAHVEAGLRSFDRNMPEEINRVLTDHISSYLFAPTEIAKNNLLKEGIEENK
FT                   IFVVGNTIVDATLQNLKIAEKNENIKAFFNNIVDNDYFLLTLHRAENVDNKERLKNIVE
FT                   GIAKITEIYNKTIIFPIHPRTKKRLEEFNLFGKLKSNKKIKIIEPVGYLEFLMLEKNAK
FT                   IILTDSGGVQEEACILKIPCITLRDNTERPETVEVGANILVGDNKEKLIKAVEIMLNKK
FT                   RNWKNPFGDGKSGEKIVKILMNNIMDNINE"
FT   gene            complement(494589..496940)
FT                   /locus_tag="MFS40622_0514"
FT   CDS_pept        complement(494589..496940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0514"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; ERCC4 domain protein;
FT                   helix-hairpin-helix motif; SMART: DEAD-like helicase ;
FT                   helicase domain protein; Helix-hairpin-helix DNA-binding
FT                   class 1; KEGG: mja:MJ1505 Hef nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69206"
FT                   /db_xref="GOA:D3S846"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="InterPro:IPR041755"
FT                   /db_xref="UniProtKB/TrEMBL:D3S846"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ADC69206.1"
FT                   /translation="MFIEHPLIKSKTLEARLYQQIIAANALKKKTLCVLSTGLGKTAIA
FT                   ILVIAGILTKKDGKILILAPSRPLVEQHYNRLKEVLNIDEDKIIALTGKIQPKKRVELY
FT                   KKGKIFIATPQVIENDIIAGRINIDEFVLLIADEAHHTTGDHAYAFVAKKFKDKCHVLG
FT                   LTASPGSDIDRVMEICENLGIEHVEVRTEDDEDVKPYIAKVKLTPIRIDLPDEFKRALK
FT                   LINEALKERLKILKDAGVIDSISNTTKTELIELNNKLFSYDEEVKYELIRVCSEALKLM
FT                   HAKELLESQGKSVFLNYINKLSMQRTKSAKSIVNDEKVREAVNLLMKSNVEHPKLDKVV
FT                   DIVKGILQKNEDERIIIFAQYRDTVEKIVNLLTQNGIKAIRFIGQANKEGKGMSQKEQI
FT                   EAIEKFKKEGSVLVSTSVSEEGIDIPTVNYIIFYEPVPSEIRFIQRRGRAMRGEGGKVY
FT                   VLIAKGTADEAYYRSALYREKEMKRLLKNMCYLLNKRLQKKFEEEREEETKKEIKEIKE
FT                   ADIEDTHPIFKTATKEEIKKEEEKAKKPVTILDFIKQIEVKEKSKSEEDKIKQDIKVPK
FT                   KPIKIIVDVREKNMAKLLHNYANIELKTLEVGDYVLSDRVVVERKTAEDFVNSIIDKRL
FT                   FSQLKNLRKVEKPLLIVEGDNFGRIHENALRGAILSIILDFGIPIIFTKNAEETADLLI
FT                   KIAEKEQLKEKRAVMVRYGKTTMSLKEQQKFIVESLPDVGGALAERLLKHFKTVERVFT
FT                   AKEEELMKVEGVGKERAKKIREVLTAEYEG"
FT   gene            complement(497049..498236)
FT                   /locus_tag="MFS40622_0515"
FT   CDS_pept        complement(497049..498236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69207"
FT                   /db_xref="GOA:D3S847"
FT                   /db_xref="UniProtKB/TrEMBL:D3S847"
FT                   /inference="similar to AA sequence:KEGG:MJ1506"
FT                   /protein_id="ADC69207.1"
FT                   /translation="MFKKFLMILIGFILLSSISAIQIDNPQYQPNIIHPGDDVNLWIKI
FT                   TNDNYDNEVRNVVVEVSPHYPFELKQVNPVKGKAKISHLNPGESDIAYFKLHVDENAPS
FT                   RDYRIDVKVSYDEVENKNGKEIINHYEVTKVYYLPVYGIASFQLKINDTSIIPGKTKTV
FT                   KLDVKNVGTGNAKYLNLYLIGNDKINILGGGSVFIGCLKSNNQYIIPIKIYAVPEIENG
FT                   IYSINAKLFWIGEDGRQYNLTIPLNIRVVKKIYENQPYIYLDDVKNKGDYVEITIGIAN
FT                   RGTTKIRHCVMTLTVNGKNYTKYIGDLDEDDYDTSVFEINDFGDIPIKVTVTYFDDYHN
FT                   QYNTTETFNIHVEKVEKQESLRPIYIIGGVIVVIILILYIRKRKRRQEFEEFEEI"
FT   sig_peptide     complement(498168..498236)
FT                   /locus_tag="MFS40622_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.423 at
FT                   residue 23"
FT   gene            498318..499505
FT                   /locus_tag="MFS40622_0516"
FT   CDS_pept        498318..499505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0516"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   mja:MJ1507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69208"
FT                   /db_xref="GOA:D3S848"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D3S848"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADC69208.1"
FT                   /translation="MKVEDIITFAFKNMKQKRTQSLLTIVGIVIGVLAIVSLISLGYGV
FT                   QNYIHEEMMKIGSNKITILPMKQFGVPPSHYFTKKEVKAIKKVKGVDTVMYGWYGGCEI
FT                   EYNGEKKFVSYYYAIPSKLREVYKDSGYDIEKGRWLEDNDKYACVIGYGTAHNLFNREI
FT                   KVGDVIKIKDKKFRVVGILKQVGNQQDDNSIILNIDVGEKLFGNEGEYNFISVTVKEGE
FT                   DIEKVSEEIKKALKKSFGDEEFSVLTAEQLAETVSSVLGVITIFVVGVAAISLLVGAVG
FT                   ISNTMHMSILERRKDIGILKALGAETTDILAIFVVESGFLGLFGGVVGLVLGVLLAEII
FT                   EALAHKMGYLMVNAWISYELIVGVLIFSFLVGVISGYFPARSGAKLDPIETLRGE"
FT   gene            499507..500181
FT                   /locus_tag="MFS40622_0517"
FT   CDS_pept        499507..500181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0517"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ1508 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69209"
FT                   /db_xref="GOA:D3S849"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S849"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC69209.1"
FT                   /translation="MIEAKNIWKIYGRGEAKTIALKNINLEIEEGEFLMIMGPSGCGKS
FT                   TLLNILALLDTPTKGEVYYKGRRTSSMSENERAIFRRKVSGFIFQQFHLIKTLTALENV
FT                   ELPMMLDEKDKSYRRKRAKKLLEMVGLGDRLNHYPYQLSGGQQQRVAIARALANNPKII
FT                   FADEPTGNLDSKSGIAVMNILKELNEKGITIVMVTHEQELTKYASKIVKLRDGEIVEIV
FT                   EK"
FT   gene            500291..500752
FT                   /locus_tag="MFS40622_0518"
FT   CDS_pept        500291..500752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0518"
FT                   /product="Domain of unknown function DUF1931"
FT                   /note="PFAM: Domain of unknown function DUF1931; KEGG:
FT                   mja:MJ1509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69210"
FT                   /db_xref="GOA:D3S850"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR015207"
FT                   /db_xref="UniProtKB/TrEMBL:D3S850"
FT                   /inference="protein motif:PFAM:PF09123"
FT                   /protein_id="ADC69210.1"
FT                   /translation="MAEMIIPYPQLKKIMNTTCEIDLYKTEAEDMMDVVEKKLADLFEV
FT                   AYKNAKEENAKIIKMRHIPLTKGFLNSMELFRSVIEEENIVAETIKKYVMKKIPGDLPL
FT                   DDIVVDNLPLITGTIFIVVGRVIKALHEDIERIRKEHIEEAKKVLDYTL"
FT   gene            complement(500775..501353)
FT                   /locus_tag="MFS40622_0519"
FT   CDS_pept        complement(500775..501353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0519"
FT                   /product="Protein of unknown function DUF207"
FT                   /note="PFAM: Protein of unknown function DUF207; KEGG:
FT                   mja:MJ1510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69211"
FT                   /db_xref="GOA:D3S851"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="UniProtKB/TrEMBL:D3S851"
FT                   /inference="protein motif:PFAM:PF02676"
FT                   /protein_id="ADC69211.1"
FT                   /translation="MGFLEDKKRTLMNLELAIREGLVDEEIIPILNKINEIDNYYTTSS
FT                   CIGRVGIMEIPKDKNPKLYSRWLGKWHHYATYEEMFDALKNRKEGYIVFVMNSPILHIA
FT                   CKDISSAKKMLELAIHSGLKASSIKSVSEKRVIVEILTTYKVDAPIGEDGEIFVDNDYL
FT                   KFLLDYSNSKLKRAREILMRWANRLDELK"
FT   gene            501532..501855
FT                   /locus_tag="MFS40622_0520"
FT   CDS_pept        501532..501855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0520"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mja:MJ1511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69212"
FT                   /db_xref="GOA:D3S852"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D3S852"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ADC69212.1"
FT                   /translation="MAEFVPAETMEVVKKNCPEFYEAVANLQKEVFSGKKLDEKMQRLV
FT                   LLAVVATLGDEKAVKRQTKKLLEMGATIEEIQDVMKVVYIGAGMPRFIKAVEAILEVAG
FT                   DQC"
FT   gene            502063..505422
FT                   /locus_tag="MFS40622_0521"
FT   CDS_pept        502063..505422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0521"
FT                   /product="reverse gyrase"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mfe:Mefer_0049 reverse gyrase; TIGRFAM:
FT                   reverse gyrase; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; type III restriction
FT                   protein res subunit; SMART: DNA topoisomerase I
FT                   DNA-binding; DNA topoisomerase I ATP-binding; Toprim sub
FT                   domain protein; DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69213"
FT                   /db_xref="GOA:D3S853"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005736"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034142"
FT                   /db_xref="InterPro:IPR040569"
FT                   /db_xref="UniProtKB/TrEMBL:D3S853"
FT                   /inference="protein motif:TFAM:TIGR01054"
FT                   /protein_id="ADC69213.1"
FT                   /translation="MIPMIYKEMCPNCNGEITSERLAIGVCEKCLKEKNVFEKLKLCEK
FT                   LREEKTLKELKSYCIIWNEFKEFEEFAKSLGYELLSIQKMWAKRVLKNKSFSIVAPTGV
FT                   GKSFFGILMSLFLAKKGKRCYIILPTTLLVKQTYEKMLSLVEKNNLNIKVVAYHSELST
FT                   KEKKEAKERIENNDYDVLITTSNFLTKNMPNCRFDFVFVDDVDALLKASKNIDRTLKLL
FT                   GFDEEIINEAYKIIYLIKIGKIEDAMKKREILKEKVAKIKHGCLIIASATGKSYGDRVK
FT                   LYRELLDFEIGFGMNKLRDVVDIYDEEFSKEKILEYIKLFGSGGIVFVSIDYGVEKAQE
FT                   IEKYLLDNNIKAKLIHSKDKKGFDDFREGKIDVLIGVASYYGVLVRGLDMPERVRYAIF
FT                   YGIPKFKIRLKEYINSLKEKGELKEDIDIEGKTEEEIRQIITEKLKIKNFSLRKEDDEY
FT                   LLLIPDVKTYIQASGRTSRMTEFGLTKGASIVLVDEKEIFEALKKYMLFMYESEFKRID
FT                   EINLEELIKKIDEDREKIKVGRAKGKVPDLLKSVLMVVESPNKARTIANFFGKPSVRKI
FT                   NNRNVYEVCIGDLNLIITASGGHVFDLVTKEGFYGVKIEDNLYIPIYTSIKKVNGEQFT
FT                   DQKDLEELIRQLMEKGEKVNAMDAKENVEIIREIADEVDAIFIATDIDTEGEKIGYDIA
FT                   INALPFNKNIYRVGFNEITKRAILKAVESFKKGDKLELDENKVRGQIVRRIEDRWIGFR
FT                   LSQKLWEVFDKNYLSAGRVQTPVLGWIIERYNEHKIKVPYLSLKLENDIYIGKIWEDEF
FT                   DKDEVEVEVKVYEKEIPPLPPFTTDTLLEEATKRFGLSTDEVMSIAQELFELGLTSYHR
FT                   TSSTRVSLDGMRVAREYLKLNNMEDYLKNREYFMEGAHECIRPTKPMDTEELIEFLKEN
FT                   NIKLTKNHIKVYDLIFRRFIASQMKEAVVEYEEIYIKDLDEKVEGYIDIKFDGWSRIYN
FT                   LKLKKLPRIEKSTLKVLDKKLRKIPKVPLYDEGEVVKLMKERGIGRPSTYAQIIKKLLD
FT                   RGYVIKSRDKNKLIPTKLGIDVYNYLISNYPHLISEERTRELEEIMDKIENGEVDYLEV
FT                   LKALHEEILSIK"
FT   gene            complement(505429..506403)
FT                   /locus_tag="MFS40622_0522"
FT   CDS_pept        complement(505429..506403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69214"
FT                   /db_xref="UniProtKB/TrEMBL:D3S854"
FT                   /inference="similar to AA sequence:KEGG:MJ1513"
FT                   /protein_id="ADC69214.1"
FT                   /translation="MNDLEKIRGGVHIAVQGYEVDRITEVPIMRRAEKVYLICMPENND
FT                   SEQGKAFKNAIIKKFEEKRVNYEVVEADLFDLDDIVKKMKDIIAHERKEFGDVRFYINV
FT                   SSGSTIGCIAGTTCAMILNKENSKIIPYYVIPERLLDDISEKEREKLRKEYKEKYDCSY
FT                   LPRSFGVRGIRLIYPFEVSLPREELLIFLKFIGRAGSRGLTIKELSILTKEEFLNADVY
FT                   DERSIKELIKAVGGSVKKMKSLVKELKDIVGSDIDDLKKIIDWRKKCRSSVNSTKQSDL
