(data stored in ACNUC17686 zone)

EMBL: CP001903

ID   CP001903; SV 1; circular; genomic DNA; STD; PRO; 5330088 BP.
XX
AC   CP001903;
XX
PR   Project:PRJNA43631;
XX
DT   22-MAY-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Bacillus thuringiensis BMB171, complete genome.
XX
KW   .
XX
OS   Bacillus thuringiensis BMB171
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus;
OC   Bacillus cereus group.
XX
RN   [1]
RP   1-5330088
RX   DOI; 10.1128/JB.00562-10.
RX   PUBMED; 20525827.
RA   He J., Shao X., Zheng H., Li M., Wang J., Zhang Q., Li L., Liu Z., Sun M.,
RA   Wang S., Yu Z.;
RT   "Complete genome sequence of Bacillus thuringiensis mutant strain BMB171";
RL   J. Bacteriol. 192(15):4074-4075(2010).
XX
RN   [2]
RP   1-5330088
RA   Shao X., He J., Zheng H., Li M., Zhang Q., Li L., Wang S., Yu Z.;
RT   ;
RL   Submitted (01-FEB-2010) to the INSDC.
RL   State Key Laboratory of Agricultural Microbiology, Huazhong Agricultural
RL   University, 1 Shizishan Road, Wuhan, Hubei 430070, P. R. China
XX
DR   MD5; 882e0f3d9839a93255bc953e8d1b9ee8.
DR   BioSample; SAMN02603314.
DR   EnsemblGenomes-Gn; BMB171_C5089.
DR   EnsemblGenomes-Gn; BMB171_C5090.
DR   EnsemblGenomes-Gn; BMB171_C5091.
DR   EnsemblGenomes-Gn; BMB171_C5092.
DR   EnsemblGenomes-Gn; BMB171_C5093.
DR   EnsemblGenomes-Gn; BMB171_C5094.
DR   EnsemblGenomes-Gn; BMB171_C5095.
DR   EnsemblGenomes-Gn; BMB171_C5096.
DR   EnsemblGenomes-Gn; BMB171_C5097.
DR   EnsemblGenomes-Gn; BMB171_C5098.
DR   EnsemblGenomes-Gn; BMB171_C5099.
DR   EnsemblGenomes-Gn; BMB171_C5100.
DR   EnsemblGenomes-Gn; BMB171_C5101.
DR   EnsemblGenomes-Gn; BMB171_C5102.
DR   EnsemblGenomes-Gn; BMB171_C5103.
DR   EnsemblGenomes-Gn; BMB171_C5104.
DR   EnsemblGenomes-Gn; BMB171_C5105.
DR   EnsemblGenomes-Gn; BMB171_C5106.
DR   EnsemblGenomes-Gn; BMB171_C5107.
DR   EnsemblGenomes-Gn; BMB171_C5108.
DR   EnsemblGenomes-Gn; BMB171_C5109.
DR   EnsemblGenomes-Gn; BMB171_C5110.
DR   EnsemblGenomes-Gn; BMB171_C5111.
DR   EnsemblGenomes-Gn; BMB171_C5112.
DR   EnsemblGenomes-Gn; BMB171_C5113.
DR   EnsemblGenomes-Gn; BMB171_C5114.
DR   EnsemblGenomes-Gn; BMB171_C5115.
DR   EnsemblGenomes-Gn; BMB171_C5116.
DR   EnsemblGenomes-Gn; BMB171_C5117.
DR   EnsemblGenomes-Gn; BMB171_C5118.
DR   EnsemblGenomes-Gn; BMB171_C5119.
DR   EnsemblGenomes-Gn; BMB171_C5120.
DR   EnsemblGenomes-Gn; BMB171_C5121.
DR   EnsemblGenomes-Gn; BMB171_C5122.
DR   EnsemblGenomes-Gn; BMB171_C5123.
DR   EnsemblGenomes-Gn; BMB171_C5124.
DR   EnsemblGenomes-Gn; BMB171_C5125.
DR   EnsemblGenomes-Gn; BMB171_C5126.
DR   EnsemblGenomes-Gn; BMB171_C5127.
DR   EnsemblGenomes-Gn; BMB171_C5128.
DR   EnsemblGenomes-Gn; BMB171_C5129.
DR   EnsemblGenomes-Gn; BMB171_C5130.
DR   EnsemblGenomes-Gn; BMB171_C5131.
DR   EnsemblGenomes-Gn; BMB171_C5132.
DR   EnsemblGenomes-Gn; BMB171_C5133.
DR   EnsemblGenomes-Gn; BMB171_C5134.
DR   EnsemblGenomes-Gn; BMB171_C5135.
DR   EnsemblGenomes-Gn; BMB171_C5136.
DR   EnsemblGenomes-Gn; BMB171_C5137.
DR   EnsemblGenomes-Gn; BMB171_C5138.
DR   EnsemblGenomes-Gn; BMB171_C5139.
DR   EnsemblGenomes-Gn; BMB171_C5140.
DR   EnsemblGenomes-Gn; BMB171_C5141.
DR   EnsemblGenomes-Gn; BMB171_C5142.
DR   EnsemblGenomes-Gn; BMB171_C5143.
DR   EnsemblGenomes-Gn; BMB171_C5144.
DR   EnsemblGenomes-Gn; BMB171_C5145.
DR   EnsemblGenomes-Gn; BMB171_C5146.
DR   EnsemblGenomes-Gn; BMB171_C5147.
DR   EnsemblGenomes-Gn; BMB171_C5148.
DR   EnsemblGenomes-Gn; BMB171_C5149.
DR   EnsemblGenomes-Gn; BMB171_C5150.
DR   EnsemblGenomes-Gn; BMB171_C5151.
DR   EnsemblGenomes-Gn; BMB171_C5152.
DR   EnsemblGenomes-Gn; BMB171_C5153.
DR   EnsemblGenomes-Gn; BMB171_C5154.
DR   EnsemblGenomes-Gn; BMB171_C5155.
DR   EnsemblGenomes-Gn; BMB171_C5156.
DR   EnsemblGenomes-Gn; BMB171_C5157.
DR   EnsemblGenomes-Gn; BMB171_C5158.
DR   EnsemblGenomes-Gn; BMB171_C5159.
DR   EnsemblGenomes-Gn; BMB171_C5160.
DR   EnsemblGenomes-Gn; BMB171_C5161.
DR   EnsemblGenomes-Gn; BMB171_C5162.
DR   EnsemblGenomes-Gn; BMB171_C5163.
DR   EnsemblGenomes-Gn; BMB171_C5164.
DR   EnsemblGenomes-Gn; BMB171_C5165.
DR   EnsemblGenomes-Gn; BMB171_C5166.
DR   EnsemblGenomes-Gn; BMB171_C5167.
DR   EnsemblGenomes-Gn; BMB171_C5168.
DR   EnsemblGenomes-Gn; BMB171_C5169.
DR   EnsemblGenomes-Gn; BMB171_C5170.
DR   EnsemblGenomes-Gn; BMB171_C5171.
DR   EnsemblGenomes-Gn; BMB171_C5172.
DR   EnsemblGenomes-Gn; BMB171_C5173.
DR   EnsemblGenomes-Gn; BMB171_C5174.
DR   EnsemblGenomes-Gn; BMB171_C5175.
DR   EnsemblGenomes-Gn; BMB171_C5178.
DR   EnsemblGenomes-Gn; BMB171_C5179.
DR   EnsemblGenomes-Gn; BMB171_C5180.
DR   EnsemblGenomes-Gn; BMB171_C5181.
DR   EnsemblGenomes-Gn; BMB171_C5182.
DR   EnsemblGenomes-Gn; BMB171_C5183.
DR   EnsemblGenomes-Gn; BMB171_C5184.
DR   EnsemblGenomes-Gn; BMB171_C5185.
DR   EnsemblGenomes-Gn; BMB171_C5186.
DR   EnsemblGenomes-Gn; BMB171_C5187.
DR   EnsemblGenomes-Gn; BMB171_C5188.
DR   EnsemblGenomes-Gn; BMB171_C5189.
DR   EnsemblGenomes-Gn; BMB171_C5190.
DR   EnsemblGenomes-Gn; BMB171_C5191.
DR   EnsemblGenomes-Gn; BMB171_C5192.
DR   EnsemblGenomes-Gn; BMB171_C5193.
DR   EnsemblGenomes-Gn; BMB171_C5194.
DR   EnsemblGenomes-Gn; BMB171_C5195.
DR   EnsemblGenomes-Gn; BMB171_C5196.
DR   EnsemblGenomes-Gn; BMB171_C5197.
DR   EnsemblGenomes-Gn; BMB171_C5198.
DR   EnsemblGenomes-Gn; BMB171_C5199.
DR   EnsemblGenomes-Gn; BMB171_C5200.
DR   EnsemblGenomes-Gn; BMB171_C5201.
DR   EnsemblGenomes-Gn; BMB171_C5202.
DR   EnsemblGenomes-Gn; BMB171_C5203.
DR   EnsemblGenomes-Gn; BMB171_C5204.
DR   EnsemblGenomes-Gn; BMB171_C5205.
DR   EnsemblGenomes-Gn; BMB171_C5206.
DR   EnsemblGenomes-Gn; BMB171_C5207.
DR   EnsemblGenomes-Gn; BMB171_C5208.
DR   EnsemblGenomes-Gn; BMB171_C5209.
DR   EnsemblGenomes-Gn; BMB171_C5210.
DR   EnsemblGenomes-Gn; BMB171_C5211.
DR   EnsemblGenomes-Gn; BMB171_C5212.
DR   EnsemblGenomes-Gn; BMB171_C5213.
DR   EnsemblGenomes-Gn; BMB171_C5214.
DR   EnsemblGenomes-Gn; BMB171_C5215.
DR   EnsemblGenomes-Gn; BMB171_C5216.
DR   EnsemblGenomes-Gn; BMB171_C5217.
DR   EnsemblGenomes-Gn; BMB171_C5218.
DR   EnsemblGenomes-Gn; BMB171_C5219.
DR   EnsemblGenomes-Gn; BMB171_C5220.
DR   EnsemblGenomes-Gn; BMB171_C5221.
DR   EnsemblGenomes-Gn; BMB171_C5222.
DR   EnsemblGenomes-Gn; BMB171_C5223.
DR   EnsemblGenomes-Gn; BMB171_C5224.
DR   EnsemblGenomes-Gn; BMB171_C5225.
DR   EnsemblGenomes-Gn; BMB171_C5226.
DR   EnsemblGenomes-Gn; BMB171_C5227.
DR   EnsemblGenomes-Gn; BMB171_C5228.
DR   EnsemblGenomes-Gn; BMB171_C5229.
DR   EnsemblGenomes-Gn; BMB171_C5230.
DR   EnsemblGenomes-Gn; BMB171_C5231.
DR   EnsemblGenomes-Gn; BMB171_C5232.
DR   EnsemblGenomes-Gn; BMB171_C5233.
DR   EnsemblGenomes-Gn; BMB171_C5234.
DR   EnsemblGenomes-Gn; BMB171_C576.
DR   EnsemblGenomes-Gn; BMB171_C577.
DR   EnsemblGenomes-Gn; EBG00001148570.
DR   EnsemblGenomes-Gn; EBG00001148571.
DR   EnsemblGenomes-Gn; EBG00001148572.
DR   EnsemblGenomes-Gn; EBG00001148573.
DR   EnsemblGenomes-Gn; EBG00001148574.
DR   EnsemblGenomes-Gn; EBG00001148575.
DR   EnsemblGenomes-Gn; EBG00001148576.
DR   EnsemblGenomes-Gn; EBG00001148577.
DR   EnsemblGenomes-Gn; EBG00001148578.
DR   EnsemblGenomes-Gn; EBG00001148579.
DR   EnsemblGenomes-Gn; EBG00001148580.
DR   EnsemblGenomes-Gn; EBG00001148581.
DR   EnsemblGenomes-Gn; EBG00001148582.
DR   EnsemblGenomes-Gn; EBG00001148583.
DR   EnsemblGenomes-Gn; EBG00001148584.
DR   EnsemblGenomes-Gn; EBG00001148585.
DR   EnsemblGenomes-Gn; EBG00001148586.
DR   EnsemblGenomes-Gn; EBG00001148587.
DR   EnsemblGenomes-Gn; EBG00001148588.
DR   EnsemblGenomes-Gn; EBG00001148589.
DR   EnsemblGenomes-Gn; EBG00001148590.
DR   EnsemblGenomes-Gn; EBG00001148591.
DR   EnsemblGenomes-Gn; EBG00001148592.
DR   EnsemblGenomes-Gn; EBG00001148593.
DR   EnsemblGenomes-Gn; EBG00001148594.
DR   EnsemblGenomes-Gn; EBG00001148595.
DR   EnsemblGenomes-Gn; EBG00001148596.
DR   EnsemblGenomes-Gn; EBG00001148597.
DR   EnsemblGenomes-Gn; EBG00001148598.
DR   EnsemblGenomes-Gn; EBG00001148599.
DR   EnsemblGenomes-Gn; EBG00001148600.
DR   EnsemblGenomes-Gn; EBG00001148601.
DR   EnsemblGenomes-Gn; EBG00001148602.
DR   EnsemblGenomes-Gn; EBG00001148603.
DR   EnsemblGenomes-Gn; EBG00001148604.
DR   EnsemblGenomes-Gn; EBG00001148605.
DR   EnsemblGenomes-Gn; EBG00001148606.
DR   EnsemblGenomes-Gn; EBG00001148607.
DR   EnsemblGenomes-Gn; EBG00001148608.
DR   EnsemblGenomes-Gn; EBG00001148609.
DR   EnsemblGenomes-Gn; EBG00001148610.
DR   EnsemblGenomes-Gn; EBG00001148611.
DR   EnsemblGenomes-Gn; EBG00001148612.
DR   EnsemblGenomes-Gn; EBG00001148613.
DR   EnsemblGenomes-Gn; EBG00001148614.
DR   EnsemblGenomes-Gn; EBG00001148615.
DR   EnsemblGenomes-Gn; EBG00001148616.
DR   EnsemblGenomes-Gn; EBG00001148617.
DR   EnsemblGenomes-Gn; EBG00001148618.
DR   EnsemblGenomes-Gn; EBG00001148619.
DR   EnsemblGenomes-Gn; EBG00001148620.
DR   EnsemblGenomes-Gn; EBG00001148621.
DR   EnsemblGenomes-Gn; EBG00001148622.
DR   EnsemblGenomes-Gn; EBG00001148623.
DR   EnsemblGenomes-Gn; EBG00001148624.
DR   EnsemblGenomes-Gn; EBG00001148625.
DR   EnsemblGenomes-Gn; EBG00001148626.
DR   EnsemblGenomes-Gn; EBG00001148627.
DR   EnsemblGenomes-Gn; EBG00001148628.
DR   EnsemblGenomes-Gn; EBG00001148629.
DR   EnsemblGenomes-Gn; EBG00001148630.
DR   EnsemblGenomes-Gn; EBG00001148631.
DR   EnsemblGenomes-Gn; EBG00001148632.
DR   EnsemblGenomes-Gn; EBG00001148633.
DR   EnsemblGenomes-Gn; EBG00001148634.
DR   EnsemblGenomes-Gn; EBG00001148635.
DR   EnsemblGenomes-Gn; EBG00001148636.
DR   EnsemblGenomes-Gn; EBG00001148637.
DR   EnsemblGenomes-Gn; EBG00001148638.
DR   EnsemblGenomes-Gn; EBG00001148639.
DR   EnsemblGenomes-Gn; EBG00001148640.
DR   EnsemblGenomes-Gn; EBG00001148641.
DR   EnsemblGenomes-Gn; EBG00001148642.
DR   EnsemblGenomes-Gn; EBG00001148643.
DR   EnsemblGenomes-Gn; EBG00001148644.
DR   EnsemblGenomes-Gn; EBG00001148645.
DR   EnsemblGenomes-Gn; EBG00001148646.
DR   EnsemblGenomes-Gn; EBG00001148647.
DR   EnsemblGenomes-Gn; EBG00001148648.
DR   EnsemblGenomes-Gn; EBG00001148649.
DR   EnsemblGenomes-Gn; EBG00001148650.
DR   EnsemblGenomes-Gn; EBG00001148651.
DR   EnsemblGenomes-Gn; EBG00001148652.
DR   EnsemblGenomes-Gn; EBG00001148653.
DR   EnsemblGenomes-Gn; EBG00001148654.
DR   EnsemblGenomes-Gn; EBG00001148655.
DR   EnsemblGenomes-Gn; EBG00001148656.
DR   EnsemblGenomes-Gn; EBG00001148657.
DR   EnsemblGenomes-Gn; EBG00001148658.
DR   EnsemblGenomes-Gn; EBG00001148659.
DR   EnsemblGenomes-Gn; EBG00001148660.
DR   EnsemblGenomes-Gn; EBG00001148661.
DR   EnsemblGenomes-Gn; EBG00001148662.
DR   EnsemblGenomes-Gn; EBG00001148663.
DR   EnsemblGenomes-Gn; EBG00001148664.
DR   EnsemblGenomes-Gn; EBG00001148665.
DR   EnsemblGenomes-Gn; EBG00001148666.
DR   EnsemblGenomes-Gn; EBG00001148667.
DR   EnsemblGenomes-Gn; EBG00001148668.
DR   EnsemblGenomes-Gn; EBG00001148669.
DR   EnsemblGenomes-Gn; EBG00001148670.
DR   EnsemblGenomes-Gn; EBG00001148671.
DR   EnsemblGenomes-Gn; EBG00001148672.
DR   EnsemblGenomes-Gn; EBG00001148673.
DR   EnsemblGenomes-Gn; EBG00001148674.
DR   EnsemblGenomes-Gn; EBG00001148675.
DR   EnsemblGenomes-Gn; EBG00001148676.
DR   EnsemblGenomes-Gn; EBG00001148677.
DR   EnsemblGenomes-Gn; EBG00001148678.
DR   EnsemblGenomes-Gn; EBG00001148679.
DR   EnsemblGenomes-Gn; EBG00001148680.
DR   EnsemblGenomes-Gn; EBG00001148681.
DR   EnsemblGenomes-Gn; EBG00001148682.
DR   EnsemblGenomes-Gn; EBG00001148683.
DR   EnsemblGenomes-Gn; EBG00001148684.
DR   EnsemblGenomes-Gn; EBG00001148685.
DR   EnsemblGenomes-Gn; EBG00001148686.
DR   EnsemblGenomes-Gn; EBG00001148687.
DR   EnsemblGenomes-Gn; EBG00001148688.
DR   EnsemblGenomes-Gn; EBG00001148689.
DR   EnsemblGenomes-Gn; EBG00001148690.
DR   EnsemblGenomes-Gn; EBG00001148691.
DR   EnsemblGenomes-Gn; EBG00001148692.
DR   EnsemblGenomes-Gn; EBG00001148693.
DR   EnsemblGenomes-Gn; EBG00001148694.
DR   EnsemblGenomes-Gn; EBG00001148695.
DR   EnsemblGenomes-Gn; EBG00001148696.
DR   EnsemblGenomes-Gn; EBG00001148697.
DR   EnsemblGenomes-Gn; EBG00001148698.
DR   EnsemblGenomes-Gn; EBG00001148699.
DR   EnsemblGenomes-Gn; EBG00001148700.
DR   EnsemblGenomes-Gn; EBG00001148701.
DR   EnsemblGenomes-Gn; EBG00001148702.
DR   EnsemblGenomes-Gn; EBG00001148703.
DR   EnsemblGenomes-Gn; EBG00001148704.
DR   EnsemblGenomes-Gn; EBG00001148705.
DR   EnsemblGenomes-Gn; EBG00001148706.
DR   EnsemblGenomes-Gn; EBG00001148707.
DR   EnsemblGenomes-Gn; EBG00001148708.
DR   EnsemblGenomes-Gn; EBG00001148709.
DR   EnsemblGenomes-Gn; EBG00001148710.
DR   EnsemblGenomes-Gn; EBG00001148711.
DR   EnsemblGenomes-Gn; EBG00001148712.
DR   EnsemblGenomes-Gn; EBG00001148713.
DR   EnsemblGenomes-Gn; EBG00001148714.
DR   EnsemblGenomes-Gn; EBG00001148715.
DR   EnsemblGenomes-Gn; EBG00001148716.
DR   EnsemblGenomes-Gn; EBG00001148717.
DR   EnsemblGenomes-Gn; EBG00001148718.
DR   EnsemblGenomes-Gn; EBG00001148719.
DR   EnsemblGenomes-Gn; EBG00001148720.
DR   EnsemblGenomes-Gn; EBG00001148721.
DR   EnsemblGenomes-Gn; EBG00001148722.
DR   EnsemblGenomes-Gn; EBG00001148723.
DR   EnsemblGenomes-Gn; EBG00001148724.
DR   EnsemblGenomes-Gn; EBG00001148725.
DR   EnsemblGenomes-Gn; EBG00001148726.
DR   EnsemblGenomes-Gn; EBG00001148727.
DR   EnsemblGenomes-Gn; EBG00001148728.
DR   EnsemblGenomes-Gn; EBG00001148729.
DR   EnsemblGenomes-Gn; EBG00001148730.
DR   EnsemblGenomes-Gn; EBG00001148731.
DR   EnsemblGenomes-Gn; EBG00001148732.
DR   EnsemblGenomes-Gn; EBG00001148733.
DR   EnsemblGenomes-Gn; EBG00001148734.
DR   EnsemblGenomes-Gn; EBG00001148735.
DR   EnsemblGenomes-Gn; EBG00001148736.
DR   EnsemblGenomes-Gn; EBG00001148737.
DR   EnsemblGenomes-Gn; EBG00001148738.
DR   EnsemblGenomes-Gn; EBG00001148739.
DR   EnsemblGenomes-Gn; EBG00001148740.
DR   EnsemblGenomes-Gn; EBG00001148741.
DR   EnsemblGenomes-Gn; EBG00001148742.
DR   EnsemblGenomes-Gn; EBG00001148743.
DR   EnsemblGenomes-Gn; EBG00001148744.
DR   EnsemblGenomes-Gn; EBG00001148745.
DR   EnsemblGenomes-Gn; EBG00001148746.
DR   EnsemblGenomes-Gn; EBG00001148747.
DR   EnsemblGenomes-Gn; EBG00001148748.
DR   EnsemblGenomes-Gn; EBG00001148749.
DR   EnsemblGenomes-Gn; EBG00001148750.
DR   EnsemblGenomes-Gn; EBG00001148751.
DR   EnsemblGenomes-Gn; EBG00001148752.
DR   EnsemblGenomes-Gn; EBG00001148753.
DR   EnsemblGenomes-Gn; EBG00001148754.
DR   EnsemblGenomes-Gn; EBG00001148755.
DR   EnsemblGenomes-Gn; EBG00001148756.
DR   EnsemblGenomes-Gn; EBG00001148757.
DR   EnsemblGenomes-Gn; EBG00001148758.
DR   EnsemblGenomes-Gn; EBG00001148759.
DR   EnsemblGenomes-Gn; EBG00001148760.
DR   EnsemblGenomes-Tr; BMB171_C5089-1.
DR   EnsemblGenomes-Tr; BMB171_C5090-1.
DR   EnsemblGenomes-Tr; BMB171_C5091-1.
DR   EnsemblGenomes-Tr; BMB171_C5092-1.
DR   EnsemblGenomes-Tr; BMB171_C5093-1.
DR   EnsemblGenomes-Tr; BMB171_C5094-1.
DR   EnsemblGenomes-Tr; BMB171_C5095-1.
DR   EnsemblGenomes-Tr; BMB171_C5096-1.
DR   EnsemblGenomes-Tr; BMB171_C5097-1.
DR   EnsemblGenomes-Tr; BMB171_C5098-1.
DR   EnsemblGenomes-Tr; BMB171_C5099-1.
DR   EnsemblGenomes-Tr; BMB171_C5100-1.
DR   EnsemblGenomes-Tr; BMB171_C5101-1.
DR   EnsemblGenomes-Tr; BMB171_C5102-1.
DR   EnsemblGenomes-Tr; BMB171_C5103-1.
DR   EnsemblGenomes-Tr; BMB171_C5104-1.
DR   EnsemblGenomes-Tr; BMB171_C5105-1.
DR   EnsemblGenomes-Tr; BMB171_C5106-1.
DR   EnsemblGenomes-Tr; BMB171_C5107-1.
DR   EnsemblGenomes-Tr; BMB171_C5108-1.
DR   EnsemblGenomes-Tr; BMB171_C5109-1.
DR   EnsemblGenomes-Tr; BMB171_C5110-1.
DR   EnsemblGenomes-Tr; BMB171_C5111-1.
DR   EnsemblGenomes-Tr; BMB171_C5112-1.
DR   EnsemblGenomes-Tr; BMB171_C5113-1.
DR   EnsemblGenomes-Tr; BMB171_C5114-1.
DR   EnsemblGenomes-Tr; BMB171_C5115-1.
DR   EnsemblGenomes-Tr; BMB171_C5116-1.
DR   EnsemblGenomes-Tr; BMB171_C5117-1.
DR   EnsemblGenomes-Tr; BMB171_C5118-1.
DR   EnsemblGenomes-Tr; BMB171_C5119-1.
DR   EnsemblGenomes-Tr; BMB171_C5120-1.
DR   EnsemblGenomes-Tr; BMB171_C5121-1.
DR   EnsemblGenomes-Tr; BMB171_C5122-1.
DR   EnsemblGenomes-Tr; BMB171_C5123-1.
DR   EnsemblGenomes-Tr; BMB171_C5124-1.
DR   EnsemblGenomes-Tr; BMB171_C5125-1.
DR   EnsemblGenomes-Tr; BMB171_C5126-1.
DR   EnsemblGenomes-Tr; BMB171_C5127-1.
DR   EnsemblGenomes-Tr; BMB171_C5128-1.
DR   EnsemblGenomes-Tr; BMB171_C5129-1.
DR   EnsemblGenomes-Tr; BMB171_C5130-1.
DR   EnsemblGenomes-Tr; BMB171_C5131-1.
DR   EnsemblGenomes-Tr; BMB171_C5132-1.
DR   EnsemblGenomes-Tr; BMB171_C5133-1.
DR   EnsemblGenomes-Tr; BMB171_C5134-1.
DR   EnsemblGenomes-Tr; BMB171_C5135-1.
DR   EnsemblGenomes-Tr; BMB171_C5136-1.
DR   EnsemblGenomes-Tr; BMB171_C5137-1.
DR   EnsemblGenomes-Tr; BMB171_C5138-1.
DR   EnsemblGenomes-Tr; BMB171_C5139-1.
DR   EnsemblGenomes-Tr; BMB171_C5140-1.
DR   EnsemblGenomes-Tr; BMB171_C5141-1.
DR   EnsemblGenomes-Tr; BMB171_C5142-1.
DR   EnsemblGenomes-Tr; BMB171_C5143-1.
DR   EnsemblGenomes-Tr; BMB171_C5144-1.
DR   EnsemblGenomes-Tr; BMB171_C5145-1.
DR   EnsemblGenomes-Tr; BMB171_C5146-1.
DR   EnsemblGenomes-Tr; BMB171_C5147-1.
DR   EnsemblGenomes-Tr; BMB171_C5148-1.
DR   EnsemblGenomes-Tr; BMB171_C5149-1.
DR   EnsemblGenomes-Tr; BMB171_C5150-1.
DR   EnsemblGenomes-Tr; BMB171_C5151-1.
DR   EnsemblGenomes-Tr; BMB171_C5152-1.
DR   EnsemblGenomes-Tr; BMB171_C5153-1.
DR   EnsemblGenomes-Tr; BMB171_C5154-1.
DR   EnsemblGenomes-Tr; BMB171_C5155-1.
DR   EnsemblGenomes-Tr; BMB171_C5156-1.
DR   EnsemblGenomes-Tr; BMB171_C5157-1.
DR   EnsemblGenomes-Tr; BMB171_C5158-1.
DR   EnsemblGenomes-Tr; BMB171_C5159-1.
DR   EnsemblGenomes-Tr; BMB171_C5160-1.
DR   EnsemblGenomes-Tr; BMB171_C5161-1.
DR   EnsemblGenomes-Tr; BMB171_C5162-1.
DR   EnsemblGenomes-Tr; BMB171_C5163-1.
DR   EnsemblGenomes-Tr; BMB171_C5164-1.
DR   EnsemblGenomes-Tr; BMB171_C5165-1.
DR   EnsemblGenomes-Tr; BMB171_C5166-1.
DR   EnsemblGenomes-Tr; BMB171_C5167-1.
DR   EnsemblGenomes-Tr; BMB171_C5168-1.
DR   EnsemblGenomes-Tr; BMB171_C5169-1.
DR   EnsemblGenomes-Tr; BMB171_C5170-1.
DR   EnsemblGenomes-Tr; BMB171_C5171-1.
DR   EnsemblGenomes-Tr; BMB171_C5172-1.
DR   EnsemblGenomes-Tr; BMB171_C5173-1.
DR   EnsemblGenomes-Tr; BMB171_C5174-1.
DR   EnsemblGenomes-Tr; BMB171_C5175-1.
DR   EnsemblGenomes-Tr; BMB171_C5178-1.
DR   EnsemblGenomes-Tr; BMB171_C5179-1.
DR   EnsemblGenomes-Tr; BMB171_C5180-1.
DR   EnsemblGenomes-Tr; BMB171_C5181-1.
DR   EnsemblGenomes-Tr; BMB171_C5182-1.
DR   EnsemblGenomes-Tr; BMB171_C5183-1.
DR   EnsemblGenomes-Tr; BMB171_C5184-1.
DR   EnsemblGenomes-Tr; BMB171_C5185-1.
DR   EnsemblGenomes-Tr; BMB171_C5186-1.
DR   EnsemblGenomes-Tr; BMB171_C5187-1.
DR   EnsemblGenomes-Tr; BMB171_C5188-1.
DR   EnsemblGenomes-Tr; BMB171_C5189-1.
DR   EnsemblGenomes-Tr; BMB171_C5190-1.
DR   EnsemblGenomes-Tr; BMB171_C5191-1.
DR   EnsemblGenomes-Tr; BMB171_C5192-1.
DR   EnsemblGenomes-Tr; BMB171_C5193-1.
DR   EnsemblGenomes-Tr; BMB171_C5194-1.
DR   EnsemblGenomes-Tr; BMB171_C5195-1.
DR   EnsemblGenomes-Tr; BMB171_C5196-1.
DR   EnsemblGenomes-Tr; BMB171_C5197-1.
DR   EnsemblGenomes-Tr; BMB171_C5198-1.
DR   EnsemblGenomes-Tr; BMB171_C5199-1.
DR   EnsemblGenomes-Tr; BMB171_C5200-1.
DR   EnsemblGenomes-Tr; BMB171_C5201-1.
DR   EnsemblGenomes-Tr; BMB171_C5202-1.
DR   EnsemblGenomes-Tr; BMB171_C5203-1.
DR   EnsemblGenomes-Tr; BMB171_C5204-1.
DR   EnsemblGenomes-Tr; BMB171_C5205-1.
DR   EnsemblGenomes-Tr; BMB171_C5206-1.
DR   EnsemblGenomes-Tr; BMB171_C5207-1.
DR   EnsemblGenomes-Tr; BMB171_C5208-1.
DR   EnsemblGenomes-Tr; BMB171_C5209-1.
DR   EnsemblGenomes-Tr; BMB171_C5210-1.
DR   EnsemblGenomes-Tr; BMB171_C5211-1.
DR   EnsemblGenomes-Tr; BMB171_C5212-1.
DR   EnsemblGenomes-Tr; BMB171_C5213-1.
DR   EnsemblGenomes-Tr; BMB171_C5214-1.
DR   EnsemblGenomes-Tr; BMB171_C5215-1.
DR   EnsemblGenomes-Tr; BMB171_C5216-1.
DR   EnsemblGenomes-Tr; BMB171_C5217-1.
DR   EnsemblGenomes-Tr; BMB171_C5218-1.
DR   EnsemblGenomes-Tr; BMB171_C5219-1.
DR   EnsemblGenomes-Tr; BMB171_C5220-1.
DR   EnsemblGenomes-Tr; BMB171_C5221-1.
DR   EnsemblGenomes-Tr; BMB171_C5222-1.
DR   EnsemblGenomes-Tr; BMB171_C5223-1.
DR   EnsemblGenomes-Tr; BMB171_C5224-1.
DR   EnsemblGenomes-Tr; BMB171_C5225-1.
DR   EnsemblGenomes-Tr; BMB171_C5226-1.
DR   EnsemblGenomes-Tr; BMB171_C5227-1.
DR   EnsemblGenomes-Tr; BMB171_C5228-1.
DR   EnsemblGenomes-Tr; BMB171_C5229-1.
DR   EnsemblGenomes-Tr; BMB171_C5230-1.
DR   EnsemblGenomes-Tr; BMB171_C5231-1.
DR   EnsemblGenomes-Tr; BMB171_C5232-1.
DR   EnsemblGenomes-Tr; BMB171_C5233-1.
DR   EnsemblGenomes-Tr; BMB171_C5234-1.
DR   EnsemblGenomes-Tr; BMB171_C576-1.
DR   EnsemblGenomes-Tr; BMB171_C577-1.
DR   EnsemblGenomes-Tr; EBT00001564467.
DR   EnsemblGenomes-Tr; EBT00001564468.
DR   EnsemblGenomes-Tr; EBT00001564469.
DR   EnsemblGenomes-Tr; EBT00001564470.
DR   EnsemblGenomes-Tr; EBT00001564471.
DR   EnsemblGenomes-Tr; EBT00001564472.
DR   EnsemblGenomes-Tr; EBT00001564473.
DR   EnsemblGenomes-Tr; EBT00001564474.
DR   EnsemblGenomes-Tr; EBT00001564475.
DR   EnsemblGenomes-Tr; EBT00001564476.
DR   EnsemblGenomes-Tr; EBT00001564477.
DR   EnsemblGenomes-Tr; EBT00001564478.
DR   EnsemblGenomes-Tr; EBT00001564479.
DR   EnsemblGenomes-Tr; EBT00001564480.
DR   EnsemblGenomes-Tr; EBT00001564481.
DR   EnsemblGenomes-Tr; EBT00001564482.
DR   EnsemblGenomes-Tr; EBT00001564483.
DR   EnsemblGenomes-Tr; EBT00001564484.
DR   EnsemblGenomes-Tr; EBT00001564485.
DR   EnsemblGenomes-Tr; EBT00001564486.
DR   EnsemblGenomes-Tr; EBT00001564487.
DR   EnsemblGenomes-Tr; EBT00001564488.
DR   EnsemblGenomes-Tr; EBT00001564489.
DR   EnsemblGenomes-Tr; EBT00001564490.
DR   EnsemblGenomes-Tr; EBT00001564491.
DR   EnsemblGenomes-Tr; EBT00001564492.
DR   EnsemblGenomes-Tr; EBT00001564493.
DR   EnsemblGenomes-Tr; EBT00001564494.
DR   EnsemblGenomes-Tr; EBT00001564495.
DR   EnsemblGenomes-Tr; EBT00001564496.
DR   EnsemblGenomes-Tr; EBT00001564497.
DR   EnsemblGenomes-Tr; EBT00001564498.
DR   EnsemblGenomes-Tr; EBT00001564499.
DR   EnsemblGenomes-Tr; EBT00001564500.
DR   EnsemblGenomes-Tr; EBT00001564501.
DR   EnsemblGenomes-Tr; EBT00001564502.
DR   EnsemblGenomes-Tr; EBT00001564503.
DR   EnsemblGenomes-Tr; EBT00001564504.
DR   EnsemblGenomes-Tr; EBT00001564505.
DR   EnsemblGenomes-Tr; EBT00001564506.
DR   EnsemblGenomes-Tr; EBT00001564507.
DR   EnsemblGenomes-Tr; EBT00001564508.
DR   EnsemblGenomes-Tr; EBT00001564509.
DR   EnsemblGenomes-Tr; EBT00001564510.
DR   EnsemblGenomes-Tr; EBT00001564511.
DR   EnsemblGenomes-Tr; EBT00001564512.
DR   EnsemblGenomes-Tr; EBT00001564513.
DR   EnsemblGenomes-Tr; EBT00001564514.
DR   EnsemblGenomes-Tr; EBT00001564515.
DR   EnsemblGenomes-Tr; EBT00001564516.
DR   EnsemblGenomes-Tr; EBT00001564517.
DR   EnsemblGenomes-Tr; EBT00001564518.
DR   EnsemblGenomes-Tr; EBT00001564519.
DR   EnsemblGenomes-Tr; EBT00001564520.
DR   EnsemblGenomes-Tr; EBT00001564521.
DR   EnsemblGenomes-Tr; EBT00001564522.
DR   EnsemblGenomes-Tr; EBT00001564523.
DR   EnsemblGenomes-Tr; EBT00001564524.
DR   EnsemblGenomes-Tr; EBT00001564525.
DR   EnsemblGenomes-Tr; EBT00001564526.
DR   EnsemblGenomes-Tr; EBT00001564527.
DR   EnsemblGenomes-Tr; EBT00001564528.
DR   EnsemblGenomes-Tr; EBT00001564529.
DR   EnsemblGenomes-Tr; EBT00001564530.
DR   EnsemblGenomes-Tr; EBT00001564531.
DR   EnsemblGenomes-Tr; EBT00001564532.
DR   EnsemblGenomes-Tr; EBT00001564533.
DR   EnsemblGenomes-Tr; EBT00001564534.
DR   EnsemblGenomes-Tr; EBT00001564535.
DR   EnsemblGenomes-Tr; EBT00001564536.
DR   EnsemblGenomes-Tr; EBT00001564537.
DR   EnsemblGenomes-Tr; EBT00001564538.
DR   EnsemblGenomes-Tr; EBT00001564539.
DR   EnsemblGenomes-Tr; EBT00001564540.
DR   EnsemblGenomes-Tr; EBT00001564541.
DR   EnsemblGenomes-Tr; EBT00001564542.
DR   EnsemblGenomes-Tr; EBT00001564543.
DR   EnsemblGenomes-Tr; EBT00001564544.
DR   EnsemblGenomes-Tr; EBT00001564545.
DR   EnsemblGenomes-Tr; EBT00001564546.
DR   EnsemblGenomes-Tr; EBT00001564547.
DR   EnsemblGenomes-Tr; EBT00001564548.
DR   EnsemblGenomes-Tr; EBT00001564549.
DR   EnsemblGenomes-Tr; EBT00001564550.
DR   EnsemblGenomes-Tr; EBT00001564551.
DR   EnsemblGenomes-Tr; EBT00001564552.
DR   EnsemblGenomes-Tr; EBT00001564553.
DR   EnsemblGenomes-Tr; EBT00001564554.
DR   EnsemblGenomes-Tr; EBT00001564555.
DR   EnsemblGenomes-Tr; EBT00001564556.
DR   EnsemblGenomes-Tr; EBT00001564557.
DR   EnsemblGenomes-Tr; EBT00001564558.
DR   EnsemblGenomes-Tr; EBT00001564559.
DR   EnsemblGenomes-Tr; EBT00001564560.
DR   EnsemblGenomes-Tr; EBT00001564561.
DR   EnsemblGenomes-Tr; EBT00001564562.
DR   EnsemblGenomes-Tr; EBT00001564563.
DR   EnsemblGenomes-Tr; EBT00001564564.
DR   EnsemblGenomes-Tr; EBT00001564565.
DR   EnsemblGenomes-Tr; EBT00001564566.
DR   EnsemblGenomes-Tr; EBT00001564567.
DR   EnsemblGenomes-Tr; EBT00001564568.
DR   EnsemblGenomes-Tr; EBT00001564569.
DR   EnsemblGenomes-Tr; EBT00001564570.
DR   EnsemblGenomes-Tr; EBT00001564571.
DR   EnsemblGenomes-Tr; EBT00001564572.
DR   EnsemblGenomes-Tr; EBT00001564573.
DR   EnsemblGenomes-Tr; EBT00001564574.
DR   EnsemblGenomes-Tr; EBT00001564575.
DR   EnsemblGenomes-Tr; EBT00001564576.
DR   EnsemblGenomes-Tr; EBT00001564577.
DR   EnsemblGenomes-Tr; EBT00001564578.
DR   EnsemblGenomes-Tr; EBT00001564579.
DR   EnsemblGenomes-Tr; EBT00001564580.
DR   EnsemblGenomes-Tr; EBT00001564581.
DR   EnsemblGenomes-Tr; EBT00001564582.
DR   EnsemblGenomes-Tr; EBT00001564583.
DR   EnsemblGenomes-Tr; EBT00001564584.
DR   EnsemblGenomes-Tr; EBT00001564585.
DR   EnsemblGenomes-Tr; EBT00001564586.
DR   EnsemblGenomes-Tr; EBT00001564587.
DR   EnsemblGenomes-Tr; EBT00001564588.
DR   EnsemblGenomes-Tr; EBT00001564589.
DR   EnsemblGenomes-Tr; EBT00001564590.
DR   EnsemblGenomes-Tr; EBT00001564591.
DR   EnsemblGenomes-Tr; EBT00001564592.
DR   EnsemblGenomes-Tr; EBT00001564593.
DR   EnsemblGenomes-Tr; EBT00001564594.
DR   EnsemblGenomes-Tr; EBT00001564595.
DR   EnsemblGenomes-Tr; EBT00001564596.
DR   EnsemblGenomes-Tr; EBT00001564597.
DR   EnsemblGenomes-Tr; EBT00001564598.
DR   EnsemblGenomes-Tr; EBT00001564599.
DR   EnsemblGenomes-Tr; EBT00001564600.
DR   EnsemblGenomes-Tr; EBT00001564601.
DR   EnsemblGenomes-Tr; EBT00001564602.
DR   EnsemblGenomes-Tr; EBT00001564603.
DR   EnsemblGenomes-Tr; EBT00001564604.
DR   EnsemblGenomes-Tr; EBT00001564605.
DR   EnsemblGenomes-Tr; EBT00001564606.
DR   EnsemblGenomes-Tr; EBT00001564607.
DR   EnsemblGenomes-Tr; EBT00001564608.
DR   EnsemblGenomes-Tr; EBT00001564609.
DR   EnsemblGenomes-Tr; EBT00001564610.
DR   EnsemblGenomes-Tr; EBT00001564611.
DR   EnsemblGenomes-Tr; EBT00001564612.
DR   EnsemblGenomes-Tr; EBT00001564613.
DR   EnsemblGenomes-Tr; EBT00001564614.
DR   EnsemblGenomes-Tr; EBT00001564615.
DR   EnsemblGenomes-Tr; EBT00001564616.
DR   EnsemblGenomes-Tr; EBT00001564617.
DR   EnsemblGenomes-Tr; EBT00001564618.
DR   EnsemblGenomes-Tr; EBT00001564619.
DR   EnsemblGenomes-Tr; EBT00001564620.
DR   EnsemblGenomes-Tr; EBT00001564621.
DR   EnsemblGenomes-Tr; EBT00001564622.
DR   EnsemblGenomes-Tr; EBT00001564623.
DR   EnsemblGenomes-Tr; EBT00001564624.
DR   EnsemblGenomes-Tr; EBT00001564625.
DR   EnsemblGenomes-Tr; EBT00001564626.
DR   EnsemblGenomes-Tr; EBT00001564627.
DR   EnsemblGenomes-Tr; EBT00001564628.
DR   EnsemblGenomes-Tr; EBT00001564629.
DR   EnsemblGenomes-Tr; EBT00001564630.
DR   EnsemblGenomes-Tr; EBT00001564631.
DR   EnsemblGenomes-Tr; EBT00001564632.
DR   EnsemblGenomes-Tr; EBT00001564633.
DR   EnsemblGenomes-Tr; EBT00001564634.
DR   EnsemblGenomes-Tr; EBT00001564635.
DR   EnsemblGenomes-Tr; EBT00001564636.
DR   EnsemblGenomes-Tr; EBT00001564637.
DR   EnsemblGenomes-Tr; EBT00001564638.
DR   EnsemblGenomes-Tr; EBT00001564639.
DR   EnsemblGenomes-Tr; EBT00001564640.
DR   EnsemblGenomes-Tr; EBT00001564641.
DR   EnsemblGenomes-Tr; EBT00001564642.
DR   EnsemblGenomes-Tr; EBT00001564643.
DR   EnsemblGenomes-Tr; EBT00001564644.
DR   EnsemblGenomes-Tr; EBT00001564645.
DR   EnsemblGenomes-Tr; EBT00001564646.
DR   EnsemblGenomes-Tr; EBT00001564647.
DR   EnsemblGenomes-Tr; EBT00001564648.
DR   EnsemblGenomes-Tr; EBT00001564649.
DR   EnsemblGenomes-Tr; EBT00001564650.
DR   EnsemblGenomes-Tr; EBT00001564651.
DR   EnsemblGenomes-Tr; EBT00001564652.
DR   EnsemblGenomes-Tr; EBT00001564653.
DR   EnsemblGenomes-Tr; EBT00001564654.
DR   EnsemblGenomes-Tr; EBT00001564655.
DR   EnsemblGenomes-Tr; EBT00001564656.
DR   EnsemblGenomes-Tr; EBT00001564657.
DR   EuropePMC; PMC2916366; 20525827.
DR   EuropePMC; PMC3651407; 23627759.
DR   EuropePMC; PMC3910694; 24501631.
DR   EuropePMC; PMC4323370; 25678849.
DR   EuropePMC; PMC4886243; 26922318.
DR   EuropePMC; PMC6193087; 30364256.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00556; L19_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF00559; L21_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01411; BsrF.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01820; RsaE.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001903.
DR   SILVA-SSU; CP001903.
XX
CC   Sorce DNA is available from the complete genome DNA of Bacillus
CC   thuringiensis; Bacteria available from a acrystalliferous mutant of
CC   wild type strain YBT-1463, which is subsp. kurstaki and a highly
CC   toxic wild strain to Lepidoptera. Now this strain is stocked in our
CC   lab, used as the recipient strain because of its high
CC   electro-transformation efficiency.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5330088
FT                   /organism="Bacillus thuringiensis BMB171"
FT                   /strain="BMB171"
FT                   /mol_type="genomic DNA"
FT                   /serovar="kurstaki"
FT                   /db_xref="taxon:714359"
FT   gene            283..1623
FT                   /gene="dnaA"
FT                   /locus_tag="BMB171_C0001"
FT   CDS_pept        283..1623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="BMB171_C0001"
FT                   /product="chromosomal replication initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04819"
FT                   /protein_id="ADH04819.1"
FT                   /translation="MENISDLWNSALKELEKKVSKPSYETWLKSTTAHNLKKDVLTITA
FT                   PNEFARDWLESHYSELISETLYDLTGAKLAIRFIIPQSQAEEDIDLPPVKPNPAQDDSA
FT                   HLPQSMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHA
FT                   IGHYVIEHNPNAKVVYLSSEKFTNEFINSIRDNKAVDFRNKYRNVDVLLIDDIQFLAGK
FT                   EQTQEEFFHTFNALHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETR
FT                   IAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAE
FT                   ALKDIIPNSKPKIISIYDIQKAVGDVYQVKLEDFKAKKRTKSVAFPRQIAMYLSRELTD
FT                   SSLPKIGEEFGGRDHTTVIHAHEKISKLLKTDTQLQKQVEEINGILK"
FT   gene            1802..2947
FT                   /gene="dnaN1"
FT                   /locus_tag="BMB171_C0002"
FT   CDS_pept        1802..2947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN1"
FT                   /locus_tag="BMB171_C0002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04820"
FT                   /protein_id="ADH04820.1"
FT                   /translation="MRFTIQKDYLVRGVQDVMKAVSSRTTIPILTGIKVVATEEGVTLT
FT                   GSDADISIESFIPVEEDGKEIVEIAQSGSIVLQAKYFSEIVKKLPKDTVEISVENHFMT
FT                   KIKSGKSEFNLNGLDSAEYPLLPQIEEHHVFKIPTDLLKHMIRQTVFAVSTSETRPILT
FT                   GVNWKVYNSELTCIATDSHRLALRKAKIEGHNIADEFQANVVIPGKSLNELSKILDESE
FT                   EMVDIVITEYQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRA
FT                   SLLARDGRNNVVKLSTLEQEMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMD
FT                   ALKALDSTEIKVSFTGAMRPFLIRTVNDDSIIQLILPVRTY"
FT   gene            3075..3287
FT                   /locus_tag="BMB171_C0003"
FT   CDS_pept        3075..3287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04821"
FT                   /protein_id="ADH04821.1"
FT                   /translation="MKRIKISTEYITLGQFLKLADVIDTGGAVKWFLQEYEVYVNNELE
FT                   NRRGRKLYANDVIEIPGSGTFQVQA"
FT   gene            3300..4427
FT                   /gene="recF"
FT                   /locus_tag="BMB171_C0004"
FT   CDS_pept        3300..4427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="BMB171_C0004"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04822"
FT                   /protein_id="ADH04822.1"
FT                   /translation="MFISEIQLKNYRNYEKLELSFEDKVNVIIGENAQGKTNLMEAIYV
FT                   LAMAKSHRTSNDRELIRWDEDFGQIKGKLQKRNSSLSLELNISKKGKKAKLNQLEQQKL
FT                   SQYIGVMNVVMFAPEDLNLVKGSPQVRRRFLDMELGQIAPVYLYELSQYQKVLTQRNHL
FT                   LKKMQGNSKNEETMLDVFTLQLIEHGAKILQKRFEFLHLLQQWAAPIHRGISRGLEELE
FT                   IVYKPSVDVSESMDLSKIKEVYYESFQSVKQREIFRGTTLIGPHRDDLQFFVNSKNVQV
FT                   FGSQGQQRTTALSLKLAEIELIYSEVKEYPILLLDDVLSELDDYRQSHLLNTIQGKVQT
FT                   FVTTTSVDGIEHETLKEAKTIHVTNGTVDCEIDRE"
FT   gene            4466..6388
FT                   /gene="gyrB"
FT                   /locus_tag="BMB171_C0005"
FT   CDS_pept        4466..6388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="BMB171_C0005"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04823"
FT                   /protein_id="ADH04823.1"
FT                   /translation="MEQKQMQENAYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLV
FT                   WEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLH
FT                   AGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIG
FT                   DTDQTGTITRFKPDPEIFQETTVYDFDTLATRMRELAFLNRNIKLTIEDKREHKQKKEF
FT                   HYEGGIKSYVEHLNRSKQPIHEEPVYVEGSKDGIQVEVSLQYNEGYTNNIYSFTNNIHT
FT                   YEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEG
FT                   QTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTR
FT                   RKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIIN
FT                   VEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLT
FT                   FFYRYMRQIIECGYIYIAQPPLFKIQQGKKIQYAYNDKELEKILAELPAQPKPGIQRYK
FT                   GLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYV
FT                   KNLDI"
FT   gene            6477..8948
FT                   /gene="gyrA"
FT                   /locus_tag="BMB171_C0006"
FT   CDS_pept        6477..8948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="BMB171_C0006"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04824"
FT                   /protein_id="ADH04824.1"
FT                   /translation="MSDNQQQARIREINISHEMRTSFLDYAMSVIVSRALPDVRDGLKP
FT                   VHRRVLYAMNDLGITADKAYKKSARIVGEVIGKYHPHGDSAVYETMVRMAQDFSQRYML
FT                   VDGHGNFGSVDGDSAAAMRYTEARMSKISMELIRDISKNTIDYQDNYDGSEREPIVLPA
FT                   RFPNLLVNGTTGIAVGMATNIPPHQLGEVIDGVLALSHNPDITIAELMEYIPGPDFPTA
FT                   GLILGRSGIRRAYETGRGSIMLRAKVEIEEKSNGKQSIIVTELPYQVNKARLIEKIAEL
FT                   VRDKKIEGITDLRDESDRNGMRIVMEVRRDANANVLLNNLYKHTALQTSFGINMLSLVN
FT                   GEPQVLNLKQNLYHYLEHQKVVIRRRTAYELEKAEARAHILEGLRIALDHLDEVITLIR
FT                   SSKTADIAKQGLMERFGLSEKQAQAILDMRLQRLTGLEREKIEQEYQDLMKLIAELKAI
FT                   LADEEKVLEIIREELTEVKERFNDKRRTEITIGGMEFIEDEDLIPEQNIAITLTHNGYI
FT                   KRLPASTYKTQNRGGRGVQGMGTNDDDFVEHLLTTSTHDHILFFTNKGKVYRTKGYEIP
FT                   EYSRTAKGLPIINLLGVDKGEWINAIIPIREFGDDQFLFFTTKQGVSKRTPLSSFANIR
FT                   TNGLIAISLREEDEVISVRLTSGDKDIIVGTSNGMLIRFNEQDVRSMGRNAAGVKAITL
FT                   GDEDQVVGMEIVEEDVNVLIVTKNGYGKRTPIDEYRLQSRGGKGLKTCNITDKNGKLVA
FT                   VKSVTGEEDIMLITAAGVIIRMPVDQISQMGRNTQGVRLIRLEEDQEVATVAKAQKDEE
FT                   EETSEEVSSEE"
FT   gene            9197..10736
FT                   /gene="rrf_1"
FT                   /locus_tag="BMB171_C5089"
FT   rRNA            9197..10736
FT                   /gene="rrf_1"
FT                   /locus_tag="BMB171_C5089"
FT                   /product="16S ribosomal RNA"
FT   gene            11341..14260
FT                   /gene="rrl_1"
FT                   /locus_tag="BMB171_C5090"
FT   rRNA            11341..14260
FT                   /gene="rrl_1"
FT                   /locus_tag="BMB171_C5090"
FT                   /product="23S ribosomal RNA"
FT   gene            14311..14425
FT                   /gene="rrs_1"
FT                   /locus_tag="BMB171_C5091"
FT   rRNA            14311..14425
FT                   /gene="rrs_1"
FT                   /locus_tag="BMB171_C5091"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(14459..15460)
FT                   /locus_tag="BMB171_C0007"
FT   CDS_pept        complement(14459..15460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0007"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04825"
FT                   /protein_id="ADH04825.1"
FT                   /translation="MHQTSCTWQQLSFFFSSQNVQRYLARCYEKSSIQDAEKKSFENCY
FT                   PFIYYLEHGKNYYELYKTAPFSIQPMLLFYGISQLFKACLLTIDPNYPESTTVLAHGVT
FT                   TRKRKKQGYQFLEDEVKVQKNGLFTHVAEQLFHMKHLEAEKFNMLELMGNIPELQNLFR
FT                   YSQKGSTLYKIDSTIKNELSFSVNLLDRLHMTKERFSRYIETSCKHLSIQHVPEKTNES
FT                   NLLFTAPIQSWNPMYSTPLYYEHLTNTYYLPLTTDPRNPKPILPELLIHYLLLYNLSMI
FT                   SRYETDWWYDLLGSYGSEDYPFIYQFLSISAQKIPYYISNFLLMEPNLFHGK"
FT   gene            15576..17039
FT                   /gene="guaB"
FT                   /locus_tag="BMB171_C0008"
FT   CDS_pept        15576..17039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BMB171_C0008"
FT                   /product="inositol-5-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04826"
FT                   /protein_id="ADH04826.1"
FT                   /translation="MWESKFVKEGLTFDDVLLVPARSDILPREVSVKTVLSESLQLNIP
FT                   LISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSESGVISDPFFLTP
FT                   EHQVYDAEHLMGKYRISGVPVVNNLDERKLVGIITNRDMRFIQDYSIKISDVMTKEQLI
FT                   TAPVGTTLEEAEKILQKYKIEKLPLVDNNGVLQGLITIKDIEKVIEFPNSAKDKQGRLL
FT                   VGAAVGVTADAMLRIDALVKASVDAIVLDTAHGHSKGVIDKVKEVRAKYPSLNIIAGNV
FT                   ATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVGVPQLTAVYDCATEARKHGIPVIA
FT                   DGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAMEK
FT                   GSKDRYFQEGNKKLVPEGIEGRVPYKGPLADTVHQLVGGLRAGMGYCGAQDLEFLRENA
FT                   QFIRMSGAGLRESHPHHVQITKEAPNYSL"
FT   gene            17213..18460
FT                   /gene="dacA"
FT                   /locus_tag="BMB171_C0009"
FT   CDS_pept        17213..18460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="BMB171_C0009"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04827"
FT                   /protein_id="ADH04827.1"
FT                   /translation="MPYSNASAETGAALNIEAGAAILVEANSGKILYQKNADELLSIAS
FT                   MTKMMSEYLVHEAVDKGKLKWDQKIKVSEYAYKVSQDASLSNVALENGGSYTVKELYEA
FT                   MAIFSANGATIALAEAIAGKEVDFVKMMNDKSKELGLKNYKFVNSTGLTNKDLKGMHPE
FT                   GTTADEENKMSAKDVATLAQHLIKDYPKVLDTAKIPKKEFRPEKEKFGMSNWNWMLKGL
FT                   VKEYDGVDGLKTGSTPEAGDCFTGTVERNGMRFISVVIKTSSHTARFDETKKLYDYGFA
FT                   NFEVKQMYKKGSSVKGQETVRVENAKDKDVAVQTKQAISLPVPKGSKDVYKTELKESSK
FT                   GQEAPIKKGAALGQMVITPKDTNDPGFLTGKSLQVDLVTTSEVEEANWFTRAMRGIGSF
FT                   FSGMWNSAVDTVKGWF"
FT   gene            18622..19509
FT                   /locus_tag="BMB171_C0010"
FT   CDS_pept        18622..19509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0010"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04828"
FT                   /protein_id="ADH04828.1"
FT                   /translation="MTNVTGTERVKRGMAEMQKGGVIMDVVNAEQAKIAEEAGAVAVMA
FT                   LERVPADIRAAGGVSRMADPTIVEEVMGAVSIPVMAKCRIGHLVEARVLESLGVDYIDE
FT                   SEVLTPADEVYHLNKRDYTVPFVCGCRDIGEAARRIAEGASMLRTKGEPGTGNIVEAVR
FT                   HMRQVNAEIRQVASLREDELMTYAKNTGAPYEVLLEIKRLGRLPVVNFAAGGVATPADA
FT                   ALMMQLGADGVFVGSGIFKSENPEKFARAIVEATTHYEDYELIASLSKGLGNAMKGVEI
FT                   STLLPEQRMQERGW"
FT   gene            19528..20118
FT                   /locus_tag="BMB171_C0011"
FT   CDS_pept        19528..20118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0011"
FT                   /product="glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04829"
FT                   /protein_id="ADH04829.1"
FT                   /translation="MVKIGVLGLQGAVREHVKSVEASGAEAVVVKRIEQLEEIDGLILP
FT                   GGESTTMRRLIDKYAFMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYEEAHIGAMDITV
FT                   ERNAFGRQKDSFEAALSIEGVGEDFVGVFIRAPYVVEVADNVEVLSKHGDRMVAVRQDQ
FT                   FLAASFHPELTDDHRVTAYFVEMVKEAKMKKVV"
FT   gene            20446..21720
FT                   /gene="serS"
FT                   /locus_tag="BMB171_C0012"
FT   CDS_pept        20446..21720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BMB171_C0012"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04830"
FT                   /protein_id="ADH04830.1"
FT                   /translation="MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQT
FT                   EELKSKRNEVSQQISVLKREKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSI
FT                   PNIPHESAPVGETEDDNVVARTWGEVKEFTYEPKPHWDLATDLGILDFERAGKVTGSRF
FT                   VFYKGAGARLERALISFMLDLHTDEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIE
FT                   SEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQF
FT                   NKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVW
FT                   IPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILEN
FT                   YQQEDGTIIIPEVLRPYMGGKTVIK"
FT   gene            21875..21967
FT                   /locus_tag="BMB171_C5131"
FT   tRNA            21875..21967
FT                   /locus_tag="BMB171_C5131"
FT                   /product="tRNA-Ser"
FT   gene            22134..22526
FT                   /locus_tag="BMB171_C0013"
FT   CDS_pept        22134..22526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0013"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04831"
FT                   /protein_id="ADH04831.1"
FT                   /translation="MDLIIQTFPLDGKTLYYVQCPVCKNNRILNSGANVSRIISDDTFR
FT                   KLCGCTCDVKPATSKVEAPKQVKKAAVKKEAAPKRTGKVLTAVINGKEMTVKEIAEAYD
FT                   ISTSTVRQRINAGKPESEIIAPTKKK"
FT   gene            complement(22562..23230)
FT                   /locus_tag="BMB171_C0014"
FT   CDS_pept        complement(22562..23230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0014"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04832"
FT                   /protein_id="ADH04832.1"
FT                   /translation="MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKV
FT                   DSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMH
FT                   HEKGTMTETDYETYKGLFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTP
FT                   IEYWKEMHGRYENWINNFNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
FT                   "
FT   gene            complement(23233..23868)
FT                   /locus_tag="BMB171_C0015"
FT   CDS_pept        complement(23233..23868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0015"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04833"
FT                   /protein_id="ADH04833.1"
FT                   /translation="MTGVPFITVEGPIGVGKTSLAKEISTHMQLHLLKEIVDENPFLGK
FT                   FYEDIDEWSFQTEMFFLCNRYKQLEDINIKYLNQRKPVVADYHIFKNLIFASRTLKDSQ
FT                   YDKYMQIYRILTQDMPVPNVIVYLTASLETLQKRIAMRGREFEKNMDPNYLLQLTKDYE
FT                   TAMDAFKKDHPEIPVLKFNGDDMDFVKNPDDLNVILSALQNTLLKESK"
FT   gene            complement(23994..24533)
FT                   /locus_tag="BMB171_C0016"
FT   CDS_pept        complement(23994..24533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0016"
FT                   /product="pyrazinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04834"
FT                   /protein_id="ADH04834.1"
FT                   /translation="MKNTALLIIDMINDFQFSHGPILAKKCETITNPILQLKKKMKSFG
FT                   YPIIYVNDHYQLWRSDIDQLITHCTNEYSENIIHKIAPSFDEYIFIKPHYSAFYETPLN
FT                   SLLGYLKIENLILTGVAGNICILFTANDAHMRNYKLYVPQDCIASNNDQDNIHALKIME
FT                   TTLKANITSSTKIKFN"
FT   gene            24643..25143
FT                   /locus_tag="BMB171_C0017"
FT   CDS_pept        24643..25143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0017"
FT                   /product="cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04835"
FT                   /protein_id="ADH04835.1"
FT                   /translation="MEQDQDIYFMQLAIEEAKKAEEIQEVPIGAVIVLDGEVISVAHNL
FT                   RETEQRSIAHAELLAIDDACKKLGTWRLEDATLYVTLEPCPMCAGGIVLSRVKRVVYGA
FT                   SDPKGGCAGTLMNLLTDERFNHQCEVVSGVLEEECGTLLTNFFRELRKKRKAIKKLEKN
FT                   TGN"
FT   gene            25701..27308
FT                   /gene="dnaX"
FT                   /locus_tag="BMB171_C0018"
FT   CDS_pept        25701..27308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="BMB171_C0018"
FT                   /product="DNA polymerase III subunits gamma and tau"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04836"
FT                   /protein_id="ADH04836.1"
FT                   /translation="MQNALLQEKVSHAYLFSGPRGTGKTTIAKVFAKAINCEHAPVAEP
FT                   CNECPSCLGITQGSISDVLEIDAASNNGVDEIRDIRDKVKYAPSAVEYKVYIIDEVHML
FT                   SMGAFNALLKTLEEPPGHVIFILATTEPHKIPPTIISRCQRFEFRKISVNDIVERLSTV
FT                   VTNEGTQVEGEALQIVARAAEGGMRDALSLIDQAISYSDEIVTTEDVLAVTGSVSQQYL
FT                   GNLVECIRENDVSRALQIIDEMMSKGKDPVRFMEDFIYYYRDMLLYQTSPQLEHMLERV
FT                   IVDDQFRKLSEEMQPEVIYEIIHTLSKGQQEMKWTNHPRIFLEVVMVQLCQQFMMQANG
FT                   TDRLQAIMNRMQQLEKELEQVKKNGVPAGVQQEVRETRATPKPVRTGSMKIPVGRVNEV
FT                   LKQAKRQDLEQLKAVWGELLGRLKSYNKVAFAVLLENSEPVAASDDTYVLAFQYEIHCK
FT                   MASENREAMDTVEQALFELLSKRLNMIAIPKSEWGKIREDFLQREGGESEESPEKKEDP
FT                   LIEEAVKLVGQELIEIKE"
FT   gene            27331..27660
FT                   /locus_tag="BMB171_C0019"
FT   CDS_pept        27331..27660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04837"
FT                   /protein_id="ADH04837.1"
FT                   /translation="MMRGGMGNMNNMMKQMQKMQKDMAKAQEELGEKTVEGTAGGGMIT
FT                   VIANGHKQILEVKIKEEVVDPEDIEMLQDLVLAATNDALKKADELSNSTMGKFTKGLNL
FT                   PGGMF"
FT   gene            27675..28271
FT                   /gene="recR"
FT                   /locus_tag="BMB171_C0020"
FT   CDS_pept        27675..28271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="BMB171_C0020"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04838"
FT                   /protein_id="ADH04838.1"
FT                   /translation="MHYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLDMKEDDVLGFAK
FT                   ALVNAKRDLAYCSVCGHITDRDPCYICNDSHRDQSVVCVVQEPKDVIAMEKMKEYQGVY
FT                   HVLRGAISPMEGIGPEDINIPQLLKRLHDETVQEVILATNPNIEGEATAMYISRLLKPT
FT                   GIKVTRIAHGLPVGGDLEYADEVTLSKALEGRREV"
FT   gene            28286..28507
FT                   /locus_tag="BMB171_C0021"
FT   CDS_pept        28286..28507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0021"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04839"
FT                   /protein_id="ADH04839.1"
FT                   /translation="MFFQKKGKLRKEYDDKLIVLLEKVKNEWLRQKRMVEQSVEPSQDV
FT                   ICSLKIAEAKYFFLLKEAKRRPVKMEQW"
FT   gene            28669..28938
FT                   /gene="bofA"
FT                   /locus_tag="BMB171_C0022"
FT   CDS_pept        28669..28938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bofA"
FT                   /locus_tag="BMB171_C0022"
FT                   /product="SigmaK-factor processing regulatory protein BofA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04840"
FT                   /protein_id="ADH04840.1"
FT                   /translation="MNSTIIIVGILTLVFIFLVFGVASKPLRFIGKVIFHVTLGIALLF
FT                   IVNVVGTYFDFHIPINMGTAAITSLLGLPGVAALVIIKLYIMPR"
FT   gene            29164..30703
FT                   /gene="rrf_2"
FT                   /locus_tag="BMB171_C5092"
FT   rRNA            29164..30703
FT                   /gene="rrf_2"
FT                   /locus_tag="BMB171_C5092"
FT                   /product="16S ribosomal RNA"
FT   gene            31308..34227
FT                   /gene="rrl_2"
FT                   /locus_tag="BMB171_C5093"
FT   rRNA            31308..34227
FT                   /gene="rrl_2"
FT                   /locus_tag="BMB171_C5093"
FT                   /product="23S ribosomal RNA"
FT   gene            34278..34392
FT                   /gene="rrs_2"
FT                   /locus_tag="BMB171_C5094"
FT   rRNA            34278..34392
FT                   /gene="rrs_2"
FT                   /locus_tag="BMB171_C5094"
FT                   /product="5S ribosomal RNA"
FT   gene            34582..34761
FT                   /locus_tag="BMB171_C0023"
FT   CDS_pept        34582..34761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0023"
FT                   /product="CsfB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04841"
FT                   /protein_id="ADH04841.1"
FT                   /translation="MKLQSEVCIVCETKRKEGIYVYNNLICHECEKDMVNTETDDPKYI
FT                   YYLKQLRKLEVSYF"
FT   gene            34833..36254
FT                   /locus_tag="BMB171_C0024"
FT   CDS_pept        34833..36254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0024"
FT                   /product="arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04842"
FT                   /protein_id="ADH04842.1"
FT                   /translation="MNQNRMPLYEALIEFKERGPLSFHVPGHKNGLNFPQEAIREFKGI
FT                   LSIDVTELAGLDDLHSPFECIDEAQQLLAEVYNTKRSYFLINGSTVGNLAMILSCCGEH
FT                   DIVLVQRNCHKSIINGLKLAGANPIFLDPWIDEAYNVPVGVRNEIIKNAIGKYPNAKAL
FT                   ILTHPNYYGMGMDLEASIAFAHAHKIPVLVDEAHGAHLCLGEPFPKSALTYGADIVVHS
FT                   AHKTLPAMTMGSYLHINSHLVDEDKVTTYLSMLQSSSPSYPIMASLDIARFTMARIKEE
FT                   GHSEIVEFLRRFKEQLRSIPQIAILEYPLQDELKVTVQTRCQLSGYELQSVFEKVGIYT
FT                   EMADPYNVLFILPLQVNEGYMKVIEMIRVALQHYEVKDKRESIRYTYNGEFSLLPYTYK
FT                   QLDGYETKIVSIEEAVGMIAAEMVIPYPPGIPLIMYGERITSEHKEQIMYLERAGARFQ
FT                   GNTKYMKVYDIESRF"
FT   gene            36256..36882
FT                   /gene="tmk"
FT                   /locus_tag="BMB171_C0025"
FT   CDS_pept        36256..36882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="BMB171_C0025"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04843"
FT                   /protein_id="ADH04843.1"
FT                   /translation="MKGLFVTIEGPEGSGKTTLIKSLLPYFEQKAQKVMATREPGGIAI
FT                   SEDIRTILHKQEYTMMEARTEALLYAAARRQHLVEKVMPALNEDYLVLCDRFIDSSLAY
FT                   QGYARGLGMDKIFEINRFATEDCMPSLTIYLDIEPEVGLARIEKDAGREVNRLDMEDIS
FT                   FHKRVREGYLQVVERFSDRIVLVNADQPMEKLIEEVVQIIEDKLL"
FT   gene            36918..37901
FT                   /gene="holB"
FT                   /locus_tag="BMB171_C0026"
FT   CDS_pept        36918..37901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="BMB171_C0026"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04844"
FT                   /protein_id="ADH04844.1"
FT                   /translation="MTKTWEQLSAIQPIGVKMLMNSIAKERISHAYLLEGGKGTGKFAT
FT                   AIQMAKSFLCSERNGVEPCHVCTNCKRIDSGNHPNLHIVKPDGLSIKKQQIHDLQEEFS
FT                   KTGLEANKKIYIIEHADRMTANAANTLLKFLEEPSSDTTAILLTEQSHQILNTILSRCQ
FT                   VVTFRPLPTESLIRRLQDEGITASLSTLAAQLTNSFDEALALCSDEWFAQARALVIKLC
FT                   EALEKDKTSIFFVQEKWGKHFGEKEQLQQGLDMLLLIYKDLLYVQLGEEDRLVFHEQKE
FT                   MFESFSYAQKRIVSALFNILEAKNRINANVNAQLVFEQLVLRLQEG"
FT   gene            37907..38734
FT                   /locus_tag="BMB171_C0027"
FT   CDS_pept        37907..38734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0027"
FT                   /product="tpl protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04845"
FT                   /protein_id="ADH04845.1"
FT                   /translation="MYDVVGVRFKKAGKVYYFDPNQFDISENEFVIVETVRGIEYGKVV
FT                   ITKKQVDENDVVLPLKKVIRIANENDRTIVEENKHAAKEAYQVCQQKVVEHNLDMKLVD
FT                   VEYTFDRNKIIFYFTADGRIDFRELVKDLAAIFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   MLCCSTFLGDFEPVSIKMAKDQNLSLNPAKISGLCGRLMCCLKYENDEYEAAKEQLPDL
FT                   DQRIQTPHGTGRVIGLNILERLIQVELVDKERIVEYTLDELVNKGVVSSQTTD"
FT   gene            38749..39099
FT                   /locus_tag="BMB171_C0028"
FT   CDS_pept        38749..39099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0028"
FT                   /product="DNA replication initiation control protein YabA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04846"
FT                   /protein_id="ADH04846.1"
FT                   /translation="MEKKDIFESVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMEN
FT                   NNLRHRFEEVQNKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFHICNLHYGSVRKEG
FT                   DCLFCLSFLNKK"
FT   gene            39182..39922
FT                   /locus_tag="BMB171_C0029"
FT   CDS_pept        39182..39922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0029"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04847"
FT                   /protein_id="ADH04847.1"
FT                   /translation="MNLYEDERLDYLLAQDMKIIQSPSVFNFSLDAVLLADFAWVPIQK
FT                   GNLLDLCTGNAVVPLLLSTRTKGNITGVEIQERLYDMGVRSVQYNGLEERIHLIHGDLK
FT                   DMPEKLGRHQYDVVTCNPPYFQTPQTSEKNMNEHLAIARHEIMCTLEDVVSASSQLVKQ
FT                   GGKVAFVHRPGRLLDIVTLMRKYKIEPKRVQFVYPKVGKEANTLLIEGIKDGNADLKIL
FT                   PPLVVYENNNEYTKELRSILYGEE"
FT   gene            40168..41043
FT                   /locus_tag="BMB171_C0030"
FT   CDS_pept        40168..41043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0030"
FT                   /product="Corrin/porphyrin methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04848"
FT                   /protein_id="ADH04848.1"
FT                   /translation="MWQQKSFQQNEKGVLYLVPTPIGNLEDMTFRAIRILKEVDLIAAE
FT                   DTRQTKKLCNYFKIETPVTSYHEHNKEVSGKKLLEKLEDGKNVALVSDAGMPCISDPGY
FT                   DIVVEAVAEQYHVIPLPGANAALTALIASGLETKQFYFYGFLQRNKKERKMELEKLRYV
FT                   QTTMMFYEAPHRLDDTLISMQEVLGNREIVLCRELTKKFEEFIRGTIEEAIEWTKQNEV
FT                   RGEFCILVAGSTEEPAPEEQWWESLSVYDHIEYYINEKSMNSKEAIKTVAKDRDLSKRD
FT                   VYQIYHVDKK"
FT   gene            complement(41064..41348)
FT                   /gene="abrB"
FT                   /locus_tag="BMB171_C0031"
FT   CDS_pept        complement(41064..41348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="abrB"
FT                   /locus_tag="BMB171_C0031"
FT                   /product="transcription state transcriptional regulator
FT                   AbrB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04849"
FT                   /protein_id="ADH04849.1"
FT                   /translation="MKSTGIVRKVDELGRVVIPIELRRTLGIAEKDALEIYVDDEKIIL
FT                   KKYKPNMTCQVTGEVSDGNLSLAEGKIILSKEGAEQILNELQDYIETAK"
FT   gene            41834..43816
FT                   /gene="metS"
FT                   /locus_tag="BMB171_C0032"
FT   CDS_pept        41834..43816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="BMB171_C0032"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04850"
FT                   /protein_id="ADH04850.1"
FT                   /translation="MTEENKSFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRMQGYN
FT                   VHYLTGTDEHGQKIQKKAEELNITPQAYVDNIVAGIKELWEKMDISYDDFIRTTEDRHK
FT                   DVVEKIFKQLVDQGDIYLDEYEGWYSVQDETFYTEHQLVDPIMEGDKVVGGKSPDSGHD
FT                   VELVREESYFFRMGKYVDRLLKFYEDNPHFIQPESRKNEMINNFIKPGLEDLAVSRTSF
FT                   DWGVRVPGNPKHVIYVWVDALSNYITALGYGTANEEKYKKFWPADVHLVGKEIVRFHTI
FT                   YWPIILMALDLPLPKKVFAHGWILMKDGKMSKSKGNVVDPVTLIDRYGLDALRYYLLRE
FT                   VPFGSDGVFTPEGFVERINFDLANDLGNLLNRTVAMIDKYFNGEIPAFKANVTEFDETL
FT                   VAFAQDTLKKVEEAMENMEFSVALGSIWQLVSRTNKYIDETQPWVLAKDENDREKLASV
FT                   MAHLAEVLRQTGIMLMPFLTVAPSKMFAQLGLTDEAHKSWESLSTIGCIPAGTKVEKGN
FT                   PIFPRLEMEVEVEYIKEQMKSSAPKVEEKKEEEPKAEEITIDDFFKVELRVAEVLSAEP
FT                   VKKADKLLKIQLDLGTEKRQVVSGIAKFYSPEDLKGKKVICVTNLKPVKLRGELSQGMI
FT                   LAGEENGVLSLASIDQNLPNGTKIK"
FT   gene            43983..44750
FT                   /locus_tag="BMB171_C0033"
FT   CDS_pept        43983..44750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0033"
FT                   /product="Sec-independent secretion protein tatD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04851"
FT                   /protein_id="ADH04851.1"
FT                   /translation="MLFDTHSHLNAEQFEGDLQEVIARMKEAGVTYTVVVGFDEVTIKK
FT                   AMELAEAYDFIYAAVGWHPVDAIDMTEEHLAWLEELASHPKVVALGEMGLDYHWDKSPK
FT                   EIQKEVFRKQIALAKKVKLPIIIHNRDATQDIVDILEEENAAEVGGIMHCFSGSVEVAE
FT                   RCVDMNFLISLGGPVTFKNAKKPKEVATEIPLEKLLIETDCPYLTPHPFRGKRNEPSYV
FT                   KLVAEEIANLKGISYEEVAEMTTKNAKVLFGVE"
FT   gene            44965..45522
FT                   /locus_tag="BMB171_C0034"
FT   CDS_pept        44965..45522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0034"
FT                   /product="ribonuclease M5"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04852"
FT                   /protein_id="ADH04852.1"
FT                   /translation="MKIKEIIVVEGKDDTVAIKRAVDADTIETNGSAIGDHVIEQVKLA
FT                   QQKRGVIIFTDPDYPGERIRKIISDKVPGCKHAFLPKEEALAKRKKGVGIEHASNESIR
FT                   RALENIHEEMEAYTSEISWSDLVDAGLVGGEMAKSRRERMGKLLKIGYTNAKQLHKRLQ
FT                   MFQVSKESFAEAYKQVIQEEKK"
FT   gene            45519..46397
FT                   /gene="ksgA"
FT                   /locus_tag="BMB171_C0035"
FT   CDS_pept        45519..46397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BMB171_C0035"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04853"
FT                   /protein_id="ADH04853.1"
FT                   /translation="MKDIATPNRTKDIVEKYGFSFKKSLGQNFLIDTNVLNRIVDHAEI
FT                   GSESGAIEIGPGIGALTEQLAKRAKKVVAFEIDQRLLPILDETLAPYGNVTVINKDVLK
FT                   ADVHEVFNEQFEEGQDVMVVANLPYYITTPILFKLLEEKLPVRGFVVMMQKEVGDRLAA
FT                   KPGTKEYGSLSIAIQYYTEVETVMTVPRTVFVPQPNVDSAIIRLLKRPKPVVEVTDETF
FT                   FFEVVRASFAQRRKTLMNNLSNNLNGFPKDKELLDRILTEVGIDPKRRGETLSIEEFAT
FT                   LSNALVLHKLS"
FT   gene            46508..47371
FT                   /locus_tag="BMB171_C0036"
FT   CDS_pept        46508..47371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0036"
FT                   /product="sporulation-specific protease YabG"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04854"
FT                   /protein_id="ADH04854.1"
FT                   /translation="MVLHVGELVERYSHKRDILFRIIEIKGEIAILFGEEIRLVADAPL
FT                   EDLISIDQREHKKRVKREKETMERTYRLFQQDYVLMKQRHEHTSTGGYTSEVNYFQMPG
FT                   RVLHIDGDPLYLRKCLDLYNKIGVPVQGIHCKETEMHEKVVDLIDHFRPDILVITGHDA
FT                   YTKSKGVKGDLAAYRHSRHFVQAVREVRKKYPSLDQLVIFAGACQSHFEALIRAGANFA
FT                   SSPSRINIHALDPVYVVGKISFTSFMERVNVWDVVRNTITGEKGLGGIETRGILRTGLP
FT                   FQHYEE"
FT   gene            47598..47858
FT                   /locus_tag="BMB171_C0037"
FT   CDS_pept        47598..47858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0037"
FT                   /product="VEG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04855"
FT                   /protein_id="ADH04855.1"
FT                   /translation="MSKRLDEIKSELDHHLGQRLMLKANSGRRKTVEQSGVLAETYRSV
FT                   FVVQLDQQEDALQRVSYSYADVLTETVELTFYGDPHNEVIL"
FT   gene            47971..48129
FT                   /gene="sspF"
FT                   /locus_tag="BMB171_C0038"
FT   CDS_pept        47971..48129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspF"
FT                   /locus_tag="BMB171_C0038"
FT                   /product="SspF protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04856"
FT                   /protein_id="ADH04856.1"
FT                   /translation="MSNQFKEELAKELGFYDVVQKEGWGGIRAKDAGNMVKRAIEIAEQ
FT                   QLMKRNQ"
FT   gene            48419..49195
FT                   /gene="ipk"
FT                   /locus_tag="BMB171_C0039"
FT   CDS_pept        48419..49195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ipk"
FT                   /locus_tag="BMB171_C0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04857"
FT                   /protein_id="ADH04857.1"
FT                   /translation="MTTIDLADRLELTELAEDRIEILSHNRYVPDDQRNLAYQAAKLLK
FT                   EKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLGLTIDELAELGAEIGS
FT                   DVSFCVYGGTAIATGRGEKIEHIKTPPSCWVILAKPHIGVSTADVYGNLKLNRVTHPNV
FT                   DKMVDVINSGDYKGICDTVGNVLEDVTFGMHPEVARIKSQMKRFGADAVLMSGSGPTVF
FT                   GLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE"
FT   gene            49250..50098
FT                   /gene="purR"
FT                   /locus_tag="BMB171_C0040"
FT   CDS_pept        49250..50098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="BMB171_C0040"
FT                   /product="purine operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04858"
FT                   /protein_id="ADH04858.1"
FT                   /translation="MKIRRSTRLVDMTYYLLQNPRQLVSLTFFAERYQSAKSSISEDLV
FT                   IIKQTFEQQGVGTLQTIPGAAGGVKYIPYISEEEADLIIDELCGLFENPDRILPGGYLY
FT                   MTDLLSNPRHINGAGRLFASVFARQPIDAVMTVATKGIPLAYAVANYLDVPVVIARKDN
FT                   KVTEGPTVSINYVSGSSKRIQTMTLAKRSLPEGSNVLIIDDFMKAGGTIQGMMSMLEEF
FT                   KANVVGIGVLVESTDIEERLINNFVSLIRLSEVDVKEKTIQVEKGNYSLAPFDEGLVEA
FT                   E"
FT   gene            50219..50593
FT                   /locus_tag="BMB171_C0041"
FT   CDS_pept        50219..50593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0041"
FT                   /product="translation initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04859"
FT                   /protein_id="ADH04859.1"
FT                   /translation="MKVVQTSKAPQAIGPYSQGIIVNNMFYSSGQIPLTANGELVTGDV
FT                   TVQTEQVFQNLQAVLEEAGASFDTVVKTTVFLKDMDDFNAVNEVYSSYFSTHKPARSCV
FT                   QVAKLPKDVSVEIEVIALVK"
FT   gene            50794..51039
FT                   /gene="spoVG"
FT                   /locus_tag="BMB171_C0042"
FT   CDS_pept        50794..51039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVG"
FT                   /locus_tag="BMB171_C0042"
FT                   /product="regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04860"
FT                   /protein_id="ADH04860.1"
FT                   /translation="MRAIASITLDHEFVVHDIRVIDGNNGLFVAMPSKRTPDGEFRDIA
FT                   HPINSGTRSKIQDAVLTEYHRLGELEEVEFEEAGAS"
FT   gene            51353..52732
FT                   /gene="gcaD"
FT                   /locus_tag="BMB171_C0043"
FT   CDS_pept        51353..52732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcaD"
FT                   /locus_tag="BMB171_C0043"
FT                   /product="glucosamine-1-phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04861"
FT                   /protein_id="ADH04861.1"
FT                   /translation="MSNRFAVILAAGKGTRMKSKLYKVLHPVCGKPMVQHVVDQVSQLG
FT                   LQKLVTVVGHGAEMVQEQLGNVSEFALQAEQLGTAHAVDQAASVLANEEGTTLVICGDT
FT                   PLITAETMEALLQQHKEAGAMATVLTAHIEEPAGYGRIVRNENGHVEKIVEHKDANEKE
FT                   LAIKEINTGTYCFDNKALFASLSKVSNDNVQGEYYLPDVIEILKNEGHIVSAYQTEQFD
FT                   ETLGVNDRVALSQAEIIMKNRINRKNMVNGVTIIDPSNTYISADAVIGSDTVLHPGTII
FT                   EGNTVIGSDCEIGPHTVIRDSEIGDRTTIRQSTVHDSKLGTEVSVGPFAHIRPDSVIGD
FT                   EVRVGNFVEIKKTVFGNRSKASHLSYIGDAQVGEDVNLGCGSITVNYDGKNKFKTVIGN
FT                   GVFIGCNSNLVAPVTVEDGAYVAAGSTITENVPSKALSVARARQVNKEDYVDQLLNKKK
FT                   S"
FT   gene            complement(52847..52966)
FT                   /locus_tag="BMB171_C0044"
FT   CDS_pept        complement(52847..52966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04862"
FT                   /protein_id="ADH04862.1"
FT                   /translation="MFVYWEACRLNNEYIATTDTFFNVNLNFSITKTINRTFS"
FT   gene            52970..53704
FT                   /locus_tag="BMB171_C0045"
FT   CDS_pept        52970..53704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0045"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04863"
FT                   /protein_id="ADH04863.1"
FT                   /translation="MELLIMIDALKRASAKTINIVIPYYGYARQDRKARSREPITSKLV
FT                   ANLLETAGATRVITLDLHAPQIQGFFDIPIDHLMGVPILSDYFETKGLKDIVIVSPDHG
FT                   GVTRARKMADRLKAPIAIIDKRRPRPNVSEVMNIIGNIEGKTAILIDDIIDTAGTITLA
FT                   ANALVENGASEVYACCTHPVLSGPAIERIQNSNIKELVVTNSIVLPEEKKIDKVHELSV
FT                   APLIGEAIIRVYEEESVSVLFN"
FT   gene            53714..54337
FT                   /gene="spoVC"
FT                   /locus_tag="BMB171_C0046"
FT   CDS_pept        53714..54337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVC"
FT                   /locus_tag="BMB171_C0046"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04864"