FT                   VWINKNVVEKLLELELIEKPEKIGKSKYVRISEKGKMLLNYVG"
FT   gene            506523..507083
FT                   /locus_tag="MFS40622_0523"
FT   CDS_pept        506523..507083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0523"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69215"
FT                   /db_xref="UniProtKB/TrEMBL:D3S855"
FT                   /inference="similar to AA sequence:KEGG:Csac_0073"
FT                   /protein_id="ADC69215.1"
FT                   /translation="MGSANAFIIVGRPDFLHNGIYPTHCLILHENDKPWWVLTPIMRFS
FT                   KDKSKNCDIIVWIPTVEHMLEDALLMIGIYIIKDKELVSLAKKFFKNMEGNRIWLYEDI
FT                   EKEHLEKLREVCKKVLSKYNLKIVMAITLDSTILHQIDVLKDYKIECEVCTTRFGRWRK
FT                   GWRGELKEFEEYDILNKSRRLLE"
FT   gene            507183..507545
FT                   /locus_tag="MFS40622_0524"
FT   CDS_pept        507183..507545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0524"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: mja:MJ1514
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69216"
FT                   /db_xref="GOA:D3S856"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:D3S856"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADC69216.1"
FT                   /translation="MEYVFVYGSLRKGFWNHEAYLKDSKFIGKGKTKEKYAMYANIIPY
FT                   VVENEKISHIVGEVYEVDEKTLERIDCLEGHPHFYRRKKVPIILESGDEIEAWIYFYPE
FT                   PCGVLVESGDYKDYRG"
FT   gene            507548..508594
FT                   /locus_tag="MFS40622_0525"
FT   CDS_pept        507548..508594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0525"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   mja:MJ1515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69217"
FT                   /db_xref="GOA:D3S857"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3S857"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADC69217.1"
FT                   /translation="MCELLGICFNKKVNVNLSLNSFKHRSEEHPNGWGIAFYPDGFVRL
FT                   IKEPIKMNDALLAECVRWTKIKSKIFIAHIRKASAGSESYVNTHPFIRRLDGREIAFAH
FT                   NGTLLGYEDLELDGYYPIGETDSEYVFCYLLSQIGRRGIEWNKEGFDELLDILRRKINK
FT                   YGAFNCLFSDGEYLFAYRDCKGRRKLHFLKRKPPYGRIRLEDEDYVINLGDVKSANEEG
FT                   FIIATNPLTNENWMSFENGELIVFKNGEMIYSNKRLTDLELKILKILRESPHRVSLRNI
FT                   IKNLNRLSRNIRYDSSVVRIGIRSLLDKGYIKQNGTDTVSWNHLDATFYTKPEKREEID
FT                   RRLREFEW"
FT   gene            508655..508954
FT                   /locus_tag="MFS40622_0526"
FT   CDS_pept        508655..508954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0526"
FT                   /product="TM2 domain containing protein"
FT                   /note="PFAM: TM2 domain containing protein; KEGG:
FT                   mja:MJ1516 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69218"
FT                   /db_xref="GOA:D3S858"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D3S858"
FT                   /inference="protein motif:PFAM:PF05154"
FT                   /protein_id="ADC69218.1"
FT                   /translation="MEAMQIKDFVKDMDKTQRIVYYEQKKKSVGIAVLLSLVIPGAGQM
FT                   YLGKVGKGIIILLTFWLIIPYLYGIYDAYKSAKDYNAQLYSIIFSKEKDEENKS"
FT   gene            508967..509278
FT                   /locus_tag="MFS40622_0527"
FT   CDS_pept        508967..509278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0527"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_0623 permease of drug/transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69219"
FT                   /db_xref="GOA:D3S859"
FT                   /db_xref="UniProtKB/TrEMBL:D3S859"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69219.1"
FT                   /translation="MGYSSLKTFFILLTLSIIGFMLGVAVGNYWFWFLAAIPTIVLEVW
FT                   IVYKFITWKHFWKVVSPFLIIMFIFCPIDAIILALSFYILRISLFALREALKGKNNRM"
FT   sig_peptide     508967..509047
FT                   /locus_tag="MFS40622_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.848) with cleavage site probability 0.365 at
FT                   residue 27"
FT   gene            509278..510873
FT                   /locus_tag="MFS40622_0528"
FT   CDS_pept        509278..510873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mja:MJ1517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69220"
FT                   /db_xref="UniProtKB/TrEMBL:D3S860"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69220.1"
FT                   /translation="MIMKLWSERIKGREVLEVLGCERVPLTEALNEIIALSIEYIEKEL
FT                   YDIELMDDVCDYYQKDILSIDKLIEGSARIKLGLDTRNHAKYWLLEVVNWFAGNRYDLK
FT                   DDEIRLGNRLRDWMNIGVSLVIPKELKPKFDEFYKMAKEFDWELEIRDNVMFKTTLNCK
FT                   EVYVVMLMGDVVNERLDSILDGGGVFDLGKRVVCDDEWFSGWLVKDIDVNKKYVGGFGS
FT                   VVFEEPGNSGYFSGECFNKRKDYKNRRDCDVDDILWLVERILSPNGIKYRNFGNGIDDL
FT                   VRDVEKIIELVEKLYKTIEKLKNDVKVGDISKINKSLDDLEWNVYKIEDYIDSIKNRRY
FT                   KPIFECIINSLADNNKINNDTIKWAENRHLRVNKNLKIVYDLFIAISEVIEGCKNVVMN
FT                   KNLPDFIVRRLNIINTFIEKLCNDILSIRENEGKTLGCVLSKLYNSDNGEKLANEVKEI
FT                   VDSLYFDCYDAFVNTIGEYEFRFIKNLASMSLIYDYAKELKKDDEKELFNHIIFKILKI
FT                   MDLMLRSMILLRHY"
FT   gene            510906..511106
FT                   /locus_tag="MFS40622_0529"
FT   CDS_pept        510906..511106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0529"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mja:MJ1518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69221"
FT                   /db_xref="UniProtKB/TrEMBL:D3S861"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69221.1"
FT                   /translation="MEVRYFDIELMEIVRGFLECSKKEEFYNNVMMLKEFVENLRDVDM
FT                   RLKMFKGNFPIKFEEIKYLFE"
FT   gene            511316..514167
FT                   /pseudo
FT                   /locus_tag="MFS40622_0530"
FT                   /product="hypothetical protein"
FT   gene            514206..515543
FT                   /locus_tag="MFS40622_0531"
FT   CDS_pept        514206..515543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0531"
FT                   /product="5-methylcytosine restriction system
FT                   component-like protein"
FT                   /note="PFAM: 5-methylcytosine restriction system
FT                   component-like protein; KEGG: tga:TGAM_0452 McrBC
FT                   5-methylcytosine restriction system component"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69222"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:D3S862"
FT                   /inference="protein motif:PFAM:PF10117"
FT                   /protein_id="ADC69222.1"
FT                   /translation="MTNLITFYEHQLIKFGDKELSKLNLGENEIIELFKTINSRNTLVE
FT                   DVEDKEFDSIFRIYPNGIKAKQYVGFVAVDNKVIQVLPKVFQYCNYENKDKILAFIKMM
FT                   NFAYDLNIKEQELAKVKDIASTPVIYEIFIYLFAYSLLNEIKRGFYKSYIKVREEKKFL
FT                   KGKLLIDKQIRKLPHQRHKFSIEYHEFTENNLLNQIFYYTTYISLKKTKWRENKKLLSE
FT                   LMLIFEGINLRKITIHDFKRVHFTRLNERFKKPFNLAKIILSAFGEIDGEDAIGFFVDM
FT                   NDLFEKFICSILSKSLGFEIKYQSKFKLFKEVKGIKNIEQKPDYVVYKDNKPVLVLDAK
FT                   YTEINREYEKPKLPSDMLRQIYTYAKYYTLKCNYKIRSVLIFPKSKKYNDFNSKAIIGE
FT                   ATFFDNEINLYVLTYNLKKLIEGDGIDEEFINCIKKLTENKGEGLE"
FT   gene            515540..517072
FT                   /locus_tag="MFS40622_0532"
FT   CDS_pept        515540..517072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0532"
FT                   /product="RNA-metabolising metallo-beta-lactamase"
FT                   /note="PFAM: RNA-metabolising metallo-beta-lactamase; KEGG:
FT                   pho:PH0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69223"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3S863"
FT                   /inference="protein motif:PFAM:PF07521"
FT                   /protein_id="ADC69223.1"
FT                   /translation="MKITIYDGADTIGGNKIHIEENGNGLFLDFGMNFVKYSKYYEEYL
FT                   SERPARGIYDLWHLNLIPKLNIYRADLIPKDLNIAQYPKIPINAVLISHAHLDHVGNIA
FT                   ILNEKIPIVASPITITILKALRDTSISNHLGMDLPYYSIKKQKENGYVLESDRKSPYLS
FT                   RKVILTEDNNKVEDFIFYRPRQNSSSRVKKIEKNDIKTLSEEDLGFEIKAFNIDHSIYG
FT                   AVGYIVEGDTVLAYTGDFRCHGKNKNETKKFIKEAKNASILITEGTRVNRDNDTNITEE
FT                   DVYNNALKIVENAKGLVIADFSPRNFERLEIFKEIAKRTGRELIITTKDAYFLNALKDV
FT                   AGIDIIDEHIKIYKNLRSTQQKWEEEIYNLYESHFISPFEIRNNQENYILCFSFYDMPH
FT                   LLDVNPNGGVYIYSSSEAFGEEQEFSFLRLWYWLKHFGFEIYGFRVNEYGKPVFDKSLH
FT                   TSGHISKEGLRKVIEKIDPNYIIPVHTENPELFKWAFGDDVLLLKNGESLKL"
FT   gene            complement(517083..518246)
FT                   /locus_tag="MFS40622_0533"
FT   CDS_pept        complement(517083..518246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0533"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase FAD-binding; KEGG: mja:MJ1520
FT                   bacteriochlorophyll synthase 43 kDa subunit (ChlP)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69224"
FT                   /db_xref="GOA:D3S864"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3S864"
FT                   /inference="protein motif:TFAM:TIGR02032"
FT                   /protein_id="ADC69224.1"
FT                   /translation="MNSNDYDVVIIGGGPVGCITGEYIKNGRVLIVEEHQSIGVPLQCA
FT                   GLISKNGVKELGNPKGVVNKIRGAYIFTKNNMVKIGNEKVRAYVFERKVMDKDIAIRAA
FT                   KKCDFLLKAYGEIEKDKDGYKVKITHLGENIVLKPKVIVGADGAKTITGKRLGLVNNKN
FT                   REILSSCQFEMVNAEVDDDFVYIFLDRRYSERFFTWIIPMGKDRVRVGLIDKGNCYNKL
FT                   MKFITEHEIAKEILKNAIITEFSTGSLPIGYLDKAFKDNVLLVGDAACHIKPLSGGGLY
FT                   FGAIGGKIAGEVISKYLNGEINSLALYDKKWKESFGNEIKNGLLVRKLFLKLGNDTLDE
FT                   LIGKLARSDLIDYINKHGDMDRQASLALKVLKSLNIGLGFRILRDLL"
FT   gene            518338..519612
FT                   /locus_tag="MFS40622_0534"
FT   CDS_pept        518338..519612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0534"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: mja:MJ1521
FT                   Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69225"
FT                   /db_xref="GOA:D3S865"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3S865"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ADC69225.1"
FT                   /translation="MDTALFLGYLSILFAGGAIIAKIAKKIGIPDIPLLLIFGLILSIF
FT                   NVIPKNIVESSFDFIGNFGLIILLFIGSFEMEWSVMKRVLDVIVKLDILALLIVWVISG
FT                   IVFNFVFHLPILSLIGLLFGAIVSATDPATLIPIFSKMDIDPEVAITLEAESVFNDPLG
FT                   IVVTLISLSPLGLAKAENPLLEFISLAVGGIILGLIAGKFYECIISKIRFEDYIAPFTL
FT                   GLAIAFWYFGESIFPSITGYEISGFMAVAIMGLYIGNVIVHKEEHKEDMEKVAIFFDEV
FT                   SIFIRILIFVLLGASISIPLLEKYAVPAFICALGSILLARPVGVLIATAIPPIRPLAER
FT                   IYLALEGPRGVVPATLAAMVYTEIIKHPNIVPKDIAALMPPTELAGTILVATFMTIIVS
FT                   VILEASWAKPLANILLKKKNVSSSQ"
FT   gene            519678..520313
FT                   /locus_tag="MFS40622_0535"
FT   CDS_pept        519678..520313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0535"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase; KEGG:
FT                   mja:MJ1522 cobalt-precorrin-6Y C(5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69226"
FT                   /db_xref="GOA:D3S866"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3S866"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADC69226.1"
FT                   /translation="MIYIVGIGPGDKEYLTLKAIKIVENADLVVGSKRALELFNIEDSK
FT                   KIILTKNLIDELKEIIKKDENIKNKKVAILSTGDPCFSGLLKTLLKIGAKKEDIEVISG
FT                   ISSIQIAAAKLKISWEDYYIITLHGKEENRKKLLNLIKSHEKVIFLPNNLKEDAKFLID
FT                   NGINPDAKIWVLENLTYKNEKISLKSLKEIVKEDFSYLTVCVYTGEND"
FT   gene            520390..520764
FT                   /locus_tag="MFS40622_0536"
FT   CDS_pept        520390..520764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0536"
FT                   /product="CrcB protein"
FT                   /note="TIGRFAM: CrcB protein; PFAM: Camphor resistance CrcB
FT                   protein; KEGG: mja:MJ1523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69227"
FT                   /db_xref="GOA:D3S867"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D3S867"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADC69227.1"
FT                   /translation="MIRELLLIGVGGFFGAIFRYLISGIVPVKFGIPTGTLIVNLIGSF
FT                   ILGFLLYCSLFAPIPTEYKLLIGTGFCGALTTFSTFSYETFVLVDEGLLFKALLNILIN
FT                   VVGCLVMVYFGRVLALAIFR"
FT   gene            520775..521101
FT                   /locus_tag="MFS40622_0537"
FT   CDS_pept        520775..521101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0537"
FT                   /product="protein of unknown function DUF190"
FT                   /note="PFAM: protein of unknown function DUF190; KEGG:
FT                   mja:MJ1524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69228"
FT                   /db_xref="InterPro:IPR003793"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D3S868"
FT                   /inference="protein motif:PFAM:PF02641"
FT                   /protein_id="ADC69228.1"
FT                   /translation="MIKAKILKIYLKEGDKFKGELMYKYIMKILKREKISGATVYKGIC
FT                   GYGVRGIAEFDIFRLSVNLPVIIECVDIEENINRVLPKLYEVIKNNGLIVITDCYVYKG
FT                   ETHE"
FT   gene            521094..523874
FT                   /locus_tag="MFS40622_0538"
FT   CDS_pept        521094..523874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0538"
FT                   /product="Oligosaccharyl transferase STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase STT3 subunit; KEGG:
FT                   mja:MJ1525 putative transmembrane oligosaccharyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69229"
FT                   /db_xref="GOA:D3S869"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:D3S869"
FT                   /inference="protein motif:PFAM:PF02516"
FT                   /protein_id="ADC69229.1"
FT                   /translation="MSNALEKISNFFKERNWIKILLIVLMLMFMSFQLRAQTADMKFAQ
FT                   NNEFLKKMFSDEHGRMYLLAIDPYYYLRLSENLYDHGYCGDTIKIINGKEVPYDLYQYA
FT                   PPGHPIPWEPPVICLATLAIYYIWHSIDATVIIMNAAFWVPAVLGMLLGIPIYFIVRRV
FT                   TNSNIGGIVGAIAIISAPALLYKTCAGFADTPIFEILPILFIVWFILEAIHSQEKTALF
FT                   KKDLKNPISLFVIAALIIELIFGIYLNIASGESIVIASVFFYAISLAFVLAGLVIAGIK
FT                   KLKGKDVEFELFALLAVILTAVAPKMWGAWWYGFDVITGFLITYIIALALLKSQVKIKE
FT                   FIDIGNFKNVVCLSIFYILGSIILLTAIYGVGTAISPITSPLGYNKILSSYTLTTGWPN
FT                   VYTTVAELAKPSSWGDIFTNAIGSNTIAIVGILGIVLSFLSLRHEKIKFDIKYAILLAI
FT                   WLVVTLYAATKGIRFASLATPPLAIGLGIFVGQLDRVLKMKNDTAIVGIGIPAGLFGLL
FT                   MLSKYSAKISQILLPTTYVPAIAYGFLIVLALLAIYKISDIISTINDKKETIIKISALL
FT                   LCIGVIIPPLSAVVPFSAAPTFNNGWKAGLDWIKETAPKNAVITCWWDNGHIYTYEARR
FT                   MVTFDGGSQNTPRAYWVGRIFATSNENLAIGIIRMLATSGDEAFEKGSVLMNFTHNNVS
FT                   ETVKILNEILPVNRSTAYEILTKKYGLSDKEAELVLNATHPEHPNPDYLITYNRMTDIA
FT                   PVWSMFGFWNFSLPPNTPDKKREKGAFFKGTSYYLGNGTILTNVNVYGYSYVTLINNTN
FT                   ISTYIVQKINGQTKIIGTFKIHKLYIKTPSGVREIVLNKDGQLSEFIRLNANGEGYAWL
FT                   STRNLEDSIYARLHFLDGYGLKHIKLVKATIDPTDFGVQPGFKIYKVDYGTDYLK"
FT   sig_peptide     521094..521204
FT                   /locus_tag="MFS40622_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.815 at
FT                   residue 37"
FT   gene            523940..525076
FT                   /locus_tag="MFS40622_0539"
FT   CDS_pept        523940..525076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0539"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   mja:MJ1387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69230"
FT                   /db_xref="GOA:D3S870"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D3S870"
FT                   /inference="protein motif:PFAM:PF01969"
FT                   /protein_id="ADC69230.1"
FT                   /translation="MFLLDPFSGISGDMFLSAMIDFVDKQELITTIKKVIDVDIEVKKV
FT                   KKCHILANKVNIIPKDIDYNADTYKDIKNIIKNSDIQRDIKTTALDILKILANAESRVH
FT                   DISIEDVHFHEVGNYDTIADIVGAAYIINKLKLKDNCLYRPINVGSGFVETEHGLLPVP
FT                   APATAEILKGLKIFFSDIKEELTTPTGAAIIKYINPKLVEGSFIIKNISYGAGDKDLEL
FT                   PNVLRVFRIEYIKMEKIVLLETNVDDIPAEILGYLYEVLEGKVRDLHFIPTYMKKNRPA
FT                   YTVRAIVDRDKANEVAKIIMRETGSLGVRIFDIERITADRDFKTIKLFDEYVKIKIGKI
FT                   DDEIISEKPEFEDLKKIAKKYGIPLKDLYKITFSKQIR"
FT   gene            complement(525051..525413)
FT                   /locus_tag="MFS40622_0540"
FT   CDS_pept        complement(525051..525413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0540"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mvu:Metvu_0177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69231"
FT                   /db_xref="GOA:D3S871"
FT                   /db_xref="UniProtKB/TrEMBL:D3S871"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69231.1"
FT                   /translation="MAELSAVNYVEVKKIRGKVFVGFTLLGIGIGMIFNETGAGCLIGL
FT                   GIGFIISSFIKYKDEKTDENSNKSTSFQFWPIILGLFFIFLGVAIILNYEIIWEYIFPI
FT                   FLILLGLSFILSALKK"
FT   gene            525531..526067
FT                   /locus_tag="MFS40622_0541"
FT   CDS_pept        525531..526067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0541"
FT                   /product="protein of unknown function DUF127"
FT                   /note="PFAM: protein of unknown function DUF127; KEGG:
FT                   mja:MJ1385 tRNA 2'-O-methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69232"
FT                   /db_xref="GOA:D3S872"
FT                   /db_xref="InterPro:IPR002845"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3S872"
FT                   /inference="protein motif:PFAM:PF01994"
FT                   /protein_id="ADC69232.1"
FT                   /translation="MVVEVLRLGHRGDRDKRISTHVALTARALGADRVIFTTEDEHVEN
FT                   SVKKVVESWGGNFEFVVEKHWKKYIREFKKRGIVVHLTMYGANINEIMPEIKELSKDKD
FT                   ILVVVGAEKVPKEVYELADYNISVGNQPHSEVAALAIFLDRLFEGKTLYRDFENAKIKI
FT                   VPSNHGKVVIRENQK"
FT   gene            526096..526680
FT                   /locus_tag="MFS40622_0542"
FT   CDS_pept        526096..526680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0542"
FT                   /product="SagB-type dehydrogenase domain protein"
FT                   /note="TIGRFAM: SagB-type dehydrogenase domain; PFAM:
FT                   nitroreductase; KEGG: mja:MJ1384 NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69233"
FT                   /db_xref="GOA:D3S873"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D3S873"
FT                   /inference="protein motif:TFAM:TIGR03605"
FT                   /protein_id="ADC69233.1"
FT                   /translation="MEIQLPEIEEIKLEDVLVKRRSVREYSSSPLTLRELSHILFAAYG
FT                   VTDERGFKTVPSAGATYPLEIYVNVRDVIGVEEGVYKYIPERHSIVRVLDEEVGHELAL
FT                   VALRQMFIAIAPIVLIIAANYERTTRIYGDRGFRYVHMEVGHVAQNVYLMATSLGLGTV
FT                   SVGAFYDDEVREILKIKEHPLLLMPVGRKID"
FT   gene            526698..527471
FT                   /locus_tag="MFS40622_0543"
FT   CDS_pept        526698..527471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0543"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   mja:MJ1383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69234"
FT                   /db_xref="GOA:D3S874"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012022"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3S874"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADC69234.1"
FT                   /translation="MIDTHIHSDTRGLEDLELMAMCLDAVITLAHDPFEMKSIKVWEAH
FT                   VEKLLINELERAKKVGLNLFICVGMHPRAIPPEVDEALDKIKSYINYDRVVVGIGEIGL
FT                   EKATKEEKEVFIKQLMLAEELNIPAVVHTPRRNKEEVTKIILDEISTLDLKNRDIVIEH
FT                   CNKETTKWVLDEELYVGLTVQPGKLTPLEAVEIVKEFKDFADKILLNSDCSSNASDVLA
FT                   VPRTVLKMKVNDIEKDVINKVAHQNAVELFGLDIE"
FT   gene            complement(527583..528515)
FT                   /locus_tag="MFS40622_0544"
FT   CDS_pept        complement(527583..528515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1941 transcriptional
FT                   antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69235"
FT                   /db_xref="InterPro:IPR007505"
FT                   /db_xref="UniProtKB/TrEMBL:D3S875"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69235.1"
FT                   /translation="MNYSTILNIMVFQSLYYIVLETELLKLVIDDKDLKEKLENLKIKA
FT                   IKLLDEYHLWEFFYEPPLNLANIQEKLVTQQNPYYNFIFSIYKEIVKIVFSKTVLENIE
FT                   EGLEYPLINFAYIYEAWAIWRIVHSLRANGFEIIENGILLGKNNKFKRKTKMIFILEKD
FT                   SKRVYVIWEMKFKPSTDSTYLGDLIRAFNISNVENIEIKPDIVILVENLENKDIEKVVV
FT                   GDVKFRVDENAKLPRLENIYKVLGYVLDLRRFEVFKNAKFEGLLIYPSTVETIKIPIID
FT                   PKSENAVVYITLVPLTSKQYDIDVNTLIN"
FT   gene            complement(528716..529093)
FT                   /locus_tag="MFS40622_0545"
FT   CDS_pept        complement(528716..529093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cff:CFF8240_0750 undecaprenyl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69236"
FT                   /db_xref="UniProtKB/TrEMBL:D3S876"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69236.1"
FT                   /translation="MQSKPLNKKYIWDDEELSLPINLLDYVKVNNQPLSEVTKSNKVYI
FT                   KGKNIIISFKNFFGDLKLEFPDKEEILKITPKKLFYNQEINPDEGYDIVKHRVLNDIRD
FT                   FITFIVKEIKISRRIRHLRLF"
FT   gene            complement(529234..530586)
FT                   /locus_tag="MFS40622_0546"
FT   CDS_pept        complement(529234..530586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0546"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: hmu:Hmuk_3015
FT                   ATPase associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69237"
FT                   /db_xref="GOA:D3S877"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S877"
FT                   /inference="protein motif:PFAM:PF07728"
FT                   /protein_id="ADC69237.1"
FT                   /translation="MKVWIVAAAGDEPTKHLERTIKNPVKLEEIINNLGNPVDESGKNI
FT                   AKDDLEKILLSINEKGEYYLWGAVPGKNNESNWTQMQKGDICLFYVKGKKFGYWAKVVY