FT                   /protein_id="ADH04864.1"
FT                   /translation="MRRNQNWLRLFVSKKESSGTRMKLIVGLGNPGREYELTRHNIGFM
FT                   AIDELAKRWNISLNEQKFKGVFGAGFVNGEKVILLKPLTYMNLSGESIRPLMDYYKIDV
FT                   EDFVVMYDDLDIPVGKLRLRMKGSAGGHNGVKSTISHLGTQEFQRIRMGIDRPKNGMKV
FT                   VDYVLGRFTSEEIPDVNHSIEKAADACEEWLNKPFLQIMNTFNS"
FT   gene            54408..54632
FT                   /locus_tag="BMB171_C0047"
FT   CDS_pept        54408..54632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0047"
FT                   /product="hypothetical protein"
FT                   /note="similar to BC0057"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04865"
FT                   /protein_id="ADH04865.1"
FT                   /translation="MEGYYYCRHCGGNVGSINAEKVYSDVLFQLTEQEVVEMIHFHENG
FT                   NIYIKTICESCQETLASYPEYYEYEKFLQ"
FT   gene            54738..58268
FT                   /gene="mfd"
FT                   /locus_tag="BMB171_C0048"
FT   CDS_pept        54738..58268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="BMB171_C0048"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04866"
FT                   /protein_id="ADH04866.1"
FT                   /translation="MIGLLEQFYKNEEIQSVINGLEDGLKEQLISGMATSSRSLLMAAL
FT                   YKKTKKSQLIVTHNLYQAQKVHEDLVALLGEKDVWLYPVNELIASEIGVASPELKAQRI
FT                   EVLNRLAAGENGIIVAPVAGLRRFLPIKELWKQKQVEINLGQEIDLDALLHTLHHIGYE
FT                   RKSMVEAPGEFSLRGGILDIYPLTEELPFRIEFFDTEVDSIRLFDVDEQRSQGKKESVR
FT                   FGPATEFLFSQEELKSGIQHLEEGLTKTMQKLSDDKLKTTVLETVSHEIEMLKNGQSIE
FT                   QMFKYLSIFYKEPASLIDYLPEDGVVILDEISRIQETASHLETEEAEWYISLLGEGTII
FT                   QDLSFSHPFEGFLHHKKRSFVYLTLFLRHIAHTHPQNIVNVTCKTMQDFHGQMNLLKTE
FT                   IDRWNEGHFTTVVLGTDDERVKKLQHILSDYDIEADIVEGTDILLPGRLQIAVGDLHAG
FT                   FEMPMQKLVVITEKELFHKKVKKSQRKQKLSNAERIKSYSELKVGDYVVHVNHGIGKFL
FT                   GIETLEINGVHKDYLNIKYQGNDKLYVPIEQIDQVQKYVGSEGKDPKVYKLGGNDWKKV
FT                   KTKVEKSVQDIADDLIKLYAEREASKGYAYTPDTAEQQEFESSFPYQETEDQLRSIDEI
FT                   KKDMERGRPMDRLLCGDVGYGKTEVAIRAAFKAIMDEKQVAILVPTTILAQQHYETIRE
FT                   RFQDYPINIGLLSRFRTRKQQNETIKGLKDGTVDIVIGTHRILSKDVTYKDLGLLIIDE
FT                   EQRFGVTHKEKIKQLKANVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTY
FT                   VVEYNPALMREAIERELARGGQVYFLYNRVEDIERKADEISMLVPDARVTYAHGKMNES
FT                   ELESVMLSFLEGQHDVLVSTTIIETGVDIPNVNTLIVFDADRMGLSQLYQLRGRVGRSN
FT                   RVAYAYFAYKRDKVLSEVAEKRLQAIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGF
FT                   IDSVGFDLYSQMLKDAIEQRRGTDGAENIVNVEIDLEVDAYLPDAYISDSKQKIMMYKQ
FT                   FRGVSAIEDIEELQEEMIDRFGDYPQEVGYLLQIANIKVLAMKEQIELIKQNKFEVTFL
FT                   FSEQASQNIDGGKLFMLGNSFGRMIGLGMEGSQLKIVMKTNGLETSKWLTIAENLLKGL
FT                   PDVKKEVINA"
FT   gene            58405..58941
FT                   /gene="spoVT"
FT                   /locus_tag="BMB171_C0049"
FT   CDS_pept        58405..58941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVT"
FT                   /locus_tag="BMB171_C0049"
FT                   /product="stage V sporulation protein T"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04867"
FT                   /protein_id="ADH04867.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPISELGDFAKEYADALYDSLGHNVLVCDRDSIIAVSGVSKKEYLNKSVGDLIEK
FT                   TMEERKSVIMTDESDISIIDGVTEKVHSYTVGPIVANGDPIGAVIIFSKEAIISEIEHK
FT                   AVNTAASFLAKQMEQ"
FT   gene            59172..60773
FT                   /locus_tag="BMB171_C0050"
FT   CDS_pept        59172..60773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0050"
FT                   /product="polysaccharides export protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04868"
FT                   /protein_id="ADH04868.1"
FT                   /translation="MEAKKYQAFWRGAIILTIASFVTKVLSAFYRIPYQNIAGDIGFYI
FT                   YQQIYPFYGFCLILATYGFPVIISKMVAERLEQGKQKEAEEIICVSFWFLLGIGFIGFF
FT                   TLFFGAETIAVAMGDIHLDKLLRVISFSFLLMPFLSVARGYFQGFNNMMPTAVSQVIEQ
FT                   TIRVSIIVFLSLFLIAHGFDLYTVGAGAMLGSIAGGLIGIIVLILYMRQDFRSIFFKSA
FT                   ARIKGKRKIVKILFWQGLAICVSNLVLIFIQMADSVSFYSLLIGAGEQVENAKVLKGVY
FT                   DRSIPLMQLGTVVTTSFSLSLIPIITAAKERGDLSFIQEKVKLAMKITFVIGLAAAIGL
FT                   TCIIQPTNIMLFENSDGSDVLSILSLSILFSSLSITTASILQGLGQTFKPALFVVFGGC
FT                   LKLALNYIFMPYFGVKGAAFATLCALIIISGLNSLLLTRAVSGSLINKRNMLGIVISGI
FT                   CMGFVLMMFTRVLQMSGLVINTEHRGSATLEALLGVAIGGLTYMFFILKLRVFTKKELG
FT                   TVMKQEKKEGSLKKSG"
FT   gene            60786..62246
FT                   /locus_tag="BMB171_C0051"
FT   CDS_pept        60786..62246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0051"
FT                   /product="MazG protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04869"
FT                   /protein_id="ADH04869.1"
FT                   /translation="MSGIITILGLGAGELDQLTMGVYRKIKEADHLFVRTKEHPVIEEL
FT                   EKEGVQYTSFDAVYEAHDTFEIVYETIANKLLEQAEGTEIIYAVPGHPLVAERTVQLLL
FT                   EKGEVSNVEVRIEGGQSFLDPMFASLKIDPIEGFQLLDATSFERGQLELRQHLIFCQVY
FT                   DAFVASDVKLTLMEMLPDDYEVYIVTAAGTSFEQVKKVPLYMLDHETELNNLTSVYVPP
FT                   VQERASLYQQFDVLREIIAELRGPNGCPWDKKQTHQSLKKYLIEEAYEVLEAIDEEDDD
FT                   HLVEELGDILLQVMLHAQIGEDEGWFSIDDIIRTLSEKMVRRHPHVFGNTDVNSADEVI
FT                   ANWEEIKKQEKGFVKESVLNGVPKSLPQLLRAYEIQKKAGKVGFDWVDVQPMIEKALEE
FT                   WQEFQQEVTNMDEEKMLGEFGDLLFAFVNIARHYKIDPEEALRSTNEKFTGRFLYMEAK
FT                   VAEMNKEMKDLSLEQLDVLWEEAKQTER"
FT   gene            62261..62536
FT                   /locus_tag="BMB171_C0052"
FT   CDS_pept        62261..62536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0052"
FT                   /product="heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04870"
FT                   /protein_id="ADH04870.1"
FT                   /translation="MRLDKFLKVSRLIKRRTLAKEVADQGRISINGQVAKASSDVKVAD
FT                   ELTIRFGQKIVTVKINELKETTKKEDAANMYSLVREEKVKAEEGLF"
FT   gene            62745..62903
FT                   /gene="yabP"
FT                   /locus_tag="BMB171_C0053"
FT   CDS_pept        62745..62903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabP"
FT                   /locus_tag="BMB171_C0053"
FT                   /product="hypothetical protein"
FT                   /note="similar to BC0063"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04871"
FT                   /protein_id="ADH04871.1"
FT                   /translation="MGFLTIRGQNLQMKNLDVEKGIVSIKGKVNEMLYIDENQGEKTKG
FT                   FFSKLFK"
FT   gene            62900..63553
FT                   /gene="yabQ"
FT                   /locus_tag="BMB171_C0054"
FT   CDS_pept        62900..63553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yabQ"
FT                   /locus_tag="BMB171_C0054"
FT                   /product="spore cortex biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04872"
FT                   /protein_id="ADH04872.1"
FT                   /translation="MSLTIQLYTMLSMIGMGAWIGASLDTYQRFLKRQERKRWLVFIHD
FT                   ILFWIVQALFVFYVLLLVNEAELRIYVFLALLCGFAAYQSLLKALYMKLLNFLIYIFMQ
FT                   TTYFFVRIIQLLMIKPVIIIAQLFIAFILFLFRILLSIGHVLWKMVIWILLFIWKVFFW
FT                   PVRFIASLIWKLLPNRVKLFIVKHIGFLQYIAKLKGHIFQLWEHIKKKLGGPRK"
FT   gene            63550..63909
FT                   /gene="divIC1"
FT                   /locus_tag="BMB171_C0055"
FT   CDS_pept        63550..63909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="divIC1"
FT                   /locus_tag="BMB171_C0055"
FT                   /product="cell division protein DIVIC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04873"
FT                   /protein_id="ADH04873.1"
FT                   /translation="MRELRQRTIEKQSPNPVKEHIIQTDENRKRLYRRLAVFLVFTFTI
FT                   IASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKLNDEEYVLKIARRD
FT                   YFFSGKGEIIFPVSK"
FT   gene            63997..64482
FT                   /locus_tag="BMB171_C0056"
FT   CDS_pept        63997..64482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04874"
FT                   /protein_id="ADH04874.1"
FT                   /translation="MSIEVGSKLQGKVTGITNFGAFVELPEGLTGLVHISEVADNYVKD
FT                   INDHLKVGDQVEVKVINVEKDGKIGLSIKKAKEREKTEGDRPRGEYQRGGDQQRSGRPQ
FT                   RNNRSFNRDNRGGGNDRAPKETFEQKMARFLKDSEDRLTSLKRNTESKRGGRGARRG"
FT   gene            64642..64715
FT                   /locus_tag="BMB171_C5132"
FT   tRNA            64642..64715
FT                   /locus_tag="BMB171_C5132"
FT                   /product="tRNA-Met"
FT   gene            64729..64800
FT                   /locus_tag="BMB171_C5133"
FT   tRNA            64729..64800
FT                   /locus_tag="BMB171_C5133"
FT                   /product="tRNA-Glu"
FT   gene            65060..67531
FT                   /gene="spoIIE"
FT                   /locus_tag="BMB171_C0057"
FT   CDS_pept        65060..67531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIE"
FT                   /locus_tag="BMB171_C0057"
FT                   /product="stage II sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04875"
FT                   /protein_id="ADH04875.1"
FT                   /translation="MPKAGRNTMNTSALAMNESQLDGIKWTSKLRMKFEQVFFRWGFII
FT                   VVIGFLLGRAYILTNILPFALPFFAAVYVMKRDKMPLAFLALMGGALSVSIDNLFFTFA
FT                   SIFTFFIYNIFFSRFTRKTVGLVPFQVFISALTAHLVVVYFAQQTVTMYDLLVSTIEAG
FT                   LSFVLTMIFLQSVPLLVERKGKQQALETEEIVCLIILLASVLTGTTDWFVYDASIQHIF
FT                   TRYLVLVFAFIAGAATGSTVGVVTGLILSLANVSSLSQLSLLAFSGLLGGLLKEGKRLG
FT                   VSLGLLIGTSLITLYVDKQTNIVTTLIESGVAIVIFLLTPKLVLDRIAKFMPGTQEHSQ
FT                   DQQQYLRRMRDVTANKINQFANVFAALSNSFSVYGYVEEEDKETEADLFLSTITAKTCQ
FT                   TCFKKDQCWVVNFDKTYDYMKQIMNETEEGTLQHNRKLVREWDKHCVRGKKVTDLVAGE
FT                   LDHFYEGQKLRKQMKENRRIVAEQLLGVSKVMEDFAKEIQRERENHQVQEEQIMQAFRD
FT                   FGVEVEHVDIYCLDRGSIDIEMLIPVASNEHGECEKLVAPMLSDILKENIVVKHEEKSS
FT                   YPNGHSLISFGSAKTYSLDTGLATAAKGGGFVSGDSYAMMDLSVGKYALAISDGMGNGQ
FT                   RAHMESKETVKLLQKILQSGIDEEIAIKSINSILSLRTTEEMFTTLDLAMVDLRDASAR
FT                   FLKIGSTPSFVKRANNILKIEASNLPMGIIEDVEVDVVGEQLKTGDILIMMSDGIFEGA
FT                   QHVENHELWMKRKIKELQTEDPQEIADIIMEEVIRSCDGYINDDMTIVVAKVKKNMPKW
FT                   ATIPIVGMQAQ"
FT   gene            67762..69192
FT                   /gene="tilS"
FT                   /locus_tag="BMB171_C0058"
FT   CDS_pept        67762..69192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BMB171_C0058"
FT                   /product="cell cycle protein MesJ"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04876"
FT                   /protein_id="ADH04876.1"
FT                   /translation="MKDTFVEKVDDFVKQHDVLKNDSTIVVGVSGGPDSLALLYYLLEK
FT                   RAEKQLEIVVAHVDHMFRGDESYEDLQFVQGLCEELGIICETIRINVSQYQQQYGMNAQ
FT                   VAARECRYAFLERIMKKYDARYVALGHHGDDQVETILMRLVRGSTPKGYAGIAVKRPFH
FT                   NGYLIRPLLGVTKEEIVDYCNKLNLMPRIDPSNKKEVYTRNRLRKYVLPHLKEENPQMH
FT                   EKFQKFSVQMQEDEAYLQELAFEKMNKVITKKSDKQISLSIPAFESMSMPLQRRGIQLI
FT                   LNYLYEYKIPSSLSSIHIDKLIEFFKRTQPSGSLDFPGDLKIVRSYEECSFRFKQEIVS
FT                   PFSQDLLVPGIITLLNGDEFVTEVSEDIPSNMNETVFVAKYNDISYPLRIRSRENGDRM
FT                   SIQGMNGTKKIKAIFIEAKVPKEKREEWPVVCDASGTIIWVPLLKRSAFAISKEMAKKD
FT                   KYMIIHYKSKESSGRIMK"
FT   gene            69189..69731
FT                   /gene="hpt_2"
FT                   /locus_tag="BMB171_C0059"
FT   CDS_pept        69189..69731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpt_2"
FT                   /locus_tag="BMB171_C0059"
FT                   /product="hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04877"
FT                   /protein_id="ADH04877.1"
FT                   /translation="MMNQDIEKVLISEEQIQEKVRELGAIIAEDYKNTVPLAIGVLKGA
FT                   MPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTGEVKILKDLDTSVEGRDILIVEDIIDS
FT                   GLTLSYLVDLFKYRKAKSVKIVTLLDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQ
FT                   YRNLPYVGVLKPSVYSN"
FT   gene            69817..71718
FT                   /gene="ftsH"
FT                   /locus_tag="BMB171_C0060"
FT   CDS_pept        69817..71718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="BMB171_C0060"
FT                   /product="cell division protein ftsH"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04878"
FT                   /protein_id="ADH04878.1"
FT                   /translation="MNRIFRNTIFYLLIFLVVIGIVSYFNGSTQKTTSVSYDKFITKLE
FT                   SGEVRNVQLQPKNGVFEVKGQFNNSSQGEQFVTYAPNTEELQKKINDKAKGAEVKYQPA
FT                   EETSAWVTFFTSIIPFVIIFILFFFLLNQAQGGGSRVMNFGKSKAKLYNDEKKKVRFRD
FT                   VAGADEEKQELVEVVEFLKDPRKFSEVGARIPKGVLLVGPPGTGKTLLARAVAGEAGVP
FT                   FFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGGGHDER
FT                   EQTLNQLLVEMDGFGANEGIIIVAATNRPDILDPALLRPGRFDRQITVDRPDVNGREAV
FT                   LKVHARNKPLDEHINLRAIATRTPGFSGADLENLLNEAALVAARQDKKKIDMSDIDEAT
FT                   DRVIAGPAKKSRVISEKERNIVAFHEAGHTVIGVVLDEADVVHKVTIVPRGQAGGYAVM
FT                   LPKEDRYFMTKPELLDKITGLLGGRVAEEIVFGEVSTGAHNDFQRATGIARRMVTEFGM
FT                   SDKLGPMQFGSSQGGQVFLGRDFHSEQNYSDAIAHEIDMEMQSIMKECYARAKQILTEN
FT                   RDKLDIIAQTLLEVETLDAEQINHLCDYGRLPERPTSSDDVKVNINMKKDDEDKEDK"
FT   gene            71963..72751
FT                   /gene="coaX"
FT                   /locus_tag="BMB171_C0061"
FT   CDS_pept        71963..72751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="BMB171_C0061"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04879"
FT                   /protein_id="ADH04879.1"
FT                   /translation="MIFVLDVGNTNAVLGVFEEGELRQHWRMETDRHKTEDEYGMLVKQ
FT                   LLEHEGLSFEDVKGIIVSSVVPPIMFALERMCEKYFKIKPLVVGPGIKTGLNIKYENPR
FT                   EVGADRIVNAVAGIHLYGSPLIIVDFGTATTYCYINEEKHYMGGVITPGIMISAEALYS
FT                   RAAKLPRIEITKPSSVVGKNTVSAMQSGILYGYVGQVEGIVKRMKEEARQEPKVIATGG
FT                   LAKLISEESNVIDIVDPFLTLKGLYMLYERNANLQHEKGE"
FT   gene            72758..73633
FT                   /gene="hslO"
FT                   /locus_tag="BMB171_C0062"
FT   CDS_pept        72758..73633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="BMB171_C0062"
FT                   /product="Hsp33-like chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04880"
FT                   /protein_id="ADH04880.1"
FT                   /translation="MKDYLVKALAFDGEVRAYSVRTTNTVSEAQRRHDTWRTASAALGR
FT                   SLTAGTMMGAMLKGEQKLTIKVEGNGPIGPILVDAHANGDVRGYVTNPHVDFEGTEQGK
FT                   LRVYQAVGTEGFVTVIKDIGMREPFIGQSPIVSGELGEDFTYYFAVSEQTPSSVGVGVL
FT                   VNGDDSILAAGGFILQIMPGAQDETISFIEDRLQKIPPVSTLIEQGLSPEELLYAVLGE
FT                   DKVKVLETMDVQFNCTCSRERIESVLISLGKTELEQVREEEEETEVHCHFCNERYKFSK
FT                   EDITNLIENL"
FT   gene            73747..74670
FT                   /gene="cysK1"
FT                   /locus_tag="BMB171_C0063"
FT   CDS_pept        73747..74670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK1"
FT                   /locus_tag="BMB171_C0063"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04881"
FT                   /protein_id="ADH04881.1"
FT                   /translation="MRVAQSVSELIGKTPIVKLNRIVESDSADIYLKLEFMNPGSSVKD
FT                   RIALAMIEDAEKKGLLKEGDTIIEPTSGNTGIGLAMVAAAKGYNAILVMPETMSIERRN
FT                   LLRAYGAELVLTPGPEGMGGAIRKATELAKEHGYFIPQQFKNQSNPEIHRLTTGPEIIE
FT                   QMGDRLDAFIAGIGTGGTITGAGEVLKEAYKDIKIYAVEPADSPVLSGGKPGPHKIQGI
FT                   GAGFVPETLDVEVYDEIIQVKTEQAFEYARRVAKEEGILVGISSGAVIYGATEVAKKLG
FT                   KGKKVLVIIPSNGERYLSTPLYQFES"
FT   gene            74893..76290
FT                   /gene="pabB"
FT                   /locus_tag="BMB171_C0064"
FT   CDS_pept        74893..76290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabB"
FT                   /locus_tag="BMB171_C0064"
FT                   /product="para-aminobenzoate synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04882"
FT                   /protein_id="ADH04882.1"
FT                   /translation="MQRRKSLALSIPYQLDFFKQYKFLSQGKSQHILLESGRGGRYNIV
FT                   GLNPVAVIRGKGEMLHISESGKETIKRGNPLDLMQEYMEQWKTDYNPEYPPFQGGAIGY
FT                   FSYDCIRYIEKLPSLAEDDIDIPDIFFLLFDDVFVYDQKEQVLWVITHYVDKYEEAKER
FT                   LNEWKSLWMTEAPEVTVPFESPEKKSEAVAFTEAGFMKAVECIQEYIGAGDVFQVNLST
FT                   RQERTLQTHPLEIYTSLREINPSPYMGYLELGDFQIVSGSPELLIKKQGTEVSTRPIAG
FT                   TRSRGADEQEDEELARELIENEKERAEHVMLVDLERNDLGRVCRYGTVEVDEFMVIEKY
FT                   SHVMHIVSNVRGEVEEDKDAFDLVKAVFPGGTITGAPKIRTMEIIEELEPVRRGIYTGS
FT                   IGWIGYSGDTELNIVIRTLLAKDGKAHVQAGAGIVIDSNPENEYKESLKKAIALWRAKE
FT                   RSEETVR"
FT   gene            76296..76883
FT                   /gene="pabA"
FT                   /locus_tag="BMB171_C0065"
FT   CDS_pept        76296..76883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="BMB171_C0065"
FT                   /product="para-aminobenzoate/anthranilate synthase
FT                   glutamine amidotransferase component II"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04883"
FT                   /protein_id="ADH04883.1"
FT                   /translation="MILMIDNYDSFTFNLVQFLGELGQELVVKRNDEVTISDIENMKPD
FT                   FLMISPGPCSPNEAGISMEAIKYFAGKTPIFGVCLGHQSIAQVFGGEVVRAERLMHGKT
FT                   SLMHHDGKTIFSDIPNPFTATRYHSLIVKKETLPDCLEVTSWTEEGEIMALRHKTLPIE
FT                   GVQFHPESIMTSHGKELLQNFIRKYSPSATLC"
FT   gene            76877..77749
FT                   /gene="pabC"
FT                   /locus_tag="BMB171_C0066"
FT   CDS_pept        76877..77749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="BMB171_C0066"
FT                   /product="4-amino-4-deoxychorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04884"
FT                   /protein_id="ADH04884.1"
FT                   /translation="MLIYVNGQYVEASEARISPYDHGYLYGLGVFETFRIYNGHPFLLD
FT                   DHYNRLIEALDTLQIKWTMTKNDVMLILKDLLAKNELKHAYVRFNVSAGIDEIGLQTEM
FT                   YEEPSVIVFIKPLTAPGDVVEKEGVILKQVRNTPEGTFRLKSHHYLNNILGKREIGNVV
FT                   SKEGIFLTEAGYVAEGIVSNLFFVKGDVLYTPSLETGILNGITRAFIIKSAEELNIEVK
FT                   EGFFTKDELLSADEVFVTNSIQEIVPLYRIEAQDFPGKVGVVTKSLMYLYGMQREKLWS
FT                   RNELRRGDV"
FT   gene            77751..78584
FT                   /gene="folP"
FT                   /locus_tag="BMB171_C0067"
FT   CDS_pept        77751..78584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="BMB171_C0067"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04885"
FT                   /protein_id="ADH04885.1"
FT                   /translation="MKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAA
FT                   VRHAKEMQGQGAHIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYK
FT                   AEVAKQAIEAGAHIINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIAD
FT                   LYDSIKIAKNAGVPDENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSF
FT                   IGHVLDLPVEERLEGTGATVCLGIEKGCEFVRVHDVKEMARMAKMMDAMIGKGVR"
FT   gene            78585..78947
FT                   /gene="folB"
FT                   /locus_tag="BMB171_C0068"
FT   CDS_pept        78585..78947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="BMB171_C0068"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04886"
FT                   /protein_id="ADH04886.1"
FT                   /translation="MDKIYIHDMEFYGYHGVFPEENKLGQRFKVDLTVELDLKRAGESD
FT                   DLEHSVNYGELFELCRKVVEDRKYKLVESIAENIAADILKQYESISRCTIKVIKPDPPI
FT                   PGHYRAVAVEITRERP"
FT   gene            78944..79459
FT                   /gene="folK"
FT                   /locus_tag="BMB171_C0069"
FT   CDS_pept        78944..79459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="BMB171_C0069"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04887"
FT                   /protein_id="ADH04887.1"
FT                   /translation="MNNIAYIALGSNIGERYTYLTEAIQFLNKNPYIQVDDISSVYETE
FT                   PVGYTDQSCFLNLVIKISTNLSPQELLKVTQKVENDLGRKREIRWGPRTIDLDILLYNQ
FT                   ENIEAENLIVPHPRMFERAFVIVPLLEINQDIKQNISRSQVEEMKRREGVTVWKQKNGE
FT                   DAFVLFES"
FT   gene            79411..79614
FT                   /locus_tag="BMB171_C0070"
FT   CDS_pept        79411..79614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0070"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04888"
FT                   /protein_id="ADH04888.1"
FT                   /translation="MEAEKWGRRIRAFRKLKGYTQEGFAKELGVSVSVLGEVERGNRSP
FT                   SQDFVVEVAKALNVSIEELMPK"
FT   gene            complement(79571..79921)
FT                   /locus_tag="BMB171_C0071"
FT   CDS_pept        complement(79571..79921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04889"
FT                   /protein_id="ADH04889.1"
FT                   /translation="MSAVVYLSTYFAASTRVSFSPPKICKLNGFSLSSIYNISNVLLLL
FT                   SNIALSLTISAQTKPAPNSFTVKRNAELHTPAIGASTTGFFISIFAIFNNQPTPSCTIT
FT                   LALIPLSKHLMP"
FT   gene            complement(79989..80216)
FT                   /locus_tag="BMB171_C0072"
FT   CDS_pept        complement(79989..80216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04890"
FT                   /protein_id="ADH04890.1"
FT                   /translation="MFYLFNNIPIRFSFIHLHSCTSVNRHSLATSTLNSPSIFYCENMF
FT                   FIPTDTHFNCNRLFYSIYNRCYHFIYFIRI"
FT   gene            80169..80636
FT                   /locus_tag="BMB171_C0073"
FT   CDS_pept        80169..80636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0073"
FT                   /product="Nif3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04891"
FT                   /protein_id="ADH04891.1"
FT                   /translation="MYEGKADWDIIKQVKQSVNIPVIGNGDVATPQDAKRMLDEIGVDG
FT                   VMIGRAALGDPWMIYRTVKYLETGELMPEPTVREKIDVCMLHLDRLIDLKNESVAVREM
FT                   RKHAAWYLKGVRGNASVRNGINACNTREDLANVLGTFVEEVEAKQQTIYVG"
FT   gene            80796..82295
FT                   /gene="lysS"
FT                   /locus_tag="BMB171_C0074"
FT   CDS_pept        80796..82295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="BMB171_C0074"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04892"
FT                   /protein_id="ADH04892.1"
FT                   /translation="MDNMNHEELNDQLIVRREKLHNLREQGIDPFGKRFERTNSTTDLV
FT                   SLYGEFSKEELEEKEIAVSIAGRIMTKRGKGKAGFAHVQDLHGQVQIYVRKDAVGDDEY
FT                   ELFKTADLGDLVGIEGKVFKTNVGELSVKATGFTLLTKSLRPLPDKYHGLKDVEQRYRQ
FT                   RYLDLITSMESRETFVTRSKIIREMRRYLDDNGYLEVETPMMHAIAGGASARPFTTHHN
FT                   ALDMELYMRIAIELHLKRLIVGGLEKVYEIGRVFRNEGVSTRHNPEFTMIELYEAYADY
FT                   KDIMKLTEDMVAHIAKKVLGTTTIQYGDYEINLEPEWTRLHMVDAIKQYSGADFWNPMS
FT                   VEEARELAKEHNVEIKDTMEVGHIINEFFEQKVEDKLIQPTFIYGHPVEISPLAKKNDE
FT                   DPRFTDRFELFIVAREHANAFTELNDPIDQKERFEAQLKEREQGNDEAHMMDDDYIEAL
FT                   EYGMPPTGGLGIGIDRLVMLLTNAPSIRDVLLFPAMRHKQD"
FT   gene            82676..84215
FT                   /gene="rrf_3"
FT                   /locus_tag="BMB171_C5095"
FT   rRNA            82676..84215
FT                   /gene="rrf_3"
FT                   /locus_tag="BMB171_C5095"
FT                   /product="16S ribosomal RNA"
FT   gene            84820..87739
FT                   /gene="rrl_3"
FT                   /locus_tag="BMB171_C5096"
FT   rRNA            84820..87739
FT                   /gene="rrl_3"
FT                   /locus_tag="BMB171_C5096"
FT                   /product="23S ribosomal RNA"
FT   gene            87844..87958
FT                   /gene="rrs_3"
FT                   /locus_tag="BMB171_C5097"
FT   rRNA            87844..87958
FT                   /gene="rrs_3"
FT                   /locus_tag="BMB171_C5097"
FT                   /product="5S ribosomal RNA"
FT   gene            87963..88038
FT                   /locus_tag="BMB171_C5134"
FT   tRNA            87963..88038
FT                   /locus_tag="BMB171_C5134"
FT                   /product="tRNA-Val"
FT   gene            88043..88118
FT                   /locus_tag="BMB171_C5135"
FT   tRNA            88043..88118
FT                   /locus_tag="BMB171_C5135"
FT                   /product="tRNA-Thr"
FT   gene            88132..88207
FT                   /locus_tag="BMB171_C5136"
FT   tRNA            88132..88207
FT                   /locus_tag="BMB171_C5136"
FT                   /product="tRNA-Lys"
FT   gene            88221..88301
FT                   /locus_tag="BMB171_C5137"
FT   tRNA            88221..88301
FT                   /locus_tag="BMB171_C5137"
FT                   /product="tRNA-Leu"
FT   gene            88331..88405
FT                   /locus_tag="BMB171_C5138"
FT   tRNA            88331..88405
FT                   /locus_tag="BMB171_C5138"
FT                   /product="tRNA-Gly"
FT   gene            88422..88510
FT                   /locus_tag="BMB171_C5139"
FT   tRNA            88422..88510
FT                   /locus_tag="BMB171_C5139"
FT                   /product="tRNA-Leu"
FT   gene            88514..88587
FT                   /locus_tag="BMB171_C5140"
FT   tRNA            88514..88587
FT                   /locus_tag="BMB171_C5140"
FT                   /product="tRNA-Arg"
FT   gene            88596..88669
FT                   /locus_tag="BMB171_C5141"
FT   tRNA            88596..88669
FT                   /locus_tag="BMB171_C5141"
FT                   /product="tRNA-Pro"
FT   gene            88679..88754
FT                   /locus_tag="BMB171_C5142"
FT   tRNA            88679..88754
FT                   /locus_tag="BMB171_C5142"
FT                   /product="tRNA-Ala"
FT   gene            88837..90376
FT                   /gene="rrf_4"
FT                   /locus_tag="BMB171_C5098"
FT   rRNA            88837..90376
FT                   /gene="rrf_4"
FT                   /locus_tag="BMB171_C5098"
FT                   /product="16S ribosomal RNA"
FT   gene            90981..93900
FT                   /gene="rrl_4"
FT                   /locus_tag="BMB171_C5099"
FT   rRNA            90981..93900
FT                   /gene="rrl_4"
FT                   /locus_tag="BMB171_C5099"
FT                   /product="23S ribosomal RNA"
FT   gene            93952..94066
FT                   /gene="rrs_4"
FT                   /locus_tag="BMB171_C5100"
FT   rRNA            93952..94066
FT                   /gene="rrs_4"
FT                   /locus_tag="BMB171_C5100"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(94427..94546)
FT                   /locus_tag="BMB171_C0075"
FT   CDS_pept        complement(94427..94546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04893"
FT                   /protein_id="ADH04893.1"
FT                   /translation="MINHMKHLINNVYIIMQFDFYNANVTSTTTFTFYYKSSF"
FT   gene            94906..95454
FT                   /locus_tag="BMB171_C0076"
FT   CDS_pept        94906..95454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0076"
FT                   /product="ClpC ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04894"
FT                   /protein_id="ADH04894.1"
FT                   /translation="MTCQNCNIRPATLHYTKVINEKKAEVHLCEQCAEQSGYTSFFQSS
FT                   QSNFSFHDVFAGLLHGESTMFGEGKNGFSNTNTVRCPDCKMTYEHFTKVGRFGCASCYD
FT                   TFKGHLNPLLKRLHGGHTEHCGKIPERMEGNIHLKKELDELKLILKQYVQNEEFEKAAE
FT                   VRDEIRGLETQLSEHREGE"
FT   gene            95459..96523
FT                   /locus_tag="BMB171_C0077"
FT   CDS_pept        95459..96523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0077"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04895"
FT                   /protein_id="ADH04895.1"
FT                   /translation="MSLDKIMNEAISPWMKGDGPDSDIVLSSRIRLARNFKQYQFSTMQ
FT                   NEEEAQQVQELFKKKFINKSVEPFGKFGLLKMNELTPLQRRVLVEKHLISPNLAGTEYG
FT                   ACLLSESEHISVMLNEEDHIRIQCLFPGLQLSKALQSANQIDNWIEKEVEYAFDESLGY
FT                   ITSCPTNVGTGLRASVMIHLPGLVLTKRISRIIQVIQKLGLVVRGIYGEGSEALGNIFQ
FT                   VSNQMTLGKSEVDIIADLKSVMQQIIQQEKLARELIVQNSSIELEDKVYRSYGILANSR
FT                   LIQSAEAATCLSDVRLGIDLGYIKGISRNILTELMVLTQPGILQQYAGGPLGPEERDYR
FT                   RATLIRERLRIEKN"
FT   gene            96546..98981
FT                   /locus_tag="BMB171_C0078"
FT   CDS_pept        96546..98981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0078"
FT                   /product="negative regulator of genetic competence
FT                   clpC/mecB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04896"
FT                   /protein_id="ADH04896.1"
FT                   /translation="MMFGRFTERAQKVLALSQEEAIRIGHNNIGTEHILLGLVREGEGI
FT                   AAKALIALGLSPEKVQKEVEALIGRGTEASQTVHYTPRAKKVIELSMDEARKLGHSYVG
FT                   TEHILLGLIREGEGVAARVLNNLGVSLNKARQQVLQLLGSNEASSGHQGGSSTNANTPT
FT                   LDSLARDLTVVARENRLDPVIGRSKEIQRVIEVLSRRTKNNPVLIGEPGVGKTAIAEGL
FT                   AQQIVNNEVPETLRDKRVMTLDMGTVVAGTKYRGEFEDRLKKVMDEIRQAGNIILFIDE
FT                   LHTLIGAGGAEGAIDASNILKPSLARGELQCIGATTLDEYRKYIEKDAALERRFQPIHV
FT                   DEPSLEESTQILKGLRDRYEAHHRVSITDDAIDAAVKLSDRYITDRFLPDKAIDLIDEA
FT                   ASKVRLRSYTTPPNLKELEVKLEEIRKEKDAAVQSQEFEKAASLRDMEQRLREKLEDTK
FT                   RQWKEQQGKENSEVTVEDIANVVSTWTRIPVSKLAQTETDKLLNLESILHDRVIGQDEA
FT                   VVAVAKAVRRARAGLKDPKRPIGSFIFLGPTGVGKTELARALAESMFGDEDAMIRIDMS
FT                   EYMEKHSTSRLVGSPPGYVGYEEGGQLTEKVRRKPYSVVLLDEVEKAHPDVFNILLQVL
FT                   EDGRLTDSKGRTVDFRNTIVIMTSNVGAEALKRNKHLGFNVQDESRDYSDMKGKVMDEL
FT                   KKAFRPEFLNRIDEIIVFHMLEKKHIQEIVTLMVNQLVNRLKEQEIELHLTEGAIAAIA
FT                   DKGFDREYGARPLRRAIQKHVEDRLSEELLKGAIEKGQKVIFDVEGETFVIHSAEKVK"
FT   gene            99077..100453
FT                   /gene="radA"
FT                   /locus_tag="BMB171_C0079"
FT   CDS_pept        99077..100453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BMB171_C0079"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04897"
FT                   /protein_id="ADH04897.1"
FT                   /translation="MAKKKTKFTCQECGYQSPKYMGKCPGCGQWNSLVEEMEPVVSSRR
FT                   LNYANAIQTEVTKPRRLTEVETKSEARIETKFQEFNRVLGGGIVDGSLVLIGGDPGIGK
FT                   STLLLQISSQLADASYDVLYISGEESAKQIKLRADRLHVNGSNLFVVSETDLQRIAAHI
FT                   EEMNPAFVVIDSIQTIHLPEVTSAPGSVAQVRECTAELMKLAKTKGIPIFIVGHVTKEG
FT                   AIAGPRMLEHMVDAVLYFEGDRHHTYRILRAVKNRFGSTNEMGIFEMKELGLAEVLNPS
FT                   EIFLEERPVGVAGSTVVASMEGTRPVLVEIQALISPTSFGNPRRMATGIDHNRVSLIMA
FT                   VLEKRTGLLLQNQDAYLKVAGGLKLDEPAIDLAVALSIASSFRDKSTAPTDAVIGEVGL
FT                   TGEIRRVSRIEQRVQEAAKLGFQRAIIPRKNLGGWTIPEGIEVVGVSNLGEALRLTLGG
FT                   "
FT   gene            100457..101530
FT                   /locus_tag="BMB171_C0080"
FT   CDS_pept        100457..101530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0080"
FT                   /product="DNA integrity scanning protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04898"
FT                   /protein_id="ADH04898.1"
FT                   /translation="MEENKQRVKSMINILQLVAPGTPLREGIDNVLRAQTGGLIVLGYN
FT                   EQIKSIVDGGFHINCAFSPASLYELAKMDGALILNETGSKILIANAQLVPDSSIDSIET
FT                   GMRHRTAERVAKQTGSLVVAISQRRNVITLYQGNLRYTLKDIGVILTKANQAIQTLEKY
FT                   KAVWNDGITNLGILEFEEVVTMSEVVHVLHSVEMVLRIKNEILSYIHELGTEGRLIRLQ
FT                   LTELLADLEAEAALLIKDYHQEKTQDHHQILKKLQDLANTQLLEDSDLVKLLGYPGQTS
FT                   LEESVTPRGYRITSKISRVPPLIIENLINRFKTLQGVCRATINELDDVEGIGEVRAKKI
FT                   REGLKRIQEHLYMSRHN"
FT   gene            101691..102800
FT                   /locus_tag="BMB171_C0081"
FT   CDS_pept        101691..102800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04899"
FT                   /protein_id="ADH04899.1"
FT                   /translation="MLKRIVQLFFLVIGGALGIYLIPKIINVLDIGAVPLLEGSYVRAI
FT                   IGAIILFLTTFWLVDYIVQLIKHIEEALVKAPVADVLFGTLGLISGLIVAYLILIPIRE
FT                   FTIPVISTVLQVFFTLLLGYLGFQVGFKKRNELLGLFTLPQRGGKKKNNSENEEVEVEA
FT                   EKSTTHWKILDTSVIIDGRIADICQTKFLEGTIVIPQFVLEELQHIADSSDALKRNRGR
FT                   RGLDILNRIQKEMPIPVEIYEGDFDDIQEVDSKLVKLAKITGGTVVTNDFNLNKVSELQ
FT                   GVTVLNINDLANAIKPVVLPGEELSVYVVKDGKEQNQGVAYLDDGTMIVVEDGREYVGS
FT                   QLDVLVTSVLQTSAGRMIFAKRKLLEKAL"
FT   gene            102817..103497
FT                   /gene="ispD"
FT                   /locus_tag="BMB171_C0082"
FT   CDS_pept        102817..103497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispD"
FT                   /locus_tag="BMB171_C0082"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04900"
FT                   /protein_id="ADH04900.1"
FT                   /translation="MYTLIIPAAGQGKRMGAGKNKLFLLIDEVPIIVHTLRAFEKDKAC
FT                   KSIIMAINEEERPYFEELMQKYQIEKHVQFIQGGAERQDSVYNALQYASGVEYVLVHDG
FT                   ARPFVTNKVIRDVLTAAEKYGASICAVPVKDTVKKVEQGVVVETVERSQLNAVQTPQGF
FT                   SVSLLLEAHRSAKQSCFLGTDDASLVERVGKQVGVVEGSYYNIKVTTPEDLLIAESFLR
FT                   VQKK"
FT   gene            103614..104090
FT                   /gene="ispF"
FT                   /locus_tag="BMB171_C0083"
FT   CDS_pept        103614..104090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="BMB171_C0083"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04901"
FT                   /protein_id="ADH04901.1"
FT                   /translation="MFRIGQGFDVHEFAEGRPLIIGGITIPHEKGLIGHSDADVLLHTI
FT                   ADACLGAIAAGDIGKHFPDTDPAFKDADSAVLLQKVWEFVREQGYELGNLDCTIIAQKP
FT                   KMAPHIESMRKRISELLETSIDNINVKATTTEKLGFTGREEGIASQAVVLLQKK"
FT   gene            104162..105637
FT                   /gene="gltX"
FT                   /locus_tag="BMB171_C0084"
FT   CDS_pept        104162..105637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="BMB171_C0084"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04902"
FT                   /protein_id="ADH04902.1"
FT                   /translation="MEGVPIMEKQVRVRYAPSPTGHLHIGNARTALFNYLFARHLDGKF
FT                   IIRIEDTDVKRNVAGGEESQLKYLKWLGMDWDEGVDVGGEFGPYRQTERLDIYKKLYED
FT                   LLERGLAYKCYMTEEELEAEREGQIARGETPRYAGNHRELTEEQVKEFEAEGRIPSIRF
FT                   RVPANRDYTFKDIVKDEVAFHSNDFGDFVIVKKDGIPTYNFAVAVDDHLMEITHVLRGD
FT                   DHISNTPKQMMIYEAFGWDIPQFGHMTLIVNESRKKLSKRDESIIQFIEQYKELGYLPE
FT                   AIFNFIALLGWSPVGEEEIFSKDEFIKMFDAARLSKSPALFDSQKLKWMNNQYMKKQDL
FT                   DTVVELSLPHLVKAGRVGETLSEQDQAWIRDVIALYHEQMSFGAEIVELSEMFFKDHVD
FT                   YEEEGQEVLNGEQVPEVLRAFAGQIEALEAMEPAAIKAAIKAVQKETGHKGKNLFMPIR
FT                   VATTGQTHGPELPNAIALLGKEKVLNRLQKVIG"
FT   gene            106083..106748
FT                   /gene="cysE"
FT                   /locus_tag="BMB171_C0085"
FT   CDS_pept        106083..106748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="BMB171_C0085"
FT                   /product="serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04903"
FT                   /protein_id="ADH04903.1"
FT                   /translation="MFKRLREDIEVVFEQDPAARGYFEVILTYSGLHAVWAHRIAHAFY
FT                   KKNFFFLARFVSQVSRFFTGIEIHPGATIGRRFFIDHGMGVVIGETCEIGDNVTIYQGV
FT                   TLGGTGKEKGKRHPTIQDNVLIATGAKVLGSITVGENSKIGAGSVVLKEVPAHSTVVGI
FT                   PGRVVIQNGVKIGQELNHSDLPDPIFDKLKAMEVELDKLKKQLELKVERKDKNDYSHL"
FT   gene            106864..108126
FT                   /gene="cysS"
FT                   /locus_tag="BMB171_C0086"
FT   CDS_pept        106864..108126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BMB171_C0086"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04904"
FT                   /protein_id="ADH04904.1"
FT                   /translation="MVFDTVRRYLEYKGYDVQYVSNFTDVDDKLIKAANELGEDVPTIA
FT                   DRFVEAYFEDVTALGCKHATVHPRVTENMDIIIEFIQELVNKGYAYESEGDVYFKTKEF
FT                   EGYGKLSHQPIADLRHGARIEVGEKKQDPLDFALWKAAKEGEIFWESPWGQGRPGWHIE
FT                   CSAMARKYLGDTIDIHAGGQDLAFPHHENEIAQSEALTGKTFARYWMHNGYININNEKM
FT                   SKSLGNFILVHDIIKQYDPQLIRFFMLSVHYRHPINFSEELLQSTNNGLERIKTAYGNL
FT                   KHRMESSTDLTDHNEKWLAEIEKFQTAFEEAMNDDFNTANAITELYNVANHANQYLLEE
FT                   HTSKVVIEAYVKQLETLFDILGLELSKEELLDEEIEELIQKRIEARKNRDFALSDQIRD
FT                   DLKERNIILEDTAQGTRWKRG"
FT   gene            108129..108536
FT                   /locus_tag="BMB171_C0087"
FT   CDS_pept        108129..108536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04905"
FT                   /protein_id="ADH04905.1"
FT                   /translation="MIDAKQLNSLALAYMGDAVYEQYIRYHLLQKGKVRPNQLHRLGTS
FT                   FVSAKAQAKVVYHLLETAFLTEEEEAVLRRGRNANSGTVPKNTDVQTYRHSTAFEALIG
FT                   YHHLLNNRERLDEIVYKAIAVLEEKEGGTSS"
FT   gene            108533..109276
FT                   /locus_tag="BMB171_C0088"
FT   CDS_pept        108533..109276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0088"
FT                   /product="23S rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04906"
FT                   /protein_id="ADH04906.1"
FT                   /translation="MTSEYIIGRNPVIEALRSGRDINKIWIAEGAAKGQVQIVLALAKE
FT                   NKIILQHAPKKKLDQLVEGNHQGVIAQVAAYQYAELEDLFKVAEKRNEDPFFLILDEIE
FT                   DPHNLGSIMRTADATGAHGIIIPKRRAVGLTASVAKASTGAIEYIPVARVTNLSRTIDE
FT                   LKERGLWIAGTDAKGKTDYRNLDGTMPIGLVIGSEGKGMSRIIGEKCDFLITLPMVGKV
FT                   TSLNASVAASLLMYEVYRKRHEIGK"
FT   gene            109280..109792
FT                   /locus_tag="BMB171_C0089"
FT   CDS_pept        109280..109792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0089"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04907"
FT                   /protein_id="ADH04907.1"
FT                   /translation="MNDILIVDGYNIIGAWGDLKKLRDVDLQSSRDALIDKMADYQGYT
FT                   GTKVMIVFDAYTVHGIEKKMKQSRVEVIFTRKNQTADEKIEQLAIELRNINTQIYVATS
FT                   DYTEQWVIFGQGALRKSARELELEVQAMEQQVRRRTKDTKEQQPAMRKIFSKDITEKLE
FT                   KLRRGER"
FT   gene            109860..110519
FT                   /gene="sigH"
FT                   /locus_tag="BMB171_C0090"
FT   CDS_pept        109860..110519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="BMB171_C0090"
FT                   /product="RNA polymerase factor sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04908"
FT                   /protein_id="ADH04908.1"
FT                   /translation="MEAGFVSIGDVTFRDLEDEAIVELVRKGNTDALEYLIHKYKNFVR
FT                   AKSRSYFLVGADREDIVQEGMIGLFKAIRDYKEDKLSSFKAFAELCITRQIITAIKTAT
FT                   RQKHIPLNSYVSLDKPIYDEESDRTLLDVISEAKVTDPEEMIISQEEYTDIESKISELL
FT                   SDLERKVLSLYLDGRSYQEISEQLNRHVKSIDNALQRVKRKLERYMEMRESTTLNS"
FT   gene            110835..111014
FT                   /gene="secE"
FT                   /locus_tag="BMB171_C0091"
FT   CDS_pept        110835..111014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BMB171_C0091"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04909"
FT                   /protein_id="ADH04909.1"
FT                   /translation="MRLTNFFGDVGREMKKVSWPKKDELLRSTATVVATVVFFAIFFAV
FT                   VDMGISSLIRLILG"
FT   gene            111230..111679
FT                   /gene="nusG"
FT                   /locus_tag="BMB171_C0092"
FT   CDS_pept        111230..111679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BMB171_C0092"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04910"
FT                   /protein_id="ADH04910.1"
FT                   /translation="MGMQDKIFRVVVPEEVEVEMKNGKEKLMKRKVFPGYVLVELIMTD
FT                   DSWYVVRNTPGVTGFVGSSGSGSKPSPLLEEEVVTIMKHMGMDNEVVDFDFELHETVRV
FT                   NEGPFADYTGAIEEIDVEKKKVSVLVDMFGRETPVELDFHQIEKL"
FT   gene            111868..112272
FT                   /gene="rplK"
FT                   /locus_tag="BMB171_C0093"
FT   CDS_pept        111868..112272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BMB171_C0093"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04911"
FT                   /protein_id="ADH04911.1"
FT                   /translation="MVKLQIPAGKANPAPPVGPALGQAGVNIMGFCKEFNARTADQAGL
FT                   IIPVEITVFEDRSFTFITKTPPAAVLLKKVAGIESGSGEPNRNKVATVKRDKVREIAET
FT                   KMPDLNAASVEAAMRMVEGTARSMGIVIED"
FT   gene            112449..113141
FT                   /gene="rplA"
FT                   /locus_tag="BMB171_C0094"
FT   CDS_pept        112449..113141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BMB171_C0094"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04912"
FT                   /protein_id="ADH04912.1"
FT                   /translation="MAKRGKKYVEAAKLVDRAAAYSATEAVELVKKTNTAKFDATVEAA
FT                   FRLGVDPKKADQQIRGAVVLPHGTGKVQRVLVFAKGEKAKEAEAAGADFVGDTDYIGKI
FT                   QQGWFDFDVVVATPDMMGEVGKLGRVLGPKGLMPNPKTGTVTFDVTKAVNEIKAGKVEY
FT                   RVDKAGNIHVPIGKVSFEDAKLVENFKTIADTLQKVKPAAAKGTYMKNVTVASTMGPGV
FT                   RVDVSTLA"
FT   gene            113375..113875
FT                   /gene="rplJ"
FT                   /locus_tag="BMB171_C0095"
FT   CDS_pept        113375..113875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BMB171_C0095"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04913"
FT                   /protein_id="ADH04913.1"
FT                   /translation="MSKVIETKQQVVTEIADKLRASKSTIVVDYRGLTVSEATELRKQL
FT                   REAGVEFKVYKNSLTRRAAESAEMAELNEFLTGPNAIAFSNEDVVAPAKVLNDFAKDHE
FT                   ALEIKAGVIEGKLVTLDEVKAIATLPSREGLLSMLLSVLQAPIRNLALATKAVADQKEE
FT                   QGA"
FT   gene            113943..114302
FT                   /gene="rplL"
FT                   /locus_tag="BMB171_C0096"
FT   CDS_pept        113943..114302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BMB171_C0096"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04914"
FT                   /protein_id="ADH04914.1"
FT                   /translation="MTKEQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAGE
FT                   AAAEKTEFDVELTSAGAQKIKVIKVVREITGLGLKEAKELVDNTPKVIKEAAAKEEAEE
FT                   IKAKLEEVGAAVEVK"
FT   gene            114379..114978
FT                   /locus_tag="BMB171_C0097"
FT   CDS_pept        114379..114978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0097"
FT                   /product="16S rRNA m(2)G 1207 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04915"
FT                   /protein_id="ADH04915.1"
FT                   /translation="MADHYFSNDPSSKSDRKRWEFALRGSRFTFLSDHGVFSKNEVDFG
FT                   SRLLIEAFQMPDIKGNILDVGCGYGPIGLSLAKEFQGREVHMVDVNERALGLAKENAAN
FT                   NKIENIRIFQSSVYENVDGKYAAILSNPPIRAGKDIVHEILEKAVEYLVPGGELWIVIQ
FT                   KKQGAPSALKKLEEVFSEVEVVEKKKGYYIIKSKKR"
FT   gene            115270..118803
FT                   /gene="rpoB"
FT                   /locus_tag="BMB171_C0098"
FT   CDS_pept        115270..118803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BMB171_C0098"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04916"
FT                   /protein_id="ADH04916.1"
FT                   /translation="MTGQLVQYGRHRQRRSYARISEVLELPNLIEIQTSSYQWFLDEGL
FT                   REMFQDISPIEDFTGNLSLEFIDYSLGEPKYSVDECKERDVTYAAPLRVKVRLINKETG
FT                   EVKEQDVFMGDFPLMTETGTFVINGAERVIVSQLVRSPSVYYSGKVDKNGKRGFTATVI
FT                   PNRGAWLEYETDAKDVVYVRIDRTRKLPVTVLLRALGFGSDQEITELLGDNEYLSNTLE
FT                   KDNTDSTEKALLEIYERLRPGEPPTVENAKSLLVSRFFDPKRYDLANVGRYKINKKLHI
FT                   KNRLFNQRLAETLVDPETGEILAAEGTILDRRTLDRILPYLEKNIGFKTAKPMGGVVEG
FT                   DVELQSIKIYAPESEGERVINVIGNANITRDVKHITPGDILASISYFFNLLYKVGDTDD
FT                   IDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMSIQDTNAITPQALINIRPVIASIK
FT                   EFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLTRERAGFEVRDVHYSHYGRMCPIE
FT                   TPEGPNIGLINSLSSFAKVNEFGFIETPYRRVDPETGLVTGHVDYLTADEEDNYVVAQA
FT                   NMKLSDEGEFLSEDIVARFRGENIVTNRERIDYMDVSPKQVVSAATACIPFLENDDSNR
FT                   ALMGANMQRQAVPLMNPESPIVGTGMEYVSAKDSGAAVICKHPGVVERVEAREVWVRRY
FT                   VEVDGQTVKGDLDRYKMQKFIRSNQGTCYNQRPIVSVGNEVVKGEILADGPSMELGELA
FT                   LGRNVLVGFMTWDGYNYEDAIIMSERLVKDDVYTSIHIEEYESEARDTKLGPEEITRDI
FT                   PNVGEDALRNLDERGIIRVGAEVKDGDLLVGKVTPKGVTELTAEERLLHAIFGEKAREV
FT                   RDTSLRVPHGGGGIILDVKVFNREDGDELPPGVNQLVRAYIVQKRKISEGDKMAGRHGN
FT                   KGVISRILPEEDMPYLPDGTPIDIMLNPLGVPSRMNIGQVLELHLGMAARYLGIHIATP
FT                   VFDGAREEDVWGTIEEAGMANDAKTILYDGRTGEPFDNRVSVGVMYMIKLAHMVDDKLH
FT                   ARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEILTVKSDDVVGRVK
FT                   TYEAIVKGENVPEPGVPESFKVLIKELQSLGMDVKMMSSDDTEIEMRDTEDDDDHQSAD
FT                   KLNVEVETTKE"
FT   gene            complement(118955..119122)
FT                   /locus_tag="BMB171_C0099"
FT   CDS_pept        complement(118955..119122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04917"
FT                   /protein_id="ADH04917.1"
FT                   /translation="MTHTFTTYFCTRYFNATSITNYTFITYTFVFSAMTFPVLLWSENT
FT                   LTEQAIFFRL"
FT   gene            119198..122452
FT                   /gene="rpoC"
FT                   /locus_tag="BMB171_C0100"
FT   CDS_pept        119198..122452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BMB171_C0100"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04918"
FT                   /protein_id="ADH04918.1"
FT                   /translation="MSPRALEEVIYFASYVVTESGDTPLDKKQLLSEKEYRAYRDRYGS
FT                   TFQAAMGAEAIKKLLQDIDLDKEVDFLKEELKTAQGQRRTRAIKRLEVLEAFRNSGNEP
FT                   SWMILDVLPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPSIIVQ
FT                   NEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSHMLKGKQGRFRQNLLGKRVDYSGR
FT                   SVIVVGPNLKMYQCGLPKEMALELFKPFVMKELVEKGLAHNIKSAKRKIERVQPEVWDV
FT                   LESVIKEHPVLLNRAPTLHRLGIQAFEPTLVEGRAIRLHPLVCTAYNADFDGDQMAVHV
FT                   PLSSEAQAEARLLMLAAQNILNPKDGKPVVTPSQDMVLGNYYLTLEREGAIGEGMVFKD
FT                   ANEALLAYQNGYVHLHTRVAVAASAVNNATFTEEQKSMLLLTTVGKLIFNEILPESFPY
FT                   INEPTNSNLEKETPAKYFVEKGANIKEIIASREEVAPFSKKILGNIIAEVFKRFQITET
FT                   SRMLDRMKNLGFKYSTKAGITVGVSDILVLGEKDEILHEAQAKVDNVIKQFRRGLITEE
FT                   ERYDRVISIWSNAKDVIQGKLMKSLNKRNPIFMMSDSGARGNASNFTQLAGMRGLMANP
FT                   SGRIIELPIKSSFREGLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIV
FT                   REDDCGTDRGLLIGAIKEGNEVIESLYDRLVGRFARKTVKHPETGEVLVAENQLITEDI
FT                   AHIVENSGVETVNIRSAFTCNTRHGVCKKCYGRNLATGTDVEVGEAVGIIAAQSIGEPG
FT                   TQLTMRTFHTGGVAGDDITQGLPRIQEIFEARNPKGQAVISEIDGVIAAINDVKDRQEV
FT                   VVQGEVEARTYAIPYGARLKVTPGQPISHGKELTEGSIDPKELLKVTDITAVQEYLLRE
FT                   VQKVYRMQGVEIGDKHVEVMVRQMLRKVRVSDAGETDVLPGTLLDIHQFTDANAKVLLQ
FT                   GKQPATARPVLLGITKASLETDSFLSAASFQETTRVLTDAAIKGKRDELLGLKENVIIG
FT                   KLVPAGTGMNRYRKVDLVKTTQDDMNVENDEVYVEQ"
FT   gene            122566..122814
FT                   /locus_tag="BMB171_C0101"
FT   CDS_pept        122566..122814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04919"
FT                   /protein_id="ADH04919.1"
FT                   /translation="MSYQKVSTAENVVVGHKRTLEAIKNGTVKEVVIAEDADMRLTHAI
FT                   IRIAMQYNVPITKVESVRKLGKASGIQVGASAIGIIS"
FT   gene            123381..123851
FT                   /gene="rpsG"
FT                   /locus_tag="BMB171_C0102"
FT   CDS_pept        123381..123851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="BMB171_C0102"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04920"
FT                   /protein_id="ADH04920.1"
FT                   /translation="MPRKGPVAKRDVLPDPMYNSKLVTRLINKMMVDGKKGKSQTILYN
FT                   AFDIVNERTGKEPMEVFEQALKNIMPVLEVRARRVGGANYQVPVEVRPERRTTLGLRWL
FT                   VNYARLRGEKTMEERLANEILDAANNAGASVKKREDTHKMAEANKAFAHYRW"
FT   gene            124060..126138
FT                   /gene="fusA"
FT                   /locus_tag="BMB171_C0103"
FT   CDS_pept        124060..126138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="BMB171_C0103"
FT                   /product="elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04921"
FT                   /protein_id="ADH04921.1"
FT                   /translation="MAREFSLENTRNIGIMAHIDAGKTTATERILYYTGRIHKIGETHE
FT                   GASQMDWMEQEQERGITITSAATTAQWKGHRVNIIDTPGHVDFTVEVERSLRVLDGAVA
FT                   VLDAQSGVEPQTETVWRQATTYGVPRIVFVNKMDKIGADFLYSVGTIHDRLQANAHPIQ
FT                   LPIGAEDEFNGIIDLVEECAYMYGNDLGTDIQRVEIPEEHKELAEEYRGKLIEAVAELD
FT                   EEMMMKYLEGEEITVEELKAGIRKATTSVEFFPVICGSAFKNKGVQILLDAVIDYLPSP
FT                   LDVPAIKGTLPDTDEEVERKSSDEEPFAALAFKIMTDPYVGKLTFFRVYSGVLNSGSYV
FT                   KNSTKGKRERVGRILQMHANSREEISTVYAGDIAAAVGLKDTTTGDTLCDEKSLVILES
FT                   MEFPEPVISVAIEPKSKADQDKMGTALSKLSEEDPTFRAHTDQETGQTIIAGMGELHLD
FT                   IIVDRMRREFKVEANVGAPQVAYRETFRAAAKVEGKFARQSGGRGQFGHVWIEFEPNEE
FT                   GKGFEFENKIVGGVVPREYIPAVGAGLEDALKNGVLAGYPLVDIKAALVDGSYHDVDSS
FT                   EMAFKIAASMALKAAVSKCSPVILEPMMKVEVVIPEEYMGDIMGDVTSRRGRVEGMEAR
FT                   GNAQVVRAMVPLSEMFGYATSLRSNTQGRGTFSMVFDHYEEVPKSVSEEIIKKNKGE"
FT   gene            126256..127443
FT                   /gene="tuf"
FT                   /locus_tag="BMB171_C0104"
FT   CDS_pept        126256..127443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="BMB171_C0104"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04922"
FT                   /protein_id="ADH04922.1"
FT                   /translation="MAKAKFERSKPHVNIGTIGHVDHGKTTLTAAITTVLAKAGGAEAR
FT                   GYDQIDAAPEERERGITISTAHVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGGIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYGF
FT                   PGDDIPVIKGSALKALQGEADWEAKIIELMAEVDAYIPTPERETDKPFLMPVEDVFSIT
FT                   GRGTVATGRVERGIVKVGDVVEIIGLAEENASTTVTGVEMFRKLLDQAQAGDNIGALLR
FT                   GVAREDIQRGQVLAKSGSVKAHAKFKAEVFVLSKEEGGRHTPFFANYRPQFYFRTTDVT
FT                   GIIQLPEGTEMVMPGDNIEMTIELIAPIAIEEGTKFSIREGGRTVGYGVVATIVE"
FT   gene            127842..128150
FT                   /gene="rpsJ"
FT                   /locus_tag="BMB171_C0105"
FT   CDS_pept        127842..128150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="BMB171_C0105"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04923"
FT                   /protein_id="ADH04923.1"
FT                   /translation="MAKEKIRIRLKAYDHRILDQSAEKIVETAKRSGATVSGPIPLPTE
FT                   KTVYTILRAVHKYKDSREQFEMRTHKRLIDIVSPTPQTVDSLMRLDLPSGVDIEIKL"
FT   gene            128185..128817
FT                   /gene="rplC"
FT                   /locus_tag="BMB171_C0106"
FT   CDS_pept        128185..128817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="BMB171_C0106"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04924"
FT                   /protein_id="ADH04924.1"
FT                   /translation="MTKGILGRKIGMTQVFAENGELIPVTVIAANPNVVLQKKTTETDG
FT                   YNAIQLGFEDKREKLTNKPEQGHTAKASTTPKRFIREIRDADVDGLEVGQEVKVDVFAT
FT                   GEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNRVFKGKKLAGR
FT                   MGGDQVTIQNLEIVQVDTERNLLLVKGNVPGAKKSLVVVQGAVKVSK"
FT   gene            128843..129466
FT                   /gene="rplD"
FT                   /locus_tag="BMB171_C0107"
FT   CDS_pept        128843..129466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="BMB171_C0107"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04925"
FT                   /protein_id="ADH04925.1"
FT                   /translation="MPKVTVYNQTGSQVGEIELAEAIFGIEPNEAVLFEAVMMQRASLR
FT                   QGTHKVKTRSEVRGGGRKPWRQKGTGRARQGSIRSPQWRGGGTVFGPTPRSYAYKLPKK
FT                   VRRLAIKSALATKVVENNIVVLEDLVLNAPKTKDMLAVLKGLTVEKKALIVTADANESV
FT                   ELSARNIPGVTVITADGVNVLDVLHHDKLIMTKAAVEKVEEVLA"
FT   gene            129466..129756
FT                   /gene="rplW"
FT                   /locus_tag="BMB171_C0108"
FT   CDS_pept        129466..129756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="BMB171_C0108"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04926"
FT                   /protein_id="ADH04926.1"
FT                   /translation="MRDPRDIIKRPVITERSMEMMAEKKYTFDVDVKSNKTEVKDALEA
FT                   IFGVKVEKVNIMNYKPKAKRVGRHAGFTSRRRKAIVKLTADSKEIEIFQGV"
FT   gene            129785..130615
FT                   /gene="rplB"
FT                   /locus_tag="BMB171_C0109"
FT   CDS_pept        129785..130615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="BMB171_C0109"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04927"
FT                   /protein_id="ADH04927.1"
FT                   /translation="MGIKKYNPTTNGRRNMTTNDFAEITTDRPEKSLLAPLSKKAGRNN
FT                   QGKITVRHQGGGHKRQYRIIDFKRNKDGIPGRVATIEYDPNRSANIALINYVDGEKRYI
FT                   LAPKSLEVGMEVMSGPEADIKIGNALPLINIPVGTVVHNIELKPGRGGQLVRSAGTSAQ
FT                   VLGKEGKYVLVRLTSGEVRLVLSACRASIGQVGNEQHELIKIGKAGRSRWLGKRPTVRG
FT                   SVMNPVDHPHGGGEGRSPIGRKSPMSPWGKPTLGFKTRKKNKASDKFIVRRRKK"
FT   gene            130972..131313
FT                   /gene="rplV"
FT                   /locus_tag="BMB171_C0110"
FT   CDS_pept        130972..131313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="BMB171_C0110"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04928"
FT                   /protein_id="ADH04928.1"
FT                   /translation="MQAKAVARTVRIAPRKVRLVVDLIRGKQVGEAIAILNHTPKTASP
FT                   VVEKVLKSAIANAEHNYEMDINNLVVEKVFVDEGPTLKRFRPRAMGRASQINKRTSHIT
FT                   VVVSEKKEG"
FT   gene            131317..131976
FT                   /gene="rpsC"
FT                   /locus_tag="BMB171_C0111"
FT   CDS_pept        131317..131976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="BMB171_C0111"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04929"
FT                   /protein_id="ADH04929.1"
FT                   /translation="MGQKVNPIGLRVGVIRDWESRWFAEKDYATLLHEDIKIREYINVR
FT                   LKDSAVAKVEIERAANRVNVTIHTAKPGMVIGKGGTEVEALRKALNQLTGKRVHINILE
FT                   VKRADLNAKLVGENIARQLENRVSFRRAQKQVIQRAMRAGAKGIKTQVSGRLGGADIAR
FT                   AESYSEGTVPLHTLRADIDYAAVEADTTYGKLGVKVWIYRGEVLPTKKKASEEGGK"
FT   gene            131978..132412
FT                   /gene="rplP"
FT                   /locus_tag="BMB171_C0112"
FT   CDS_pept        131978..132412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="BMB171_C0112"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04930"
FT                   /protein_id="ADH04930.1"
FT                   /translation="MLMPKRVKYRREHRGKMRGRAKGGTEIAFGEFGLQAQAASWITNR
FT                   QIEAARRAMTRYMKRGGKVWIKIFPSKPYTAKPLEVRMGSGKGAPEGWVAVVKPGKIMF
FT                   EIAGVSEEVAREALRLAAHKLPVKCKFVKREENGGESNEN"
FT   gene            132402..132602
FT                   /gene="rpmC"
FT                   /locus_tag="BMB171_C0113"
FT   CDS_pept        132402..132602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="BMB171_C0113"
FT                   /product="50S ribosomal protein L29P"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04931"
FT                   /protein_id="ADH04931.1"
FT                   /translation="MKTNDIRELTTAEIETKVKALKEELFNLRFQLATGQLENPTRIRE
FT                   VRKAIARMKTVVREREIGINR"
FT   gene            132677..132886
FT                   /gene="rpsQ"
FT                   /locus_tag="BMB171_C0114"
FT   CDS_pept        132677..132886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="BMB171_C0114"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04932"
FT                   /protein_id="ADH04932.1"
FT                   /translation="MDKTITVLVETYKTHSLYGKRVKYSKKYKAHDEQNQAKLGDIVKI
FT                   METRPLSATKRFRLVEIVEEAVII"
FT   gene            132930..133298
FT                   /gene="rplN"
FT                   /locus_tag="BMB171_C0115"
FT   CDS_pept        132930..133298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="BMB171_C0115"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04933"
FT                   /protein_id="ADH04933.1"
FT                   /translation="MIQQESRLKVADNSGARELLTIKVLGGSGRKYANIGDIIVATVKQ
FT                   ATPGGVVKKGDVVKAVVVRTKSGARRPDGSYIKFDENAAVIIKDDKSPRGTRIFGPVAR
FT                   ELRDSNFMKIVSLAPEVL"
FT   gene            133337..133648
FT                   /gene="rplX"
FT                   /locus_tag="BMB171_C0116"
FT   CDS_pept        133337..133648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="BMB171_C0116"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04934"
FT                   /protein_id="ADH04934.1"
FT                   /translation="MHVKKGDKVQVITGKDKGKQGVILVAFPKQNRVIVEGVNIVKKHS
FT                   KPSQLNPQGGIITKEAPIHVSNVMILDPKTGEPTRVGFKVEDGKKVRIAKKSGELLDK"
FT   gene            133675..134214
FT                   /gene="rplE"
FT                   /locus_tag="BMB171_C0117"
FT   CDS_pept        133675..134214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="BMB171_C0117"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04935"
FT                   /protein_id="ADH04935.1"
FT                   /translation="MNRLKEKFQKEITPALVSKFNYKSVMQVPKIEKIVINTGVGDAVS
FT                   NSKALDNAVEELTQITGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGEQMYEFFDKLV
FT                   SVSLPRVRDFRGVSKKSFDGRGNYTLGVKEQLIFPEIDYDKVSKVRGMDIVIVTTAKTD
FT                   EEARELLTQFGMPFQK"
FT   gene            134248..134433
FT                   /gene="rpsN"
FT                   /locus_tag="BMB171_C0118"
FT   CDS_pept        134248..134433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="BMB171_C0118"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04936"
FT                   /protein_id="ADH04936.1"
FT                   /translation="MAKKSMIAKQKRTPKFKVQEYTRCERCGRPHSVYRKFKLCRICFR
FT                   ELAYKGQIPGVKKASW"
FT   gene            134463..134861
FT                   /gene="rpsH"
FT                   /locus_tag="BMB171_C0119"
FT   CDS_pept        134463..134861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="BMB171_C0119"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04937"
FT                   /protein_id="ADH04937.1"
FT                   /translation="MVMTDPIADMLTRIRNANMVRHEKLEVPASKIKKEIAELLKREGF
FT                   IRDVEYIEDNKQGILRIFLKYGANNERVITGLKRISKPGLRVYAKADEVPRVLNGLGIA
FT                   LVSTSKGVMTDKDARQLQTGGEVVAYVW"
FT   gene            134894..135433
FT                   /gene="rplF"
FT                   /locus_tag="BMB171_C0120"
FT   CDS_pept        134894..135433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="BMB171_C0120"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04938"
FT                   /protein_id="ADH04938.1"
FT                   /translation="MSRIGKKILEIPAGVTITVAEDNTVTVKGPKGELTRTFNADMLIK
FT                   IEENTLTVERPSEQKEHRALHGTTRALIGNMVEGVTEGFARGLELVGVGYRAQKQGDKL
FT                   VLSVGYSHPVEMTPEAGLEVEVPAPTKIVIKGIDKQRVGEFAANIRAVRAPEPYKGKGI
FT                   RYEGEVVRRKEGKTAK"
FT   gene            135465..135827
FT                   /gene="rplR"
FT                   /locus_tag="BMB171_C0121"
FT   CDS_pept        135465..135827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="BMB171_C0121"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04939"
FT                   /protein_id="ADH04939.1"
FT                   /translation="MITKADKNATRKKRHARVRAKLTGTAERPRLNVFRSNQHIYAQVI
FT                   DDVNGVTLVSASTLDKDLALNGTSNIEAATKVGESVAKRAVEKGVKEVVFDRGGYLYHG
FT                   RVKALAEAAREAGLQF"
FT   gene            135849..136349
FT                   /gene="rpsE"
FT                   /locus_tag="BMB171_C0122"
FT   CDS_pept        135849..136349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="BMB171_C0122"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04940"
FT                   /protein_id="ADH04940.1"
FT                   /translation="MHRIDPSKLELEERVVTINRVAKVVKGGRRFRFAALVVVGDKNGH
FT                   VGFGTGKAQEVPDAIRKAIEDAKKNLIAVPLVGTTIPHTINGHFGAGEVFLKPAAEGTG
FT                   VIAGGPVRAVLELAGVQDILSKSLGSNTPINMIRATVNGLSELKRAEDVAKLRGKSVEE
FT                   LLG"
FT   gene            136363..136545
FT                   /gene="rpmD"
FT                   /locus_tag="BMB171_C0123"
FT   CDS_pept        136363..136545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="BMB171_C0123"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04941"
FT                   /protein_id="ADH04941.1"
FT                   /translation="MAKKLEITLTRSVIGRPQDQRATVEALGLKKLNSTVVKEETPAIL
FT                   GMINKVSHLVTVKEA"
FT   gene            136579..137019
FT                   /gene="rplO"
FT                   /locus_tag="BMB171_C0124"
FT   CDS_pept        136579..137019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="BMB171_C0124"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04942"
FT                   /protein_id="ADH04942.1"
FT                   /translation="MKLHELKPAEGSRKVRNRVGRGIGSGNGKTAGKGHKGQNARSGGG
FT                   VRLGFEGGQTPLFRRLPKRGFTNINRKEFAIVNLSTLNRFEDGTEVTPELLLETGVISK
FT                   LNDGVKVLASGAVEKKLTVKAHKFSSSAKEAIEAAGGSVEVI"
FT   gene            137019..138320
FT                   /gene="secY"
FT                   /locus_tag="BMB171_C0125"
FT   CDS_pept        137019..138320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="BMB171_C0125"
FT                   /product="preprotein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04943"
FT                   /protein_id="ADH04943.1"
FT                   /translation="MFRTISNFMRVAEIRRKILFTLAMLIVFRIGTFIPVPFTNGDVLK
FT                   AQDQLNALGILNTFGGGALKNFSIFAMGIMPYITASIIVQLLQMDVVPKFSEWSKQGEM
FT                   GRRKLTQFTRYFTIVLAFIQGFGMSIGFNGMVGGQLILNPGWSTYLYIATVLTAGTAFL
FT                   MWLGEQITAKGVGNGISILIFGGIAAAIPSVISQVYQQQFQNIGDQLFMSIVKVALILL
FT                   AVLAVIVGVIFIQQAVRKIPIQYAKRVTGGNGGYAGAQNTHLPLKVNSAGVIPVIFAVS
FT                   FLITPPTIAQFFPKHDVSQWIIANFNYSHPVGMIIYVALIVAFTYFYAFVQVNPEQMSE
FT                   NLNKQGGYVPGIRPGKNTEQYLTKILYRLTFVGSIFLAAIAILPVIFTKLGNLPPSAQI
FT                   GGTSMLIVVGVALETMKQLESQLVKRHYKGFIKQ"
FT   gene            138377..139027
FT                   /gene="adk"
FT                   /locus_tag="BMB171_C0126"
FT   CDS_pept        138377..139027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="BMB171_C0126"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04944"
FT                   /protein_id="ADH04944.1"
FT                   /translation="MNLILMGLPGAGKGTQAEQIVAKYNIPHISTGDMFRAAMKAETEM
FT                   GLQAKSFIDKGALVPDEVTIGIVRERLSQDDCVRGFLLDGFPRTVAQASALEEIMKDLG
FT                   KKIDYVLNINVDSGLLLKRLTGRRICKECGATYHLEFNPPAKADVCDKCGGELYQRSDD
FT                   NEETVANRLDVNIKQTKPLLDFYEELGYLQSINGEQDINKVFADIDVLIGGLA"
FT   gene            139027..139773
FT                   /gene="maP1"
FT                   /locus_tag="BMB171_C0127"
FT   CDS_pept        139027..139773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maP1"
FT                   /locus_tag="BMB171_C0127"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04945"
FT                   /protein_id="ADH04945.1"
FT                   /translation="MIICKTPREIEIMREAGRIVALTHQELKQHITPGITTKELDQIAE
FT                   KTIQKYGATPSFKGYNGFPGSICASVNEELVHGIPGKRKLKEGDIISIDIGAKYNGYHG
FT                   DSAWTYPVGNISESVQKLLDVTEKSLYLGLEQVKPGERLSNISHAVQTHAEENGFSIVR
FT                   EYVGHGIGQDLHEDPQIPHYGPPNRGPRLKPGMVICVEPMVNQGRRYVKTLSDDWTVVT
FT                   VDGKWCAHFEHTIALTEAGYEILTTL"
FT   gene            139842..140060
FT                   /gene="infA"
FT                   /locus_tag="BMB171_C0128"
FT   CDS_pept        139842..140060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BMB171_C0128"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04946"
FT                   /protein_id="ADH04946.1"
FT                   /translation="MAKDDVIEVEGTVLETLPNAMFKVELENGHVVLAHVSGKIRMNFI
FT                   RILPGDKVTVELSPYDLNRGRITYRFK"
FT   gene            140096..140209
FT                   /gene="rpmJ"
FT                   /locus_tag="BMB171_C0129"
FT   CDS_pept        140096..140209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BMB171_C0129"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04947"
FT                   /protein_id="ADH04947.1"
FT                   /translation="MKVRPSVKPICEKCKVIRRRGKVMVICENPKHKQKQG"
FT   gene            140231..140596
FT                   /gene="rpsM"
FT                   /locus_tag="BMB171_C0130"
FT   CDS_pept        140231..140596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="BMB171_C0130"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04948"
FT                   /protein_id="ADH04948.1"
FT                   /translation="MARIAGVDIPRDKRVVISLTYVFGIGRTTAEKILAEAGISEETRV
FT                   RDLTEDELGRIRDIIDRIKVEGDLRREVSLNIKRLMEIGSYRGLRHRRGLPVRGQNSKN
FT                   NARTRKGPRRTVANKKK"
FT   gene            140621..141010
FT                   /gene="rpsK"
FT                   /locus_tag="BMB171_C0131"
FT   CDS_pept        140621..141010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="BMB171_C0131"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04949"
FT                   /protein_id="ADH04949.1"
FT                   /translation="MARKTNTRKKRVKKNIEAGIAHIRSTFNNTIVTLTDTHGNALSWS
FT                   SAGALGFRGSRKSTPFAAQMAAETAAKAAMEHGLKTLEVTVKGPGAGREAAIRALQAAG
FT                   LEVTAIRDVTPVPHNGCRPPKRRRV"
FT   gene            141191..142135
FT                   /gene="rpoA"
FT                   /locus_tag="BMB171_C0132"
FT   CDS_pept        141191..142135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="BMB171_C0132"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04950"
FT                   /protein_id="ADH04950.1"
FT                   /translation="MIEIEKPKIETVELNEDAKYGKFVIEPLERGYGTTLGNSLRRILL
FT                   SSLPGAAVTAIQIDGVLHEFSTVEGVVEDVTTIILNLKKLALKIYSEEEKTLEIDVQGE
FT                   GIVTAADITHDSDVEILNPDLHIATLAKDAHFRVRLTAKRGRGYTPADANKSEDQPIGV
FT                   IPIDSIYTPVSRVTYQVEKTRVGQVANYDKLTLDVWTDGSIGPKEAISLGAKILTEHLN
FT                   IFVGLTDEAQNAEIMVEKEEDQKEKVLEMTIEELDLSVRSYNCLKRAGINTVQELANKT
FT                   EEDMMKVRNLGRKSLEEVKHKLEELGLGLRKDD"
FT   gene            142171..142533
FT                   /gene="rplQ"
FT                   /locus_tag="BMB171_C0133"
FT   CDS_pept        142171..142533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="BMB171_C0133"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04951"
FT                   /protein_id="ADH04951.1"
FT                   /translation="MAYRKLGRTSAQRKAMLRDLATDLIINERIQTTETRAKELRSVVE
FT                   KMITLGKRGDLHARRQAAAFIRNEVANAETGQDALQKLFADVAPRYAERQGGYTRIAKI
FT                   GPRRGDAAPMVIIELV"
FT   gene            142637..143479
FT                   /gene="cbiO"
FT                   /locus_tag="BMB171_C0134"
FT   CDS_pept        142637..143479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="BMB171_C0134"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04952"
FT                   /protein_id="ADH04952.1"
FT                   /translation="MKKEKLRIENISFQYPGAATYALKDVSFSLYEGEWVSIIGQNGSG
FT                   KSTLAKLLNGLFLPEAGTITVNDTMVLSEETVWDVRKQIGMVFQNPDNQFVGTTVQDDV
FT                   VFGLENIGMPREQMIERLEQALQLVRMEDFLNDEPHSLSGGQKQRVAIAGVLALQPSIL
FT                   ILDEATSMLDPQGRREVVETVRQLVTQKGITVLSITHDLEEAAQSDRVIILNKGEILEE
FT                   GTPEKIFKSSHMLQEIGLDVPFSVKIAELLKRNEILLQNTHLTMESLVNELWRLHSKK"
FT   gene            143455..144336
FT                   /gene="cbiO"
FT                   /locus_tag="BMB171_C0135"
FT   CDS_pept        143455..144336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO"
FT                   /locus_tag="BMB171_C0135"
FT                   /product="cobalt transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04953"
FT                   /protein_id="ADH04953.1"
FT                   /translation="MEITFQKVEHRYQYKTPFERRALYDVDVSFPSGGYYAIIGHTGSG
FT                   KSTMIQHLNGLLQPTNGTVQIGEHLISAGKKEKKLKPLRKKVGVVFQFPEHQLFEETVE
FT                   KDICFGPTNFGVSVDEARQKARKAIELVGLEPELLTRSPFELSGGQMRRVAIAGVLAME
FT                   PEVLVLDEPTAGLDPKGQNELMEMFYKLHKEKGLTVILVTHNMEDAAQYAEQIVVMHKG
FT                   TVFLQGSAEEVFSHADELEKIGVDLPMSLKYKRAIEEKFGISIPKATLSLEDLTHEVVQ
FT                   VLRKGGHESCSS"
FT   gene            144324..145118
FT                   /locus_tag="BMB171_C0136"
FT   CDS_pept        144324..145118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0136"
FT                   /product="cobalt transport protein cbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04954"
FT                   /protein_id="ADH04954.1"
FT                   /translation="MQQLIIGRYIPGNSLIHQLDPRTKLLIVFLYVFVVFLANNAISYG
FT                   FLFLYALIALFFAKVPIRYVLSGLKPILWIFLFTFFLHIFTNKEGDVLFQLGWFSIYEK
FT                   GLEQGIYISVRFFVIILMTTLLTLTTTPIEITDGLETLLKPLKRIKVPVHEIALMMSIS
FT                   LRFIPTLMDETSKIMKAQASRGIDFAGGPIKDRMKAIISLLVPLFISAFKRAEDLAIAM
FT                   EARGYQSGEGRTKFRQLRWKTSDTVTIVSLFCLACILAWVRS"
FT   gene            145118..145876
FT                   /gene="truA"
FT                   /locus_tag="BMB171_C0137"
FT   CDS_pept        145118..145876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="BMB171_C0137"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04955"
FT                   /protein_id="ADH04955.1"
FT                   /translation="MENREMDRIKCTVAYDGMHFCGYQIQPNHRTVQQEIEKALQKLHK
FT                   GELVRVQASGRTDSTVHAKGQVIHFDTPLSLEEWQWSNALNTMLPDDIVIRQVEKKTEE
FT                   FHARYGVEKKEYRYRVLLSKTADVFRRNYVYQYPYPLEINSIRKAIPYFIGTHDFTSFC
FT                   SAKTDKKDKVRTIYEIELIEQDDEIIFRFVGNGFLYNMVRIIVGTLLSVGQGKLDPDSI
FT                   PEILAKQNRQFAGKMAPGHGLYLWEVNYNN"
FT   gene            146029..146466
FT                   /gene="rplM"
FT                   /locus_tag="BMB171_C0138"
FT   CDS_pept        146029..146466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="BMB171_C0138"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04956"
FT                   /protein_id="ADH04956.1"
FT                   /translation="MRTTFMAKANEVERKWYVVDAEGQTLGRLASEVASILRGKNKPTF
FT                   TPHVDTGDHVIIINAEKIHLTGNKLNDKIYYRHTNHPGGLKQRTALEMRTNYPVQMLEL
FT                   AIKGMLPKGRLGRQVSKKLNVYAGAEHPHQAQKPEVYELRG"
FT   gene            146488..146880
FT                   /gene="rpsI"
FT                   /locus_tag="BMB171_C0139"
FT   CDS_pept        146488..146880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="BMB171_C0139"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04957"
FT                   /protein_id="ADH04957.1"
FT                   /translation="MAQVQYYGTGRRKSSVARVRLVPGEGRVIINGRDFENYIPFAALR
FT                   EVVKQPLVATETLGNYDVLVNVNGGGYTGQAGAIRHGISRALLKADPEYRLTLKRAGLL
FT                   TRDARMKERKKYGLKGARRAPQFSKR"
FT   gene            147042..147470
FT                   /locus_tag="BMB171_C0140"
FT   CDS_pept        147042..147470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04958"
FT                   /protein_id="ADH04958.1"
FT                   /translation="MNVIVSLQEKQKEKQLKYERKMLRELSLKTLRSNIRDAFQMQELH
FT                   RQYEDYCIELGIESYLLGARYSKFGYYGESFFDVKYRALEEEQQLTETLFQFLTSMTMR
FT                   EIKLKDEELLFESCQQFIGLWWQEGYEKGERRYRLKLH"
FT   gene            147537..148250
FT                   /gene="cwlD"
FT                   /locus_tag="BMB171_C0141"
FT   CDS_pept        147537..148250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cwlD"
FT                   /locus_tag="BMB171_C0141"
FT                   /product="spore-specific N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04959"
FT                   /protein_id="ADH04959.1"
FT                   /translation="MKRIRIISFALAAVVLFFLVKQEFQITKSWRAWNLPLSGKVIVLD
FT                   AGHGGPDGGAVGGKDIIEKDITLEITKKVQDYLQEQGALVILTREGDYDLANKDTKSYS
FT                   RRKAEDLKKRVEIINKPDVDFFASIHLNALTSSGSKGAQTFYYRSSIENERAAKFIQAE
FT                   LRTSLENTNRSAKTISHVYLLKYSKTPGALIEAGFLSNVNERYMLNSEKYQQKVAAAIY
FT                   RGILRYFTEKGNPPE"
FT   gene            148395..149462
FT                   /locus_tag="BMB171_C0142"
FT   CDS_pept        148395..149462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0142"
FT                   /product="Mrp protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04960"
FT                   /protein_id="ADH04960.1"
FT                   /translation="MVTKEQVVEALEGIVDPFLHKTLKETSAIKEVTVKPEKEHVSVKI
FT                   AIVKTGTAEQMQLQSGIVKLVKELGAATVGLRFAEFTEEELAQFAPEQEEEQSESLLSP
FT                   NSKTTFLAVASGKGGVGKSTVSVNLAVALARLGKKVGIIDADIYGFSVPDMMGIEKRPI
FT                   VRGDKIIPVERLGVKVISMGFFVEDNAPVIWRGPMLGKMLNHFFTEVEWGDLDYLVLDL
FT                   PPGTGDVALDVHSMLPSCKEIIVTTPHPTAAFVAARAGAMALRTEHSILGVVENMAYFE
FT                   SKVTGEKEYVFGKGGGDKLATELQTNVLGRIPLQQPDWNKEDFAPSVYEGTHTTGIIYS
FT                   KIAETVIDKTAVTQK"
FT   gene            complement(149634..150251)
FT                   /gene="gerD"
FT                   /locus_tag="BMB171_C0143"
FT   CDS_pept        complement(149634..150251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerD"
FT                   /locus_tag="BMB171_C0143"
FT                   /product="spore germination protein GerD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04961"
FT                   /protein_id="ADH04961.1"