FT                   KIRDKSLAEFLWGTDKKGNTWELMYFLDKPRVLELPLLDFNLEHCYKLNFIPQGLSPID
FT                   PEKVERIKIKYGSYEEFLKKYEPKNRTFKTYENKYLTFIERIYKKELEIALSEMNRGKN
FT                   ILFYGPPGSGKTVLSKILAERYSAQNNGNGYLLYTVHGGTDYFDLIARVIPQTDDSGRL
FT                   VYKKEPRYLINAIMEKKVLILDEINRTQIDTALGIFFTYLEREHRIQDAQTIVNIIEKE
FT                   TDLKVNSEEFIENLDFFRIIGTLNIYDKTFLFKLGDALRRRFRFIEITTTPEIIKWIEN
FT                   NFEEFLDIIGYDLSRVDIARELFAIFSEINSIKELGIGILKELLLFSMNFI"
FT   gene            complement(530929..532788)
FT                   /locus_tag="MFS40622_0547"
FT   CDS_pept        complement(530929..532788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0547"
FT                   /product="MGS domain protein"
FT                   /note="PFAM: MGS domain protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; Carbamoyl-phosphate
FT                   synthetase large chain oligomerisation; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; KEGG: mja:MJ1381
FT                   carbamoyl-phosphate synthase, large subunit (carB2)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69238"
FT                   /db_xref="GOA:D3S878"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D3S878"
FT                   /inference="protein motif:PFAM:PF02142"
FT                   /protein_id="ADC69238.1"
FT                   /translation="MENMEKLKEILLKAKKMGFSDKQIAHLLGMDEMEVRELRKKLNII
FT                   PLYKMVDTCAAEFEAKTPYYYSAYETYVYKEQDESNPSDRKKVIIIGSGPIRIGQGIEF
FT                   DYSSVHAVLALKEMGIEAIIINNNPETVSTDYDTSDKLYFEPITFEDVLNIAEREKEKG
FT                   ELLGVIVQFGGQTAINLAMKLKKAGVNILGTTPENINVAEDREEFSKLLKKLNIPQAEG
FT                   GTAFTKEEALEIAKRIGYPVLVRPSYVLGGRAMQIVYSEDELIEYMEEAVRVSEEHPVL
FT                   IDKFLEDAVELDVDAVCDGESVLIGAIMEHIEEAGVHSGDSATVIPPQTLPKEIIDTVI
FT                   DYTAKLARALNIVGLLNVQYAVKDGVVYVLEANPRASRTVPYVSKSVGIPLAKLATKIM
FT                   LGKKLEELIKNYDVEKVAEKVWIAKPKYVSIKEAVFPFQKLPGVDPVLGPEMKSTGEAI
FT                   GIDKDFGRAYYKAQLSANMELPIIGNVFISVRDRDKKQVVEVAKKLHELGFTIYATEGT
FT                   AKVLRDNGIPAILVKKISESPNDNILKLMRDGKIHLIINTSSGKKAKSDGYYIRRAAVD
FT                   LGIPYITTIPGAKAAVKAIEAVKTGELNVYSLDELDASIKNRF"
FT   gene            complement(532836..532997)
FT                   /locus_tag="MFS40622_0548"
FT   CDS_pept        complement(532836..532997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0548"
FT                   /product="UbiA prenyltransferase"
FT                   /note="KEGG: cce:Ccel_1113 UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69239"
FT                   /db_xref="GOA:D3S879"
FT                   /db_xref="UniProtKB/TrEMBL:D3S879"
FT                   /inference="similar to AA sequence:KEGG:Ccel_1113"
FT                   /protein_id="ADC69239.1"
FT                   /translation="MKKETKIRLIIIMNLILVALTLFALITGRLLVTLVGVVCIINGLL
FT                   ALKRAKEE"
FT   sig_peptide     complement(532923..532997)
FT                   /locus_tag="MFS40622_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.739 at
FT                   residue 25"
FT   gene            complement(533015..533227)
FT                   /locus_tag="MFS40622_0549"
FT   CDS_pept        complement(533015..533227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0549"
FT                   /product="Protein of unknown function DUF2283"
FT                   /note="PFAM: Protein of unknown function DUF2283; KEGG:
FT                   mvu:Metvu_1348 protein of unknown function DUF2283"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69240"
FT                   /db_xref="InterPro:IPR019270"
FT                   /db_xref="UniProtKB/TrEMBL:D3S880"
FT                   /inference="protein motif:PFAM:PF10049"
FT                   /protein_id="ADC69240.1"
FT                   /translation="MKIRYDPKSDILYILIKEGDVSDTDEIDEDVWIEYDKDGNIIGIE
FT                   LWNAGEKVIGNILKEIKNLDKAKIA"
FT   gene            complement(533224..533511)
FT                   /locus_tag="MFS40622_0550"
FT   CDS_pept        complement(533224..533511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tsi:TSIB_1934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69241"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:D3S881"
FT                   /inference="similar to AA sequence:KEGG:TSIB_1934"
FT                   /protein_id="ADC69241.1"
FT                   /translation="MEIYLTEHAKLRLKERNIELNEVVNIIKNPKMKFYDIRNRHLIAI
FT                   GEREKKEGHYLIIAYDRVREGVEVVTVIDTSKSLEKIVSNRVNNARWIRL"
FT   gene            complement(533532..535007)
FT                   /locus_tag="MFS40622_0551"
FT   CDS_pept        complement(533532..535007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0551"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding
FT                   protein"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; KEGG: mja:MJ1378 carbamoyl-phosphate
FT                   synthase, medium subunit (carB1)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69242"
FT                   /db_xref="GOA:D3S882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="UniProtKB/TrEMBL:D3S882"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ADC69242.1"
FT                   /translation="METIEKVMVFGSGPIVIGQAAEFDFSGSQACKALKEEGIYTILVN
FT                   SNPATIQTDTDMADKVYLEPLHPTIVEKIIEKERPDAILPTMGGQTGLNLALELHRRGI
FT                   LDKYGIKLLGSNIKTIEIAEDRELFAEAMAEINEPVTKCKAVNSVDEAIEFAEEIGYPV
FT                   IVRPAFTLGGTGGGIAHNKEELMDIASKGLKYSIIHQVLIDESVLGWKEFELEVMRDRK
FT                   DTCIIVCGMENIDPMGIHTGESIVVSPIQTLPDEFYQKLRNAAIKIIRHLGIEGGCNIQ
FT                   FAVNKEMTEYRVIEVNPRVSRSSALASKATGYPIARIAAKIAIGKTLDEILNDVTKETP
FT                   ASFEPTLDYVVVKIPRWPFDKFKTVDKRLGTSMKSTGEVMAIGRSFEEALQKAIRSLDI
FT                   GRFGLIGDGKDKDYSDEEIEEILKNPTDERIFVIAKALEKGWSVEKIVELTDIDEFFIK
FT                   KIKNIVDMKKELEKLKEDEELDIYKLSIKAEKL"
FT   gene            535177..536850
FT                   /locus_tag="MFS40622_0552"
FT   CDS_pept        535177..536850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0552"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="KEGG: mja:MJ1377 glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: Glutamyl/glutaminyl-tRNA
FT                   synthetase, class Ic, catalytic domain;
FT                   Glutamyl/glutaminyl-tRNA synthetase, class Ic, anti-codon
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69243"
FT                   /db_xref="GOA:D3S883"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/TrEMBL:D3S883"
FT                   /inference="protein motif:TFAM:TIGR00463"
FT                   /protein_id="ADC69243.1"
FT                   /translation="MNGENMEEKILAIALRNAIKYNGKANPKAVLGIFLSENPEYRSKA
FT                   KEILPIVEKVVEDVNKLPLDEIKKKLEELGEDAKKKEKKERDLELPNVKDKVVMRFAPN
FT                   PSGPLHIGHARAAVLNDYFVKKYGGKLILRLEDTDPKRVLPEAYDMIKEDLDWLGVKVD
FT                   EVVIQSDRIELYYEYGRKLIEMGKAYVCDCNPEEFRELRNKGIPCKCRERAVEDNLELW
FT                   EKMLNGELENVAVRLKTDIKHKNPSIRDFPIFRIEKTPHPRTGDKYCVYPLMNFSVPVD
FT                   DYLLGMTHVLRGKDHIVNTEKQAYIYKYFGWEMPEFIHYGILKIEDIVLSTSAMYKGIK
FT                   EGLYSGWDDVRLGTLRALRRRGIKPEAIYEIMKRIGIKQADVKFSWENLYAINKELIDK
FT                   DARRFFFVWNPKKLVIEGADKKVLKLRMHPDRPEFGERELIFDGEVYVVGDELEENKMY
FT                   RLMELFNIVVEKVDDIALAKYHSDDFKIARKNKAKIIHWIPVKDSVKVKVLMPNGEIKE
FT                   GFAEKDFKMVEVDDIIQFERFGFVRIDKKDDEIVCCYAHR"
FT   gene            complement(536860..537600)
FT                   /locus_tag="MFS40622_0553"
FT   CDS_pept        complement(536860..537600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0553"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /note="TIGRFAM: ribosomal RNA large subunit
FT                   methyltransferase J; PFAM: ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ; KEGG: mja:MJ1376 cell division protein FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69244"
FT                   /db_xref="GOA:D3S884"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3S884"
FT                   /inference="protein motif:TFAM:TIGR00438"
FT                   /protein_id="ADC69244.1"
FT                   /translation="MGRKDKRWILQRKKDFYYKLAKKLKYRSRASFKLMQLNEKFNVIK
FT                   PGKIVLDLGCAPGGWMQVAREIVGDKGFIIGIDLQPVKPFEYDNVVAIKGDFTLEESLN
FT                   KIRELIPNEEKKVDVVISDASPNISGYWDIDHARSIDLVTTALQIATEMLKERGNFVAK
FT                   VFYGDMIDDYVNLVKKYFEKVYITKPQASRKESAEVYVIAKRYTGKKWEEEDKIKRVKK
FT                   VEDEENGELLAKKIKEMRKLKSKK"
FT   gene            537687..538931
FT                   /locus_tag="MFS40622_0554"
FT   CDS_pept        537687..538931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0554"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; multi
FT                   antimicrobial extrusion protein MatE; KEGG: mja:MJ1375
FT                   SpoVB isolog"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69245"
FT                   /db_xref="GOA:D3S885"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3S885"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ADC69245.1"
FT                   /translation="MSLGKDSIYILLSNIYSKGMAYLFYFITAFLLGTEAFGILKGLMP
FT                   IVDTLTIFFSSGIPPAIAKFLAEEKEANINKYIPILYLMILFSIFGFILTPYVKYILGG
FT                   HYLNLDNSLYLAIGFCVVASTLIAFSRGILQGLLKIKYLSLTWIVEYTVKVILVFILTL
FT                   YFGIFGSLLSISLSYLIAGIFGVYLIYKALKGKFDFKKLIDIKDITKNIFSNFNLDILK
FT                   YSVPIALTSSSYRLFGDIDNIVIMSIMGGFWSGIYGYSSLISRGIFMFASAVSIPLLPR
FT                   ISKTKDLSLLKEGIIQNTIFSSIFVLGCLFFPEIPLIAFFKIANPEGILCLRILAISSL
FT                   FMSYYTLISSALQGLGYAKISFYIILFGLVLNIVLNLILVNAYGIVGGSLATLITSITV
FT                   FLIGVFAILRIKKHK"
FT   gene            complement(538932..539732)
FT                   /locus_tag="MFS40622_0555"
FT   CDS_pept        complement(538932..539732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69246"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3S886"
FT                   /inference="similar to AA sequence:KEGG:MJ1374"
FT                   /protein_id="ADC69246.1"
FT                   /translation="MRVEIIFLGCGGGRWATITQKKATGGFRIHTNELRMHVDPGPGAI
FT                   VRLNELKISPWRTNALFISHCHPDHYTDGEIIVEAITQGMTKKRGVFLGSLSVVEGFGE
FT                   YEHVVSKYHQSKLEKVQVLYPKDEVELYDTTLKATHTKHGDPFGIGFRLSTIYGDIGYT
FT                   SDTELIPELIEDFDGVRILIANIVRKKNERIKGHLCSNDAIDLINSMSKKPELLIMNHM
FT                   GVKMTNPQIEAEYISQNTGIEVIPAKLGLKVELLNGKYKYQLIK"
FT   gene            complement(539800..540312)
FT                   /locus_tag="MFS40622_0556"
FT   CDS_pept        complement(539800..540312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69247"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:D3S887"
FT                   /inference="similar to AA sequence:KEGG:MJ1373"
FT                   /protein_id="ADC69247.1"
FT                   /translation="MKKNMIILFLFMVIFCSITLCGCVSFEKNISEKNKTEHSNTKNNL
FT                   YANLNTSKNQSIQNTNNNTNNKPNNKTNLSKTLNYEIIAYGAFGEKNRGYYYYYEGNKT
FT                   VIVINLGEMPTAGYKIEIVNITEANHGITVYYKVIPPKEFATMVITYPYIKLSVNGTYK
FT                   VECKEVK"
FT   sig_peptide     complement(540244..540312)