FT                   /translation="MKRMLFIFVSSFLLIALAACAQGKETKSELDYDQTKKMIVDILKT
FT                   DQGKKAIQDVLTDEKMKQALILDETVVKKTIEDAMVSDKGQQFWEKLFKDPEFSSKFAK
FT                   SMGKEQTQLMKTLLKDPEYQAGVIEIMKNPEVEKMMLQTMKSKEYRQYLQQVLTETAES
FT                   PLFQAKMIDIISKGVQKAEKGGSGKKEAGGDGGSQGEKKEEQ"
FT   gene            150391..151002
FT                   /locus_tag="BMB171_C0144"
FT   CDS_pept        150391..151002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0144"
FT                   /product="KINB signaling pathway activation protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04962"
FT                   /protein_id="ADH04962.1"
FT                   /translation="MNSRKWVRLFLTTLFLGGISTVIIGFVLEWDKYNEFFQNFDGKEI
FT                   LAVSFWLMGVGFIFSVISQMGFFAYLTIHRFGLGMFRSSSLWNAVQLFFIAFVLFDFVY
FT                   LRSVLIANGEVSLGNNILVAGMLFVFGAIVAYVKSKETNKKAFVPALFFMVVVTILEWV
FT                   PALRINDTDWLYLMVIPLLLCNAYQLLVLHRLIGKTSKSA"
FT   gene            complement(151120..151884)
FT                   /gene="pdaB"
FT                   /locus_tag="BMB171_C0145"
FT   CDS_pept        complement(151120..151884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaB"
FT                   /locus_tag="BMB171_C0145"
FT                   /product="chitooligosaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04963"
FT                   /protein_id="ADH04963.1"
FT                   /translation="MFFFFITSKRNFKHISLIVILSLFTAWLLFLKTYSHESAFSTATG
FT                   PKVIYKGDTAKKQVAFTFDISWGDKKAIPILDTLKEKEIKNATFFLSAAWAERHPDIVE
FT                   RIMKDGHEIGSMGYNYTSYTSLETNEIRRDLLRAQDVFTKLGVKQVKLLRPPSGEFNKA
FT                   TLKIAESLGYTVVHWSNNSNDWKNPGVNNIVSTVSNNLKGGDIVLLHASDSALQTNRAL
FT                   PLLLQKIKSDGYEQISVSQLISNTSTKSEDVK"
FT   gene            152055..152273
FT                   /locus_tag="BMB171_C0146"
FT   CDS_pept        152055..152273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04964"
FT                   /protein_id="ADH04964.1"
FT                   /translation="MLGLMLTKEERKEMEYILKRELEELLFDFEDERIHEVVKKAMEER
FT                   YKIIFCLFRRVANTEECIRYVRKRIFY"
FT   gene            152505..154044
FT                   /gene="rrf_5"
FT                   /locus_tag="BMB171_C5101"
FT   rRNA            152505..154044
FT                   /gene="rrf_5"
FT                   /locus_tag="BMB171_C5101"
FT                   /product="16S ribosomal RNA"
FT   gene            154649..157568
FT                   /gene="rrl_5"
FT                   /locus_tag="BMB171_C5102"
FT   rRNA            154649..157568
FT                   /gene="rrl_5"
FT                   /locus_tag="BMB171_C5102"
FT                   /product="23S ribosomal RNA"
FT   gene            157662..157776
FT                   /gene="rrs_5"
FT                   /locus_tag="BMB171_C5103"
FT   rRNA            157662..157776
FT                   /gene="rrs_5"
FT                   /locus_tag="BMB171_C5103"
FT                   /product="5S ribosomal RNA"
FT   gene            157785..157859
FT                   /locus_tag="BMB171_C5143"
FT   tRNA            157785..157859
FT                   /locus_tag="BMB171_C5143"
FT                   /product="tRNA-Asn"
FT   gene            157864..157936
FT                   /locus_tag="BMB171_C5144"
FT   tRNA            157864..157936
FT                   /locus_tag="BMB171_C5144"
FT                   /product="tRNA-Thr"
FT   gene            157961..158035
FT                   /locus_tag="BMB171_C5145"
FT   tRNA            157961..158035
FT                   /locus_tag="BMB171_C5145"
FT                   /product="tRNA-Glu"
FT   gene            158041..158116
FT                   /locus_tag="BMB171_C5146"
FT   tRNA            158041..158116
FT                   /locus_tag="BMB171_C5146"
FT                   /product="tRNA-Val"
FT   gene            158134..158217
FT                   /locus_tag="BMB171_C5147"
FT   tRNA            158134..158217
FT                   /locus_tag="BMB171_C5147"
FT                   /product="tRNA-Tyr"
FT   gene            158283..158357
FT                   /locus_tag="BMB171_C5148"
FT   tRNA            158283..158357
FT                   /locus_tag="BMB171_C5148"
FT                   /product="tRNA-Gln"
FT   gene            158363..158438
FT                   /locus_tag="BMB171_C5149"
FT   tRNA            158363..158438
FT                   /locus_tag="BMB171_C5149"
FT                   /product="tRNA-Lys"
FT   gene            158444..158515
FT                   /locus_tag="BMB171_C5150"
FT   tRNA            158444..158515
FT                   /locus_tag="BMB171_C5150"
FT                   /product="tRNA-Gly"
FT   gene            158526..158598
FT                   /locus_tag="BMB171_C5151"
FT   tRNA            158526..158598
FT                   /locus_tag="BMB171_C5151"
FT                   /product="tRNA-Ala"
FT   gene            158716..159861
FT                   /locus_tag="BMB171_C0147"
FT   CDS_pept        158716..159861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0147"
FT                   /product="glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04965"
FT                   /protein_id="ADH04965.1"
FT                   /translation="MKVVIASDSYKESLKAIEVCGAIERGFRAIFPNAEYVKIPIGDGG
FT                   EGTVESLVDATGGRIISISVTGPLREGIQAFYGISKDKKTAFIEMAAASGLQHVPVEKR
FT                   NPLITTTKGTGELILHALDQGVEYIILGLGGSATNDGGAGMLEALGVRFINGKGEVIDP
FT                   SGGTLHSIVTIDFSRMDPRLKGVKIEAACDVDNPLVGMQGASFVFGRQKGANIEMMKEL
FT                   DENLQHYANMLKRYVSFDVSEIPGAGAAGGMGAAVISVLKGDLRRGIEIVLDYTNFDKH
FT                   IEDAHLIITGEGRIDKQTAYGKAPVGVAGRAKRFSVPVIAIGGSVSSDCSAVYEKGIDA
FT                   VFSITTRPMTLEEAYKVAEENIEMTTKNIATVWKIASEKHF"
FT   gene            160072..160965
FT                   /gene="rocF"
FT                   /locus_tag="BMB171_C0148"
FT   CDS_pept        160072..160965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="BMB171_C0148"
FT                   /product="arginase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04966"
FT                   /protein_id="ADH04966.1"
FT                   /translation="MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVK
FT                   DMGDICIEREKEIDENTKLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGT
FT                   LAGVAKHYKNLGVIWYDAHGDLNTEETSPSGNIHGMSLAASLGYGHSSLVDLYGAYPKV
FT                   KKENVVIIGARALDEGEKDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLS
FT                   LDLDGLDPHDAPGVGTPVIGGLSYRESHLAMEMLAEADIITSAEFVEVNTILDERNRTA
FT                   TTAVALMGSLFGEKLK"
FT   gene            161214..162035
FT                   /locus_tag="BMB171_C0149"
FT   CDS_pept        161214..162035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04967"
FT                   /protein_id="ADH04967.1"
FT                   /translation="MPFEDTTILKYLSTALDIAIVWFIIYKLILIIRGTKAVQLLKGIT
FT                   VIIVVKMISIFLELRTLSWLTEQVLTWGFLAVIIIFQPELRRALEQLGRGSLFSRVGTH
FT                   EDDEPEMVATAIAKATEYMGKRRIGALITLSKETGMGDYVETGIPLNANVSSELLINIF
FT                   IPNTPLHDGAVIMQGSTIKAAACYLPLSESPFISKELGTRHRAAMGVSEVTDSITVVVS
FT                   EETGQISLTKNGKLHRDLKTEQLKDMLLAEFSGNEKTTSSSLWNWRRKRHG"
FT   gene            162028..163509
FT                   /locus_tag="BMB171_C0150"
FT   CDS_pept        162028..163509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04968"
FT                   /protein_id="ADH04968.1"
FT                   /translation="MDKLMENHWFLKGISLLLACMLFMSATLTEKNTTSGILPFANDTK
FT                   ETLTNYAINLKYDEEKYIVSGIPAEGVKVKLEGPKASVATAKAKKQFDIPVDLRDSPKG
FT                   TYEISLKTNGLPDDVKGTVQPSTIKVTLHEKARKYVHVDLKLSNEDQMPAGATLEKSSL
FT                   KPDTVEVVGTKEEIESISSAKAYVDLKGVNKTVTKTPEVTLYNKEGKRLNVRTSPSKIS
FT                   VTLNVATQTTANNTEKTVPVTYTKKGSLAEGLAVTNISVEPREVTIAGPKDILDNIQSL
FT                   EGVEVDLSQLTESTTFDASVLLPKGVTSAKPNQVKVSVGVQKTKQTKTKTIDGIPIQKN
FT                   GLSKDVTAQLLSPQDGKISVDISGEASIVDKITAAQITAVINLQNVSSGTKDISIQVSG
FT                   PGNISIEPKQKSAKVTIVKKEKPDKEVQGNGQQPDSNTDQENQNEKPKNPEPDSEKEQE
FT                   KNQNQNQNQDKDKETSQEPTVDNQKEQEKGANHNG"
FT   gene            163502..164848
FT                   /gene="glmM"
FT                   /locus_tag="BMB171_C0151"
FT   CDS_pept        163502..164848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BMB171_C0151"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04969"
FT                   /protein_id="ADH04969.1"
FT                   /translation="MGKYFGTDGVRGVANKELTPELAFKIGRFGGYVLTKDTDRPKVII
FT                   GRDTRVSGHMLEGALVAGLLSTGAEVMRLGVISTPGVAYLTKALDAQAGVMISASHNPV
FT                   QDNGIKFFGSDGFKLTDEQEAEIEALLDKEVDELPRPTGTNLGQVSDYFEGGQKYLQYI
FT                   KQTVEEDFSGLHIALDCAHGATSSLAPYLFADLEADISTMGTSPNGMNINEGVGSTHPE
FT                   GLAELVKEKGADIGLAFDGDGDRLIAVDEKGNIVDGDQIMFICAKYMKETGQLKHNTVV
FT                   STVMSNLGFYKALEANNITSDKTAVGDRYVMEEMKRGGYNLGGEQSGHIILLDYITTGD
FT                   GMLSALQLVNIMKMTKKPLSELAGEMTKFPQLLVNVRVTDKKLALENEKIKEIIRVVEE
FT                   EMNGDGRILVRPSGTEPLIRVMAEAPTQEVCDAYVHRIVEVVKAEVGAE"
FT   gene            165335..167137
FT                   /gene="glmS"
FT                   /locus_tag="BMB171_C0152"
FT   CDS_pept        165335..167137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmS"
FT                   /locus_tag="BMB171_C0152"
FT                   /product="D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04970"
FT                   /protein_id="ADH04970.1"
FT                   /translation="MCGIVGFIGEQDAKEILLKGLEKLEYRGYDSAGIAVQAENGVVVY
FT                   KEKGRIAKLREIVDENVAASVGIGHTRWATHGVPSKVNAHPHQSTSKRFTLVHNGVIEN
FT                   YELVKKEYLQDVTFVSETDTEVIVQLMEQQVSTGLSVEEAFRNTLSLLHGSYAIGLLDA
FT                   ENPNMIYVAKNKSPLLVGVGDNFNVVASDAMAMLQVTDQFIELMDKEIVIVTKESITIK
FT                   NLQGETIERAPFTAELDASDIEKGTYPHFMLKEIDEQPLVIRNIIQKYQDENGEIELNQ
FT                   DIRNAILDSDRIYIIACGTSYHAGLVGKQFIEKFAKMPVEVHVASEFSYNMPLLTERPF
FT                   FIYISQSGETADSRAVLVQTNEMGHKALTITNVPGSTLSREADYTLPLYAGPEIAVAST
FT                   KAYTAQLAVLSILAADIAKAKGEVLDFDLTHELGLVANAMIELCDQKEEMDALAKQFLA
FT                   TTRNCFFIGRSVDFYVGLEGALKLKEISYIQAEGFAGGELKHGTIALIENGTPVIALAT
FT                   QEHVNLGIRGNVKEVVARGANPCIISMKGLEMEGDSFVLPAVHEALAPLVAVIPLQLIS
FT                   YYAALHRECDVDKPRNLAKSVTVE"
FT   gene            complement(167235..168350)
FT                   /locus_tag="BMB171_C0153"
FT   CDS_pept        complement(167235..168350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04971"
FT                   /protein_id="ADH04971.1"
FT                   /translation="MKNFKKSTGKILLASGLVVSMSACSVTNLFGEKEKTNAESGKQES
FT                   KETKTEGKSSETKEKSTNSKEESKDVKMIMVLPEDYPQLMVDIEEDLLRRLDYYDASVR
FT                   DNKKGSKSNEEVRDSIKDLDKVFNKIERIDAPGKYKEDHKEIVKAVQKLKESFKEVSKL
FT                   FDYSKTLKDTDDAIIDKANNKLDEAKRIWKPVFNKLKAEAKGGSTTTSTTSGTSSSNSP
FT                   SLSSGNTVKTYSTQDKTGIFKGKIDTPDEDSAKFKNVQNNYKDGTELVGNWGIDYGDGV
FT                   KTTLVLKADKTFETYANGSYPNKDNYLTGTYQADVSSHQLTLMVEKGTQNGQEVKLERP
FT                   IYSSYEVKNLDGKALQIFHIDEQVTICYVKQ"
FT   gene            168951..170915
FT                   /locus_tag="BMB171_C0154"
FT   CDS_pept        168951..170915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0154"
FT                   /product="acylamino-acid-releasing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04972"
FT                   /protein_id="ADH04972.1"
FT                   /translation="MKVNEKTYLSIEEIISLPTVSSTNISDDGKNVAFVKKTADWKDNT
FT                   YRNHVWIYEKDKKQSYPLSNGDIDSTHPLWSPDARCIAYLSPVGDGKNQIFVKSLDGYR
FT                   EVQITDEKEGVSTFKWGPTGKGLYYVTQSKECEEIKKRKDLYGDFQHIGKEHQNNCLYY
FT                   IEIEKVIQSDTDEHKNRVVYQLTDGKDFHIHEFDISNDGKKVVFMATPSSNMADYINGD
FT                   LYILHIKAGELQKLNVDKLLGGSVCFSPDGSEICYTASIREKGYYRNHIQDSTLEIYDI
FT                   NTGELIQPLTDFDSTVMPLQWTAKGVLIRWQNKTNYLIGLLAEDGTVEILSEKVDGFIM
FT                   DASITKDGKHISYNKAITNETFEIYLDDKKITDENSFFKGKLRSNREIISWKSSDGLEI
FT                   EGVLSTPVELDNNKKYPLLVVIHGGPAWASFPIFSDCFNEKYPIEQFVEKGFIVLEPNY
FT                   RGSSGYGNEFLKANYRKQGIADYDDVISGVDELVEKGMVDKDRVGVMGWSNGGYVSAFC
FT                   STFSSRFKAISVGGGITNWSTHYVNTDIPYFIRMYLGNTPWNDPEIYTKTSPMTYIKSA
FT                   CTPTLIQHGEKDARIPITNAYDLYQGLMDMEVDTELIIFKGMAYSSDQPGVHVAIMKQN
FT                   LMWFSHYILGESMEGFRTL"
FT   gene            171023..171589
FT                   /locus_tag="BMB171_C0155"
FT   CDS_pept        171023..171589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04973"
FT                   /protein_id="ADH04973.1"
FT                   /translation="MTGNKNDLLVEKREELLKVLQARFEKNMNRHEGLEWAKVEAKLTT
FT                   NNEKMWSLNEMEVTGGEPDVVGYDEEKDEYTFYDCSKESPKGRRSLCYDLEALESRKKH
FT                   KPENNVIDVANAMGIELLTEEQYRELQQLGDFDMKSSSWVQTPSDIRELGGALFCDYRF
FT                   GHVFVYHNGADSYYAARGFRGSLKV"
FT   gene            complement(171662..172168)
FT                   /locus_tag="BMB171_C0156"
FT   CDS_pept        complement(171662..172168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04974"
FT                   /protein_id="ADH04974.1"
FT                   /translation="MVINFLRTDKRATFILLLLRLYIGYTWLAAGIGKVFGQSFDASGF
FT                   LKGAIAQASGDHPAVQSWWADFLQHFVLPNADLFSFLVQWGEILVGLGLILGGLTKTAA
FT                   FFGIIMNLSFLLSGTVSVNPNLLILTMFILVAGQNAGRIGLDGYVFPKLFRKNNHGTYK
FT                   LSKTA"
FT   gene            172564..172683
FT                   /locus_tag="BMB171_C0157"
FT   CDS_pept        172564..172683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0157"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04975"
FT                   /protein_id="ADH04975.1"
FT                   /translation="MNQLKNKVAVITGVSRLDGIGAAICKELAESGYDIFFTY"
FT   gene            172702..173337
FT                   /locus_tag="BMB171_C0158"
FT   CDS_pept        172702..173337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0158"
FT                   /product="3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04976"
FT                   /protein_id="ADH04976.1"
FT                   /translation="MPWGVEKNEQIQLEEELLQNGVRVSSMELDLTRNDAPKELINKVT
FT                   EQLGYPDILINNAAYSTNNDFSTLTAEELDKHYMVNIRATTLLSSQFARGFDKKSGGRI
FT                   VNMTSGQFQGPMVGELAYATTKGAIDALTSTLSAEVAHLGITVNAINPGPTDTGWMTEE
FT                   IKQGLKPMFPFGRIGEPKDAARLIKFLVSEEAEWITGQVIHSEGGFKR"
FT   gene            complement(173377..174045)
FT                   /locus_tag="BMB171_C0159"
FT   CDS_pept        complement(173377..174045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0159"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04977"
FT                   /protein_id="ADH04977.1"
FT                   /translation="MGNKSFLDEWGKVIWEATIQTFQMTSISLFISILIALPLGVTLVL
FT                   TRPGGQHENKIIYPILNTIINIIRSLPFIILLFFILPFTKFLMGTSIGVQGVIVPLVVF
FT                   TAPYIARLMETALLEVDRGVIEAYQAMGVSTIKIIWHVMVKEARPSLVLGLTIATIGLI
FT                   GATAMAGLVGAGGLGDLAYRFGHLRYEPEVMYATVFILIILVQGLQSLGNGVARRLKKD
FT                   "
FT   gene            complement(174020..175060)
FT                   /locus_tag="BMB171_C0160"
FT   CDS_pept        complement(174020..175060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0160"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04978"
FT                   /protein_id="ADH04978.1"
FT                   /translation="MIELKNISKVFTTKKGNVEALKSTSLKVEKGEVFGIIGYSGAGKS
FT                   TLIRCVNLLEKPTTGNIIVNEQDLTTLSTKELAKARQKIGMIFQGFNLLKTVTVYENIA
FT                   LPLRLAGIPKAEIEKRVEKYLRIVDLFNRKDAYPSELSGGQKQRVAIARALSHEPEVLL
FT                   SDEATSALDPETTDSILDLLLKINEEIGITILLITHEMNVIQRICDRVAVMEHGAVIES
FT                   GTVKEIFTNPQHVTTKKFVNSAFAAKIPAEVQKELQRTGEIVTLSFIGNSSGEPALAIA
FT                   TKRFQVYPNILSGNITQLKHEAYGKLVIHMQGEQNEINHALSFLQEQGIIVEGGRTDYG
FT                   KQVLFG"
FT   gene            complement(175073..175885)
FT                   /locus_tag="BMB171_C0161"
FT   CDS_pept        complement(175073..175885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0161"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04979"
FT                   /protein_id="ADH04979.1"
FT                   /translation="MKKVLLSIVSGAVLLLGACSVSSDKEVKELDEKKITVGVTGGPHE
FT                   QIFEKVKEVAAKDGLEIDIKVFNDYVAPNVSLDEKSLDVNSYQTKSYLDVFKAERNMKL
FT                   AEVFSTVTFPMGVYSKDIKDVKDLKEGDAIAVPNDPTNELRALKLFEKAGVLKVDPKAT
FT                   EKATAKDVIENPKKLKIVELEASQLPTQLSEVKAAAINTNFALGAKLSPAKDSIFREGK
FT                   DSPYVNWVVVRTENKDDAVVNKLKKAYQSKEVKEFIEKKFDGSVLPSW"
FT   gene            complement(176166..177074)
FT                   /locus_tag="BMB171_C0162"
FT   CDS_pept        complement(176166..177074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0162"
FT                   /product="quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04980"
FT                   /protein_id="ADH04980.1"
FT                   /translation="MKAIICTKYGPPNVLQLQNIEKPKPKKNEVLVKIHATSVSTGDCR
FT                   IRGFNSPLLFWIPMRIILGFRKPRKPILGVELSGEIEDIGTDVTQFKKGDQVFALTELN
FT                   LGGYAEYTCVHESGLIALKPTNVTYEEAAVIPFGGTSALHFLRKGQIKKGQRVLIYGAS
FT                   GSVGTAAVQLAKYFGATVTAICSSSNFDLVTALGADNVIDYMKEDFTKRGEHYDIIFDA
FT                   VGKYNKSLCTDALMPNGKYVSVNGMMAKVSKEDMNLLKQLAETEKLKPVIDRTYRLEEI
FT                   AEAHIYVEKGHKKGNVSITLK"
FT   gene            177232..177996
FT                   /locus_tag="BMB171_C0163"
FT   CDS_pept        177232..177996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04981"
FT                   /protein_id="ADH04981.1"
FT                   /translation="MKKIIFVSSLVLAISLGVGCSNEKAAKTDEPKKESVQKEKELTAK
FT                   DVFKKTNEAFKNEEHVTMTYGVGVKAEGTEMDILKAKMQLEPKTKNSRSEMNISGTDVV
FT                   VYTVDGKVAGEVKNPNTGEVVTVPEEQLNAGGMKATQDIIDKLEVPEVVLDKMKLEKSG
FT                   DKYKLKFTLKGQETENMLTSMDETQKKMLQAQNAKIEEVDAEYIITKDFKYESAKIDMI
FT                   MSSNGKDKAHIITNAKYTSYEKFDPIQLPAAK"
FT   gene            178108..179544
FT                   /locus_tag="BMB171_C0164"
FT   CDS_pept        178108..179544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0164"
FT                   /product="L-gulonolactone oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04982"
FT                   /protein_id="ADH04982.1"
FT                   /translation="MKKGKIAAVIVAYTVLLATSVHTYKKQIDHPIMSDVGKLLPTKIK
FT                   RVESATEEHSLIKLVRDAKVSGEKISIAGMQHSQGGQTYYPNGTMLDMKGYNKILEFDP
FT                   EKKQITVQSGVTWNDIQKKINPYGLAVQVMQSQNIFTVGGSLSVNVHGRDIRHEALIDT
FT                   VDSFRLLMADGTVRNVSREENAELFPYVIGGYGLFGVILDVTLKLTDDELYEMHTRMID
FT                   YKEYVSYFKEKVKRDENVRMHLARISIAPNSFLKEMYVTDYTLAQNQNMREEYSELKEE
FT                   NIIAVPKFLLGLSRYSDWGKNTFWDIQRGYFERTDGKYETRNNVMRSDSAFMEYENPNR
FT                   TEVLQEYFVPIDAFTEYIDDLRNVLNEEEFNLLNITIRYVEKNENAVLSYAKDDMFALV
FT                   LLINQGRSESEIKKTEDVIRKMIDVTLKHNGSYYLPYYSYPTKEQLKRAYPRIEEFLKK
FT                   KKEVDSEERFVNLFYREYTK"
FT   gene            179541..180074
FT                   /locus_tag="BMB171_C0165"
FT   CDS_pept        179541..180074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0165"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04983"
FT                   /protein_id="ADH04983.1"
FT                   /translation="MTYRRFVASQSIIMMAGSMVFPFYILLLRNVGNSFSQFGWAYGLF
FT                   ALTSALVYPLVGKISDQVGDKKLLIIYAWSMAILMLCFPIATEVWHVYILQIVMGILGA
FT                   VQRNTEKTSLARKVAQEKAGYEIGKYHVWTSIGAAVAVIATGYLVDFFTIGTIFYIASI
FT                   LYVVSGIVLSSKKI"
FT   gene            180153..181871
FT                   /locus_tag="BMB171_C0166"
FT   CDS_pept        180153..181871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04984"
FT                   /protein_id="ADH04984.1"
FT                   /translation="MKFVVLAILTLFLIPWTRSSSKLRAVDKKGDKKVVKGKKSSILVI
FT                   PVLFWIGIAIYEYFWLIDDRVDSILTHYSVAVAILIGLVLFSQDQIGKLEGTLKRLLMF
FT                   ILLASYGYFGYLHDIVISQKKYDSVVKIEKDISEPFTENDQPFTVPPKTAENKMKKVFG
FT                   DIPKVAYFELGELTPQMVNGEALYVAPIEVSGFFKARKAETIPGYVTMSGTNPDAEAKL
FT                   HLGYKMKYVPSMFFGNNLERVVRQAEPNLIFKGKPKFEVDDKGKPYYTMTYGEFISGRS
FT                   GFEVEGVVVVDAQTGEVKRYDKGKAPKFVDGVLNHETASTLNTYFGKYIHGFWNTKFSQ
FT                   TDMKIPTEWGTKEGVTPIFGKDGTLYYFTDFTSPKEGVDSALGYSLVDARTGKLYYYNG
FT                   KEVKGIMDGSAATEVVDNSFKREKWHGTMPVIYNVYGKPAWIIPVVDDGGLVRAHTVVY
FT                   AANAKIFATGSSQKEALENYKNVMSGNGDTFRPTSTGKEAQKEGIVQRVYKEKSGENTI
FT                   VYVLLENEQKVFMIPVKKFPYAMFTEVGDPIQITYLDTGEMMSSVSKFTNSNVKK"
FT   gene            182052..183248
FT                   /locus_tag="BMB171_C0167"
FT   CDS_pept        182052..183248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0167"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04985"
FT                   /protein_id="ADH04985.1"
FT                   /translation="MILVLGTLTAIGPLSIDMYLPSLPKLTDDLQTGASLAQLTLTACL
FT                   LGLSVGQLFVGSISDIYGRRKPLIIALIIYVASSLLCAVAPSIWTLVLLRFLQGASGSA
FT                   GIVISRAMVRDMYSGSEMTKFFSLLMLVNGAAPILAPIIGGQLLQFTTWRGVFIVLGAI
FT                   SVFMLISATFVLRETLPPEERETGGLSGTLATYGKLLKDRLFMGYALSQGLVTAAMFAY
FT                   ISGSPFVLQNIYGASPQQFSLFFAINGIGIIIASQVTGRLAGKVNEKTLFVAGIIIAAV
FT                   GGLSLLLTIVLGIGLIGVLCSLFLVVSSVGVVSTTGFSLAMRNQKQAAGTASALLGLLQ
FT                   FISGALVAPLVGIGGSNTALPMGVVIALCEVGAVLCYLFMARRSEKQFELQQKQNLEA"
FT   gene            complement(183282..183728)
FT                   /locus_tag="BMB171_C0168"
FT   CDS_pept        complement(183282..183728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04986"
FT                   /protein_id="ADH04986.1"
FT                   /translation="MYNTIPFMGEDIRVLIREKSLHIENTESLRRVLKKKHAPFKLAQY
FT                   LKQQHTNQFHTVLNISDKSLTIEIIGHVYIGNFADTLKEIPRIPKIAPIIVKKAYKITD
FT                   HTDIIDCGEKEVDSNRWVWDKLAVLYDTIMNNMYKVFQRNEKKN"
FT   gene            184002..184505
FT                   /locus_tag="BMB171_C0169"
FT   CDS_pept        184002..184505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04987"
FT                   /protein_id="ADH04987.1"
FT                   /translation="MKKVLGIAVMGSMILLAGCNGNKDTKEPKEKVEQSTEQTEEMKEY
FT                   RAVHEKYDLKMNKEINNALQLFEVAKEKGGKEITTATYKEDVQKVTTSMLEDIDHIRKE
FT                   IRVPKSKEQEHEVYVGFLNESEQAMKKLQKLAKEEDSSLIRDIEINFATASTYYKRFQA
FT                   ETKK"
FT   gene            complement(184522..184737)
FT                   /locus_tag="BMB171_C0170"
FT   CDS_pept        complement(184522..184737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04988"
FT                   /protein_id="ADH04988.1"
FT                   /translation="MDPLLLATIGLPLTIVILVIIGFYKLFIKKKSITSFYTPFDNITG
FT                   QTISEFHEEQKILVSEDEDGDGKKKK"
FT   gene            185147..186064
FT                   /locus_tag="BMB171_C0171"
FT   CDS_pept        185147..186064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0171"
FT                   /product="oligopeptide transport system permease protein
FT                   oppB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04989"
FT                   /protein_id="ADH04989.1"
FT                   /translation="MYVIKKLSVMVFTLWVITTVTFLIMHIIPGDPFSSDAKVFPEEVI
FT                   QNMRAKYHLDEPLWNQYVAYLDGVVHFDFGESVQSTGQGVSEIITTGFGPSAIIGLQAL
FT                   IISLLVGIAAGTFAALYHGKVIDYGVSLLAILGISIPSFILAPLFIQVFAIQFELLPVA
FT                   SWGTFEHTVLPSFALALGPIAVITRFVRSNMIEVLQSDYIKLARAKGIPIKKIIIRHAL
FT                   RNAIVPVLTFVGPLMAGLLTGTFVIEKIFSIPGLGKYFVDSIFNRDYPVIMGTTIFYSA
FT                   LLIVCIFITDIIHRIVDPRIRSIT"
FT   gene            186081..187085
FT                   /locus_tag="BMB171_C0172"
FT   CDS_pept        186081..187085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0172"
FT                   /product="oligopeptide transport system permease protein
FT                   oppC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04990"
FT                   /protein_id="ADH04990.1"
FT                   /translation="MGAYEINDQLLTNEEKKELTINKDQQKISRKKEVFRKFVSNPIAV
FT                   LGSVTLLLIIVFSLVGESLTPFTASEQVKEATNLPPSSEHWFGTDDLGRDIWARTWAGG
FT                   KISLTVGLVAAALDIGLGVLIGGFSGYVRGRNRLGTLIDEWIIRGIEVLYGIPYLLIVI
FT                   LLLIVMKPGLFTIIIALALTGWIGMARLVRAQVLSLKQREFVIAAERLGTSHMKIIYGH
FT                   LIPNLTGIIIVNLSFTIPAAIFSESFLSFIGLGVQSPAASWGTMTNDALGTLLSGEWWQ
FT                   LFFPAIMIALIMFAFNAIGDGLQDAIDPKIVKRNRKEKKHGTALIFRKRNVSR"
FT   gene            187042..188052
FT                   /locus_tag="BMB171_C0173"
FT   CDS_pept        187042..188052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0173"
FT                   /product="oligopeptide transport ATP-binding protein oppD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04991"
FT                   /protein_id="ADH04991.1"
FT                   /translation="MGQLLSLENVTLAVEKENSNQAIVKHVSFSISEGEIVALVGESGS
FT                   GKSVTAQSIIGLNQESIHIDDGNISFESKELTNLQESEWNQIRGKDISFIFQDPLSSLN
FT                   PTMKVGRQITEVILQHEKKSKKEAKEIAINLLNDLGIHEAEKRFEQYPHQLSGGMRQRI
FT                   CLAIAFACHPKLVIADEPTTALDVTIQKQIMELLKERKEKKNTSILLITHDLALVREVA
FT                   DRVVVMYGGRVVEKGTIEEVIGSPKHPYTKSLLQAIPNMDDSEKVLRAIEGTTPSIETL
FT                   NSFGCPFVNRCPVAIKECIHRFPERTTYSKEHSSHCWQHVLEHNKAKSKEKVNAS"
FT   gene            188049..188822
FT                   /locus_tag="BMB171_C0174"
FT   CDS_pept        188049..188822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0174"
FT                   /product="oligopeptide transport ATP-binding protein oppF"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04992"
FT                   /protein_id="ADH04992.1"
FT                   /translation="MTTDLITVKQVTKTYGSKNKEIAALKDISLSIPKGTTLGIIGESG
FT                   SGKTTLGKLIAGIESPTSGEIDYNGQVVHKLKATHKRDFLQKVQFIFQDSTAALNPRWK
FT                   VRDSVTEGYISFGLGDKGLKDKVAGDALERVGLDRRYIDRYPHEFSGGQRQRIAIARAL
FT                   LCEPEVLILDEPISALDVSLQIQIVHLLQKIQKEQGYTYLFIAHDLPMVHYLCEKVAVL
FT                   YKGELVEFGNTDEVFRNPQHSYTKTLLASTPKISG"
FT   gene            188836..190446
FT                   /locus_tag="BMB171_C0175"
FT   CDS_pept        188836..190446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0175"
FT                   /product="oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04993"
FT                   /protein_id="ADH04993.1"
FT                   /translation="MKKFLLFVIMTVLAITSVACGKKETQKASAGKGEGDRLVTNIGSD
FT                   PYTLDSAIATDSTSGYVIGHLFSSLYTQDSDGKYQNELAEKEEVNANGTEYTIHLKKDI
FT                   KWSDGSPITANDFEFAWKRLLNPKTGSMNATEMYFIKGAEAYNTGKGEEGQVGIQVVDP
FT                   QTLKVTLEHPVSSIKQKLASSLFIPLSKKSIDDNNKLKTDPKELITNGPFTLKEWKHNQ
FT                   AITVQKNKEYYDKKVTLKEIEFRIIPDSKTAYQLYKSKELDLLSSLPQEMIEKEKGNKE
FT                   YKRVAGFSSYIYSFNVEKEPFTNAKVRKAFSLAVDRKFIVEKLYKNNAQEANAFVPEGA
FT                   KTQSGRDFRKEKGGYVKFDPAEAKKLLEEGMKEQGWSTLPEVTLKFTTDTQHKKVAEAM
FT                   QEMFKKNLGVDIKLENKEWKSYIDTYKQSDFQLAYMGWGGSLLDPITKLDLYAGDGPNN
FT                   YAKWHNKEFDALVKEAEVEQNEDKRFDLLHKAEDIMFTDSPLIPIIFPSDSYLQKQTVS
FT                   GLQYYVGSKPDLRYAKIKK"
FT   gene            complement(190463..190930)
FT                   /locus_tag="BMB171_C0176"
FT   CDS_pept        complement(190463..190930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04994"
FT                   /protein_id="ADH04994.1"
FT                   /translation="MRILLSVLLALMLVPALTGCKAPAKEDTTSNKKTTEEAKNEAPAD
FT                   LKLNFNEFDLKADYQDTKKDYEADYKNVAADKKMEAKIEDHKADVKLTGDEAITKLSPL
FT                   LQELKFDKDTPDQEVIDQVVNVFKLDKDYQKFDLEVVFSDGTKKEYKREIK"
FT   gene            191104..192003
FT                   /locus_tag="BMB171_C0177"
FT   CDS_pept        191104..192003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0177"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04995"
FT                   /protein_id="ADH04995.1"
FT                   /translation="MHEEYKEIIKKSIEYIENHLHEELTTERVASHSAVSMYHFHRIFQ
FT                   RYVGMSVTDYIRKRRLTHAAQVLVSTERAVIDIAVQYGFSSQEAFTRAFKRMFQLPPKK
FT                   YRKYFQSFYIEREGVSMQKGIPKGWILSGSHPAEYEMGLDYEVVHQGKVSAYIKAKENV
FT                   THGGFSTLMQMFRADKYVGKRLRFTAFIKSENVRDWAGLWMRVDGKDTEPLAMDNMQNR
FT                   PIKNTNNWQSYSVVLDIKEEALGIAFGVLLSGEGCVWLDSIRFDEVDEKIPSTDLAENF
FT                   YETLLEDPVNLQFEEVEK"
FT   gene            complement(192532..194172)
FT                   /locus_tag="BMB171_C0178"
FT   CDS_pept        complement(192532..194172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0178"
FT                   /product="oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04996"
FT                   /protein_id="ADH04996.1"
FT                   /translation="MKKKVVPVVASVLGASLLLTACGGNKDNASGAKANDKAPDKQAIN
FT                   LSFASEIPTMDVAKATDGESMNVMRNVFEGLYAMGEDNKPVPGVAESVDISPDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFAFAWQRAVNPDTAAEYAFLFFDIKNAKQINQKQLPIDQLGV
FT                   KAVDDKTLEVQLDRPVPYFLSLTTFSTFLPINEEYLKSQGDKYGLETNHLIYNGAFTLD
FT                   NWKHEQSFQLKKNPNYWDAKTVKLEEINFNVVKDKSTEVNLYDSGQIDRVALTAEFVDK
FT                   YKSDPNFKERAEVGIQFLRLNQKNETLKNQHARLAINGAMNKKAYVETILNNGAVPAEG
FT                   MVPAKFAKSPEGNDFRKENGNLVKDDVKTAKENWKKAKQELGTDKVTIELLTSDNALAK
FT                   KTGEYLKGELEKNLDGLTVNLKPQPRKQQLKLLLSGDYEIGIDGWGPDFADPITFLDLF
FT                   TTGSAYNFDKYSNKEYDELIHKVKTDLAGDEKARFEAMKQAEKILLQDGAVAPLYQQGR
FT                   SYLQRSFIKGLVTTDFGGEFNYKWTEVTK"
FT   gene            complement(194578..196218)
FT                   /locus_tag="BMB171_C0179"
FT   CDS_pept        complement(194578..196218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0179"
FT                   /product="oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04997"
FT                   /protein_id="ADH04997.1"
FT                   /translation="MKKKFVPGIASVVGVSILLTGCGSYKNEASGANAKDEAPSKQVLN
FT                   LSSPTEIRTMDTARATDTDSGQVMRNVFEGLYNLGEGNKPVPGVAKSHEVSGDKTKYTF
FT                   HLRDSKWSNGTPVTAKDFVFAWQRAVDPATASEYAFLFFDIKNATKINNKELPADQLGV
FT                   KAVDDHTFEVELERPVPYFISLTAFPTFLPINEEFFKVQGDKYALEDNTILYNGAFTLS
FT                   DWKHEQSFKFKKNPTYWDKDTVKLEEINFNVVKEKSTEVNLFESKQLDRIKLTSDFVDK
FT                   YKKDANFKERPNVGVQFLRMNQQNKVLQNVSARQAIDQTIDRKSFVNTLLNDGSTPTFG
FT                   LVPKNFAKGPEGKDFRTANGDLTKVDTKSAQELWKKAKQELGSEKITLELLTSDADLDK
FT                   KTGEFLKGQLEKNLDGLTVNIKPQPRKQQVSLLLKGDYEIGIDGWSPDFADPITFLELF
FT                   TTNNPYNLDHYSNKEFDETIAKVKTTLAGDEKARWEALLASEKILFKDSVIAPLYQKGE
FT                   SYLERSYVKGIVQVDFAGQLNFKWAKIEK"
FT   gene            complement(196608..197441)
FT                   /locus_tag="BMB171_C0180"
FT   CDS_pept        complement(196608..197441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0180"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04998"
FT                   /protein_id="ADH04998.1"
FT                   /translation="MILTSLKDYTTLHNGVKMPWFGLGVFKVEDGSEVIDSVKAAIKNG
FT                   YRSIDTAAIYQNEEGVGQAIRESGVSREELFITSKVWNSDQGYETTLQAFETTLEKLGL
FT                   EYLDLYLVHWPVKGKYTESWKALETLYKDGRVRAIGVSNFHIHHLQDVFEIAEIKPMVN
FT                   QVEYHPRLAQEELHAFCKEHNIQLEAWSPLMQGQLLDNPTLQEIATKYNKSTAQIILRW
FT                   DLQNEVVTIPKSIKEHRIIENANIFDFELSADDMKAIQALNEDRRVGPDPDNFNF"
FT   gene            complement(197443..198246)
FT                   /locus_tag="BMB171_C0181"
FT   CDS_pept        complement(197443..198246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0181"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADH04999"
FT                   /protein_id="ADH04999.1"
FT                   /translation="MLTKHRILFIGAGRMAEAIFSGLLKTSKVYIEEIIVSNRSNIEKL
FT                   KQLQHQYNVSTTTDWKQHVTSVDTVVLAMPPSAHEELLAELSPLISNQLVVTVAAGIGP
FT                   FYLEARLPKGTPVAWIMPNTAAEIGKSISLYTMGQSVNEIHQETLQLLLKGIGTSQLCT
FT                   EEEVHQLTAVTGSAPAFLYYFAESLIEATKSYGVDEETAKHLVIQMISGSASMLEQTQN
FT                   PANLREQVTTPGGSTAEGLKTLYEYNFSEAIQKAVEATNKKARGK"
FT   gene            complement(198532..199383)
FT                   /locus_tag="BMB171_C0182"
FT   CDS_pept        complement(198532..199383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0182"
FT                   /product="glucose uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05000"
FT                   /protein_id="ADH05000.1"
FT                   /translation="MDILLALLPAIAWGNILLVSVKMGGGAYSQTVGMTIGALFFATIM
FT                   YVFTQPALTMTILIVGFISGLFWALGQVNQLKTVEKLGVSTTVTISTGMQLVATSIFGV
FT                   IAFREWTTTTTIILGTIAILLIVVGVVFTSLDDKENAQPPGQLKKGLLTLIVSTFGYLV
FT                   YVIIIRWYNIDGWSAILPQAVGMFVGAVVLTSKHKPFNKYAIRNALSGLLWGTGNLFLL
FT                   LSLPRVGVATSFPLSQTGIVISTFGAIVFLGEKKTKRQLIFIALGSVLIIGGAVLLGMT
FT                   KA"
FT   gene            complement(199684..200358)
FT                   /gene="modB"
FT                   /locus_tag="BMB171_C0183"
FT   CDS_pept        complement(199684..200358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="BMB171_C0183"
FT                   /product="molybdenum ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05001"
FT                   /protein_id="ADH05001.1"
FT                   /translation="MSIDAILSPVFLSLRVAACATILVTILGTIVGRALARSSWRYKVL
FT                   LETIFLLPMVLPPTIIGFFLIIIFGNNSPIGKWVESLFQQSIMFTSTAAIIASTVVAFP
FT                   LMYQSAKTGFSIANVQIEESARDLGASEYQVFLHVTLPLAFPALLSGMILSFVRALGEF
FT                   GATLMFAGNIPGKTQTIPTAIYMAIDASNMQLAWTLVVITIGMSLVFLLCIQLINKRIT
FT                   NS"
FT   gene            complement(200364..201170)
FT                   /gene="modA"
FT                   /locus_tag="BMB171_C0184"
FT   CDS_pept        complement(200364..201170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="BMB171_C0184"
FT                   /product="molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05002"
FT                   /protein_id="ADH05002.1"
FT                   /translation="MNKFILRSIGALILSFLLIFSAACTSGEKHTKSAAKEDKTVELTI
FT                   SAAASLQDALKEIEKQYKEKEPNIKLSFNFGASGALQQQIEQGAPADLFFSAAEDKFQT
FT                   LVKKGFINEKEGKNLLGNELVLVVPKDSSLTKIQDLKDEKIKKIALGTPESVPAGKYAK
FT                   ASLTHENLWNDVQNKVVFTKDVRQVLTYVETGNVDAGIVYKTDALISDKVKIGETAAAT
FT                   SHEPIHYPLGVIKESKHKKEATSFYEYLQSKDAQSIFKKYGFTVLS"
FT   gene            201331..202251
FT                   /locus_tag="BMB171_C0185"
FT   CDS_pept        201331..202251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0185"
FT                   /product="periplasmic molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05003"
FT                   /protein_id="ADH05003.1"
FT                   /translation="MDHHSYTTEEVAKRLKVSKLTVYDLIKKGELPSYRVGRQMRIDAA
FT                   DLDQYIKQMKTGKVQVNPVKNDGSSILNTCIISGQELTLDMLAKRIENRLPSSNVLRAY
FT                   QGSLTSLVKMYQGEGSIVSLHLFDGETGTYNIPYVKRILVGQPCLMINLLSRNVGFYVQ
FT                   KGNPKKIKTWADISGSTIKFVNREKGSGIRVLVDEQLRIRKLNKADISGYEWEESNHLG
FT                   VATQVANGKADVGVGSEKFSQIVNVDFIPIMKEQYDLVILKNKENEELIEVVKDILQSE
FT                   EFHNELNAIGGYDITKTGQIVYEIK"
FT   gene            complement(202827..203693)
FT                   /locus_tag="BMB171_C0186"
FT   CDS_pept        complement(202827..203693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0186"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05004"
FT                   /protein_id="ADH05004.1"
FT                   /translation="MELRDLQIFKSVADQGSVSSAAKELNYVQSNVTARIKQLENELKT
FT                   PLFYRHKRGMTLTAEGRKMLVYVSKILQDVDELKQVFLDSETPSGILKIGTVETVSTLP
FT                   TILSSYYKSYPNVDLSLQAGLTEELLREVLDHQLDGAFISGPIKHPLIEQYDVSTEKLM
FT                   LITQNKAFHIEEFTTTPLLVFNQGCGYRSKLERWLKDEGLLPKRIMEFNILETILNSVA
FT                   LGLGITLVPQSAVHHLSKAGKVHCHAIPEKYGSISTVFIRRKDSYMTNSMRSFLKTIED
FT                   HHHINML"
FT   gene            203836..204789
FT                   /locus_tag="BMB171_C0187"
FT   CDS_pept        203836..204789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0187"
FT                   /product="drug/metabolite exporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05005"
FT                   /protein_id="ADH05005.1"
FT                   /translation="MIIGALACLIASMSWGAMFPVADHALEYIDPFYFSLIRYGAVAIM
FT                   LIVLLLVKEGKQAFCLEGRGKLLVFFGTMAFTVYNVLIFLGQMLMGKSGVMVASIMEAL
FT                   MPMISICILWGYKHIKPKKYMITSMVIAFVGAVFVITKGDMSFFVTLKDNMFPLAFIFI
FT                   GVVGWVIYTMGGQTCSDWSTLRYSTLTCVFGTTVTGIITVIITSLGYISVPSMGTISIV
FT                   KYDLLFMMTLPGIVALLAWNYGVKILSSINGILFINFVPITTLAIMMMQGYQITMFDII
FT                   GTVLVIAALIRNNVCQRKEENINKRVLQEEQLRQAV"
FT   gene            204811..204951
FT                   /locus_tag="BMB171_C0188"
FT   CDS_pept        204811..204951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05006"