FT                   /locus_tag="MFS40622_0556"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.387 at
FT                   residue 23"
FT   gene            complement(540309..541142)
FT                   /locus_tag="MFS40622_0557"
FT   CDS_pept        complement(540309..541142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0557"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: mja:MJ1372 hypothetical protein; TIGRFAM:
FT                   undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69248"
FT                   /db_xref="GOA:D3S888"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D3S888"
FT                   /inference="protein motif:TFAM:TIGR00055"
FT                   /protein_id="ADC69248.1"
FT                   /translation="MDNIKNKLKSIGKRAIIDFYRFLDNSGALKIYEKILEESIDKNNL
FT                   PKHVAIIMDGNRRAAEIYGRDRYYGHYLGAEKVRDVLRWARDLGIKVVTLYAFSTENFK
FT                   RPREEVDKLMELFEKKFYEIADDEEIHEYEVRVRAIGRIHLLPKNVQKAIKYAEERTKN
FT                   YNKFFVNVAIAYGGQQEIIDAVKKIAEKVKRGEIKPEDIDKELIDKHLYTADLPFPNPD
FT                   LIIRTSGEERISNFLIWQSSYSELYFCDIYWPLFRRVDFLRAVREYQRRQRRFGK"
FT   gene            complement(541449..542195)
FT                   /locus_tag="MFS40622_0558"
FT   CDS_pept        complement(541449..542195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0558"
FT                   /product="methanogen marker protein 4"
FT                   /note="TIGRFAM: methanogen marker protein 4; KEGG:
FT                   mja:MJ1371 methlytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69249"
FT                   /db_xref="GOA:D3S889"
FT                   /db_xref="InterPro:IPR016764"
FT                   /db_xref="UniProtKB/TrEMBL:D3S889"
FT                   /inference="protein motif:TFAM:TIGR03270"
FT                   /protein_id="ADC69249.1"
FT                   /translation="MYAIGIGDNKKEVLKAYEKLKEEGVEVELIDNPKLLVDKLINGEI
FT                   EGAVRGSLSSSKVILYLRERIGKFYRASVLKNPFTNEIFLLSPVGIDDISEDKNERIKD
FT                   KIRIIEFASKFLKNHNIEPKVAVLSGGRLGDLGRNKVVDETIYEAEEIVKHFKGNLDII
FT                   HNGILIEEYLKDGYNIIIAIDGITGNIIFRCLGLVCKIPGYGAVILSDKDINFIDTSRN
FT                   ANWERYYNAVKFLSAHKDKAPYCILK"
FT   gene            complement(542201..543187)
FT                   /locus_tag="MFS40622_0559"
FT   CDS_pept        complement(542201..543187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0559"
FT                   /product="methanogenesis marker protein 12"
FT                   /note="TIGRFAM: methanogenesis marker protein 12; KEGG:
FT                   mja:MJ1370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69250"
FT                   /db_xref="InterPro:IPR016735"
FT                   /db_xref="UniProtKB/TrEMBL:D3S890"
FT                   /inference="protein motif:TFAM:TIGR03281"
FT                   /protein_id="ADC69250.1"
FT                   /translation="MITVGIDHGTSGITTCIKDNDKKIIFKLKRTELKEKSYLEELKKH
FT                   IPLENIDLVALTYSMGDGINKILPIEKVKNRGVLSIEGAGEKVGGGTKVYDEIKESGLP
FT                   AIVIPGLHRGIECLDERFRALYSHIASPEKVSIAYYAHKLFGFNDFVLSDISSNTVTLL
FT                   IKNGKIFGGFDACIGAIGMLHGPIDLEMIRDIDAGKITANEAFSKAGAVKIAKLYKGVE
FT                   NTKEEIINNYFNDENCRLAVDSLILSVSMEINSLLPLLNKNKRRVVLAGSIGTLRDPID
FT                   IPKRIKEFVDAKIFALYGESGAIGGALIAEDILKGKRDILGIEVEFK"
FT   gene            543269..544027
FT                   /locus_tag="MFS40622_0560"
FT   CDS_pept        543269..544027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0560"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mja:MJ1368 sulfate
FT                   transport system permease protein (CysT)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69251"
FT                   /db_xref="GOA:D3S891"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3S891"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADC69251.1"
FT                   /translation="MEKFDIAMSVFLVMIFLFIFLPIVYMLSNPGDLSQLLDKEVIEAF
FT                   KTTLLAGAVATLIALIFGIPTGYILARYDFKFKSFIEAVLDLPMAIPHSVIGIIILSFI
FT                   YGIDIIKFIGRYIVDNFWGIVVVYLFVGIPFMVNSIRDGFLSVDEEIEYVSRTLGASKI
FT                   RTFFEISLPLIKNNIISGIILSFARGISEVGAILIIAYYPKTVPVLILERFMSFGLDAS
FT                   KPISVGMILVSIALFALLRMFGKMKRDSNT"
FT   gene            544241..545134
FT                   /locus_tag="MFS40622_0561"
FT   CDS_pept        544241..545134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0561"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ1367 sulfate transport ATP-binding protein
FT                   (CysA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69252"
FT                   /db_xref="GOA:D3S892"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S892"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC69252.1"
FT                   /translation="MLKVENLSKIWKDFKLKNVSFEIDREYCVILGPSGAGKSVLIKCI
FT                   AGILKPDSGKIILNGDNITNLPPEKRNVGYVPQNYALFPNKNVYKNIAYGLIIKKVNKI
FT                   EIDRKVKEIAEFLNISHLLDRNVKTLSGGEQQRVALARALILNPSILLLDEPTSAVDIK
FT                   IKENIISELKKIKHIPVLHITHDLAEARTLGEKVGIFMNGELIAFGNRDVLKKPKNKKV
FT                   AEFLGFNIINDKAIAPEDVIIKDGNEGEVVNIIDYGKYKKVFVKYNGYIIKAFTERDLN
FT                   IGDNVGLEFREETKLS"
FT   gene            545150..546004
FT                   /locus_tag="MFS40622_0562"
FT   CDS_pept        545150..546004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0562"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: mfe:Mefer_1352 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69253"
FT                   /db_xref="GOA:D3S893"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037514"
FT                   /db_xref="UniProtKB/TrEMBL:D3S893"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADC69253.1"
FT                   /translation="MIIVSGSQSQNLAFKVAKLLNTKLTRVEYKRFPDNEIYVRVVDEI
FT                   NDDEAVIINTQKNQNDAIVETVLLCDALRDEGVKKITLVAPYLAYARQDKKFNPGEAIS
FT                   IRALAKIYSNIVDKLITINPHETHIKDFFTIPFIYGDAIPKLAEYVKDKLENPIVLAPD
FT                   KGALEFAKTASKILNAEYDYLEKTRLSPTEIQIAPKTLDANGRDVLIVDDIISTGGTMA
FT                   TAVKLLKEQGAKRIIAACVHPVLIGDALNKLYSAGVEEVVGTDTYLSEVSKVSVAEIIV
FT                   DLL"
FT   gene            complement(546005..547186)
FT                   /locus_tag="MFS40622_0563"
FT   CDS_pept        complement(546005..547186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0563"
FT                   /product="TraB family protein"
FT                   /note="TIGRFAM: TraB family protein; PFAM: TraB determinant
FT                   protein; KEGG: mja:MJ1365 pheromone shutdown protein
FT                   (TraB)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69254"
FT                   /db_xref="GOA:D3S894"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:D3S894"
FT                   /inference="protein motif:TFAM:TIGR00261"
FT                   /protein_id="ADC69254.1"
FT                   /translation="MKHVKIFNGINECDIYLIGTAHVSKDSIEEVENIISSVSPEGVAV
FT                   ELDDRRFFSLISNEEKKVDLKKVLKEGNFLKFFIYLILANSQKKIGESLGIKPGSEMKK
FT                   AIEIASRYGLPIYLIDRDINITLSRLMDRMTFKEKIKIFWELLNSDEGDLEVDDDLLKE
FT                   MVENPEKFIKLLKEMSPTIYEVLVDERDRFMAKRLFELSKGKNSLVAVVGAGHVEGIVR
FT                   YLKQLENGKDIDLMELIKVKKRKKSLTKLLTYGISLAIIAIFLYIVYYALNNPELLKMI
FT                   TFQWIIFTGGLSALGVILARGKLITALIAFLSAPITTLVPLPLAAVGTIAGLVELKYRE
FT                   ITDKDLVGIINAESIKELLNNNLFRVLLVATLSNIGASIGVFYCLGKFIGFLG"
FT   gene            complement(547275..548465)
FT                   /locus_tag="MFS40622_0564"
FT   CDS_pept        complement(547275..548465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0564"
FT                   /product="tRNA pseudouridine synthase D TruD"
FT                   /note="PFAM: tRNA pseudouridine synthase D TruD; KEGG:
FT                   mja:MJ1364 tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69255"
FT                   /db_xref="GOA:D3S895"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D3S895"
FT                   /inference="protein motif:PFAM:PF01142"
FT                   /protein_id="ADC69255.1"
FT                   /translation="MKLRMKPEDFIVEEIIDFDKISGNKCYLYKLTKRNIESLKAFSYI
FT                   SKKFKIPLRDIGYCGLKDRHALTTQYISIPKKYGKLSLDEPNLKLELVGESKFLLLGDL
FT                   EGNRFTITVRGIKKDDIPKIKENLKYLEFGAPNYFDSQRFGSVFDKKFIAKEVIKGNYE
FT                   EAVKILLTKYKKSEKKIIKDLKRFISKNWGDWDKVWNYIKENNIKAKLYVNMVKELKKS
FT                   NDYKKALSYVDDRLKKIFVAAYQSYLWNECVKELLKKYIPEEDRVYYEYECGTLMFYKK
FT                   MDREVFNLLKDKKFPTIAPDIEYSGEEKEIIEEILKREGITMEDLNNIGGLGRFIYNER
FT                   KILSVPKNLKIGEFEEDELNKGKYKITLSYELEKGSYATIIIKRAFLGVKTKKRKR"
FT   gene            complement(548584..548659)
FT                   /locus_tag="MFS40622_R0006"
FT                   /note="tRNA-Val3"
FT   tRNA            complement(548584..548659)
FT                   /locus_tag="MFS40622_R0006"
FT                   /product="tRNA-Val"
FT   gene            548759..548846
FT                   /locus_tag="MFS40622_R0007"
FT                   /note="tRNA-Ser1"
FT   tRNA            548759..548846
FT                   /locus_tag="MFS40622_R0007"
FT                   /product="tRNA-Ser"
FT   gene            549207..550181
FT                   /locus_tag="MFS40622_0565"
FT   CDS_pept        549207..550181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0565"
FT                   /product="Protein of unknown function DUF553"
FT                   /note="PFAM: Protein of unknown function DUF553; KEGG:
FT                   mmz:MmarC7_0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69256"
FT                   /db_xref="GOA:D3S896"
FT                   /db_xref="InterPro:IPR007562"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3S896"
FT                   /inference="protein motif:PFAM:PF04473"
FT                   /protein_id="ADC69256.1"
FT                   /translation="MGLKKYFIIAIVAVAAYHFIGNSSVFQLDSLGNEMYSKLNEDEII
FT                   NLQSWAYHFQGKDMYETIWNIIFWQEDNIGYDYKKMFSHNPYIQSPTETYMKKSGTCID
FT                   YALLTACLLLGLHKDAYVFVIDSHNPYSGGHAFCAVKIGDKYFAIDQHAPITDVDSHIK
FT                   EFLKEHPDLNPNSIRVYHFYIPVDEVYDVKAEMFRWQYNPTNKILSPEEKKVIENAIID
FT                   YFTKKYRLKPDQRINNMESMKYLPYGFHEGIYVYQPYECNLYPEFGEQYGRWLDRRLSG
FT                   HLTLTEKLEGKKYKPIDFKKYRYIWIKVDDKGGYGRIYIYLAK"
FT   gene            complement(550432..551433)
FT                   /locus_tag="MFS40622_0566"
FT   CDS_pept        complement(550432..551433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0566"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein ; TrkA-C domain protein; KEGG: mja:MJ0138.1
FT                   potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69257"
FT                   /db_xref="GOA:D3S897"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3S897"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADC69257.1"
FT                   /translation="METIKKIELGVIVIILLILIEAIILMTVEGWDFFTAFYTAVVTIS
FT                   TVGYGDYTPKTFIGKLSVIIYIFAGVGAVAYTMGNIASFFIEGHFKKYFRLRKMMDKIK
FT                   KLNNHYIICGYGRLGKVIAEEFKKSNIPFVIIDSDEKILEEAIEKDPNLVCIVGDATSD
FT                   DILKKAKIEKAKGLISVVSSDAENVFITLSAKKLNPNIYIVAKAEKPSTLDKLIKAGAD
FT                   RAVCPYIVGGMEIARIAINPDIVEFIHSLVATEEDMEVRRYIVKNKELDNKLLKDSGIR
FT                   EKTGATILAIKKGDKTITSPPPDTVINIGDTIYAFGTKEQLEKLKRYVEGII"
FT   gene            complement(551434..552063)
FT                   /locus_tag="MFS40622_0567"
FT   CDS_pept        complement(551434..552063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0567"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein; KEGG:
FT                   mja:MJ0139 potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69258"
FT                   /db_xref="GOA:D3S898"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:D3S898"
FT                   /inference="protein motif:PFAM:PF07885"
FT                   /protein_id="ADC69258.1"
FT                   /translation="MNLKDRKLKKIIEILSLIFTFEIVISFILSTYNPPYQDLLIRLDY
FT                   ISIMFFTFEFIYNFYYVEDKVRFFKDIYNIVDAIVVIAFLLYSLQIFYSKAFLGLRIIN
FT                   LIRILVLLRIIKLRKLEENQALINFLTLLTICFIASCLIWIAESDVNPSINNFFDAFYF
FT                   TTISITTVGYGDITPKTDAGKLIIIFSVLFFISGLLTSLQKALKGD"
FT   gene            552102..553541
FT                   /locus_tag="MFS40622_0568"
FT   CDS_pept        552102..553541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0568"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG: mja:MJ0138
FT                   cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69259"
FT                   /db_xref="GOA:D3S899"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D3S899"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ADC69259.1"
FT                   /translation="MEIGILDIKGSLPLFEDFGNLPTKIIDEKNYKEIKDLDVLIIPGG
FT                   SLVESKSLNEGIKNEILNFAGYIIGICSGFQILSKKIDIGRKSSVPIIREGLGLLDVEF
FT                   YPLVCTDRVEFKLKKSIFGEGRGEGFHCHTYGDIRIVDKETKILTVSKVKKLNYKLGKE
FT                   QEIISGAFKDKVFGTMVHNFLDNEFVRDNFLKHLGVAEDEKEEIFEKNKIIKDELKKRA
FT                   LKYRLNPELIENNKKDKNKKRGIILLATSSNSGKTFLTTAISAKLKGRVFVTKIGGDVR
FT                   DIVPALYLLREKMTKYNSIKIGERGWVDVKEFLEYIKKADYDYIIVEGVMGAFTASLKN
FT                   ISSYQIAKKLGFPVYIVSPCNISGIEGAFVEAMAYYSLLKDIGIKVEGIILNKVYSWEG
FT                   FNKLKSLAEKYNIKLYGVGKVANESRGLIPEVEIDYESFCKNAFNVNLEIEIPEIEINN
FT                   NINDEDDNFLDRVDNWIKKII"
FT   gene            553554..554399
FT                   /locus_tag="MFS40622_0569"
FT   CDS_pept        553554..554399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0569"
FT                   /product="protein of unknown function DUF114"
FT                   /note="PFAM: protein of unknown function DUF114; KEGG:
FT                   mja:MJ0137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69260"
FT                   /db_xref="GOA:D3S8A0"
FT                   /db_xref="InterPro:IPR002825"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A0"
FT                   /inference="protein motif:PFAM:PF01972"
FT                   /protein_id="ADC69260.1"
FT                   /translation="MDIFSGFIGSLIWWLLFFYLIMAPQIQYKQLQLARLKILKELSSK
FT                   RNSTVITMIHRQESIGLFGIPVYKFITIEDSEEILRAIRTAPKDKPIDLIIHTPGGLVL
FT                   AATQIAKALKAHPAETRVIVPHYAMSGGTLIALAADKIIMDENAVLGPVDPQLGQYPAP
FT                   SIVKAVEQKGVDKVDDQTLILADIAKKAINQVQNFVYSLLKDKYGEEKAKELSKTLTEG
FT                   RWTHDYPITVEEAKKLGLDVDTNVPEEVYMLMELYKQPVRQRGTVEFMPYPVKQENSNK
FT                   "
FT   repeat_region   554503..554947
FT                   /rpt_unit_range=554504..554535
FT                   /note="CRISPRS"
FT   gene            555463..556311
FT                   /locus_tag="MFS40622_0570"
FT   CDS_pept        555463..556311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0570"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: mja:MJ1682 heat
FT                   shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69261"
FT                   /db_xref="GOA:D3S8A1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A1"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADC69261.1"
FT                   /translation="MINQIKTYLLMALLVGLIYTFCIMLHIHPLIAIIFALIPNVIAYY
FT                   FSDKLVLMSYNARILDEHEMPWLHQMVERVARKAGLPKPKVAIVPTMTPNAFATGRNPE
FT                   NAVVAVTEGILQLLSPEELEGVIGHEISHIKHRDILISTIVATLAGAIIYVAEWLKWGL
FT                   FFGYNEDEENPLELIGTILLLILAPIAATLIQFAISRQREFYADEEGAKLTHPLWLANA
FT                   LAKLERGVELYPLERGNPATAHMFIVNPFKEDFVMKLFSTHPPTEERIERLLEMCKRMG
FT                   R"
FT   gene            556324..557466
FT                   /locus_tag="MFS40622_0571"
FT   CDS_pept        556324..557466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0571"
FT                   /product="methanogenesis marker 16 metalloprotein"
FT                   /note="TIGRFAM: methanogenesis marker 16 metalloprotein;
FT                   PFAM: protein of unknown function DUF39; KEGG: mja:MJ1681
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69262"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR017677"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A2"
FT                   /inference="protein motif:TFAM:TIGR03287"
FT                   /protein_id="ADC69262.1"
FT                   /translation="MEKELKVITIDELKKYIRNNEEDKIDEVDVVTSATCGIMSGTAGI
FT                   FHIPFNNIFRRAEEIYLDDIKGVVGICPNEFLGKVDAIFYGEVGFLFKDLVKGKVVEAK
FT                   AVSEGKIYKNEITIDDLPTAKMIGTRLAFKNYSAITNLSDREVKTIFHRLPLKNGEASF
FT                   SGCGMFNPLENMVIKDEKDVVGKKALLNGAEAIILGFGTRSSIEKPNLMMSADMKDMNA
FT                   YYLGGFITSNGVEIYNTIAVPINVKEHKEALKKLDKDIALPLVNIFGREIIDIGNYAEV
FT                   WENVDLRPKIYLDRCKNCRECLAEKYCPTLAIKREGGKIKITEDCFGCGICNICPHGVF
FT                   ETKLGSICGIPITCRQSDRKRALKLAKELKKRIEKGEFKI"
FT   gene            557725..557946
FT                   /locus_tag="MFS40622_0572"
FT   CDS_pept        557725..557946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mfe:Mefer_0004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69263"
FT                   /db_xref="GOA:D3S8A3"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A3"
FT                   /inference="similar to AA sequence:KEGG:Mefer_0004"
FT                   /protein_id="ADC69263.1"
FT                   /translation="MDEKKQLIFNAIFDIYKIFLGAGLTLLVAVIVKVAFSEGSFATGL
FT                   TLCLIDILAMFYLSWIFGSILYDIYKEL"
FT   gene            complement(557947..558069)
FT                   /locus_tag="MFS40622_0573"
FT   CDS_pept        complement(557947..558069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69264"
FT                   /db_xref="GOA:D3S8A4"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC69264.1"
FT                   /translation="MQFDAFAILVLLVIGFMVVFSTLLAIWYWKFGRKLIHQKE"
FT   sig_peptide     complement(557992..558069)
FT                   /locus_tag="MFS40622_0573"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.716 at
FT                   residue 26"
FT   gene            complement(558178..559323)
FT                   /locus_tag="MFS40622_0574"
FT   CDS_pept        complement(558178..559323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0574"
FT                   /product="Sep-tRNA"
FT                   /note="TIGRFAM: Sep-tRNA; PFAM: Soluble liver antigen/liver
FT                   pancreas antigen; KEGG: mja:MJ1678 Sep-tRNA:Cys-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69265"
FT                   /db_xref="GOA:D3S8A5"
FT                   /db_xref="InterPro:IPR008829"
FT                   /db_xref="InterPro:IPR013375"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A5"
FT                   /inference="protein motif:TFAM:TIGR02539"
FT                   /protein_id="ADC69265.1"
FT                   /translation="MDINLDKYKNLTRTLTREFINLNPIQRGGILPKESKKAVYEYWDG
FT                   YSVCDYCHGRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICNEGDYV
FT                   VLDKNAHYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNLEDKGKNVGLILL
FT                   THVDGEYGNLNDAKKVGKIAKNKGIPFLLNCAYTVGRMPVDGKEVKADFIVASGHKSMA
FT                   ASAPCGILAFSEEFADKITKTSQRFPVKEVEMLGCTSRGLPIVTLMASFPHVVERVKRW
FT                   DEEIKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRKGFFFYDELKK
FT                   RGIGGIRAGVTKEIKMSVYGLEWEQVEYVVNAIKDIVESYK"
FT   gene            complement(559342..559959)
FT                   /locus_tag="MFS40622_0575"
FT   CDS_pept        complement(559342..559959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0575"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: mja:MJ1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69266"
FT                   /db_xref="GOA:D3S8A6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A6"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ADC69266.1"
FT                   /translation="MELQYFILAFTSIFSILNPFGAVPVFITLTESYPKKERDLVAKRT
FT                   VIYALAILLAFTLFGEWILKFFGISLDAFKIAGGILLLLISLDMVRGQQEAKIHRKEIE
FT                   AAYEIDEIALMPLATPLLAGPGSITACMVAMAEASDIGDRFLVILAILLSLGITYLTLL
FT                   SAEKVLDKIGRLGIRILTRMMGLILTAIAVQMIVNGIKGALL"
FT   gene            complement(559969..560685)
FT                   /locus_tag="MFS40622_0576"
FT   CDS_pept        complement(559969..560685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0576"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69267"
FT                   /db_xref="InterPro:IPR012021"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A7"
FT                   /inference="similar to AA sequence:KEGG:MJ1676"
FT                   /protein_id="ADC69267.1"
FT                   /translation="MKKYIISIGVDISDNDVKTNPKVNELVNREVKEKLSKLGIKSCIS
FT                   NITGDDIVITSFVPENLIEENNRIIFEILNKYAEGFDDLKGISKDKDKAGEGLSYAIAE
FT                   SASEYGDALIIAFDTYGGESFVDEMALFVKEIGEKFGYDVGCSVSNEPIKIPGIGYTGA
FT                   ESDDPVVVITVEELEDIPKLACLIYGGLLSFDKICFVKNGEEINIIPPGVIYTMSAFLN
FT                   GNVIDLYEGIRKRVKF"
FT   gene            complement(560834..561622)
FT                   /locus_tag="MFS40622_0577"
FT   CDS_pept        complement(560834..561622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0577"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: mja:MJ1675 tRNA pseudouridine synthase A;
FT                   TIGRFAM: tRNA pseudouridine synthase A; PFAM: Pseudouridine
FT                   synthase I, TruA, alpha/beta domain"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69268"
FT                   /db_xref="GOA:D3S8A8"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A8"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ADC69268.1"
FT                   /translation="MVITMHILKIAYDGRYSFQQQPHKQTVCDILLDTLEEIDFLAKKK
FT                   IIYSGGRTDKGVSALGNFVIVELKKEPILSYINAKLKDKGIWVLGYREIDEIPKVKYRH
FT                   YRYILPNINYNIDAIKEGAKKMIGTHSFHNLSKRDKSKEKSPIRTIYDIKISENEFYLT
FT                   IDIIGESFLWNMVRKIVGALDLVGRGKKPVDWIGKLLDENHREGVPTFPPDGLILVEAK
FT                   VDVDYIYDNYSIRKFKEYWEEFFKLQVMKLGIAKTVLEFI"
FT   gene            561708..563606
FT                   /locus_tag="MFS40622_0578"
FT   CDS_pept        561708..563606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0578"
FT                   /product="CRISPR-associated protein, TM1812 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, TM1812 family;