FT                   /protein_id="ADH05006.1"
FT                   /translation="MLESLLFFFAVGVACELAAINRNGRKKIKQQAELIQLLKELKERK
FT                   N"
FT   gene            205034..205276
FT                   /locus_tag="BMB171_C0189"
FT   CDS_pept        205034..205276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05007"
FT                   /protein_id="ADH05007.1"
FT                   /translation="MKAVRRREPLANPKKSNLLKVMLFIIHSPYLFNAEATAFASKRAD
FT                   NTMPIVFKKLFIFILFIILIHSFSNNCCPVSDLIV"
FT   gene            205445..206050
FT                   /locus_tag="BMB171_C0190"
FT   CDS_pept        205445..206050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0190"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05008"
FT                   /protein_id="ADH05008.1"
FT                   /translation="MYKPITFLLKYIFKTAGKVEVQGREKLPEGGPYVVACTHTSFMDV
FT                   LMLATGMYPTQIHYMAKKELFEGKFKNWFFKNVNAFPVDRANPGPSTLKIPSRLLKEGK
FT                   VVGIFPSGTRSAEDVSLKAGAVTIAMRSNVPLVPAAYVGPSSVKELIKGKRAQLIFGDP
FT                   IQIEAGEQIDRKTAMKMMTDQLNEKFEELKEALQSNQK"
FT   gene            206220..206387
FT                   /locus_tag="BMB171_C0191"
FT   CDS_pept        206220..206387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05009"
FT                   /protein_id="ADH05009.1"
FT                   /translation="MHSPYLFNVEATAFASIRAENTMPIVCKKLFVFILFIILIRSFSN
FT                   SCYLVSDLIV"
FT   gene            206524..207501
FT                   /locus_tag="BMB171_C0192"
FT   CDS_pept        206524..207501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0192"
FT                   /product="LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05010"
FT                   /protein_id="ADH05010.1"
FT                   /translation="MANIKDIAKMAGVSVTTVSRVLNDHPYVSEEKRKAVIEIVEKLNY
FT                   SQNANAVHLSKGKTNIVGVILPYINHPCFDAMVSGMMETALAHNYRVLLCQTNYNKKEE
FT                   MKSLHMLKTKQLDGLIICSRANDWETIEPYASYGAIIACEDNDISNISSVYTNHSAAFQ
FT                   LGMDYLIEKGYKKIGYCTGRKLGPSSQKRFDVYKQQLQSIDEEVNEEWIFTECFTLEDG
FT                   VKVAHKLKEMQDLPEALIVAGDEVAIGVMTEVEKLGIQVPEDLAIIGFDNQPISQVLQL
FT                   TTIDQNLKEIGKTAFEMLHRKVNDESSEQEKLEIPYELVERSTV"
FT   gene            208111..208947
FT                   /locus_tag="BMB171_C0193"
FT   CDS_pept        208111..208947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05011"
FT                   /protein_id="ADH05011.1"
FT                   /translation="MVNQRIKEITLITIGSLLFAIGINYFAIPNRLSEGGIIGLTVVTY
FT                   YLFDWSPGIVNFAINAILLAVGYKFFDKKTMIYTILGIVETSLFLYVTEHIEYHVNSDT
FT                   LLAALFAGLFVGIGLGCMFKAGGTSGGSAILAQLANQYLGWSVGKGVLIIDIVVIAGSV
FT                   FIIGQEKAMYTLVAVFIGAKVIDFIVEGMDTKTAVTIISNQPDLIREAITKNMTRGVTV
FT                   LEGRGGYTGKNKEVLYVVINKQELVKLKQVISRVDEDAFVVIHDVRDVLGGGFKAS"
FT   gene            209086..209442
FT                   /locus_tag="BMB171_C0194"
FT   CDS_pept        209086..209442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05012"
FT                   /protein_id="ADH05012.1"
FT                   /translation="MKKKMITTIIAMIVIVVMLLPTKLGPVIDKYNPFYKTKEYYTVVN
FT                   TIGQHIGDEWYEYEFIAFDERGREQKIKKTVKHMLKRDEALKVFAKGRYGESIEEIEVA
FT                   NIPINAKSKLLTMR"
FT   gene            210008..210121
FT                   /locus_tag="BMB171_C0195"
FT   CDS_pept        210008..210121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05013"
FT                   /protein_id="ADH05013.1"
FT                   /translation="MRKEEVVKLPIKDFCSYFTVAVVCIGLFDIITNLIVK"
FT   gene            210180..210944
FT                   /locus_tag="BMB171_C0196"
FT   CDS_pept        210180..210944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0196"
FT                   /product="Sec-independent secretion TatD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05014"
FT                   /protein_id="ADH05014.1"
FT                   /translation="MEWIDSHIHVDQYKDEEKSRLLKEVENSKEIKGLIAVSMNYQSCK
FT                   ETLSLAKKYPFIYPAIGFHPEQQIHKEECEQIYQLIEQNAEEIVAIGEVGLPYYLRKED
FT                   ERIAADPYIAVLKKFIELASKYNLPIVLHAVYEDADIVCDLLEKYKVSRAHFHWFKGSD
FT                   ETMKRMMRNGYYISITPDVLHKEKIRKIVSYYPLEYMMVETDGPWEFQEDVITHPRMIR
FT                   EVLKEISSIKNISIDKVAETIYENTSRFYLKG"
FT   gene            complement(211061..212710)
FT                   /locus_tag="BMB171_C0197"
FT   CDS_pept        complement(211061..212710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05015"
FT                   /protein_id="ADH05015.1"
FT                   /translation="MKKCLTLLFSILLLIPTYTSAQTSSKPKVLVLYSTQDDKFSNNVQ
FT                   ILNTQLGHFTNDITVKNLKEATSINNVSSYTHIVYIGETKEAFSDETKQFLENFSGPVL
FT                   VLGQNVEQLSKRFSFITLNSDDIRVNKIEYPDKKLKNTLEEERLIQSFDTNGTVLANAL
FT                   SSNNTNPLIVQHETSYYVATPNLFDWMSHYVGEMLFSYFSQKPTKNKVEAYLRLEDVHP
FT                   AADINQLKEIAELLKEKKMPYMITVIPVYKDPDTGKIIHLKDKPELVDLLRSMQDDGAA
FT                   IIMHGYTHQFYDSETGEGFEFWDVKTDQPIRQPKHEKPKTKDDFPNIESYNQYVKKGEE
FT                   FEEKYTKDHIEKGIQELVDAKLYPVAFEAPHYTMSQKGYEILSRYFSTYVGQLQLNDTT
FT                   WKSMHSPYYTSTPSFLHGMKLLPETVGFIEEDTPQTTAKMKERALSVSKLSDGVIGAFY
FT                   HPYLGAKPLKEVLKDLESIPNIEWIDLQKEKNEVKMKDIHITTNKDGIHVEKPTSANDI
FT                   IDYIKQYGFFLILGFVIIVFLLLLKRAKKLES"
FT   gene            212950..213483
FT                   /locus_tag="BMB171_C0198"
FT   CDS_pept        212950..213483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0198"
FT                   /product="invasion protein IagB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05016"
FT                   /protein_id="ADH05016.1"
FT                   /translation="MKKFFVGFLVVLGVYLYFQGKSEGMDKLVNGTSYVDSEEVKQMKQ
FT                   IIIEEAKKVNLPEWIPLAIAEHESRLNPRSVGDNGTSFGLFQLHRGGGLAPEHLTDDEL
FT                   KDPRTNAQIAMPHLMKGYKRGVQKGLTDFALLKYIANTSGWPGNLGPEWTDNNMKYNIG
FT                   LEDVYYRNKGVIKE"
FT   gene            complement(213520..214395)
FT                   /locus_tag="BMB171_C0199"
FT   CDS_pept        complement(213520..214395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0199"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05017"
FT                   /protein_id="ADH05017.1"
FT                   /translation="MRISCLLFFPYSFRGFPSPFPECIKRDFYTYFKGAYIQMDTQQLY
FT                   FLNDIGKQKPESIRNRSSACPFCDKEQLTDILATDGSIIWLKNKFPTLQDTFQTVLIET
FT                   DNCEDHIATYTEEHMRKLMQFSIQHWLHLQKNKEFASVILYKNHGPFSGGSLHHAHMQI
FT                   IGMKYVDYLENIKEENFQGVIVQKNERIELNISERPIIGFTEFNIIIDNISYIDEMANY
FT                   IQQTVRYILIDFHKGCSSYNLFFYYLNGKIICKVVPRFVVSPLYVGYKIPQVSTKLEDV
FT                   KIQLAEYFTK"
FT   gene            214966..215100
FT                   /locus_tag="BMB171_C0200"
FT   CDS_pept        214966..215100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05018"
FT                   /protein_id="ADH05018.1"
FT                   /translation="MKRSLAARAKFLDFIYFCRAIFHDAVVNGIRMPFFNNCIVTIER"
FT   gene            complement(215119..215274)
FT                   /locus_tag="BMB171_C0201"
FT   CDS_pept        complement(215119..215274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05019"
FT                   /protein_id="ADH05019.1"
FT                   /translation="MFPPKDFITLFTLQIVIFRTPFNIKNHEKETFPMVFGIEKGSQIA
FT                   PFSHVY"
FT   gene            215408..217105
FT                   /locus_tag="BMB171_C0202"
FT   CDS_pept        215408..217105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0202"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05020"
FT                   /protein_id="ADH05020.1"
FT                   /translation="MKKGTRIGHVAQIPKFDEVMTVYDVLSSAFKVEKELEKEMHALEK
FT                   NMAVEQEQSALEKLMERYGVIQEKFAFLGGYEIEANIMKVANGLQVTDLFSRVFTELSG
FT                   GEQTKVSLAYMLLQKPDLLLLDEPTNHLDLFAVEWLEQFLKEYTGTVIVISHDRYFLDE
FT                   VVTKIFDLEDGEIHVYHTNYSQFVEEKEERLLQEFQAYQEQQKKIKKMKEAIKRLREWA
FT                   NQANPPNEGLHKRARNMERALERIEKLKRPILERKQMGLQFEGQERSGKDVVVMKEVSK
FT                   GFAGRPLFEQANLHVRFQERAAIVGRNGTGKTTLLKLLLEEINPDVGEIRIGSSVKIGY
FT                   LSQHTYGNVKSNVLEAFREYVAVTEGEARHILAKFLFYGPAVFKKVTQLSGGEKMRLRL
FT                   AQLMYQDINFLILDEPTNHLDIESREVLEEALEQYNGTILAVSHDRYFLNKLFEKTYWI
FT                   DECKLFEFAGNYAWARQKWEEKLEKQVIKQKRQGRKSVEMVPVKEKKARNLEEIENELM
FT                   HVEEDIYAIECEMEHVADVERLEKLYEEKTMKELLRAKLYSELENIVE"
FT   gene            218194..219789
FT                   /locus_tag="BMB171_C0203"
FT   CDS_pept        218194..219789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0203"
FT                   /product="oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05021"
FT                   /protein_id="ADH05021.1"
FT                   /translation="MKIEKIAATDKTKVPDKAKNRKDTLVVGISKPGGVFLPYFQQNGW
FT                   DGNVTSVIFASLVSTDKQGKPIPELAEKWDVSSDQLTYTFHLRKDLKFSDGSPLTADDV
FT                   AFTLTLLHDKAYEGEVDISQYAVKGGKEYKEGKATSIEGIQVVDPQTIKITTEKVNSQA
FT                   IFVLGGTVLSKAYYGKDYKQNTSLDYLKDLYGKPLAAGPYKFEKYIPGQEVRFVANENY
FT                   YAGKPKIQNFIYKITSGDTKLQLFQTGEVDHTGLGTGDEVLEQAKALEFANIQIETAPS
FT                   FSYIYMNNNKPYLKDKKVRQALIYGLDRKKYVDTALKGYGTVANVPIHPTSWAYTEEGV
FT                   NKYEYDKEKAKKLLDEAGWKVGSDGIREKDGQKLKLSYFGPSSAKDSDLLIPIAKENYK
FT                   EIGVEFNPEFMDFNTMLSKVNKGDYDLASVSTPITSDPSETAGEYLSTANETSLGYKNA
FT                   KVDELIQKGIETVDIEKRKPIYKELYKELSDDPPVILLNYRRTITGYNGNIKGIDPEKY
FT                   NSISANLPVLSFEK"
FT   gene            219845..220849
FT                   /locus_tag="BMB171_C0204"
FT   CDS_pept        219845..220849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0204"
FT                   /product="oligopeptide transport system permease protein
FT                   oppB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05022"
FT                   /protein_id="ADH05022.1"
FT                   /translation="MKKCSSILSIRLERKRVKTYIVRRLLQMIPTLLGTSIIIFVLFAL
FT                   LPGDYIDSNPKITPERAAELRELYGLNKPIVERYFHWLGNALQGDFGFSLQYQEPVTSL
FT                   LNKFIWNSFSVAIIALFFIWLIALIIGVFSATKQHSLFDKLVTIGVFAAMSFPSFFIGL
FT                   FLIKVFAVDFKLLPIGGMIDVGSNSTGFAYVIEVAKHMILPVFILTLLGVGSLTRYFRT
FT                   SMLEVVRQDYIRTARAKGLKEKTVIYKHALKNAILPAITLLAFELPGLFSGAIIIEQIF
FT                   NWPGIGNIQLEALNFRDYTVLMAFTMFLSCLTIVSNFLADIVYAVVDPRIRLK"
FT   gene            220862..221782
FT                   /locus_tag="BMB171_C0205"
FT   CDS_pept        220862..221782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0205"
FT                   /product="oligopeptide transport system permease protein
FT                   oppC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05023"
FT                   /protein_id="ADH05023.1"
FT                   /translation="METVTVITEKKEKKRRNESSPWRQAFKKIKKNKMALVGFYALIFM
FT                   FLFCFIGPFFSPYASGKIQVALINKPPSFSHWLGTDQLGRDILTRLMQAGRISLTIGLA
FT                   SMVLSVILGALLGAIAGFYRGIVDNIIMRLADILMSMPGLPLLIIMGAILSEWKVPSDY
FT                   RLYVIMIILSLVGWPGLARLVRGQILSLREQAFMQAADVLGIKDYRKIIYHLIPNVLPI
FT                   LIVVSTLGVAGSILGESALSYLGLGVVPPTPSWGNMISAANSLIDFQKRPWLWIPPGFA
FT                   IFITVVSINLLGDALRDALDPKMRR"
FT   gene            221793..222773
FT                   /locus_tag="BMB171_C0206"
FT   CDS_pept        221793..222773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0206"
FT                   /product="oligopeptide transport ATP-binding protein oppD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05024"
FT                   /protein_id="ADH05024.1"
FT                   /translation="MSKAVVELKDLQTHFQTEEGTVKAVNHVSFSVREGETVCVVGESG
FT                   CGKSVTALSIMGLIAESGSVVGGDILYEGKSLLGMKEKELRSLRGNDIAMIFQEPMTSL
FT                   NPVFTVGEQIVETLREHELLSKNEAYKKAIELIRKVGIARADEIVHSYPHELSGGMLQR
FT                   IMIAVALSCNPKLLIADEPTTALDVTIQAQILDLLRQVKEEFKTSILLITHDLGVVAEM
FT                   ADYVVVMYGGKVIEEAPVLEIFQNPKHPYTKGLLKSKPVMGKRIDKLYSIPGQVPNLVG
FT                   LGEFCYFSGRCEHCMEICEKEAPNLNVNDENHKVACWLYEERAEQ"
FT   gene            222770..223735
FT                   /locus_tag="BMB171_C0207"
FT   CDS_pept        222770..223735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0207"
FT                   /product="oligopeptide transport ATP-binding protein oppF"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05025"
FT                   /protein_id="ADH05025.1"
FT                   /translation="MSEPLLEVKNLKTYFPIKGGVFSRTIGHVKAVDGVSFTINKGEVF
FT                   GLVGESGSGKTTIGKTILRLVQKTEGEVKFKGKDVHSLSKDELRKHRPNMQLVFQDPFS
FT                   SLNPRMRIGEALGEPMLAHGLATKENVREKVIEVLELCGLAPYHIDRYPHEFSGGQRQR
FT                   IVIARAMVLNPEFIVADEPVAALDVSIQAQIINLFSELQEKKGLSYLFISHDLSVVEHL
FT                   CTKIGIMYLGTIVETAPRDELFTNPLHPYTKALLSAVPIPDPTVKRERIILEGDIPSPA
FT                   NPPSGCRFHTRCPFATDVCKKIVPEFRNVGAEHFVACHHV"
FT   gene            complement(223770..224642)
FT                   /locus_tag="BMB171_C0208"
FT   CDS_pept        complement(223770..224642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0208"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05026"
FT                   /protein_id="ADH05026.1"
FT                   /translation="MKLIALDMDGTLLSSNLEISKENLQAIQTAQEAGHIVMICSGRAK
FT                   EDALKLLEEYKLSLPVGASNGAIVYVDGKVINSRCIQNDKVYKLAKLLESEGFPYKLYT
FT                   NKGVYSPYTWQDQVMQAFEENKHALDVTLEELERITEKQKKSNLITDFKKIEDVVNNQE
FT                   LEISKFFILTFNAAHRAQLLSILQEDADIMVTASAPTNLEIMDKNGHKGNGIQQMAAHF
FT                   NIPIEDTVAIGDNFNDVPMLEVAGLSVAMGNAEEDVKKLCDVVTLTNNEHGVAHAIEQF
FT                   VLKQTSSIK"
FT   gene            complement(225038..225208)
FT                   /locus_tag="BMB171_C0212"
FT   CDS_pept        complement(225038..225208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05030"
FT                   /protein_id="ADH05030.1"
FT                   /translation="MLQNFYYTNTLDRNTINAVNTTAPLADPTKSPFVTCNTCSFISFI
FT                   LPFYKLSICNF"
FT   gene            225226..225342
FT                   /locus_tag="BMB171_C0209"
FT   CDS_pept        225226..225342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05027"
FT                   /protein_id="ADH05027.1"
FT                   /translation="MKDMKEQVLQITKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            225378..225494
FT                   /locus_tag="BMB171_C0210"
FT   CDS_pept        225378..225494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05028"
FT                   /protein_id="ADH05028.1"
FT                   /translation="MKDMKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            225529..225645
FT                   /locus_tag="BMB171_C0211"
FT   CDS_pept        225529..225645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05029"
FT                   /protein_id="ADH05029.1"
FT                   /translation="MKDMKEQVLQVTKGDFVGSASGAVVLTALIVFLSSVLV"
FT   gene            225680..225799
FT                   /locus_tag="BMB171_C0213"
FT   CDS_pept        225680..225799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05031"
FT                   /protein_id="ADH05031.1"
FT                   /translation="MRDMNSEQVFQVTKTDLLGSLGGAVILTSFILFLANVLV"
FT   gene            226193..227311
FT                   /gene="hppD"
FT                   /locus_tag="BMB171_C0214"
FT   CDS_pept        226193..227311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hppD"
FT                   /locus_tag="BMB171_C0214"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05032"
FT                   /protein_id="ADH05032.1"
FT                   /translation="MKQKSMDTLAAQMEDFFPVRDVDHLEFYVGNAKQSSYYLARAFGF
FT                   KIVAYSGLETGNREKVSYVLVQKNMRFVVSGALSSENRIAEFVKTHGDGVKDVALLVDD
FT                   VDKAYSEAVKRGAVAIAPPQELTDEDGTLKKAVIGTYGDTIHTLVERKNYKGAFMPGFQ
FT                   KVEFNIPFEESGLIAVDHVVGNVEKMEEWVSYYENVMGFKQMIHFDDDDISTEYSALMS
FT                   KVMTNGSRIKFPINEPADGKRKSQIQEYLEFYNGAGVQHLALLTSDIVKTVEALRANGV
FT                   EFLDTPDTYYDELTARVGKIDEEIDKLKELKILVDRDDEGYLLQIFTKPIVDRPTLFIE
FT                   IIQRKGSRGFGEGNFKALFESIEREQERRGNL"
FT   gene            227378..228334
FT                   /locus_tag="BMB171_C0215"
FT   CDS_pept        227378..228334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0215"
FT                   /product="fumarylacetoacetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05033"
FT                   /protein_id="ADH05033.1"
FT                   /translation="MKFVTFRLPSKELRAGWLEGDKVIDMNLASEGKIPSSMIAFLEKA
FT                   DEYVEVVRNIKNPNKGIYALEEVQLTAALPNPSSIRDFYAFEQHVKTARGRRGLDVVPE
FT                   WYDIPVFYFTNHRAVIGSSDFVIGPKKSKKLDYELEIACVIGREGRNISREQAEEYIFG
FT                   YCIMNDWSARDLQATEMKVGLGPAKGKDFATSLGAHLVTKEELDVYRNGDRYNLEMTAH
FT                   VNGKLLSKGNFQDIYYTFAEMIERASEDVTLYPGDVIGSGTVGTGCILELGTEEWLQDG
FT                   DVVELSITGLGTLRNTIKKEKEAGDGHVLSSHGRTTS"
FT   gene            228300..229472
FT                   /locus_tag="BMB171_C0216"
FT   CDS_pept        228300..229472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0216"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05034"
FT                   /protein_id="ADH05034.1"
FT                   /translation="MFYRHMGELPHKRHVQFRKKDGSLYREQVMGTKGFSGTQSILYHH
FT                   YMPTEVGHSALSHSCQLQYEEDVALSHRHFRTKESKKSGDAISGRNFILGNEDLLIGVV
FT                   SPTEKMDYFYRNGDGDEMLFVHYGTGKIETMFGTIHYRKGDYVTIPIGTIYRVIPDEGE
FT                   TKFLVVEANSQITTPRRYRNEYGQLLEHSPFCERDLRGPEKLETYDEKGEFVVMTKSRG
FT                   YMHKHVLGHHPLDVVGWDGYLYPWVFNVEDFEPITGRIHQPPPVHQTFEGHNFVICSFV
FT                   PRLYDYHPESIPAPYYHSNVNSDEVLYYVEGNFMSRKGVEEGSITLHPSGIPHGPHPGK
FT                   TEASIGKKETLELAVMIDTFRPLRIVKQAHETEDEKYMYSWIEQGSYTVK"
FT   gene            229704..231119
FT                   /locus_tag="BMB171_C0217"
FT   CDS_pept        229704..231119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0217"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05035"
FT                   /protein_id="ADH05035.1"
FT                   /translation="MKQIFQKKPIAKLMQESKQKTLARTLGALDLTMLGIGAIVGTGIF
FT                   VLTGVVAAKHSGPAIILSFAIAALACAFAAFCYAEFASSVPVSGSVYTYTYATMGEVFA
FT                   FLIGWDLMLEYLLATSAVANGWSAYFQSLLKGFGIHIPTILSSAPGTGKGGIIDLPAVL
FT                   IILVMTVLLSRGVRESARVNNIMVFIKIAVVLIFIFAGFNYVKPENWTPFMPFGLDGVM
FT                   AGAATVFFAFIGFDAVSTAAEEVKRPQRDLPIGIIASLLICTVLYIVVSLILTGIVPYG
FT                   QLNISDPVAFALQFIGQDGLAGVISVGAITGITTVMLVMMYGQVRVSYAMSRDGLLPKR
FT                   LAKVHPKFKTPFLNTWTTGIIAALISGLIDLNVLAHLVNMGTLSAFALVAVAVIVMRRT
FT                   HPDLPRAFKAPLVPFLPALTVIFCLYLMLQLSGTAWISFGIWMVIGIAVYFLYSRKHSA
FT                   LNNSKKEEDVANL"
FT   gene            231228..232499
FT                   /locus_tag="BMB171_C0218"
FT   CDS_pept        231228..232499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0218"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05036"
FT                   /protein_id="ADH05036.1"
FT                   /translation="MKNTWRELREMDRNVWIRFIGETLNGIAMMMLMPFFALYLKDKVD
FT                   SLLEVGVIMALSPIAASFGSLIGGRIADIYGRKPIMIFSMASNALLMLGFLFIEGFIPY
FT                   AILSIFLGLSNSLFHPAASAMVADVTAPEKRTEAYGLLRMGHNIGAAIGPIMGASVVVL
FT                   SKNLVFIIASSTMLFYALLVLLLIQETMPKRTDKEEHKEKESGAVWKIVMRDKALMIYL
FT                   LAGIIISMGFSQTEGMLPLHFDNEMKRIFGTNNPYPYLMALNGLLVVLFQFQISKWATD
FT                   KPVGKTMLYGACLFGIGLFFIGWLPKWFGEFNTNATIILITLLFVYALYTLGEMIMSPV
FT                   QMTFVANLAPEHLRGTYMGAASLQWITGSAFGPLLGGFLLDRLLGHFLFTILAVGCVVA
FT                   GIVYVSLDRLVEQRQKDTLTKQSS"
FT   gene            232728..233813
FT                   /gene="ddl"
FT                   /locus_tag="BMB171_C0219"
FT   CDS_pept        232728..233813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="BMB171_C0219"
FT                   /product="D-alanyl-alanine synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05037"
FT                   /protein_id="ADH05037.1"
FT                   /translation="MTKIKLGLLYGGKSAEHQVSLQTALAAIKALNQDKFEIHPIYITE
FT                   QGQWVRGERIEGEVTDVEALKMSGAENAISPLSLSTEIIPSAASEENAIDVIFPLLHGP
FT                   NGEDGTVQGLLELMNIPYVGNGVLASSAGMDKVVMKNIFAEAGLKQAKYASFIRSAWEK
FT                   NREEAYSKVEDKLGYPCFVKPANLGSSVGINKCKNREELEDAFVEAFQFDRKIIVEENI
FT                   VGREVEVGVLGNDEPKCSVVGEIVPKKDFYDYKSKYIDGDTALIIPAEMTEEESNVIKR
FT                   DAIIAFQSLDGAGLTRADFFLTKDGEVYINEVNTMPGFTPFSMFPLLWQHTGLPYPELI
FT                   EELIRLAIERHEEKQKIKYTI"
FT   gene            233876..235252
FT                   /gene="murF"
FT                   /locus_tag="BMB171_C0220"
FT   CDS_pept        233876..235252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="BMB171_C0220"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl-D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05038"
FT                   /protein_id="ADH05038.1"
FT                   /translation="MIKRMLKQVEQMVNGTELAEQYEGITIQGVSIDTRKIEKGNLYVP
FT                   IQGERFDGHAFVDKAVENGAVATLWMKDVANPPENLPVIFVEDTLSALQMLAKNYRDQL
FT                   DVKVVGVTGSNGKTSTKDIVTSLLATKFKVQKTEGNFNNHIGLPLTILNLEENTEVAVL
FT                   EMGMSSRGEIEFLSKLARPNAAIITNIGEAHLMDLGSREAIAEAKLEIVTGLQEGGVFV
FT                   YNGDEPLLTNRVPGMNLAAETVTFGDARANDYYPTTVTLQATGTHFKMNRDENISFYLP
FT                   VLGKHNVYNTLASMAIAKHFGVTWEEMKEGLVTLQMTGMRMEIVKTNSGLTIINDAYNA
FT                   SPTAMEAAFHLMNGLDGFAKKIVVLGDMLELGDQEVQFHYEVGKLIDPAKISHVFTYGR
FT                   LGAQIAEGAKINFPNERVKAYDNKEELVKDLQAVVDVKDVVLIKASRGMKLEEVITMLK
FT                   "
FT   gene            235558..237159
FT                   /locus_tag="BMB171_C0221"
FT   CDS_pept        235558..237159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0221"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05039"
FT                   /protein_id="ADH05039.1"
FT                   /translation="MTTFRELGLSDSLLQSVESMGFEEATPIQAETIPHALQGKDIIGQ
FT                   AQTGTGKTAAFGLPLLDKVDTHKESVQGIVIAPTRELAIQVGEELYKIGKHKRVRILPI
FT                   YGGQDINRQIRALKKHPHIIVGTPGRILDHINRKTLRLQNVETVVLDEADEMLNMGFIE
FT                   DIEAILTDVPETHQTLLFSATMPDPIRRIAERFMTEPQHIKVKAKEVTMPNIQQFYLEV
FT                   QEKKKFDVLTRLLDIQSPELAIVFGRTKRRVDELSEALNLRGYAAEGIHGDLTQAKRMS
FT                   VLRKFKEGSIEVLVATDVAARGLDISGVTHVYNFDIPQDPESYVHRIGRTGRAGKKGIA
FT                   MLFVTPRESGQLKNIERTTKRKMDRMDAPTLDEALEGQQRLIAEKLQSTIENENLAYYK
FT                   RIAEEMLEENDSVTVVAAALKMMTKEPDTTPIALTSEPPVVSRGGGSKKRGGNGGGYRD
FT                   GNRNRSRDGRGGGDGRNRDRNRDGRNRDGNRDRNRDGNRDRNRDGGSRGRRGEGQGRPG
FT                   SSNGRGERKHHSRPQA"
FT   gene            237256..238218
FT                   /gene="uvsE"
FT                   /locus_tag="BMB171_C0222"
FT   CDS_pept        237256..238218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvsE"
FT                   /locus_tag="BMB171_C0222"
FT                   /product="putative UV damage endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05040"
FT                   /protein_id="ADH05040.1"
FT                   /translation="MLVRLGYVAMSVHLKNASPSQTMTYAQFQKLDDRDAAIRKLERIA
FT                   NSNLENCLRLLKHNKGHDISFFRLSSKLIPLANHEELLEWNYIRPLKENLKKLGEYAVH
FT                   MNMRIDFHPDHFVVLNSPEESVFKQSVKTLQMHKKLLKGMGIEHKQRCVLHVGGGYKDK
FT                   ELALERFIENWSNVPRGIQEMIILENDDTTFTLEETLYLGEKLDIPVVFDLHHHMMNNE
FT                   QEDWYEDWARVVHTWETSLLPIKMHISSPREGKDPRAHADYINVDAFLSFLRRIKGSVP
FT                   QIDCMIEAKMKDESLFQLMRDLSEQVDVEIIDGASFYIK"
FT   gene            complement(238211..238783)
FT                   /locus_tag="BMB171_C0223"
FT   CDS_pept        complement(238211..238783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05041"
FT                   /protein_id="ADH05041.1"
FT                   /translation="MLIRSTHISLQPTILTLLLIHLVMMILGDFFLLPLAASNEYIAKG
FT                   EWWRVITSLLVHVDLQHFLSNSIFLFALGSSIEKQLGHFSFFILFFLSGISGNISSYII
FT                   MPLEYIHAGASGGIFGLLGAQLFLLYNRYRSSKPKEIAIFSIMILLLLLFTFFNPSANP
FT                   ISHLTGLITGGILTPFLTKKNDGAKLI"
FT   gene            238877..239236
FT                   /gene="acpS"
FT                   /locus_tag="BMB171_C0224"
FT   CDS_pept        238877..239236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BMB171_C0224"
FT                   /product="Holo-[acyl-carrier protein] synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05042"
FT                   /protein_id="ADH05042.1"
FT                   /translation="MIIGIGIDIIELNRIEKMLDGKLKFMERILTENERNVAMELKGSR
FT                   LTEFVAGRFAAKEAYSKAVGTGIGKEVSFLDIEVKNDERGKPILITSTEYIVHLSISHS
FT                   KEFAVAQVVLESLSR"
FT   gene            239330..240343
FT                   /locus_tag="BMB171_C0225"
FT   CDS_pept        239330..240343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05043"
FT                   /protein_id="ADH05043.1"
FT                   /translation="MKRRLFLVLVGLLTVFVLAGCMEKKQDDVVRDLESKVKGMKSYQA
FT                   EAKLSIKTGNEPQEYNVEIWHKEPSFYRVNLKNAKKDQSQIILRNEEGVFVLTPALNKS
FT                   FRFQSDWPQNSSQAYLYESLVRDILQDKKNLTFEKTDKYYIFKTKTNYQHQNMLPRQEI
FT                   TLNKSDLTPVSVKLMDNDQNVLVKVDFSKVKFDAKFDKGAFDTKQNMSRAQVDVQTTAK
FT                   EDKPFAILYPLDTPQGMTLQDEKELKTDSGKRAILTYTGNKKSFTLIQEKAKVAEASSA
FT                   VSVSGEPVDLGFTIGALTKDSVTWSHNGVEYMLVSKGLEPKELLMVARSVTAKQVK"
FT   gene            240461..241630
FT                   /gene="dal1"
FT                   /locus_tag="BMB171_C0226"
FT   CDS_pept        240461..241630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dal1"
FT                   /locus_tag="BMB171_C0226"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05044"
FT                   /protein_id="ADH05044.1"
FT                   /translation="MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSNVEIFAVVKANAY
FT                   GHDYIPVAKTALEAGATRLAVAFLDEALVLRRAGITEPILVLGPSPPRDVNVAAENDVA
FT                   LTVFQKEWVDEAIKLWDGSSVMKFHINFDSGMGRIGIRERKELKEFLKSLEGAPFLELE
FT                   GVYTHFATADEVETSYFDKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNA
FT                   VRIGIAMYGLSPSVEIRPFLPFELEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEW
FT                   IATVAIGYADGWLRRLQGFEVLINGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQ
FT                   GDEYISATEVAEYSGTINYEIIATISFRVPRIFIRNGKVVEIINYLNNI"
FT   gene            241990..242226
FT                   /locus_tag="BMB171_C0227"
FT   CDS_pept        241990..242226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0227"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05045"
FT                   /protein_id="ADH05045.1"
FT                   /translation="MVTELDGIGKQENKNRHELICQATQLLLRQHKTKKRYQHESMRRG
FT                   YIEMGKINLGIASEAFLAEYEAAHTVERLVSGG"
FT   gene            242231..242581
FT                   /locus_tag="BMB171_C0228"
FT   CDS_pept        242231..242581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0228"
FT                   /product="PEMK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05046"
FT                   /protein_id="ADH05046.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVA
FT                   AITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQIRTIDKQRLTDKITHLDEVMMIRVD
FT                   EALQISLGLIDF"
FT   gene            242649..244817
FT                   /locus_tag="BMB171_C0229"
FT   CDS_pept        242649..244817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0229"
FT                   /product="transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05047"
FT                   /protein_id="ADH05047.1"
FT                   /translation="MEMVDNRQALMKMLVKELGFTEKQVRHVIQLTEEGNTVPFIARYR
FT                   KEWTGSLDEVQIRTILERWQYMMQLEDRKEEVLRLIDEKGKLTEELRQQIVKATKLQEV
FT                   EDLYRPYKEKRRTKATVAKEKGLEPLAEWLLLYKKEDPAKKAVEFINVEKEVQSAEEAL
FT                   QGAQDIIAEMVSDEAAYRSWIRNVTFRKGVMSSSVKDEEKDEKNIYEMYYSYEEPLQKV
FT                   VPHRVLAMNRGEKEDILRVAVVPPVDEIVTFLNKKVIRDNDSKSAHYVQLAIEDGYKRL
FT                   IQSSIEREIRKELTETAEEQAIHIFSENLRNLLLQPPMKGKVVLAVDPAYRTGCKLSVV
FT                   DDTGKVLHIDVIYPHPPVRKYDDAKTKVLSIIDKYQVEMIAIGNGTASRETEEFIVDVL
FT                   QSVNRDVFYIIVNEAGASVYSASDLAREEFPNLQVEERSAVSIGRRLQDPLAELVKIDP
FT                   KSVGVGQYQHDVSQKRLNESLTFVVETAVNQVGVNVNTASVALLQYVSGLSKTVAKNIV
FT                   AKREEDGKFTKRTELKKIPRLGAKTYEQCIGFLRILEGANPLDRTGIHPEQYKNVELLL
FT                   KSLGLSIDDVGQPQLQKRLEEVEISKLSQETGVGEPTLVDIIDALISPERDMRDELPKP
FT                   LLKKGILKLEDLKRGMELEGTVRNVVDFGAFVDVGVKQDGLVHISKLSKQFVKHPLDVV
FT                   SVGQIVKVWVDDIDTKKGRVALSMLPIE"
FT   gene            245187..245645
FT                   /locus_tag="BMB171_C0230"
FT   CDS_pept        245187..245645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05048"
FT                   /protein_id="ADH05048.1"
FT                   /translation="MDEQEIQRLVEEVSLQYFEMPFLHKAVFNNRLRTTGGRYLLKSHN
FT                   IELNYRYYELYGEEELVGIIKHELCHYHLHIAGRGYKHGDRDFRELLKKVDAPRFCKRM
FT                   INEEKEKKIYKYECMECSLQYVRRRQINIKRYVCGKCKGKLKPISKTS"
FT   gene            245759..245833
FT                   /locus_tag="BMB171_C5152"
FT   tRNA            245759..245833
FT                   /locus_tag="BMB171_C5152"
FT                   /product="tRNA-Asn"
FT   gene            245837..245927
FT                   /locus_tag="BMB171_C5153"
FT   tRNA            245837..245927
FT                   /locus_tag="BMB171_C5153"
FT                   /product="tRNA-Ser"
FT   gene            245936..246010
FT                   /locus_tag="BMB171_C5154"
FT   tRNA            245936..246010
FT                   /locus_tag="BMB171_C5154"
FT                   /product="tRNA-Glu"
FT   gene            246015..246090
FT                   /locus_tag="BMB171_C5155"
FT   tRNA            246015..246090
FT                   /locus_tag="BMB171_C5155"
FT                   /product="tRNA-Val"
FT   gene            246116..246192
FT                   /locus_tag="BMB171_C5156"
FT   tRNA            246116..246192
FT                   /locus_tag="BMB171_C5156"
FT                   /product="tRNA-Met"
FT   gene            246196..246271
FT                   /locus_tag="BMB171_C5157"
FT   tRNA            246196..246271
FT                   /locus_tag="BMB171_C5157"
FT                   /product="tRNA-Asp"
FT   gene            246359..246433
FT                   /locus_tag="BMB171_C5158"
FT   tRNA            246359..246433
FT                   /locus_tag="BMB171_C5158"
FT                   /product="tRNA-Gln"
FT   gene            246439..246511
FT                   /locus_tag="BMB171_C5159"
FT   tRNA            246439..246511
FT                   /locus_tag="BMB171_C5159"
FT                   /product="tRNA-Lys"
FT   gene            246528..246613
FT                   /locus_tag="BMB171_C5160"
FT   tRNA            246528..246613
FT                   /locus_tag="BMB171_C5160"
FT                   /product="tRNA-Leu"
FT   gene            246706..246782
FT                   /locus_tag="BMB171_C5161"
FT   tRNA            246706..246782
FT                   /locus_tag="BMB171_C5161"
FT                   /product="tRNA-Arg"
FT   gene            246787..246863
FT                   /locus_tag="BMB171_C5162"
FT   tRNA            246787..246863
FT                   /locus_tag="BMB171_C5162"
FT                   /product="tRNA-Pro"
FT   gene            246865..246935
FT                   /locus_tag="BMB171_C5163"
FT   tRNA            246865..246935
FT                   /locus_tag="BMB171_C5163"
FT                   /product="tRNA-Gly"
FT   gene            247019..248558
FT                   /gene="rrf_6"
FT                   /locus_tag="BMB171_C5104"
FT   rRNA            247019..248558
FT                   /gene="rrf_6"
FT                   /locus_tag="BMB171_C5104"
FT                   /product="16S ribosomal RNA"
FT   gene            249163..252082
FT                   /gene="rrl_6"
FT                   /locus_tag="BMB171_C5105"
FT   rRNA            249163..252082
FT                   /gene="rrl_6"
FT                   /locus_tag="BMB171_C5105"
FT                   /product="23S ribosomal RNA"
FT   gene            252135..252249
FT                   /gene="rrs_6"
FT                   /locus_tag="BMB171_C5106"
FT   rRNA            252135..252249
FT                   /gene="rrs_6"
FT                   /locus_tag="BMB171_C5106"
FT                   /product="5S ribosomal RNA"
FT   gene            252261..252337
FT                   /locus_tag="BMB171_C5164"
FT   tRNA            252261..252337
FT                   /locus_tag="BMB171_C5164"
FT                   /product="tRNA-Met"
FT   gene            252341..252416
FT                   /locus_tag="BMB171_C5165"
FT   tRNA            252341..252416
FT                   /locus_tag="BMB171_C5165"
FT                   /product="tRNA-Asp"
FT   gene            252591..253064
FT                   /locus_tag="BMB171_C0231"
FT   CDS_pept        252591..253064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0231"
FT                   /product="ATP/GTP hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05049"
FT                   /protein_id="ADH05049.1"
FT                   /translation="MSKYEVTTKSSEETQRLSEKLGELVEAQDVIILEGDLGAGKTTFT
FT                   KGLAKGLGVKRVVNSPTFNIIKEYKGRLPLYHMDVYRLAESEEDLGFDEYFYGEGITVV
FT                   EWAHLIEAYLPNEKLQISLFHGGDDTRKIILEPIGDRYIRLCEELLQDESTSN"
FT   gene            253045..253737
FT                   /locus_tag="BMB171_C0232"
FT   CDS_pept        253045..253737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0232"
FT                   /product="glycoprotease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05050"
FT                   /protein_id="ADH05050.1"
FT                   /translation="MKVLAIDTSNYVMGVSLIEEENVIGEIITNLTKNHSVRLMPAVEK
FT                   LLKECGVKPKELTKIVVAAGPGSYTGVRIGVTAAKTLAWSLQIPIVGVSSLEVVAANGA
FT                   NFNGLICPLFDGRRGQIYTGLYTYEGEQLTSIEEDRIILIVDWLQMLKDKGQPVLFIGN
FT                   DVKLHKETIIEHLGDQAVFAPFTKNNPRPSELAFLGLQKEEQDVHTFVPSYLRLAEAET
FT                   KWLESQNK"
FT   gene            253751..254194
FT                   /gene="rimI"
FT                   /locus_tag="BMB171_C0233"
FT   CDS_pept        253751..254194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimI"
FT                   /locus_tag="BMB171_C0233"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05051"
FT                   /protein_id="ADH05051.1"
FT                   /translation="MDMIFRKMELDDIAQIVAIEEASFSTPWTADAFHRELTMNEHAHY
FT                   IVLEKDGRVVGYCGLWIIIDESHITNIAILPEYRGQKLGDALLKAVISEAKELGVKTMT
FT                   LEVRVSNEVAKQLYRKYGFQNGGIRKRYYADNQEDGLVMWVNI"
FT   gene            254194..255210
FT                   /locus_tag="BMB171_C0234"
FT   CDS_pept        254194..255210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0234"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05052"
FT                   /protein_id="ADH05052.1"
FT                   /translation="MEKNTIILGIETSCDETAVAVVKNGTEIIANVVASQIESHKRFGG
FT                   VVPEIASRHHVEEITVVLEEALKEANITFDDIDAIAVTEGPGLVGALLIGVNAAKAVAF
FT                   AHDIPLVGVHHIAGHIYANRLVKEVQFPLLSLVVSGGHTELVYMKEHGSFEVIGETRDD
FT                   AAGEAYDKVARTLSMPYPGGPHIDRLAHEGEPTIDLPRAWLEPDSYDFSFSGLKSAVIN
FT                   TVHNAKQRGIEIAPEDLAASFQESVIDVLVTKAARAAEAYNVKQLLLAGGVAANKGLRA
FT                   RLEEEFAQKENIELIIPPLSLCTDNAAMIAAAGTIAYEQGKRATLALNANPGLDIEA"
FT   gene            complement(255691..257670)
FT                   /locus_tag="BMB171_C0235"
FT   CDS_pept        complement(255691..257670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0235"
FT                   /product="ABC transporter ATP-binding protein uup"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05053"
FT                   /protein_id="ADH05053.1"
FT                   /translation="MIEKYKHGKVKKLFEVKTLILLQVNALSKLYGAETILANIKLEVQ
FT                   TKDRIALVGRNGAGKSTLLKIIAGELSHDGGEIIKPKDVSIGYLAQNTGLETSLTIWDE
FT                   MLTVFTHLQQMETKLRRLEQEMGKEENFSNEATYERLLADYDQLQLNYKDQGGYQYEAD
FT                   IRSILSGLGFPVETHQTTISTLSGGQKTRLALGKLLLTKPDLLILDEPTNHLDIETLTW
FT                   LEQYLQGYPGAILIVSHDRYFLDKLVTQVYEISNKESRRFVGNYSKYLDLKSALYEQEM
FT                   KRYEKQQDEIAKLEDFVQKNIARASTTKRAQSRRKQLDRMELLTRPLGDSKSASFHFDI
FT                   EKQSGNDVLQVNDATIGYDGNPIIEHVTMRLTRGDSVALVGPNGIGKSTLLKSIVNKLP
FT                   LLNGDVSFGSNVSVGYYDQEQANLTSSKRVLNELWDEYPLQPEKEIRTILGNFLFTGDD
FT                   VLKPVSSLSGGQKARLALAKLMMQKSNLLILDEPTNHLDLNSKEILENALIDYPGTLLF
FT                   VSHDRYFINRVTTTVVELSTEGAQEYLGDYDYYVEKKNEMIERAELEQQESDVPVQKVV
FT                   AQEKLNYLEEKERKKLERQRTRKIEELEQSIVELEEEIATLEDQLCLPEIYADYEKASE
FT                   ITTKKQTLQEQLETCMAEWEELHV"
FT   gene            257804..258433
FT                   /locus_tag="BMB171_C0236"
FT   CDS_pept        257804..258433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0236"
FT                   /product="redox-sensing transcriptional repressor Rex"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05054"
FT                   /protein_id="ADH05054.1"
FT                   /translation="MDQQKIPQATAKRLPLYYRFIQNLSLSGKQRVSSAELSEAVKVDS
FT                   ATIRRDFSYFGALGKKGYGYNVNYLLSFFRETLDQDDITRVALIGVGNLGTAFLHYNFT
FT                   KNNNTKIEMAFDVSEEKVGTEIGGIPVYHLDELEERLSNDIQVAILTVPATVAQAVADR
FT                   LAETSVHGILNFTPARLNVSENIRIHHIDLAVELQTLVYFLKNYPQ"
FT   gene            complement(258464..258655)
FT                   /locus_tag="BMB171_C0237"
FT   CDS_pept        complement(258464..258655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05055"
FT                   /protein_id="ADH05055.1"
FT                   /translation="MRNSPLFMAALYFLLGCIFTRFAITNVTDTIWNMWTILFAVMATI
FT                   DFNLALRLILVKFTKKKQ"
FT   gene            complement(258652..259401)
FT                   /locus_tag="BMB171_C0238"
FT   CDS_pept        complement(258652..259401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0238"
FT                   /product="CAAX amino protease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05056"
FT                   /protein_id="ADH05056.1"
FT                   /translation="MKKQYWWIIITYILMQLSGVVGLPLLLKTGLYDNRGFTIEEKGQI
FT                   ITGHWAIISFFIALCIVLWLLRTDIRDRHLDPMRSSVPATIGWIFIGFFLAIISQSIAG
FT                   MIEMYVFGVPRGSENTDRLMDIARTIPWFLIVVSIIGPILEEIVFRKILFGTLYKKFNF
FT                   FIAAIISSLVFATIHFDFTHLLVYTAMGLVFAFLYVKTKRIIVPIAAHVAMNTLVAIGQ
FT                   IFMSNEQIQEMIKEAEKMQGFIGGFFV"
FT   gene            259791..260075
FT                   /gene="groES"
FT                   /locus_tag="BMB171_C0239"
FT   CDS_pept        259791..260075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groES"
FT                   /locus_tag="BMB171_C0239"
FT                   /product="co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05057"
FT                   /protein_id="ADH05057.1"
FT                   /translation="MLKPLGDRVVIELVQAEEKTASGIVLPDTAKEKPQEGKVVAVGTG
FT                   RVLENGERVALEVAAGDLIIFSKYAGTEVKYEGTDYLILRESDILAVIG"
FT   gene            260114..261748
FT                   /gene="groEL"
FT                   /locus_tag="BMB171_C0240"
FT   CDS_pept        260114..261748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL"
FT                   /locus_tag="BMB171_C0240"
FT                   /product="chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05058"
FT                   /protein_id="ADH05058.1"
FT                   /translation="MAKDIKFSEEARRSMLRGVDTLANAVKVTLGPKGRNVVLEKKFGS
FT                   PLITNDGVTIAKEIELEDAFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLK
FT                   NVTAGANPMGLRKGIEKAVTAAIEELKTISKPIEGKSSIAQVAAISAADEEVGQLIAEA
FT                   MERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDSDKMEAVLDNPYILITD
FT                   KKISNIQEILPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFNVVAVKAPGFGD
FT                   RRKAMLEDIAILTGGEVITEELGRDLKSATVESLGRAGKVVVTKENTTVVEGVGSTEQI
FT                   EARIGQIRAQLEETTSEFDREKLQERLAKLAGGVAVIKVGAATETELKERKLRIEDALN
FT                   STRAAVEEGIVAGGGTSLMNVYTKVASIVAEGDEATGINIVLRALEEPVRQIAINAGLE
FT                   GSVVVERLKGEKVGVGFNAATGEWVNMLESGIVDPAKVTRSALQNAASVAAMFLTTEAV
FT                   VADKPEPNAPAMPDMGGMGMGGMGGMM"
FT   gene            complement(261952..263865)
FT                   /locus_tag="BMB171_C0241"
FT   CDS_pept        complement(261952..263865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0241"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05059"
FT                   /protein_id="ADH05059.1"
FT                   /translation="MKSKMFLHKETLPLEIPINFSNTNLKYVDKKFLNTTKWTIPMAFL
FT                   VPKTNGEEVRNLSLPHPLAQIKMMNFIEQFDSNITSFCSLSPYSIRSPWKINRANYAEL
FT                   ERKKEEFNYYNEQFLFEGTREEKFKISHNDIVKELLNYFSYRKFNNIVQFKQSQTYFRA
FT                   KYKYDNVMNIDIKEFFNSIYTHSLEWAVVGGKSLVKIGKSTKPKKARDSFFKCIDAICM
FT                   DINYNETNGIIIGPEFSRIISEVLLTRIDLEIARDLSSQGLELNKHYLIYRFIDDYTIF
FT                   FMNPKEDSERIIRNTIEKHLRGYKLNINKDKYYCTKSESMLEDDFIIIFNQKFERFKET
FT                   FIKSKRNKDKNRIISNFLVEFNILINTYKSKKLSLVRYALKALKDILGYHESPVDRQYL
FT                   LDIAAYIFNYAPEYFSTQNLYTLFLKHRKLHEGIEKEENILFDCDEEIFNRIHKIIKQH
FT                   INDFNSIYELLVSAKFLTKKIPSPLLCKILDKHKDDYFSICSVAVYILSNNGKVEPEYK
FT                   IVKQKIIKLLTTFIEDYEIKSKSSYQDAKYFYLINDFNYYPGFIHTDRKIKTLLQKHWK
FT                   DMQKQIQQDYFQNDEPAIKSQLTSSIMGASYYQWNCSYKKFLKRSFLKSANTFNSSQNA
FT                   PY"
FT   gene            264214..265368
FT                   /locus_tag="BMB171_C0242"
FT   CDS_pept        264214..265368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05060"
FT                   /protein_id="ADH05060.1"
FT                   /translation="MKISQYKVIQINKRKIYIGSPKQKDLDRKVHEDLKRKYRLYNKNR
FT                   DYIIRSIINTLVDSSENIVAGGKFTIINIDIADFFSSINTHRLYRRILRSGIIKDTSLR
FT                   KIKQIVFSSKIKGIPQGVSFSSALAEIYLEDFDKKIPLVYSNLILFKRYVDDIIIICWG
FT                   DHTQKVVDEGKSTDKNLKIMKDILGDLQLGMNKKHSVEVVDAESEFKFSYLGYTFTGQT
FT                   QSEKLNVSVDSKKIKKYKKSIRMLFSKFNRGVKSQSRFYKLYYNLRNLLWETGTKNFKN
FT                   GKEFTFGFKYNYREINDYSSFDEINQELKSQIYKAKSFNNQQKRLLHSLFLDKDKVQKF
FT                   NFNSASKPQLIGIMRKLNVTPQSSIGTERLCDVWISQIFKELYN"
FT   gene            266032..267432
FT                   /gene="guaA"
FT                   /locus_tag="BMB171_C0243"
FT   CDS_pept        266032..267432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BMB171_C0243"
FT                   /product="bifunctional GMP synthase/glutamine
FT                   amidotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05061"
FT                   /protein_id="ADH05061.1"
FT                   /translation="MNPKGIIFSGGPNSVYGEGALHCDEKIFELGLPIFGICYGMQLMT
FT                   QHFGGKVERANHREYGKAVLKVENESKLYANLPEEQVVWMSHGDLVTGLPEGFVVDATS
FT                   ESCPIAGMSNEAKNLYGVQFHPEVRHSEHGNDLIKNFVFGVCGCSEGWNMENFIEVELE
FT                   KIRETVGDKKVLCALSGGVDSSVVAVLIHKAIGDQLTCIFVDHGLLRKGEAEGVMKTFS
FT                   EGFHMNVIKVDARDRFMDKLKGVEDPEQKRKIIGNEFIYVFDDEASKLQGMDFLAQGTL
FT                   YTDIVESGTATAQTIKSHHNVGGLPEDMQFKLIEPLNTLFKDEVRVLGSELGIPDEIVW
FT                   RQPFPGPGLGIRVLGEITEEKLEIVRESDAILREEIIKAGLDREIWQYFTALPGMRSVG
FT                   VMGDERTYDYTVGIRAVTSIDGMTADWARIPWDVLEKISVRIVNEVKHVNRIVYDVTSK
FT                   PPATIEWE"
FT   gene            267973..269142
FT                   /locus_tag="BMB171_C0244"
FT   CDS_pept        267973..269142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0244"
FT                   /product="guanine-hypoxanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05062"
FT                   /protein_id="ADH05062.1"
FT                   /translation="MDPGAVFVATALAAAIGSLIMGIFAKYPIALAPGMGINAFFAYTA
FT                   VLTMGIPWQTAIAGTLMSGIIFIILTASGIREKIINAIPSELKFAVAAGIGLFIAFLGF
FT                   QNAGIIVKNDAVLVGLGDLTKGTTLLAIFGVVTTIIFMIKKVNGAVFYGMILTAILGVA
FT                   TGLIDTPKAVVGAIPSLEPTFGVALTHFGDIFTVQMGIVIITFFFIDFFDTAGTLVAVA
FT                   NQAGLMKNNKLPRAGKALFADAIATVIGAILGTSTTTSYIESSAGVAAGGRSGFTAVVT
FT                   AGFFLLALFFSPLLSVVTPAVTAPALIIVGILMVSSLGEIDWKKFEIAVPAFFTIISMP
FT                   LTYSIATGIAIGFIFYPITMVVSGRRKEVHPIMYVMGVLFVLYFIYVRK"
FT   gene            269287..269988
FT                   /locus_tag="BMB171_C0245"
FT   CDS_pept        269287..269988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0245"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05063"
FT                   /protein_id="ADH05063.1"
FT                   /translation="MAHETILVVDDEKEIRNLITIYLKNEGYKVLQAGDGEEGLRLLEE
FT                   NEVHLVVLDIMMPKVDGIHMCMKVREAKEMPIIMLSAKTQDMDKILGLTTGADDYVTKP
FT                   FNPLELIARIKSQLRRYMKMNGFAIQNEDELEIGEMKINISTHKVIVEGEEVKLTPREF
FT                   SILELLARNPGMVFSAEQIYEKVWNERSFQSDNTVMVHIRKVREKIEENPRKPRYIKTV
FT                   WGVGYKIEKDI"
FT   gene            complement(270110..270229)
FT                   /locus_tag="BMB171_C0246"
FT   CDS_pept        complement(270110..270229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05064"
FT                   /protein_id="ADH05064.1"
FT                   /translation="MNRTICRSLSLVINLFHTSPIIDSCLTIRILKKRCCCLC"
FT   gene            270257..271477
FT                   /locus_tag="BMB171_C0247"
FT   CDS_pept        270257..271477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0247"
FT                   /product="two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05065"
FT                   /protein_id="ADH05065.1"
FT                   /translation="MIEMENQNLEQGSRALKILVTDESGKVLYKTKQAQEEQIDLHNTI
FT                   RNAASFAINYTDGRNVFESTRKEFISFSPITIEGKNLYMFVSGIPEGEVIYDTQEGPFP
FT                   FLIGVLVFIFSFFYITKRKMKQIEAMAQGVKEIERGNLAYRIEKKGEDEIAALTENINN
FT                   MAEELMNNIEKERKLEKQKNELITNVSHDLRTPLTSIMGYLRLLRDSKYENKEQHDEYT
FT                   RIAFAKSEQLKNLIEDLFEYTKLTNEQVVLEKQEVCVNELLEQLIEELVPQAEEHGLTF
FT                   VKKFPEERAYASIDSEKMVRVFDNLLMNAIKYSKDDGEIKVSLQRQRRDIQIVIANHSE
FT                   AFTREELANLFERFYKKDQSRSRVTEGSGLGLAIAKSIVELQGGSIRAEYRDGIIQFIV
FT                   SLPIIEK"
FT   gene            271778..273317
FT                   /gene="rrf_7"
FT                   /locus_tag="BMB171_C5107"
FT   rRNA            271778..273317
FT                   /gene="rrf_7"
FT                   /locus_tag="BMB171_C5107"
FT                   /product="16S ribosomal RNA"
FT   gene            273922..276841
FT                   /gene="rrl_7"
FT                   /locus_tag="BMB171_C5108"
FT   rRNA            273922..276841
FT                   /gene="rrl_7"
FT                   /locus_tag="BMB171_C5108"
FT                   /product="23S ribosomal RNA"
FT   gene            276893..277007
FT                   /gene="rrs_7"
FT                   /locus_tag="BMB171_C5109"
FT   rRNA            276893..277007
FT                   /gene="rrs_7"
FT                   /locus_tag="BMB171_C5109"
FT                   /product="5S ribosomal RNA"
FT   gene            277334..278236
FT                   /locus_tag="BMB171_C0248"
FT   CDS_pept        277334..278236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0248"
FT                   /product="Alpha/beta hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05066"
FT                   /protein_id="ADH05066.1"
FT                   /translation="MLVGNYFYNYALNAKQEKEFLQDNPHLVETVSASGDVMAANEEKN
FT                   ANFVSKYKPNTLTIRSFDKLNLKGYEYMNEPSSHKWAIVVHGYNGRASEMTKYVRNFYE
FT                   QGYNVIAPDLRGHGNSEGDYVGMGWHDRKDVLIWIQQILKKDPNAEIALFGVSMGGATV
FT                   MMTSGEDLPSNVKVIIEDCGYSTVIDEFTYQLKDLFHLPKFPVMNAANTVTKLRAGYDL
FT                   EEASAVKQVAKSKTPMLFIHGDADTFVPFEMLDEVYNAAKVEKEKLIVPGAGHGEAEKV
FT                   DSNKYWNTVWKFVGKYIPA"
FT   gene            278438..279169
FT                   /locus_tag="BMB171_C0249"
FT   CDS_pept        278438..279169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0249"
FT                   /product="FrnE protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05067"
FT                   /protein_id="ADH05067.1"
FT                   /translation="MKIEVWSDFVCPFCYIGKRRLEMALEQFPHKKDVEVEFKSFELDQ
FT                   SAPIYSGTSINEVLASKYGISIEEAKRNNVQLGNHAASMGLSFNFDEMKPTNTFDAHRL
FT                   AKFAKNQGKEKEITENLLFAYFTESKNLSDVDTLATIAEASGLDKQEALNVINDKNAYA
FT                   NDVRIDEAIAQQYQISGVPYFIINQKYAISGAQPLETFVGALQQVWEEENPAPKLQELS
FT                   SEGGSDLSCTDGSCSVPSKEQ"
FT   gene            279503..281042
FT                   /gene="rrf_8"
FT                   /locus_tag="BMB171_C5110"
FT   rRNA            279503..281042
FT                   /gene="rrf_8"
FT                   /locus_tag="BMB171_C5110"
FT                   /product="16S ribosomal RNA"
FT   gene            281647..284566
FT                   /gene="rrl_8"
FT                   /locus_tag="BMB171_C5111"
FT   rRNA            281647..284566
FT                   /gene="rrl_8"
FT                   /locus_tag="BMB171_C5111"
FT                   /product="23S ribosomal RNA"
FT   gene            284618..284732
FT                   /gene="rrs_8"
FT                   /locus_tag="BMB171_C5112"
FT   rRNA            284618..284732
FT                   /gene="rrs_8"
FT                   /locus_tag="BMB171_C5112"
FT                   /product="5S ribosomal RNA"
FT   gene            284921..285088
FT                   /locus_tag="BMB171_C0250"
FT   CDS_pept        284921..285088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05068"
FT                   /protein_id="ADH05068.1"
FT                   /translation="MGVSPVIISTISFAFSDSEFFAYFIHWCYSYFYCLNNSYRFIITI
FT                   EYNTIIISSR"
FT   gene            complement(285620..286417)
FT                   /gene="bacA1"
FT                   /locus_tag="BMB171_C0251"
FT   CDS_pept        complement(285620..286417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bacA1"
FT                   /locus_tag="BMB171_C0251"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05069"
FT                   /protein_id="ADH05069.1"
FT                   /translation="MSDIIIAFILGIVEGLAEFLPISSTGHLILVGHLLGFEGERAKTF
FT                   EIVIQLGAILAIAILYHKRLVSLCNIKPLIQKEKKFNAFHVFLGVFPAVVAGLLLHDII
FT                   KTYLFQPYTVVIGLVAGAILMIFAEVKKKEAAAYSLDDLTYRQALTIGLFQCLAVYPGF
FT                   SRAGSTISGGLLAKVNYKTASEFSFLIALPVMIGATGLDLLKSWKYLSVDDIPMFAVGF
FT                   ITSFIVAMLAVVTFLKLLEKIGLKPFAYYRILLAILFTLFVLL"
FT   gene            complement(286435..287172)
FT                   /locus_tag="BMB171_C0252"
FT   CDS_pept        complement(286435..287172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0252"
FT                   /product="putative bacitracin ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05070"
FT                   /protein_id="ADH05070.1"
FT                   /translation="MVNLLYTELLKLKRSNMFLISIIGAGVAPFLVVVASYIHIKTKQP
FT                   TPTIWFDQLFTDVNLYTTLVIGFPLYGVVVAYLLTREYTEDTLKNLLTIPVSRISFITS
FT                   KFIILFLWIMMLTLVAWALTLILGLLGNFPGFNISLLLGSFLEFLICGGLLFLLSSPIV
FT                   LLTLVMKSYVPPIILTVIITMTNLMLVNSKHKDLFPWTATLDIANNELQPTYPPEYSYI
FT                   IIAVTTISGFIATLFYFKKVDIH"
FT   gene            complement(287165..288094)
FT                   /locus_tag="BMB171_C0253"
FT   CDS_pept        complement(287165..288094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0253"
FT                   /product="bacitracin transport ATP-binding protein bcrA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05071"
FT                   /protein_id="ADH05071.1"
FT                   /translation="MSPINTIIKTTNLTKVYGNQKSVDNLNINVQQGEIYGFIGRNGAG
FT                   KTTTIRMLLSLIKPTSGTIEIFGENLFQNQKDILSRIGSIVEVPGFYENLTAKENLLIN
FT                   AKIIGVHKKNAIEEALEIVGLQHETKKLVGKYSLGMKQRLGIARALLHYPELLILDEPT
FT                   NGLDPIGIKEIRKLIHSLAQERNITILISSHILAEVEQLVDRIGIIHEGKLLEEVSLDT
FT                   LRKANRKYIEFQVNNDDKAVMLLENHLQIFDYEVHDEGNIRIYSHFGQQGYINRTFVLN
FT                   DIEVLKMMISEDRLEDYFTKLVGGGTIG"
FT   gene            complement(288163..289176)
FT                   /locus_tag="BMB171_C0254"
FT   CDS_pept        complement(288163..289176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0254"
FT                   /product="two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05072"
FT                   /protein_id="ADH05072.1"
FT                   /translation="MKTDKTLFLISLQLIICGILNIQMDPRIKMSLFIILILITIYLFF
FT                   SRIQFIQHRKAMDTKLSRVLKGNLQTRLFTSNDHSLHNIVFSINELIGKLEQVQIEAKR
FT                   SEESRKQLLSSISHDIRTPLTSIIGYIDALKDGVAASEIEKQEYLKILYMKSNNLKHLV
FT                   DEIFNMAKLDANEFPLKEEELDFSEVTREVLIEFLPELSKHNIELQIRIPESTCPIIAD
FT                   HLSIMRIIGNLMKNAIYYGKDGKTIGVELLEADAEYELHIWDQGPGIPKHDLQNVFERM
FT                   YRSEQSRNSSFGGSGLGLSISKALVEKNGGHIWVESTPWKRTTFGFSIPKHNTFKK"
FT   gene            complement(289166..289879)
FT                   /locus_tag="BMB171_C0255"
FT   CDS_pept        complement(289166..289879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0255"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05073"
FT                   /protein_id="ADH05073.1"
FT                   /translation="MKDIRILIADDDKEIRNLLKIYLERELYMVDTAINGEEALHLFNQ
FT                   NNYNLVILDLMMPKIDGIEVCKKLRDKTNVPILMLTAKDHEVDKILGLSIGADDYITKP
FT                   FSIHEVIARVKALMRRFLVLGSNNTAQEKTTLSFKGLTINLNTYTVHTNKEEISLTGKE
FT                   LELLKFFTSNPGQVFTKTQLFRNVWDDNYIEDDNTVMVHIRKLRKKIEIDPSNPKFIQT
FT                   IWGIGYKFVGEKLED"
FT   gene            290365..291904
FT                   /gene="rrf_9"
FT                   /locus_tag="BMB171_C5113"
FT   rRNA            290365..291904
FT                   /gene="rrf_9"
FT                   /locus_tag="BMB171_C5113"
FT                   /product="16S ribosomal RNA"
FT   gene            292509..295428
FT                   /gene="rrl_9"
FT                   /locus_tag="BMB171_C5114"
FT   rRNA            292509..295428
FT                   /gene="rrl_9"
FT                   /locus_tag="BMB171_C5114"
FT                   /product="23S ribosomal RNA"
FT   gene            295480..295594
FT                   /gene="rrs_9"
FT                   /locus_tag="BMB171_C5115"
FT   rRNA            295480..295594
FT                   /gene="rrs_9"
FT                   /locus_tag="BMB171_C5115"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(295608..296684)
FT                   /locus_tag="BMB171_C0256"
FT   CDS_pept        complement(295608..296684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0256"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05074"
FT                   /protein_id="ADH05074.1"
FT                   /translation="MKIIAFYLPQFHQIKENDRWWGKGFTEWTNTKSAQPLFSGHYQPR
FT                   EPYQDFYYDLTTPSVRKWQAEIAKAYGIYGFCYYHYWFKGKRLLETPFNEVLKMKEPDF
FT                   PFCLSWANEPWTKSWDGLDKHILMPQDYGDISDWKEHFDYLLQAFQDKRYIYIDDKPLF
FT                   IIYRPGHIPDCEKMLNYWNALARENGLKGIYFAETLNSFPLPNINGFDASIQFEPFYTI
FT                   AHDSSSDINKVIYDSDMQLNVWDYDKVWMYILQRSLPKKKTFPGAFVDWDNTARRKNAN
FT                   SSIFVGSTPEKFTIYLSKQIHRTYSFYNSEFLFINAWNEWAEGTYLEPDKKYGFSYLEG
FT                   VKNAIDRGMKAYKKDESF"
FT   gene            complement(296908..297780)
FT                   /locus_tag="BMB171_C0257"
FT   CDS_pept        complement(296908..297780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0257"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05075"
FT                   /protein_id="ADH05075.1"
FT                   /translation="MNKFKLGSDFDHLVNSLSDVELLNLFIQSCSQTTINGVPVPRFPP
FT                   EEIQKQFVGASYEHALYEAYLFYRHIKEYAQNLGVPLNKESKVLDFGCGWGRIIRFLFK
FT                   DASDQNLLGIDVDSAMITLCNETLGRGIYKTASPHPPVEFISDNSLDIIFAYSVFSHLS
FT                   EATAENWVKEFSRVLRPGGIFIATTQARYFLDFCQQFQEHPELIQTGWHKTLSQAFPDI
FT                   HRAISDYENGKFVHSPTGAGDVRNSSFYGETVIPRTYIENHYEKYLKLQDFFDDVNRLP
FT                   QALFVLQKI"
FT   gene            complement(297808..298530)
FT                   /locus_tag="BMB171_C0258"
FT   CDS_pept        complement(297808..298530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0258"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05076"
FT                   /protein_id="ADH05076.1"
FT                   /translation="MEINLKHNNGYCVICEKKATFIEHNDWLRDHYLCSTCNSIPRQRA
FT                   LIHALHTFFPKWNSYSIHESSPGGITTQLLLKNCKNYTYSQYFKNYPLGQYFQGIRCEN
FT                   LEDMTFEDESFDLFITQDVFEHVMTPNKAFKEIERVLKPGGAHVFTVPWYHTLTKTVQR
FT                   ARMNQEVIEYIEEPIYHGNPIDENGSLVTFDWGQDMIEYIYTHANMYTIVYLQKDRSLG
FT                   LDAEFLHVFISKKQENKV"
FT   gene            complement(298749..299543)
FT                   /locus_tag="BMB171_C0259"
FT   CDS_pept        complement(298749..299543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05077"
FT                   /protein_id="ADH05077.1"
FT                   /translation="MKNINQELLNHVILHKDRIPHYHKDFPIILFWSHRSGCTALANWF
FT                   FFQIGLFTEAKKYNDFIHYYEFWVYKNNTNYIPELQNGLLEGKKDVCKLVRNPYTRAVS
FT                   SFLLLADNPYASPQWESIRHYFYNDKYSNQGISFKQFLYYVQAFGSNSLALDIHFSQQY
FT                   VPGEENFIQCYIPLEDFNTQITKLEHTYDLIKSPLALLTNSDHHRAHKMIYAGSYAELS
FT                   ITDTDFPRFPTYESFYDKETMDLVTEIYAQDFEMYPYTKGIF"
FT   gene            299836..300780
FT                   /locus_tag="BMB171_C0260"
FT   CDS_pept        299836..300780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0260"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05078"
FT                   /protein_id="ADH05078.1"
FT                   /translation="MRKNNYLIVGGNSFIGINLALGLLEQGQNVKVFSRHINNFPQNII
FT                   SEVEFIKGDLENVEDIYKALVNIDIIIYLAATSNVATSIEDVFGDINSSLFFLNFMESV
FT                   KDFRIKKIILASSGGTVYGEPEYLPIDEKHPLRPLSPYGITKVSLENYLYFYKRKYGID
FT                   YVVCRYSNPYGKYQNPLKKVGAINCFLYQHLSNERIHIYGNPEEIIRDYIYIDDLVEIT
FT                   IQLAQLNQLKSCVYNIGSGKGLSLKRIIVELEKITERKVDFICYKQKQENVQKIILNID
FT                   KVKQELNWEPKIDFKHGIRLNKLWIEEFLYSKK"
FT   gene            complement(300821..301597)
FT                   /locus_tag="BMB171_C0261"
FT   CDS_pept        complement(300821..301597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0261"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05079"
FT                   /protein_id="ADH05079.1"
FT                   /translation="MKDFIEEHKDLISQIAHSYNVNASIHPEDHIFQFIVTNPVFPSKK
FT                   EAIDYYFKDGQNSAQILLNLITSLYPPTGNPIKFLEFASGYGCVTRHLLNLQANLSITA
FT                   CDIHEEAISFIENKLNNSSILSHPEPEQLKLDSSTYDIVFCLSFFSHMPDTTWFRWLQT
FT                   LYNAVSPGGLFIFTTHGYQSKKYFGFPNLNEKGYWFLSSSEQFDLDVNQYGQTIVSPSY
FT                   VCDKIKLLPHNPIIKKYTEGFWWEHQDLWVIEKEAK"
FT   gene            complement(301665..303596)
FT                   /locus_tag="BMB171_C0262"
FT   CDS_pept        complement(301665..303596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0262"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05080"
FT                   /protein_id="ADH05080.1"
FT                   /translation="MHVNKKIIYVSHDAHFHGAQLLSLHTIKALKENFDYSVAIISIGS
FT                   GILIPDFQKYGPVYCLEQGYQTEEKVELLIKDLLSQDFTLAICSTVISGDIVALLARHN
FT                   IKIVSLIHELPHLIQQYSAEGKAKNIAEFAYKVVFPSQYVYEKFRTITELDPQKCHILP
FT                   QGLFNHNPYKNNIAKARNELRKKLNLPLDSKIILGVGFADYRKGIDLFSLISYSVRKTH
FT                   KDIHFIWVGRTDVQFLNTLPPKYKAHFTLVDPTPDIGLYNAGADLYLLTSREDPFPNVV
FT                   LEALDAKLPVIGFKNAGGFEDVVTEKTGALVDFLNLPKMLEKIYEFIHDEGLRLQKGSF
FT                   GQELIEKNFNFLNYIYQLLDLLEHNYKKISVIIPNYNYEKYLPARIESILNQTYPLYEL
FT                   IFLDDASTDHSVSTFKKLLSKENKPHLKVQQIINDKNSGSVFKQWIKGVSAATGDYIWI
FT                   AEADDLCDKTFLQEVIQGFYINNNITLSYTQSKQIDEQGNVLANHYLNYTNDIDKEKWK
FT                   GPYFRKGVEEIQDTLLIKNTIPNVSSVVFKNIDMKKTEKQLEKFKIAGDWFFYVSLLTE
FT                   GDIYFNPSPLNYHRRHLNSVTRTEDSYSHYNEVVQMQNFIKERFTIDDISKMKMYTYRK
FT                   HLKAYLKI"
FT   gene            304113..305652
FT                   /gene="rrf_10"
FT                   /locus_tag="BMB171_C5116"
FT   rRNA            304113..305652
FT                   /gene="rrf_10"
FT                   /locus_tag="BMB171_C5116"
FT                   /product="16S ribosomal RNA"
FT   gene            306257..309176
FT                   /gene="rrl_10"
FT                   /locus_tag="BMB171_C5117"
FT   rRNA            306257..309176
FT                   /gene="rrl_10"
FT                   /locus_tag="BMB171_C5117"
FT                   /product="23S ribosomal RNA"
FT   gene            309227..309341
FT                   /gene="rrs_10"
FT                   /locus_tag="BMB171_C5118"
FT   rRNA            309227..309341
FT                   /gene="rrs_10"
FT                   /locus_tag="BMB171_C5118"
FT                   /product="5S ribosomal RNA"
FT   gene            309552..310472
FT                   /locus_tag="BMB171_C0263"
FT   CDS_pept        309552..310472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0263"
FT                   /product="drug/metabolite exporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05081"
FT                   /protein_id="ADH05081.1"
FT                   /translation="MKEICMLLVAVILWGTAIAPTKWALESIQPFTLLFIRLFFAGGIC
FT                   MIFSFKELQKSVVHKKVPWKRMSLLAFTGVAGYFMFTSYGISLTSGLHVSIIDAALPLV
FT                   TILFSALFLKEEIRLNYWIGIILGAIGVLFITIPSKSANQEVSLIGDILILLSTFLFAF
FT                   YTVLLKRPKQEQYLSNEVFTTLTLIIGAVILLPFALVEIFYYGLPKVETWKTVLSVIYL
FT                   VIGATILAYWFWNKALERVSASVSGLYLNALPLISIITSIILLNESLTWRVIMGASLVL
FT                   IGVGWADKQKLCNLLKGNKVENRDC"
FT   gene            complement(310559..311350)
FT                   /locus_tag="BMB171_C0264"
FT   CDS_pept        complement(310559..311350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05082"
FT                   /protein_id="ADH05082.1"
FT                   /translation="MFNPSLLHIISSHSRSPHYHRKFPIILFWSQKSGCTSLAKWFFYQ
FT                   IDLLQTALSYSPFIHNYEYDIYKSTPAYSVRLGVALREKQKETFKLVRNPYRRAVSSFV
FT                   SLIGPPYMENPEWKPIRKFLYQDENSTKGISFKQFLYYLFIKGAHASDINPHFTQQYIA
FT                   GEEEYVTNYIYLENFDHEMKELEKRFELKTAPINEFSTSWHHQTPAMIYKGNFSEGDIT
FT                   DPLFPRHPTFESFYDTECIQLVQTIFQNDFDTYKYSKEYPY"
FT   gene            311672..313211
FT                   /gene="rrf_11"
FT                   /locus_tag="BMB171_C5119"
FT   rRNA            311672..313211
FT                   /gene="rrf_11"
FT                   /locus_tag="BMB171_C5119"
FT                   /product="16S ribosomal RNA"
FT   gene            313816..316735
FT                   /gene="rrl_11"
FT                   /locus_tag="BMB171_C5120"
FT   rRNA            313816..316735
FT                   /gene="rrl_11"
FT                   /locus_tag="BMB171_C5120"
FT                   /product="23S ribosomal RNA"
FT   gene            316786..316900
FT                   /gene="rrs_11"
FT                   /locus_tag="BMB171_C5121"
FT   rRNA            316786..316900
FT                   /gene="rrs_11"
FT                   /locus_tag="BMB171_C5121"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(316943..317089)
FT                   /locus_tag="BMB171_C0265"
FT   CDS_pept        complement(316943..317089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05083"
FT                   /protein_id="ADH05083.1"
FT                   /translation="MCPILSITLATLGKSGTQKIITIILKSLYFILFSSVALLNLRIIA
FT                   FGK"
FT   gene            317682..318167
FT                   /gene="purE"
FT                   /locus_tag="BMB171_C0266"
FT   CDS_pept        317682..318167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BMB171_C0266"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05084"
FT                   /protein_id="ADH05084.1"
FT                   /translation="MKSLVGVIMGSTSDWETMKYACDILDELNIPYEKKVVSAHRTPDY
FT                   MFEYAETARERGLKVIIAGAGGAAHLPGMVAAKTNLPVIGVPVQSKALNGLDSLLSIAQ
FT                   MPGGVPVATVAIGKAGSTNAGLLAAQILGSFHDDIHDALELRREAIEKDVREGSELV"
FT   gene            318251..319315
FT                   /gene="purK"
FT                   /locus_tag="BMB171_C0267"
FT   CDS_pept        318251..319315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BMB171_C0267"
FT                   /product="phosphoribosylaminoimidazole carboxylase ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05085"
FT                   /protein_id="ADH05085.1"
FT                   /translation="MGYKIAVLDPTKHSPCAQVADIEIVAPYDDLKAIQHLAEISDVVT
FT                   YEFENIDYRCLQWLEKHAYLPQGSQLLNTTQNRFTEKNAIEKAGLPVATYRLVQNQDQL
FT                   TEAIAGLSFPSVLKTTTGGYDGKGQVVLRSEADVEAARNLVDKAECILEKWVPFEKEVS
FT                   VIVIRSVSGETKVFPVAENIHVNNILHESIVPARITEELSQKAIAYAKVLADELELVGT
FT                   LAVEMFATDNGEIYINELAPRPHNSGHYTQDACETSQFGQHIRAICNLPLGETNLLKPV
FT                   VMVNILGEHIEGVLRQVNRLTGCYLHLYGKEEAKAQRKMGHVNILNDNIEVALEKAKSL
FT                   HIWDHQEQLLEGKR"
FT   gene            319312..320619
FT                   /gene="purB_2"
FT                   /locus_tag="BMB171_C0268"
FT   CDS_pept        319312..320619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB_2"
FT                   /locus_tag="BMB171_C0268"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05086"
FT                   /protein_id="ADH05086.1"
FT                   /translation="MISRYTRPEMGAIWTEENKFKAWLEVEILACEAWAELGDIPKEDV
FT                   KKIREHASFDIDRIYEIEKETRHDVVAFTRAVSETPALGEERKWVHYGLTSTDVVDTAL
FT                   SYILKQANEIILKDLENFVSILANKAKEHKYTIMMGRTHGVHAEPTTFGLKLGLWYEEM
FT                   KRNVERFKQAADTVRVGKLSGAVGTYANIDPFVEKYVCENLGLEAAPISTQTLQRDRHA
FT                   HYMSTLALIATSIEKMAVEIRGLQKSETREVEEAFAKGQKGSSAMPHKRNPIGSENMTG
FT                   LARVIRGYMMTAYENVPLWHERDISHSSAERVILPDATIALNYMLNRFGNIVKNLTVYP
FT                   ENMKRNMTRTYGLIYSQRVMLTLIDKGMVREEAYDIVQPKAMEAWETQVQFKELVEADE
FT                   RITSKLTQEEINECFNYEHHMQHVDTIFERLGLNEA"
FT   gene            320708..321427
FT                   /gene="purC"
FT                   /locus_tag="BMB171_C0269"
FT   CDS_pept        320708..321427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="BMB171_C0269"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05087"
FT                   /protein_id="ADH05087.1"
FT                   /translation="MQKLELLYEGKAKRIYRTESADMVWVEYKDSATAFNGEKKETITG
FT                   KGRLNNEITTLLFRKLQEVGIKTHFVEKLSETEQLVKKVSIIPLEVVTRNVIAGSLSKR
FT                   LGMEEGTVLAEPIVEFYFKDDDLGDPLVTEDHIRVLNVASPEQVSVLRDMALQINQVLI
FT                   DHFASCRVRLVDFKLEFGVTEEGEIILADEISPDTCRLWDETSNEKFDKDVFRRDLGNL
FT                   TDAYEEILKRLGGISHV"
FT   gene            321420..321674
FT                   /locus_tag="BMB171_C0270"
FT   CDS_pept        321420..321674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0270"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit PurS"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05088"
FT                   /protein_id="ADH05088.1"
FT                   /translation="MYKVKVYVTLRESVLDPQGTAVKGALHSLSFTEVQDVRIGKYMEL
FT                   TIDKSVSDLDSKVKEMCEKLLANVVMEDFRYEVEEVVAQ"
FT   gene            321719..322354
FT                   /gene="purQ"
FT                   /locus_tag="BMB171_C0271"
FT   CDS_pept        321719..322354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="BMB171_C0271"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05089"
FT                   /protein_id="ADH05089.1"
FT                   /translation="MFHAIKDELGEEVDYVWHDTENLDEYDAILLPGGFSYGDYLRCGA
FT                   ISRFANAMKAVQKAAEQGKPILGVCNGFQILVESGLLPGALIRNENLKFMCRTVQLRVE
FT                   NNETMFTSQYEKDEIINIPIAHGEGNYYCDEATLKQLEENNQIAFRYVENPNGSVSDIA
FT                   GIVNEKGNVLGMMPHPERAVDELLGGAEGLKVFQSILKQWRETYVVNA"
FT   gene            322338..324557
FT                   /gene="purL"
FT                   /locus_tag="BMB171_C0272"
FT   CDS_pept        322338..324557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="BMB171_C0272"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05090"
FT                   /protein_id="ADH05090.1"
FT                   /translation="MSLMLEPNPTQIKEERIYAEMGLTDEEFAMVEKILGRLPNYTETG
FT                   LFSVMWSEHCSYKNSKPVLRKFPTTGERVLQGPGEGAGIVDIGDNQAVVFKMESHNHPS
FT                   AIEPYQGAATGVGGIIRDVFSMGARPVALLNSLRFGELQSPRVKYLFEEVVAGIAGYGN
FT                   CIGIPTVGGEVQFDPCYEGNPLVNAMCVGLINHEDIKKGQAHGAGNTVMYVGASTGRDG
FT                   IHGATFASEELSESSEAKRPAVQVGDPFMEKLLIEACLELIQSDALVGIQDMGAAGLTS
FT                   SSAEMASKAGMGIEMYLDDVPQRETGMTPYEMMLSESQERMLIVVKKGREQEIVDLFEK
FT                   YGLAAVTMGKVTEDKMLRLFHKGEKVAEVPADALAEEAPIYHKPSKEAAYFAEFQAMKM
FT                   ETPKVENYKETLFALLQQPTIASKEWVYDQYDYQVRTSTVVTPGSDAAVVRVRGTEKGL
FT                   AMTTDCNSRYIYLDPEMGGKIAVAEAARNIVCSGGEPLAITDCLNFGNPEKPEIFWQIE
FT                   KSVDGMSEACRTLQTPVIGGNVSMYNERSGEAVYPTPTVGMVGLVHDLKHVTTQEFKQA
FT                   GDLVYVIGETKAEFGGSELQKMIHGKIFGQSPSIDLDVELKRQKQVLEAIQAGLVQSAH
FT                   DVAEGGLAVAISESAIGAKGLGATVKLDGEATAALFAESQSRFVITVKRENKEAFEKVV
FT                   EAIQVGEVTSTNEVTIHNEENEVLLTANVDEMRKAWKGAIPCLLK"
FT   gene            324542..325957
FT                   /gene="purF"
FT                   /locus_tag="BMB171_C0273"
FT   CDS_pept        324542..325957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="BMB171_C0273"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05091"
FT                   /protein_id="ADH05091.1"
FT                   /translation="MLAEIKGLNEECGVFGIWGHENAAQVSYYGLHSLQHRGQEGAGIV
FT                   VNNGEKIVGHKGLGLISEVFSRGELEGLNGKSAIGHVRYATAGGSEVANVQPLLFRFSD
FT                   HSMALAHNGNLINAKMLRRELEAEGSIFQTSSDTEVLLHLIKRSTKDSLIESVKEALNK
FT                   VKGAFAYLLLTGNEMIVALDPNGFRPLSIGKMGDAYVVASETCAFDVVGATYIRDVEPG
FT                   ELLIINDEGIHVDRFTNDVEHAICSMEYIYFARPDSNIAGVNVHAARKNMGKRLAAEAP
FT                   IEADVVTGVPDSSISAAIGYAEATGIPYELGLIKNRYVGRTFIQPSQELREQGVKMKLS
FT                   AVRGVVEGKRVVMIDDSIVRGTTSKRIVRMLREAGATEVHVRIASPPLKYPCFYGIDIQ
FT                   TRKELIAANHTVEEIREMIGADSLTFLSEDGLVDAIGRPYEGKYGGLCMAYFNGDYPTA
FT                   LYDYEQELLESMK"
FT   gene            326063..327103
FT                   /gene="purM"
FT                   /locus_tag="BMB171_C0274"
FT   CDS_pept        326063..327103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="BMB171_C0274"
FT                   /product="phosphoribosylaminoimidazole"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05092"
FT                   /protein_id="ADH05092.1"
FT                   /translation="MANAYKQAGVDIEAGYEAVSRMKKHVQTTMRKEVLGGLGGFGGMF
FT                   DLSKFALEEPVLVSGTDGVGTKLMLAFMADKHDTIGIDAVAMCVNDIVVQGAEPLFFLD
FT                   YIACGKAEPSKIENIVKGISEGCRQAGCALIGGETAEMPGMYSTEEYDLAGFTVGIVDK
FT                   KKIVTGEKIEAGHVLIGLASSGIHSNGYSLVRKVLLEDGELSLERIYGRLELPLGEELL
FT                   KPTKIYVKPILELLKKHEVYGMAHITGGGFIENIPRMLPEGIGAEIELGSWEIQPIFSL
FT                   LQEVGKLEEKEMFNIFNMGIGMVVAVKEEDAKDVVRLLEEQGEMARIIGRTIQGAGVTF
FT                   NGGTAL"
FT   gene            327100..327687
FT                   /gene="purN"
FT                   /locus_tag="BMB171_C0275"
FT   CDS_pept        327100..327687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="BMB171_C0275"
FT                   /product="phosphoribosylglycinamide"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05093"
FT                   /protein_id="ADH05093.1"
FT                   /translation="MSRLAVFASGSGSNFQSLVNAVEEKRLDAEISLLVCDKPEARAVG
FT                   RANYHHIPCFAFSAKAYESKEAFEKEILKKLEEYEIDYVILAGYMRLIGPTLLEAYGGK
FT                   IINIHPSLLPSFPGKDAVGQALEAGVKVTGVTIHYVDAGMDTGPIIAQEAVVVSEGDTR
FT                   ESLQKKIQQVEHKLYVNTVNQIVQSVKESTVN"
FT   gene            327712..329247
FT                   /gene="purH"
FT                   /locus_tag="BMB171_C0276"
FT   CDS_pept        327712..329247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BMB171_C0276"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05094"
FT                   /protein_id="ADH05094.1"
FT                   /translation="MKKRALVSVSDKTGVVEFVKGLLEQGIEVISTGGTKKLLEENGLQ
FT                   VIGISEVTGFPEIMDGRVKTLHPNIHGGLLAVRDNETHVTQMNELGMEPIDFVVVNLYP
FT                   FKETIAKPDVTFADAIENIDIGGPTMIRSAAKNHKFVSVIVDPVDYDIVLAELKENGEV
FT                   AEETKRKLAAKVFRHTAAYDALISNYLTEQMGEESPETLTVTFEKKQDLRYGENPHQKA
FT                   TFYKAPFAATSSVAYAEQLHGKELSYNNINDADAALSIVKEFTEPAVVAVKHMNPCGVG
FT                   VGTDIHEAYTRAYEADPVSIFGGIIAANREIDKATAEKLHEIFLEIVIAPSFSQEALEV
FT                   LQSKKNLRLLTINIEKATSASKKLTSVQGGLLVQEEDTLSLDESTISIPTKREPSGQEW
FT                   KDLKLAWKVVKHVKSNAIVLAKDDMTIGVGAGQMNRVGSAKIAITQAGEKAQGSALASD
FT                   AFFPMPDTLEEAAKAGITAIIQPGGSIRDEDSIKVADTYGIAMVFTGVRHFKH"
FT   gene            329511..330782
FT                   /gene="purD"
FT                   /locus_tag="BMB171_C0277"
FT   CDS_pept        329511..330782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BMB171_C0277"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05095"
FT                   /protein_id="ADH05095.1"
FT                   /translation="MNVLVIGRGGREHALAWKFAQSEKVEKVYVAPGNEGMRDVATPVD
FT                   IDENDFDALVLFAKENNVELTFVGPEIPLMNGIVDCFKEEGLRVFGPNKAAAVIEGSKA
FT                   FTKELMKKYDIPTAAYETFTDYEEAVQYIQKVGAPIVIKADGLAAGKGVTVAMTLEEAL
FT                   QAVKEMLQDVKFGAASKKVVIEEFLDGQEFSLMAFVNGTTVHPMVIAQDHKRAFDGDKG
FT                   PNTGGMGAYSPVPQIPESAVQEAIQTVLHPTAKAMIAENRSFTGILYAGLILTNDGPKV
FT                   IEFNARFGDPETEVVLPRLENDLVDVCNAVLDESELTFQWSEEAVIGVVLASKGYPEAY
FT                   KKGDIISGLDALQDVIVFHAGTAMKHGDFVTNGGRVLFVACKANSLQEAKDKVYKEIGK