FT                   CRISPR-associated protein DxTHG motif; PFAM:
FT                   CRISPR-associated protein TM1812; KEGG: mja:MJ1674
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69269"
FT                   /db_xref="InterPro:IPR011742"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8A9"
FT                   /inference="protein motif:TFAM:TIGR02221"
FT                   /protein_id="ADC69269.1"
FT                   /translation="MLKVLISPLGVGDTKANVRERQYQMAKYKFGNEITEEPFILSILI
FT                   KKLKVDKVIVVGTAKSMWERLYEYYAKKVDEFDEEYWIEIGEKVGKSKYDNYELSESDL
FT                   KRVGEIIDKYLKKINPNAVGGSKCKIIKYGITEEEIWENFDLFMNLINEVNDGDEIYLD
FT                   ITHSFRSIPLFMYVMLEFMKYFKNVKLKGIFYGMFDVRWEFGGIVPVVDLSPIFEISEW
FT                   IRGMYEFTTYGNSYLISKLLEKEDKEIAEKLQKISRYIDANYLKELREEVKNLKPLLDD
FT                   KKDKGKFLKYFIPELYKFIERLKYEDSDFEFQISMAKWNFDNKKYSSGYLCLTDSIFWR
FT                   LCELYNLPPIHENRETMKGIIYNPCLNKYPAFGAIKDIHYRRLRNIRNKIAHADVSKKG
FT                   DEFNPENDLKDVIDLLKNIELPDFDKVIEELKLSVKNNPNEKTLKLLKNILNMQIIKKI
FT                   IKAYNFEDNEEYWNFVRNYLLNRNSRCNSEKLREIINIFHKNINSVDELEEAFDMLNNT
FT                   KDEELLDSLALQNAIMHYAKSKLSNAYNVEDKEDKEMFRWILLNKNLCSKNNILSEINA
FT                   NYFKIYSNRFKPISNEVINASKEIINLLNKDLSEISEDIPFDVIKREYNKFYNNRR"
FT   gene            563611..564000
FT                   /locus_tag="MFS40622_0579"
FT   CDS_pept        563611..564000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69270"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B0"
FT                   /inference="similar to AA sequence:KEGG:MJ1673"
FT                   /protein_id="ADC69270.1"
FT                   /translation="MPRMFLLFSHKLTEEQIKDAKESLKVDEFIYLPKELQELWSNIPP
FT                   DIEDIEDYIKPIKDFLKKYAKPKDYVLIQGDFGATYKMVNFAIDNDLIPIYSTTKRIVK
FT                   DIYKDRKIITIRKFEHCRFRKYEAY"
FT   gene            564037..566772
FT                   /locus_tag="MFS40622_0580"
FT   CDS_pept        564037..566772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0580"
FT                   /product="CRISPR-associated protein, Csm1 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csm1 family;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   mvu:Metvu_1147 CRISPR-associated protein, Csm1 family"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69271"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR013408"
FT                   /db_xref="InterPro:IPR041062"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B1"
FT                   /inference="protein motif:TFAM:TIGR02578"
FT                   /protein_id="ADC69271.1"
FT                   /translation="MKEYDEYTALKIGALLHDIGKFLQRTTNKEFNGNHQTVGANFVEK
FT                   NYEKFGIDKDIVKDVVDLIKEHHNKNKKTGLVGILRLADWLSSAERDEVEEGNNNIYKI
FT                   PKEEQRLLSIFELIRLNEKDRKNIEDKISQIYIKGGKYGLQPLAINNYTIFPYTSPNPD
FT                   YNTLYEKFSKELEETKIDNFKKLYQLIQKYFWCVPSATNWKKVRGYLPDISLYDHLKTT
FT                   CAIACCLYQIYKENASKNEKADAILTDDMLNELLDKLPIGEDGLYDESNPSWEKYTLFS
FT                   LIHGDISGIQKFIFKITSKYATKSLKGRSFYLDFLTEIVAKWICKELNLPITNILFYGG
FT                   GHFYILSYKIKDNVIDEFEKKINNLLYEMFRTDLYITIAKVDIKPYEFLSQEKSNFSKK
FT                   WKEVADETIQKKLRRFYYKFSEELFEPYGIGIEERCAICKNEITESEMHKLYDDEDGAK
FT                   ICKYCASFVELTEFLKDYYTNGKIDFNKTKIKRTDIVIEDRLRLKDIPAIASLIKGIKE
FT                   YEGLNINFNDDEYFLNTYNLPDKNGELKIPFKIWSIAFPLKEVEDENGKIRKEIKDFDT
FT                   LAKQAEERTGTNKIAILKMDVDNLGTIFTEGLGNRASLSRLSTLSSMLTLFFTGYIPYL
FT                   IKKETFKGTVEGKEVELNYKDNIYLVYSGGDDTLIVGAWDAIWNLAKKIRKEFKRFVCY
FT                   NPDITLSAGIVIINPKFEFKKAVNMAENELETGKEYVIYENEEKDEKIDKNALTIFNCP
FT                   MNWDLEVCYDKEVWEKWHKLKEINALPEIYENILLKSKIEQLVEKFNEEKLEEKFEKAI
FT                   KNTGKKRLLHISQFVAERLEKIVERNKNGEIVINLPYYWRTLYYLHRNYEKNFDYVKFL
FT                   EEYLKDKVMALIKSDEQKIKFSCNDLKVSAKIIELKNRKG"
FT   gene            566777..567175
FT                   /locus_tag="MFS40622_0581"
FT   CDS_pept        566777..567175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0581"
FT                   /product="CRISPR-associated protein, Csm2 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, Csm2 family;
FT                   PFAM: CRISPR-associated protein TM1810 domain protein;
FT                   KEGG: mja:MJ1670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69272"
FT                   /db_xref="InterPro:IPR010149"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B2"
FT                   /inference="protein motif:TFAM:TIGR01870"
FT                   /protein_id="ADC69272.1"
FT                   /translation="MSNIGKCILTDEKIDTILNINSENANEVIEIAEDLAKKLEEIPSS
FT                   KMRDFYDYVLRIDETGDWYKELVLLKPKLAYNFGKETNRRKKEALEKLAGTFSKIIDEI
FT                   NNDKDKFKNFKTFFEALVAYHKIHAKSQ"
FT   gene            567202..567939
FT                   /locus_tag="MFS40622_0582"
FT   CDS_pept        567202..567939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0582"
FT                   /product="CRISPR-associated RAMP protein, Csm3 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm3
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   mja:MJ1669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69273"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR013412"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B3"
FT                   /inference="protein motif:TFAM:TIGR02582"
FT                   /protein_id="ADC69273.1"
FT                   /translation="MEDNILTLKGKVILEGVIELKTGMHIGGTKETLKIGGTDNPVIRD
FT                   AFGNILIPGSSLKGKIRALLEKKDGKYKTDVRGNNLPCNCGECEICKIFGPHDSKAIQE
FT                   PVRIMVRDAYLQPEGEKKPHDYLEIKVENTIDRVKGTTIKGGIRNMERVVAGSKFKFEI
FT                   VFNVYKKDDIKLIKKFIEGMRLLEDDYLGGSGSRGYGKIEFKDLKIINKPKEYYEMKIK
FT                   DVKLESASNLDDLMAKLEEIWSY"
FT   gene            567994..569052
FT                   /locus_tag="MFS40622_0583"
FT   CDS_pept        567994..569052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0583"
FT                   /product="CRISPR-associated RAMP protein, Csm4 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm4
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   mfe:Mefer_0968 CRISPR-associated RAMP protein, Csm4 family"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69274"
FT                   /db_xref="InterPro:IPR005510"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR040932"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B4"
FT                   /inference="protein motif:TFAM:TIGR01903"
FT                   /protein_id="ADC69274.1"
FT                   /translation="MEMIVLKPKINSKFHFGEGSLEGSNYIFHSNSLFSAIANNYIKIY
FT                   GEDEDFEKIKNIKLSSLFLKVDDIYLIPKPEHPRFYILKNKVEGVRPKDIKKIQFFSIK
FT                   AYKELLEGILNWNENRLKEIIDNQVINKTILVSNEEVEKLKNIFEVGNKKLISRVIEQK
FT                   VAIDRLKNTTLEKDGRGQLYNIEFIKLHPKAEFYFLIDYNSDDGEFIKKVKASIKLIED
FT                   EGLGGKRSIGAGFFENVEFLDMPKDFKGLFEKDEKYSVLLGVGIPKNDDIKKIGYYKLI
FT                   EIGGYIYHPKCLTKPKRNVLALAEGSIVKKEFEGDIKDITPENYKISKVYAHGKPILLP
FT                   FNLKGDKNESKM"
FT   gene            569036..570145
FT                   /locus_tag="MFS40622_0584"
FT   CDS_pept        569036..570145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0584"
FT                   /product="CRISPR-associated RAMP protein, Csm5 family"
FT                   /note="TIGRFAM: CRISPR-associated RAMP protein, Csm5
FT                   family; PFAM: protein of unknown function DUF324; KEGG:
FT                   mja:MJ1667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69275"
FT                   /db_xref="InterPro:IPR005537"
FT                   /db_xref="InterPro:IPR010173"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B5"
FT                   /inference="protein motif:TFAM:TIGR01899"
FT                   /protein_id="ADC69275.1"
FT                   /translation="MKVKCKTISPLFIGCGEEYSQLDYFIENDTAYIIDLEKAISELND
FT                   LKKVDEISRLIISNTTNNRLNLNAKDILESIGLNAEDYVVKKIKCEIKSDSKTRVKRFI
FT                   YQNNNYYVPGSSIKGAIRTAYIFNYFDRNFTELIKILKDVKISDKGKEVVNRAISKNIH
FT                   DDFFKYLLISDSDFVDEDFRFITTKRWKFANRRLGVKVDAEVMMNKNEFEVDIKINDEF
FT                   FEKMKIKLNKPNNDIEKFEKLKDLCNEFSKTVVEFELKRNNPVHVEKFYEKLLADIRKG
FT                   DALYLNLGFGGGFLSKTVYPLIWKHDKENRMFKEIKRVFLYLAGRNTKLKNAWYRANSY
FT                   LDFPTTKTFYVKDKSVIAPLGWIKMELVE"
FT   gene            570145..571524
FT                   /locus_tag="MFS40622_0585"
FT   CDS_pept        570145..571524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0585"
FT                   /product="CRISPR-associated protein, MJ1666 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, MJ1666 family;
FT                   CRISPR-associated protein DxTHG motif; PFAM:
FT                   CRISPR-associated protein DxTHG; KEGG: mja:MJ1666
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69276"
FT                   /db_xref="InterPro:IPR010171"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B6"
FT                   /inference="protein motif:TFAM:TIGR01897"
FT                   /protein_id="ADC69276.1"
FT                   /translation="MQRILIAPWGNFVTWKEVIYSFDGIEKESKSSISAICEKINPDKV
FT                   YILVLDTLSNLESENYEDIVKEVKEKTESFIKENLNIDNYEIIVCPGVGTFPNGKFYGN
FT                   LVDYYSFALYELSKRFDGDLEVHLDLTHGLNYMPVLTYRVVKDLLEIQSIKNKVRLVVY
FT                   NSDPYVGREKETLNIHIVENKTIIPSLNFDGVTTNFLNTTKFIDKKDIGKIMKEINQNK
FT                   KIRELKLMKQNINAFLASLVYALPLVYSTFFVDEEKINDKINEIISFFISNIKIDTENK
FT                   ELKRYLKFEDGFNALVKAYFTSKICKIPELIKDELSLKEIEELKNTLFKENPNAQFIKN
FT                   EIASLYNIVNTKYKANELSEIIENWIPMYKFRREGVDKFNIRNFLAHAGFEKSVTEIYI
FT                   SAENKDGKIELNEKTSLRYNKDYIEEKDGIKRFVFKYKDKNGRIEEINILEKIEEIFLN
FT                   K"
FT   gene            571710..573086
FT                   /locus_tag="MFS40622_0586"
FT   CDS_pept        571710..573086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0586"
FT                   /product="protein of unknown function DUF711"
FT                   /note="PFAM: protein of unknown function DUF711; KEGG:
FT                   mja:MJ1665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69277"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B7"
FT                   /inference="protein motif:PFAM:PF05167"
FT                   /protein_id="ADC69277.1"
FT                   /translation="MFRPEEIIETIKMIKMENLDLRTVTLGISLRDCVSKDLDELKENI
FT                   YSKITSSAENLVDVANKVSEKYGIPIVNKRIAVTPISLVIGGAIKDLDREEQIKACVEV
FT                   GEVLDKAAKKVGVDFLGGYSALVHKDATKEDKALIDSIPYMMEKTERVCSSINVASTKT
FT                   GINMDAVKRMGEVIKETAFRTEKAIGCAKLVVFANAPEDNPFMAGAFHGVGEGDKVINV
FT                   GVSGPGVVRAVIEKLPDADFGTLANEIKKVAFKITRVGELIGREVSKELGVKFGVVDLS
FT                   LAPTPARGDSIANILEAMGLEKCGTHGSTAALALLNDAVKKGGAMATSYVGGLSGAFIP
FT                   VSEDSGMVEAVEAGALSLEKLEAMTCVCSVGIDMVAIPGDTPASTISAIIADEMAIGVI
FT                   NNKTTAVRIIPVPGKKPGEYVDYGGLLGRAPIMKVNKYSSEKFIKRGGRIPAPLQALTN
FT                   "
FT   gene            complement(573083..573763)
FT                   /locus_tag="MFS40622_0587"
FT   CDS_pept        complement(573083..573763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0587"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69278"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B8"
FT                   /inference="similar to AA sequence:KEGG:MJ1664"
FT                   /protein_id="ADC69278.1"
FT                   /translation="MNKLKLKDEKEVRINFGEYKLTGFSCDNGNNLYKLFNLTLSKIRY
FT                   RKAMLEHNFHLPKIKESHKHRGITEKIKENDIYFLELIDEIKKDFKDFCSLDAGTLFEL
FT                   FMYYTVIEFFKENNIDAKVVRNLEVSYKGEVFTEIDLFVDVFGKNFIFECKNRYISSNA
FT                   ILKLYGIMKILNINIGILASTKSFHGNLKKEDIFKEYNIYILDKLIEKEKNRIFKELKE
FT                   IFGI"
FT   gene            complement(573756..574370)
FT                   /locus_tag="MFS40622_0588"
FT   CDS_pept        complement(573756..574370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0588"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A (MobA)"
FT                   /note="KEGG: mja:MJ1663 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein A (MobA)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69279"
FT                   /db_xref="GOA:D3S8B9"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8B9"
FT                   /inference="similar to AA sequence:KEGG:MJ1663"
FT                   /protein_id="ADC69279.1"
FT                   /translation="MVTIIAGIILSGGKGERIGGKKPFRVFNGKYLINYPSDILKSLNI
FT                   PFVTVFAKNSIDLDMEKKYLSKYKCLISFDLIEGKGPLMGILCGMRALNAKWFIVLPCD
FT                   CPYVSKEALKKLISNIDIAEKNNNLCIIPKHENGYIEPLFALYKRDSLHILNKIIMENK
FT                   NLSIRYFISHLNPLYIKAEELDKNKRIFKNINTIEELMNNE"
FT   gene            574470..576831
FT                   /pseudo
FT                   /locus_tag="MFS40622_0589"
FT                   /product="hypothetical protein"
FT   gene            576818..578509
FT                   /locus_tag="MFS40622_0590"
FT   CDS_pept        576818..578509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0590"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ1662 methyl coenzyme M reductase system,
FT                   component A2-like"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69280"
FT                   /db_xref="GOA:D3S8C0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC69280.1"
FT                   /translation="MITVKVKNLTKKYGDFKALDKVSFEAKKGEILGIVGKSGAGKSTL
FT                   IRILRGSLDYDEGEVEILGRKDNFKEITAIHLQRNFALWAEPVINNIIRKLYAIRNNSD
FT                   ELLPMEEEWEDYEKTAIEILKLVGLEHKKDAFANILSGGEKQRLILGRQIAKIYEKGEG
FT                   VLLLDEPATMACPASKQKLLDVIKNIRDKLGITVIITSHLPEIHRYLCDRLILLENGRV
FT                   KMDGDVEEVLNEFLKEMKPPYIRTPKIKDNAIIKVRNVAKRYYVVHGGETLNLKNVSFD
FT                   VKEGEILSIIGPSGVGKTVIMRLMAGLELPDEGKIIVDGVDITNYGWERIELRKRIGIM
FT                   HQEFSLPYYQTVENLLKYRLGLKGEKAIAHAKAKAEELGLSPKIVDAIYQLIDAPESER
FT                   ISKLQKMGLTEDIIYKLFPPVVESFEPEEILEALDLGKDILKKKVIELSGGQKVRVAMA
FT                   LQLITKPKILFLDEPFGDLDPITLRDVANYLKIINERFGTTIVLVSHCVEFIKEISDRA
FT                   ILLDENRLVMEGNPEEVCEEFIRRSNARFMREESSYNSKKSVLTSE"
FT   repeat_region   578759..579482
FT                   /rpt_unit_range=578760..578790
FT                   /note="CRISPRS"
FT   gene            579953..580519
FT                   /locus_tag="MFS40622_0591"
FT   CDS_pept        579953..580519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0591"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; KEGG:
FT                   mja:MJ1661 glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69281"
FT                   /db_xref="GOA:D3S8C1"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C1"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ADC69281.1"
FT                   /translation="MIIGVLAIQGDVEEHEEAVKKAGYEAKKVKRPEDLEGIDALIIPG
FT                   GESTAIGKLMKKYGLLEKIKNSNLPILGTCAGMVLLSKGTGINQILLELMDITVKRNAY
FT                   GRQVDSFEKEIEFKDLGKVYGVFIRAPVVDKILSDDVEVIAKDDDKIVGVKQGKYMALS
FT                   FHPELSEDGYKVYKYFVENCVENKK"
FT   gene            complement(580539..582158)
FT                   /locus_tag="MFS40622_0592"
FT   CDS_pept        complement(580539..582158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0592"
FT                   /product="O-phosphoseryl-tRNA(Cys) synthetase"
FT                   /note="TIGRFAM: O-phosphoseryl-tRNA(Cys) synthetase; PFAM:
FT                   phenylalanyl-tRNA synthetase class IIc; KEGG: mja:MJ1660
FT                   O-phosphoseryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69282"
FT                   /db_xref="GOA:D3S8C2"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR005246"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041590"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C2"
FT                   /inference="protein motif:TFAM:TIGR00470"
FT                   /protein_id="ADC69282.1"
FT                   /translation="MRFDINKVLELAEKDFEKAWRETKALIKDKHIDERYPRLKPIYGK
FT                   PHPVMETIERLRQAYLRMGFEEMINPVIVDEVEIYKQFGPEAMAVLDRCFYLAGLPRPD
FT                   VGLGNEKVEIIKNLGIDIDEEKKEKLREVLHLYKKGAIDGDDLVFEIAKALNVSNEMGL
FT                   KVLETAFPEFKDLKPEPTTLTLRSHMTSGWFITLSSLIKKRNLPLKLFSIDRCFRREQR
FT                   EDRSHLMSYHSASCVVVGEDVSVDDGKIVAEGLLAQFGFTKFKFKPDEKKSKYYTPETQ
FT                   TEVYAYHPKLGEWIEVATFGVYSPIALAKYGIDVPVMNLGLGVERLAMIIYGYEDVRAM
FT                   VYPQFYEYRLSDRDIAGMIKVDKVPILDELYNFASELIDICIANKDKESPCSIEVKREF
FT                   NFNGEKKIIKVEIFENEPNKKLLGPSVLNEVYVYDGNIYGIPPTYEGVKEEYIPILKKA
FT                   KEEGVSTNIRYIDGIIYKLVAKIEEALVSNVDEFKFRVPIVRSLGDINLKIDELALKQI
FT                   MGENKVIDVRGPVFLNAKVEIK"
FT   gene            complement(582172..583128)
FT                   /locus_tag="MFS40622_0593"
FT   CDS_pept        complement(582172..583128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0593"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; SMART: AAA ATPase; KEGG: mja:MJ1659
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69283"
FT                   /db_xref="GOA:D3S8C3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C3"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ADC69283.1"
FT                   /translation="MEFFNREKEINYLLKVLSFEPNLIYFIYGPINSGKTALIKYIIEN
FT                   KLNRDKYRDKYVVFYINLREHFISKYEDFIEVLFKEYSDDKPTNNIFRYILDVFEKIKK
FT                   EGKQPVLIIDELQKIGDLKINGYLIYELFNFFIDLTKEKHLCHVLCLSSDSLFIERVYN
FT                   EGMLKDRCKYYLVDDFDYETTKAFLKRYGFNDEEIEIIWHYFGGKPIKLVEAVQEKLLG
FT                   EDIKEFCKKSLRVRKRQLKDLLYSLEDENRNLFEGVIKLFENFKNRDEIFYEKITDEIV
FT                   WTVKKNILFVNIEEGILKAQSKLDLLAIREVLEEIKV"
FT   gene            complement(583141..583500)
FT                   /locus_tag="MFS40622_0594"
FT   CDS_pept        complement(583141..583500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69284"
FT                   /db_xref="InterPro:IPR020380"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C4"
FT                   /inference="similar to AA sequence:KEGG:MJ1658"
FT                   /protein_id="ADC69284.1"
FT                   /translation="MKDKILKDREEIEKFFIKLLGREIFISEMDVFASRCSCVGIMLTV
FT                   RGLFIDDVEIFKEKILNKLEELAKSYNINADWIFVRVLPGSDDIINIGVRELCNICREE
FT                   YKFKKPRPDLISLKF"
FT   gene            complement(583497..584495)
FT                   /locus_tag="MFS40622_0595"
FT   CDS_pept        complement(583497..584495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0595"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: mja:MJ1657 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69285"
FT                   /db_xref="GOA:D3S8C5"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C5"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ADC69285.1"
FT                   /translation="MFSIPHPGNFESLKVIVDEINKLRKINKKLKKESFEVYVGFPEFV
FT                   GTGRATLYKPNFEDLAKQVSYAKRNNIRFEVVINASCIGGIHLTPKGISYINWIFSQLK
FT                   NIGVDSVALSDPYLVDLAKDNGLEVNVSCIALVDSLDKAIFWDEKEVYAITLDSSINRH
FT                   FDIIQEIKENVSCKLKILVNEACLYKCPMRIQHFNFFSHANAQNIPALDDYYYNKCINL
FT                   RVKKKELIIKSPFIRPEDLKYYRGLVDIFKISGRSHPIGWIKRVINAYLNEKWDGNLME
FT                   LLDCPRELEHFYYLDNRALDGAIEYWKSCSKLCSKCNFCKELAEKVIKVKH"
FT   gene            complement(584521..585621)
FT                   /locus_tag="MFS40622_0596"
FT   CDS_pept        complement(584521..585621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0596"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   mja:MJ1656 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase
FT                   (HpcE)"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69286"
FT                   /db_xref="GOA:D3S8C6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C6"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ADC69286.1"
FT                   /translation="MEKPLKSILKSFFEELIKKAFETKSIYEKNPDSYNNGLLFGYYII
FT                   LDTFRDEAISFGFDVEELYLNVDFEKELMGAIEEEIPNFPKTEIDDESLLSYLRDCFMI
FT                   LEDYVDDYLDEDEFSRGVLDAFKGTVVLFESLGEKYKIINYLNLNSIKQKIGDSLDIRE
FT                   INPTKIICVGLNYIDHAKELNMEIPEYPIIFLKPTSAIIYNEDYIIKPKISKRVDYEVE
FT                   LAIVIGKKCRNVKKDEADDYIMGYTILNDVTARDLQQKDGQWTRAKSFDTFCPIGPRIV
FT                   KDIDPMNLDIECRVNGEIKQKSNTKNMIFDVYELVEFVSSIMTLYPGDIISTGTPPGVG
FT                   ELKAGDVVECEIEGIGVLRNYVRDEE"
FT   gene            complement(585624..586214)
FT                   /locus_tag="MFS40622_0597"
FT   CDS_pept        complement(585624..586214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0597"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   mfe:Mefer_0731 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69287"
FT                   /db_xref="GOA:D3S8C7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR026597"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3S8C7"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADC69287.1"
FT                   /translation="MFIKCYSGGGRLLLEETLKSCPIVKRGQYHYFIHPISDGVPLVEP
FT                   KLLREVAMRIIKIGNFEDVDKLVTAEAMGIPLVTTLSLYTDIPYVIMRKREYKLPGEIP
FT                   VFQSTGYSKGQLYLNGIEKGDKVVIIDDVISTGGTMIAIINALKRAGAEIKDIICVIER
FT                   GEGKKIVEEKTGYKIKTLVKIDVVDGKVVILRD"
FT   gene            complement(586195..586782)
FT                   /locus_tag="MFS40622_0598"
FT   CDS_pept        complement(586195..586782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MFS40622_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mja:MJ1654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MFS40622_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADC69288"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8C8"
FT                   /inference="similar to AA sequence:KEGG:MJ1654"
FT                   /protein_id="ADC69288.1"
FT                   /translation="MRYVAYKIYPEEFLNNEVVDNALIIESRKVRRVRILGKVENINVG
FT                   NITSFYVDGVNVRYFEEKSVYIEEGDIVDVIGRPRVYDGEKYIMAEIIRKRDERWIKLR
FT                   DLEIKKTRKYLLEGAEPYEEESLEEEIYSEILNPDVIKDKILAIIENLGEVTFEELAGR
FT                   INIPEEELEKYLSELRESGDIFEPRPGVYKVL"
FT   gene            complement(586793..587950)
FT                   /locus_tag="MFS40622_0599"
FT   CDS