FT                   IESDGLFYRSDIGYRAIGHEMTKS"
FT   gene            complement(330819..330983)
FT                   /locus_tag="BMB171_C0278"
FT   CDS_pept        complement(330819..330983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05096"
FT                   /protein_id="ADH05096.1"
FT                   /translation="MAKKKSFPLRIDPELHAVIEKWANDEFRSVNAHIEYLLREMAKQK
FT                   GKLKKDKDA"
FT   gene            complement(330999..331844)
FT                   /locus_tag="BMB171_C0279"
FT   CDS_pept        complement(330999..331844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0279"
FT                   /product="somatin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05097"
FT                   /protein_id="ADH05097.1"
FT                   /translation="MKEKQVFYVNGFLGIIGILILAAIGVFFLAQEIFIGAALTIILAA
FT                   VLATGIGIVQPNQAKVITFFGNYLGTIRQNGLFLTIPFAFRQTVSLRVENFNSKKLKVN
FT                   DVDGNPIEIAAVIVYKVVDSAKAMFGVEHYDRFVEIQSETAIRHVATKYPYDNFQDETC
FT                   VTLRGNTEEISEELKRELEARLEIAGVEVLETRLTHLAYATEIAHAMLQRQQAKAVLAA
FT                   RKEIVEGAVKMAKDSIHMLDEEGVLELDDERKANMVNNLLVAIVSDKGAQPVINTGSLY
FT                   "
FT   gene            complement(332064..332441)
FT                   /locus_tag="BMB171_C0280"
FT   CDS_pept        complement(332064..332441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05098"
FT                   /protein_id="ADH05098.1"
FT                   /translation="MKQNIGTINALIRITLGLVLFGCSATKLVRKPWCTWSNIFLWIGA
FT                   MKVAEGIVRFCPVVEMWKFGKYMNMGAFKMPSMNFAEKGHAKEEVNQTSTHDKPKSKGS
FT                   YDASDKEIESAIENIILAKPL"
FT   gene            332779..333468
FT                   /locus_tag="BMB171_C0281"
FT   CDS_pept        332779..333468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0281"
FT                   /product="geranylgeranylglyceryl phosphate synthase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05099"
FT                   /protein_id="ADH05099.1"
FT                   /translation="MYDISGWKHVFKLDPNKELSDEHLEMICESGTDAVIVGGSDGVTI
FT                   DNVLHMLVSIRRYAVPCVLEVSDVEAITPGFDFYYIPSVLNSRKVEWVTGVHHEALKEF
FT                   GDIMDWDEIFMEGYCVLNPEAKVAQLTEAKCNLTEDDVIAYARLADKLLHLPIFYLEYS
FT                   GTYGDVELVKNVKAELKQAKLYYGGGISNAEQAKEMAQYADTVVVGNIIYDDIKSALKT
FT                   VKAVKGE"
FT   gene            333481..335730
FT                   /gene="pcrA"
FT                   /locus_tag="BMB171_C0282"
FT   CDS_pept        333481..335730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="BMB171_C0282"
FT                   /product="DNA helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05100"
FT                   /protein_id="ADH05100.1"
FT                   /translation="MSMTDRLLNGLNPQQQKAVQTTNGPLLLMAGAGSGKTRVLTHRIA
FT                   YLLGEKGVAPWNVLAITFTNKAAREMRERIDTLVGPEAEDIWISTFHSMCVRILRRDID
FT                   RIGINRNFTILDSGDQLTVVKKIMKERNIDPKKFEPRSILAGISNAKNELLSADKYAKK
FT                   ITMADPYEKLTSDVYTEYQKRLLKNNSLDFDDLIMTTIQLFERVPEVLEFYQRKFQYIH
FT                   VDEYQDTNKAQYLLVKHLAARFKNLCVVGDSDQSIYRWRGADISNILSFEKDYENAQVI
FT                   LLEQNYRSSQNILNAANAVIEKNTNRKPKKLWTDNQVGSKISYYRAATEKDEAYFVAKK
FT                   IRDDIQMGKRKYTDFAVLYRTNAQSRMVEEIFLKSNIPYKIVGGTKFYDRKEIKDILAY
FT                   LRLIGNPDDEISFARIINMPKRGIGATSIDKIINYGVQNGISLTAVFDEIEHVGVSAKI
FT                   TKAVKEFANLLNNWVNMQEYLSVTELVEEVIEKTGYRDMLKNERSLEAEGRLENLDEFL
FT                   SVTQTFESQSEDKSLVAFLTDLALVADIDRVDEDPTAGEEVILMTMHSAKGLEFPVVFI
FT                   VGLEEGIFPHTRSLMEEDEMQEERRLAYVGITRAEEELYLSNAQMRTLFGRTSMNAASR
FT                   FIIEIPTELVESLNETAPKRETSFGAKGRTASSGKTTITTTTRSRSAFARPAAKTTGGE
FT                   QIGWAVGDKASHQKWGVGTVVSVKGEGDAKELDIAFPSPIGVKRLLAKFAPVTKQ"
FT   gene            335745..337754
FT                   /gene="ligA"
FT                   /locus_tag="BMB171_C0283"
FT   CDS_pept        335745..337754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="BMB171_C0283"
FT                   /product="NAD-dependent DNA ligase LigA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05101"
FT                   /protein_id="ADH05101.1"
FT                   /translation="MSKEIAKKRIEELRDLLNTFNYQYHVLDNPSVSDAEYDRNMQELI
FT                   KLEAENPEFMSEDSPSVRVGGTVLDIFEKVTHKSPMLSLGNAFNEGDLRDFDRRVRQGI
FT                   DSANVRYICELKIDGLAVSLHYEKGRFIQGATRGDGVTGEDITQNLKTIKAIPLRLNEE
FT                   VTLEARGEAYMPKRSFVKLNEEKEQNGEDVFANPRNAAAGSIRQLDPKIAAKRNLSMFV
FT                   YGLANVEEKTIPSHSESLDFLGELGFKTNPNRRTCETIEEVIAYVEEWQEKRPHLDYEI
FT                   DGIVIKVDDVALQESLGTTAKSPRWAIAYKFPAEEVVTRLTGIELSVGRTGVVTPTAEL
FT                   EPVRVAGTIVRRASLHNEDLIREKDIRIGDYVVVKKAGDIIPEVVNVIFDKRTGEEEEY
FT                   RMPTHCPACESELVRLEEEVALRCINPTCPAQIREGLIHFVSRNAMNIDGLGERVITQL
FT                   FDADYIRTFADLYALTKEQLLQLERFGEKSATNLIQAIENSKENSLERLLFGLGIRHVG
FT                   AKAARTFAEHFETMDELVKATEEELKAINEIGEKMAQSVVTYFDNEDVLELLQQFKEYG
FT                   VNMTYKGIKIADLQNVESYFAGKTVVLTGKLEVMGRSEAKKKIEALGGKVTGSVSKSTD
FT                   LVVAGEAAGSKLAQAEKHNVEVWNEERFLQELNK"
FT   gene            337771..338967
FT                   /locus_tag="BMB171_C0284"
FT   CDS_pept        337771..338967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0284"
FT                   /product="sex pheromone staph-cAM373 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05102"
FT                   /protein_id="ADH05102.1"
FT                   /translation="MKKIALAVLSLGLLVSGCSAGADKDEKVAEKSGKAKEQSVVPKYA
FT                   ISDEYYKTTIPFDGGNARGLVVQGLNSRLDIDEFETGLMRIAKESFSTKDNFLKGGKAL
FT                   DTQTIQMLVKRKRTDAEQKELEDKLKKDAVKFPNIGLNPALGTGSESLEVKNKKNPIYI
FT                   SNILEHDYYVKKGDNGEERVGMVVGLAMNSVQYFNEEHGYPREAAIPDEKMLAEGKKMA
FT                   QEILKVIHQKEPETKNIPITFAIYRQAPKSSLVPGNFVSYANAEKGSETVEDWQQINEK
FT                   YYLFPSEQAKTDNKREDLARVSNFKAKLSDYFQGDYTAVIGTGMYRDDELREMKLDIPV
FT                   QFNGKAEIVGFTQYVAGLVMEYFPNYMKVQVTIKSVERPEAIIIREAKQDEPLVKILD"
FT   gene            339064..339834
FT                   /locus_tag="BMB171_C0285"
FT   CDS_pept        339064..339834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05103"
FT                   /protein_id="ADH05103.1"
FT                   /translation="MEELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLSPA
FT                   SAIATNKLAATMGTFTSAMYFIRSGKVDFKIVGKLIPLTIVGAVAGALVVKFIPPDILR
FT                   PLVLVMLVFIAIYIIAKKNWGSVSTYKKMTQRKTLIFFFAILMIGFYDGFFGPGTGSFL
FT                   IFAFLLIGLDFIQAAASGKLLNFVSNIVSLITFLFLDIIHFEYGIIMGLSMILGAYFGS
FT                   KFAVQKGVGYVRTLFLLVTILLIGKNVLEYTHIL"
FT   gene            339989..341536
FT                   /locus_tag="BMB171_C0286"
FT   CDS_pept        339989..341536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0286"
FT                   /product="1-pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05104"
FT                   /protein_id="ADH05104.1"
FT                   /translation="MVVAYKHEPFTDFSVEANKLAFEEGLKKVESYLGQDYPLIIGGEK
FT                   ITTEDKIVSVNPANKEELVGRVSKASRELAEKAMQVADETFQTWRKSKPEMRADILFRA
FT                   AAIVRRRKHEFSAILVKEAGKPWNEADADTAEAIDFMEYYGRQMLKLKDGIPVESRPIE
FT                   YNRFSYIPLGVGVIISPWNFPFAIMAGMTTAALVSGNTVLLKPASTTPVVAAKFMEVLE
FT                   EAGLPAGVVNFVPGNGSEVGDYLVDHPRTRFVSFTGSRDVGIRIYERAAKVNPGQIWLK
FT                   RVIAEMGGKDTIVVDKEADLELAAKSIVASAFGFSGQKCSACSRAVIHEDVYDHVLNRA
FT                   VELTKELTVANPAVLGTNMGPVNDQAAFDKVMSYVAIGKEEGRILAGGEGDDSKGWFIQ
FT                   PTIVADVAEDARLMKEEIFGPVVAFCKAKDFDHALAIANNTEYGLTGAVITNNRDHIEK
FT                   AREDFHVGNLYFNRGCTGAIVGYQPFGGFNMSGTDSKAGGPDYLALHMQAKTTSETL"
FT   gene            complement(341807..342352)
FT                   /locus_tag="BMB171_C0287"
FT   CDS_pept        complement(341807..342352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0287"
FT                   /product="isochorismatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05105"
FT                   /protein_id="ADH05105.1"
FT                   /translation="MKTALLLIDIQNDYFPNGKMELRNPVEASEYANQLLQHFRTNSEP
FT                   IFHIQHVAIKDDATFFLPNTEGVHIHESVRPLREETVIVKHYPNSFRETNLLEQLKRLN
FT                   IEHVVVCGMMTHMCIDATVRAAFDFGFQCTVIHDACATKDLSFKNATIPAVYIHNTILA
FT                   SLNGVYANVISTQEFLAT"
FT   gene            342825..343844
FT                   /locus_tag="BMB171_C0288"
FT   CDS_pept        342825..343844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0288"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05106"
FT                   /protein_id="ADH05106.1"
FT                   /translation="MISFNNVSKVYESAGQSVHAVEDVTLSVEKGEIFGIIGFSGAGKS
FT                   TLLRLVNMLERPTAGTISIDDKDITSLSTKELRKLRQRIGMIFQSFNLFNSRTVFGNIA
FT                   YPLKLAKVPKNEIKERVNELLKFVGLEDKANYYPEQLSGGQKQRVGIARALATSPDILI
FT                   CDEATSALDPETTTEILNLLKKVNREYNLTILLITHEMHVVKEICHRVAVMEKGKVIEE
FT                   GKLFDVFTQPKTKTTQNFVRSVINDHLPESVLAKIQNGGQIYRLTFTGEETGQPVLSYI
FT                   AKNYNVDVNVLYGNIIELQNVLFGNLLVELQGEQREIQKALQHLRLQVQLKEVEAHAS"
FT   gene            343834..344499
FT                   /locus_tag="BMB171_C0289"
FT   CDS_pept        343834..344499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0289"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05107"
FT                   /protein_id="ADH05107.1"
FT                   /translation="MRVDWSIFWPRILDATGDTLLMVIVTLIFATILGIPLGLLLYVTR
FT                   KGNFLENKWVFSILNIIINTIRPVPFIIFLVALSPLTRSVIGTTIGTAAAIFPMTLVAS
FT                   IGIARMVETNLVSVPKGVIEAAQAMGASPIRIVFEILVSEALAPLILGVTFMTVGLIEF
FT                   SAVAGLVGGGGLGDLAMTYGYQRFDTSVMFVTVVLLIILVQIAQNLGNYFAKVLLRRS"
FT   gene            344521..345375
FT                   /locus_tag="BMB171_C0290"
FT   CDS_pept        344521..345375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0290"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05108"
FT                   /protein_id="ADH05108.1"
FT                   /translation="MKKILAFALSAIVGVSALSGCSSGDTGAGAKEKVVRVGVTGTDGD
FT                   AWEILKKKAEKEGIKIKLVEFSDYTTPNKALADGDIELNSFQHIAFLEQFKKEHKLDIT
FT                   AVGTTQIAPMGLYSEKYKKSNEIPDGSEIAIPNDPTNQARALKLLDAAGLLKLKKDFGL
FT                   FGDPSGIAENPKKLKITPVIAQQTPRVLKDVAASVINNGVAGQAGLDPAKDPIFLEDPK
FT                   NENAKPYINIFAARTKDKDDPTLKKVIELYHSKEVTDAIKKETNDGSISVDLSLEELEK
FT                   IVK"
FT   gene            complement(346069..346260)
FT                   /locus_tag="BMB171_C0291"
FT   CDS_pept        complement(346069..346260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05109"
FT                   /protein_id="ADH05109.1"
FT                   /translation="MHEELLRRVIRTKVKVGMHILEELPNPIQQSAKQILNILQEELAA
FT                   YPKERDHHEVNLKNIIIE"
FT   gene            complement(346253..347434)
FT                   /locus_tag="BMB171_C0292"
FT   CDS_pept        complement(346253..347434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0292"
FT                   /product="Anion-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05110"
FT                   /protein_id="ADH05110.1"
FT                   /translation="MMRIILYTGKGGVGKTSISAATAIQSAKQGLKTLVMSTDPAHSLG
FT                   DSFGIKLSSEPLEIRENLWAQEINTIYEMEKGWGKLQKYITLLFTSKAADDITTEELTM
FT                   FPGMEDLISLLRVLDYYKQNTYDVIIIDCAPTGETLAMLSFPDMLGWWMEKLFPIKRKV
FT                   LKVVRPVAQPLLGVPLPTDDIMDELTNTLEQLGEMRDILSNREVTSIRIVVNPEKMVIK
FT                   EAQRSFTYLNLYDYNVDAIMINRVIPNTVTDPYFQAWKDTQKKYKTLIQNSFDPLPIYE
FT                   APMFEQEVVGLPMLERVGDALFKTDHCPTEVKFNGRTQYVRKDGDDYIFILSIPFSNKS
FT                   ELSLNQKGDELIIRAGSVKRNITLPKTLTHLSIQGAKFEEDILNIRFGGVVHA"
FT   gene            complement(347511..347993)
FT                   /locus_tag="BMB171_C0293"
FT   CDS_pept        complement(347511..347993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0293"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05111"
FT                   /protein_id="ADH05111.1"
FT                   /translation="MLQYEHFLDLLLDNAKKLFYPEEWVSLDLTLSKTEVFCLLWMERN
FT                   TDITMTKIADLLDIPMSTTTGVVNRLVKKGYIERYRDENDRRIVLIRLTENGVMLVQEV
FT                   KQNAAHYFSLVTEALSEEEKAFLLQIFQKIMNHIATSQQKTEEKVSTPKMKNIPIE"
FT   gene            348225..348461
FT                   /locus_tag="BMB171_C0294"
FT   CDS_pept        348225..348461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05112"
FT                   /protein_id="ADH05112.1"
FT                   /translation="MRRRNTQAFTFLAWTSFVCALSGMLIGIYTLDETLSVKGYYLIGT
FT                   LFLTMSCFVLQKTIRDNEEDNERFPKNKPLDKE"
FT   gene            348603..348893
FT                   /gene="gatC"
FT                   /locus_tag="BMB171_C0295"
FT   CDS_pept        348603..348893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="BMB171_C0295"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05113"
FT                   /protein_id="ADH05113.1"
FT                   /translation="MSRISVENVKHVAHLARLAITDQEAEKFQKQLDAIVTFAEQLNEL
FT                   DTTDVKPTTHVLTMKNVMREDVPEKGLPVEEVLKNAPDHKDNQIRVPAVLE"
FT   gene            348909..350366
FT                   /gene="gatA"
FT                   /locus_tag="BMB171_C0296"
FT   CDS_pept        348909..350366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="BMB171_C0296"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05114"
FT                   /protein_id="ADH05114.1"
FT                   /translation="MSLFDHSVSELHKKLNNKEISVTDLVEESYKRIADVEDNVKAFLT
FT                   LDEENARAKAKELDAKIGAEDNGLLFGMPIGVKDNIVTNGLRTTCASKILANFDPIYDA
FT                   TVVQKLKAADTITIGKLNMDEFAMGSSNENSGFYATKNPWNLDYVPGGSSGGSAAAVAA
FT                   GEVLFSLGSDTGGSIRQPAAYCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDN
FT                   AYLLQAISGIDRMDATSANVEVGNYLAGLTGDVKGLRIAVPKEYLGEGVGEEARESVLA
FT                   ALKVLEGMGATWEEVSLPHSKYALATYYLLSSSEASANLSRFDGVRYGVRSDNVNNLLD
FT                   LYKNTRSEGFGDEVKRRIMLGTFALSSGYYDAYYKKAQQVRTLIKNDFENVFANYDVII
FT                   GPTTPTPAFKVGEKVDDPMTMYANDILTIPVNLAGVPAISVPCGFGANNMPLGLQIIGK
FT                   HFDEATIYRVAHAFEQATDYHTKKASL"
FT   gene            350381..351808
FT                   /gene="gatB"
FT                   /locus_tag="BMB171_C0297"
FT   CDS_pept        350381..351808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BMB171_C0297"
FT                   /product="aspartyl/glutamyl-tRNA amidotransferase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05115"
FT                   /protein_id="ADH05115.1"
FT                   /translation="MNLETIIGLEVHVELKTNSKIFSASPTEFGAEPNTQTSVIDLGYP
FT                   GVLPTLNKEAVNFAMKAAMALNCEIATETKFDRKNYFYPDNPKAYQISQFDKPIGENGW
FT                   IEIEVDGKKKRIGITRLHLEEDAGKSTHTADGSLVDYNRQGMPLIEIVSEPDMRTPEEA
FT                   YAYLEKLKSIIQYTGVSDCKMEEGSLRCDANISLRPVGQEKFGTKAELKNLNSFTYVQK
FT                   GLEHEQVRQEKELLSGGIIQQETRRYDEATKKTILMRVKEGSDDYRYFPEPDLVELYID
FT                   DEWKEAVRASIPELPDARKARYVAELGLPAYDAHVLTLTKEMSDFFEATVADGADAKLT
FT                   SNWLMGEVLAYLNKQQKELKDVALTPAGLSKMVQLIEKGTISSKIAKKVFNELIEKGGD
FT                   PEEIVKAKGLVQISDEGTLRKVVTEILDNNEQSIEDFKNGKDRAIGFLVGQIMKATKGQ
FT                   ANPPLVNKILLEEINKR"
FT   gene            352510..353271
FT                   /locus_tag="BMB171_C0298"
FT   CDS_pept        352510..353271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0298"
FT                   /product="putative lipid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05116"
FT                   /protein_id="ADH05116.1"
FT                   /translation="MAARQAADRKFDVVIAAGGDGTLNEVVNGLVGHEFRPKFGIIPVG
FT                   TTNDFARAIGVPRSIEEAADIICEGKTVPLDLGRANDTYFINIAGGGRITELTYEVPSK
FT                   LKTVLGQLAYYLKGIEMLPSLHPTYVEIEYDGKLLQEEITMFLITNTRSVGGFEKVAPY
FT                   ASINDGLFDLLVLKKGSIADLIKAATQAQRGEHINNPKVLYTQANRIKVHSPDKLMINL
FT                   DGEYGGDAPMEFENIYHCLELFVPEHQEDAL"
FT   gene            353412..354155
FT                   /locus_tag="BMB171_C0299"
FT   CDS_pept        353412..354155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0299"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05117"
FT                   /protein_id="ADH05117.1"
FT                   /translation="MEKVKAILFDKDGTLMDFHSIWIKVAEELVAECISLYHLPSTIGQ
FT                   TLLEEIGVEGAFVNPRSAIAAGTSLDVAKGLCNYIESAREEEMHQWVSEKLFSLMYEHR
FT                   SHMKMTADLPKVLQALKDKGFILGVVTADDFAPTELFLKQYKLENFFDYIIASDTFPAQ
FT                   KPDKKIIEVFCEKFNLESCEVAVVGDTPTDLHLAKNGDCYAIGVLSGTGDRPTLEPLAD
FT                   LVLDSVGEFISQSGEFFWEKEKSNV"
FT   gene            354310..355674
FT                   /gene="gabT"
FT                   /locus_tag="BMB171_C0300"
FT   CDS_pept        354310..355674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabT"
FT                   /locus_tag="BMB171_C0300"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05118"
FT                   /protein_id="ADH05118.1"
FT                   /translation="MNTKKFAKVNEQIPGPKAASLLERRQNIVPKGVSNGIPTFVQSAN
FT                   GALVTDVDGNQYIDFAGAIGTINVGHCHPTVKEALHKQVDQYIHTGFNVMMYEPYIELA
FT                   EKLAALAPGSFDKQVLFLNSGAEAVENAVKIARKYTKRPGIIAFSKGFHGRTLMTMTMT
FT                   SKVKPYKFGFGPFAPEVYKAPFPYEYRRPEGLTEEQYDDFIIEEFKNFFISEVAPETIA
FT                   AVVMEPVQGEGGFIVPSKKFVQEVRRICSENGILFVADEIQTGFSRTGKYFAIDHYDVV
FT                   PDLITVSKSLGAGVPISGVIGRKEIMNESAPGELGGTYAGSPLGCAAALAVLDVIENEK
FT                   LNDRAIELGKVVMNRFEEMKNKYHCIGDVRGLGAMCAFEVVQDRKTKAPDKTLTANLCA
FT                   EANKRGLLLLSAGTYGNVIRVLMPLVITDEQLEEGLTIIEESLQACYEQTNIARV"
FT   gene            355790..357157
FT                   /locus_tag="BMB171_C0301"
FT   CDS_pept        355790..357157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0301"
FT                   /product="sigma-54-dependent transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05119"
FT                   /protein_id="ADH05119.1"
FT                   /translation="MVAEKERVLMDLKDVFEYAFDEIFVTDEQGIVVRVNSTCERHYQL
FT                   AAEELVGKHVKELQKDGIFYPSATLEVIEKKRPIELVQTTKSGEYLHVRTRPVFDDEGN
FT                   LRRVISYSRDLTELYQLRQKVEEMDNQLKTYKKELRETYEHEGLIFKSLAMQKIVDTIK
FT                   KVSVVDSTVLVLGETGVGKSRLVRHLHEVSHRKHESFYEINCAALPTNLIESELFGYSG
FT                   GSFTGANREGKKGLLESAHKGTLFLDEIGEMPLEIQAKLLQVLQEKTFRPIGGRELKKV
FT                   DVRIVAATNRDLSEMVKQGTFRKDLYYRLNVIPIAIPPLRERTEDILPLIYHYLQHFNK
FT                   KYGRDVKLAPSTLQMFVGYPWEGNNREIENVIERIVITVDDVVTVEDLPLSMQEAAVEQ
FT                   SGQSLYKMLEEVERNIILKAYKTYGSSYKVAEFLQISQSAATRKIKKFIEEEENIG"
FT   gene            357150..358601
FT                   /gene="gabD"
FT                   /locus_tag="BMB171_C0302"
FT   CDS_pept        357150..358601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="BMB171_C0302"
FT                   /product="succinate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05120"
FT                   /protein_id="ADH05120.1"
FT                   /translation="MDKKATFVSIDKKAMYINGEWITLQEQIEVNNPATKEIFATVPKG
FT                   GVTEAKQAVDAAHEAFKTWSKLTAADRATKLKKWFMLIDENKEEIAAIMTKEQGKPFAE
FT                   ALGEVNYANSFVEWYAEEGKRVYGEMIPAAHPNKRILVMKQPVGVMAAITPWNFPAAMI
FT                   TRKVAPALAAGCTAVVKPASQTPLTALKLAELAHEADIPKGVINIVTGSAKAIADTWME
FT                   DGRVRKVSFTGSTEIGKELMASAAQTMKKVSLELGGHAPFIVMNDADLDKAVEAVIGSK
FT                   FRNAGQTCICTNRVFVQEEVYEVFVEKFQKAVGQLKVGDGFGDGTTVGPLIDENAVSKV
FT                   QEHIEDAIQKGGTVLYGGQKVAELEGHFIQPTVIGLANDTMLCMNEETFGPVAPVAKFK
FT                   TVDEVIERANNTPYGLAAYIFTKDISQAFQISEALEYGIIGLNDGLPSVAQAPFGGFKE
FT                   SGIGREGGHFGIEEYLEIKYISLGL"
FT   gene            358649..358972
FT                   /locus_tag="BMB171_C0303"
FT   CDS_pept        358649..358972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0303"
FT                   /product="quaternary ammonium"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05121"
FT                   /protein_id="ADH05121.1"
FT                   /translation="MVYWLLLLVTIIFEVAGTIAMKLSNGLTKLVPSVLIFVFYGICFS
FT                   VFAIVVKKIHLSIAYAIWSGVGTLLITIISVYFFKEHISLFQAFCILFIVLGVIGLKVS
FT                   SAS"
FT   gene            359105..359596
FT                   /locus_tag="BMB171_C0304"
FT   CDS_pept        359105..359596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05122"
FT                   /protein_id="ADH05122.1"
FT                   /translation="MLKKVSQIVLIFGIAFSLSACTETKDSNESKQEDVQDKVYKIGET
FT                   VDVDGLQVTIDSVKLGYPDYDENKKKEEILGIIFKVENNSKKEIPFAFYEFEITDKKGT
FT                   RFKEYNNPDSFISKKLAPDEKIQDIMLFDVAKENTYIATYRPEFTHENRTIKFELRPNK
FT                   "
FT   gene            complement(359642..360871)
FT                   /gene="ampS"
FT                   /locus_tag="BMB171_C0305"
FT   CDS_pept        complement(359642..360871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampS"
FT                   /locus_tag="BMB171_C0305"
FT                   /product="aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05123"
FT                   /protein_id="ADH05123.1"
FT                   /translation="MSFEQTLEKYAALAVNVGVNIQPGQTLSISAPLEAVQFVRLVTEK
FT                   AYKSGAKHVYVDWNDETLTRLKFDLAPEEAFAEFPSWKAHAREELAKEGAAFMSIYAEN
FT                   PDLLKGVEASRIATAHKVAGEAMKVYRDYVQADKVSWCVISVPTKEWAAKVFPDVAPEE
FT                   QEAKLWDAIFKATRADLENPVEAWKEHDETLHTKVDYLNEKHYKALHYTGPGTDLTIEL
FT                   PEKHVWAGAGSLNEKNVPFMANIPTEEVFTMPLKTGVNGQVSSTKPLVFAGNIIDNFTL
FT                   TFENGRIVDYKAEAGEEALKHLVETDEGSHFLGEVALVPHDSPISNTNVLFYNTLFDEN
FT                   ASCHLAIGNAYAFNLVGGKTMSKEELAENGANASITHNDFMIGSAELDIDGITADGRHE
FT                   PIFRKGNWAF"
FT   gene            complement(360988..361629)
FT                   /locus_tag="BMB171_C0307"
FT   CDS_pept        complement(360988..361629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0307"
FT                   /product="polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05125"
FT                   /protein_id="ADH05125.1"
FT                   /translation="MYHAIDDYHGQGIKDLFVSPANFEAQMKHLKDNGYTLLTFERWGD
FT                   INKVNKPIFVTFDDGMKNNMNAFRVLQKLKDDTFKPAATEYMIVDNVDVEGALSTSEIK
FT                   EMVDSGIFSVQSHTATHADLPKITNYEEELKGSKEKLEKITGKPVIAIAYPFGHVDDKV
FT                   VTETKKYYQFATTTKPGQFITKGEPDELLKMKRVRIHHTTTVEQFASSIK"
FT   gene            361603..361857
FT                   /locus_tag="BMB171_C0306"
FT   CDS_pept        361603..361857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05124"
FT                   /protein_id="ADH05124.1"
FT                   /translation="MIIIDCVIHKNRNLLFESNSRFRKRDCFPIFFHSCCFNLELTAFS
FT                   FKFFYVKRNCKLFLLFFRRKRFSTFLSISCAPNFILYFI"
FT   gene            362607..363314
FT                   /locus_tag="BMB171_C0308"
FT   CDS_pept        362607..363314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05126"
FT                   /protein_id="ADH05126.1"
FT                   /translation="MKYKKIIYIFFISLFIVGCQSEVSKANSVEEYIPSHLMNAEVTAD
FT                   IMTIEMEPDTLKKVGSIGQRMREHLASNMEWYLKYVEEHAEKKSFPYHPNFGVTKEEYE
FT                   FVLNAIDQSKLVNTKDGKLKFKKKNDHEVEIFSSESIKLLKYVVINTKKNTVKTSLGEC
FT                   EYFGEILASPEQKLTGPWHGKQWMLKKDDLIYIFSLGKMEAENKSIIDISVKGKYKGEI
FT                   INKEEALEFSSVS"
FT   gene            complement(363366..364562)
FT                   /locus_tag="BMB171_C0309"
FT   CDS_pept        complement(363366..364562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0309"
FT                   /product="nucleoside permease nupC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05127"
FT                   /protein_id="ADH05127.1"
FT                   /translation="MQYVMSIIGIIAVLGLCFALSNNKSKINFRAIAIMIGFQILIGWF
FT                   MFATKIGQQIIIFISKVFNKLIKLGTTGVDFLFNGIHRDFVFFLNVLLIIVFFSALLSI
FT                   FSYLGVLPFIVRVVGGAISKITGLPRVESFHAVNSVFFGSSEALIVIKNDLQHFNKNRM
FT                   FIICCSAMSSVSASVTASYVMMLDAKYVLAALPLNLFSSLIVCSLLTPVDTKKEDEVIQ
FT                   KFDRTLFGDSFIGAMINGALDGLKVAGIVAALMIAFIGVMEVVNYVISAASGAMGHAVT
FT                   LQQIFGYVLSPFAFLMGIPTQDIIPAGGIMGTKIVLNEFVAILDLKDTATTLAPRTVGI
FT                   VTVFLISFASISQIGAIVGTIRALSEKQGSVVSKFGWKMLFASTLASILSATIAGLFI"
FT   gene            364988..366364
FT                   /locus_tag="BMB171_C0310"
FT   CDS_pept        364988..366364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0310"
FT                   /product="tRNA (Uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05128"
FT                   /protein_id="ADH05128.1"
FT                   /translation="MSTKMTPPVEKNEFIDVVFEDLTHDGAGVAKVKGYPIFVKNGLPG
FT                   EEAQIKIIKVKKNFAFGRLMKLHTESPYRKDAECPVYNQCGGCQLQHLTYEGQLQAKEK
FT                   QVRDVMQRIGGLADVPVHPVLGMKNPWVYRNKAQVPIGEREGGLVAGFYRQGTHDIINM
FT                   ESCLIQAEENDTLIQEVKRICEKHGITAYNEERNKGTLRHVMARYGQVTGEIMLVFITR
FT                   TAELPNKKAIIEEIAAKFPEVKSIVQNVNTKRTNVIFGDKTTVLYGSEYIYDFIGDIKF
FT                   AISARSFYQVNPEQTKVLYDKTLEYAKLNGNETVIDAYCGIGSISLFLAQKAKKVYGVE
FT                   IVPEAIEDANRNAALNNMTNAEFGVGEAEVVIPKWYKEGVIADTMVVDPPRKGCDEALL
FT                   NTIIDMKPNRVVYVSCNPATLARDLKVLEEGGYKTQEVQPVDMFPHTTHVECVAWLKLV
FT                   "
FT   gene            366526..367515
FT                   /locus_tag="BMB171_C0311"
FT   CDS_pept        366526..367515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0311"
FT                   /product="nitrogen regulation protein NIFR3"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05129"
FT                   /protein_id="ADH05129.1"
FT                   /translation="MIDNFWRELPRPFFVLAPMEDVTDVVFRHVVSEAGRPDVFFTEFT
FT                   NSDSYCHPEGMKSVRGRLIFTEDEQPMVAHIWGDNPEYFRQMSIGMAELGFKGIDINMG
FT                   CPVPNVASRGKGSGLILRPDVAAELIQAAKAGGLPVSVKTRLGFKELSEWEDWLTHIFK
FT                   QDIANLSIHLRTREEMSQVDAHWELIPEIKKLRDRIAPNTLITINGDILDRKMGLELAE
FT                   KYGIDGVMIGRGIFKNPFAFEKEPREHSSKEHLDLLRLQLDLQDQYAEVLPRSITGLHR
FT                   FFKIYVKGFPGAAELRNQLMSTKSTDEVRGLLDKFEDSVGVAQDSETV"
FT   gene            367867..368385
FT                   /locus_tag="BMB171_C0312"
FT   CDS_pept        367867..368385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0312"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05130"
FT                   /protein_id="ADH05130.1"
FT                   /translation="MAMSNNDILKRVRYALDIKDIDMVEIFKLGGMEVTKEDVVDMLTK
FT                   IKRAPQHEAENDEVAEDEYVKTCDMMMLEAFLNGFITLKRGKQDPKPGQPAPVQSKESA
FT                   NNLLLKKMKIALSLTSEDVLDILDSVGVTVTKGELGALLRKKGHKNYKECGDRYARNFI
FT                   KGLGVKYRG"
FT   gene            368481..369188
FT                   /locus_tag="BMB171_C0313"
FT   CDS_pept        368481..369188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0313"
FT                   /product="Zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05131"
FT                   /protein_id="ADH05131.1"
FT                   /translation="MVHTYLGETINFHITYKKKKSVRLFVDSYGNVEVQAPKGTPVEYL
FT                   VQLLEEKWDWIQTTRKEMAERAHGPQEKDYDQGEGFLYLGNTYPIQISQDASIEQDNAI
FT                   FEGDKLHIYVKELKDEKIQQALKRFYYKQCKSLVEKSIKAHQSNFKTKPRSIRITDSSR
FT                   TWGTCDSNLQLTFNWKLAMAPQRVIDYVVVHEMCHMVHLNHDRSFWRLVGKIMPDYKEM
FT                   ENWLALSSWKMTV"
FT   gene            complement(369408..370103)
FT                   /locus_tag="BMB171_C0314"
FT   CDS_pept        complement(369408..370103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05132"
FT                   /protein_id="ADH05132.1"
FT                   /translation="MTVLYEGTLKQNNESFHVTLLSLEHIEQILSLQNIVVEALEDKSR
FT                   LQPLSQEEFQYILEGNGMMIGAFIENELIAFRALLVPPIDDEHLGLDIGLPESELHRVI
FT                   YQEISNVHPNCRGNGMQKILANVIMDELQKEDSKYDYVCCTVAPFNIPSLKDKFAQGMA
FT                   IAALKEKYGGSLRYVFVKKLRGDKESDWTDIQSILMSDASGQQALLSEGYLGYEMEKTA
FT                   DTFIVKFGR"
FT   gene            complement(370118..371227)
FT                   /locus_tag="BMB171_C0315"
FT   CDS_pept        complement(370118..371227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0315"
FT                   /product="mandelate racemase/muconate lactonizing family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05133"
FT                   /protein_id="ADH05133.1"
FT                   /translation="MKITAIHLYAIRLPLRNPFVISYGSYSDMPSIIVKMETDEGIIGY
FT                   GEGVADDHVTGESWESTFHTLKHTLAPTLIGQNPMNIEKIHDMMDNTIYGVPTAKATID
FT                   IACFDIMGKKLNQPVYQLIGGRYHEEFPVTHVLSIADPENMAEEAASMIQKGYQSFKMK
FT                   VGTNVKEDVKRIEAVRERVGNDIAIRVDVNQGWKNSANTLTALRSLGHLNIDWIEQPVI
FT                   ADDIDAMAHIRSKTDLPLMIDEGLKSSREMRQIIKLEAADKVNIKLMKCGGIYPAVKLA
FT                   HQAEMAGIECQVGSMVESSVASSAGFHVAFSKKIITSVELTGPLKFTKDIGNLHYDVPF
FT                   IRLNEKPGLGIEINEDTLQELTVFQDVVR"
FT   gene            371321..372592
FT                   /locus_tag="BMB171_C0316"
FT   CDS_pept        371321..372592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05134"
FT                   /protein_id="ADH05134.1"
FT                   /translation="MMIKIAVVGSKEFMDNLFPIAQKLEGIEIDPYIYLHPAESSELLK
FT                   CLKPCDVIFFSGALPYYMAKEIREQLRIPSTYLQQDETTVASSILSIMYHQSIQPHNIS
FT                   IDLVDRSFITNVFHDIGIKESPQVLDYENMLWSKDEINRVINFHVAKYQSGEAHLALTS
FT                   IHAVYDELQKIGVPSERMIDPTQSIIHGLKDAKIKAELAKSYSATVGACIISSLELRTS
FT                   LLEKLDVISKELRGSFKQVDEMTCILYTTRGDIESIIKTNAIDNLFASIEGTIAIGFGY
FT                   GKTVKEAEQNAKIAQSFAKDNLIDRCFYILTSDKDLFGPFPKEQRVQSLKNDNPELMKI
FT                   AKETKLSPANLSKIIQFSQSHPSLKFTAADLSEYLQVTRRSTERLLKKLVDYGYAHICG
FT                   EEMPYQQGRPRALYELNLPLFLSF"
FT   gene            complement(372581..374002)
FT                   /gene="nhaC1"
FT                   /locus_tag="BMB171_C0317"
FT   CDS_pept        complement(372581..374002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaC1"
FT                   /locus_tag="BMB171_C0317"
FT                   /product="Na+/H+ antiporter NnaC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05135"
FT                   /protein_id="ADH05135.1"
FT                   /translation="MKKEIPFGIAIIPIIITVAVMMVTIVVLKQTPHVPLIIGTTVASI
FT                   VAWRYGYKWNDLEEAMYKGIRLALPAIVIIILVGLTIGAWIGGGIVATMIYYGLKLLTP
FT                   SLFLVSITVICSIVALAIGSSWSTMGTIGVAGMGIGLSMGIPAPMVAGAIISGSYFGDK
FT                   MSPLSDTTNLAAGLTNTDLFVHIRHMLFTTVPGLIITLIVYAVLGKSFGANNIDAKSID
FT                   QTLQVLQQNFVISPFLLIIPVVVMVLVAKKVPAIPAILVGIILGFLSQVFIQGGSVSAS
FT                   VGALQAGFVIDTGNKLVDELFNRGGLDSMMNTVSMTIVAMTFGGVLEHTGILRSIVNQI
FT                   LKLAKSAKGLIASTIASCFATNLTCSEQYISIVVPSRMYANAYTEKGLHSKNLSRALED
FT                   GGTLTSVFVPWNTCGVFILATLGVGAFEYAPYAILNFIVPIISIIYGITGFTIVKLSDI
FT                   EKAELLKKQKAQLEA"
FT   gene            374297..375412
FT                   /gene="amhX"
FT                   /locus_tag="BMB171_C0318"
FT   CDS_pept        374297..375412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amhX"
FT                   /locus_tag="BMB171_C0318"
FT                   /product="amidohydrolase amhX"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05136"
FT                   /protein_id="ADH05136.1"
FT                   /translation="MKTLELQERLTEIFQHLHENPEVSWKEYETTAYITDFLKEEGISY
FT                   RTFDDCPGVIAEIGGGNPVIAIRADMDALWQEVNGEFKANHSCGHDAHMTIVMGLILQL
FT                   KNMRWKSGTVRFIFQPAEEKGNGALKMVEKGAVDDADFLFGVHLRPIEELSLKQAAPSI
FT                   RHGAAGFLEGMIHGEDAHGARPHQGVNAIDVISMINIGLKNIWLPPQSSYSVKMTRCQA
FT                   GGDNLNIIPGNGHFSLDVRAESNILLEELKKKIEHVIESAASMGSKTSYEWMDLAPGAE
FT                   VSEEAERFMRKGILEVYGEERCTGPLYTTGSDDFHYYTVKRPHLKAVMLGLGADLQPGL
FT                   HHPYMRFDHSCIMDGVEILKQTVLKVLEDRG"
FT   gene            375647..376252
FT                   /locus_tag="BMB171_C0319"
FT   CDS_pept        375647..376252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0319"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05137"
FT                   /protein_id="ADH05137.1"
FT                   /translation="MNEQYYDAVLHIKTVGEQKGFNKSMHYHRYEPTPYSGLDELLNQY
FT                   EIRSSDRIVDFGCGKGRLNFYMHHKCGASAVGIEMNEEFYKEAMDNRDRYARKARNSKG
FT                   KIQFQCCLAQEYEIDPHDNRFYFFNPFSVQVFMNVVNNILLSVEETGREVDIILYYPSE
FT                   DYIFFLENQTAFELKKEVRLSGAYEKNGNERFLVYTLG"
FT   gene            complement(376287..377813)
FT                   /gene="ahpF"
FT                   /locus_tag="BMB171_C0320"
FT   CDS_pept        complement(376287..377813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="BMB171_C0320"
FT                   /product="Alkyl hydroperoxide reductase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05138"
FT                   /protein_id="ADH05138.1"
FT                   /translation="MILDADIKTQLSQYLQLMENDILLKVSAGDDNVSKDMLALVDELA
FT                   TMSSKITVEKVELERTPSFSVNRPGENTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVE
FT                   QKLIDQIKNIQGEYHFESYISLSCHNCPDVVQALNVMSVLNPGITHTMIDGAAFKEEVE
FT                   SKDIMAVPTVYLNGESFGSGRMTLEEILAKMGNGPDASELSDKDPYDVLVVGGGPAGAS
FT                   AAIYAARKGIRTGIVAERFGGQVMDTMGIENFISVKKTEGPKLVASLEEHVKEYDIDVM
FT                   NLQRAKRLEKKELIEVELENGAILKSKSVIVSTGARWRNVGVPGEAEFKNKGVAYCPHC
FT                   DGPLFTGKDVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLNSLPNVT
FT                   VLKNVQTKEITGTDKVNGISYIDRETEEVHHVELQGVFVQIGLVPNTDWLGETVERVRG
FT                   EIVTDKHGATNVPGVFAAGDCTNNPYKQIIISMGSGANAALGAFDYLIRN"
FT   gene            complement(377828..378391)
FT                   /gene="ahpC"
FT                   /locus_tag="BMB171_C0321"
FT   CDS_pept        complement(377828..378391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="BMB171_C0321"
FT                   /product="Alkyl hydroperoxide reductase C22"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05139"
FT                   /protein_id="ADH05139.1"
FT                   /translation="MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTF
FT                   VCPTELEDLQNQYATLKDLGVEVYSVSTDTHFTHKAWHDSSETIGKIEYIMIGDPTRTI
FT                   TTNFNVLMEEEGLAARGTFIIDPDGVIQSMEINADGIGRDASILVNKIKAAQYVRNNPG
FT                   EVCPAKWQEGSATLKPSLDLVGKI"
FT   gene            378982..380211
FT                   /locus_tag="BMB171_C0322"
FT   CDS_pept        378982..380211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0322"
FT                   /product="5-methylribose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05140"
FT                   /protein_id="ADH05140.1"
FT                   /translation="MSKFTKYFLMEAKDVIAYVKEKLSKFEHAKGLQCKEIGDGNLNYV
FT                   FRVWDEKENMSVIVKQAGDTARISDEFKLSTNRIRIESDVLQLEDELAPGLVPKVYLFD
FT                   SVMNCCVMEDLSDHTILRTALINHQIFPRLADDLTTFMVNTLLLTSDVVMNHKEKKELV
FT                   KNYINPELCEITEDLVYSEPFTNHNKRNELFPLNEGWIREHIYSDKELRMEVAKRKFSF
FT                   MTNAQALLHGDLHTGSVFVRDDSTKVIDPEFAFYGPMGYDVGNVMANLMFAWVNADATM
FT                   SPGAEKDTYMDWLQITMVEVIDLFKQKFLGAWDIHVTEIMAREEGFSEVYLQSVLEDTA
FT                   AVTGLELIRRIVGLAKVKDITCIGNEEARARAERICLQVAKGFILRANQYRTGTSFVET
FT                   LKEQSMHYAK"
FT   gene            380221..381267
FT                   /locus_tag="BMB171_C0323"
FT   CDS_pept        380221..381267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0323"
FT                   /product="translation initiation factor IF-2B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05141"
FT                   /protein_id="ADH05141.1"
FT                   /translation="MMEEQLIPIQWKDDALVLLDQTLLPNEIVYESFKTAESVWDAIQV
FT                   MKVRGAPAIGVSAAYGVYLGIKEFAESTEEGFMDEVRKVCTYLATSRPTAVNLFWALER
FT                   MESVATDNIHLSISQLKNRLLEEAKEIHREDEEINRQIGEHALTLFHDGMGVLTHCNAG
FT                   ALATTKYGTATAPMYLAKEKGWDLKIYSDETRPRLQGSTLTALELQRAGIDVTVITDNM
FT                   AAMVMSQGKIDAVIVGCDRVAANGDVANKIGTLGVSILAKYYNIPFYVAAPTPTIDLKT
FT                   STGKEIPIEERDASEVINRFGKYSAPKESKVYNPAFDVTPHENVTAIITEKGIVKAPFT
FT                   ENLKKLFQ"
FT   gene            381321..381962
FT                   /locus_tag="BMB171_C0324"
FT   CDS_pept        381321..381962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0324"
FT                   /product="L-fuculose phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05142"
FT                   /protein_id="ADH05142.1"
FT                   /translation="MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPS
FT                   GLEYYETKPEDVVILNLDGEVVEGERKPSSELDMHLIYYRKREDINALVHTHSPYAKTI
FT                   ASLGWELPAVSYLIAFAGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGA
FT                   NNIKMAFTVAEEIEFCAQIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ"
FT   gene            complement(382004..383011)
FT                   /locus_tag="BMB171_C0325"
FT   CDS_pept        complement(382004..383011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0325"
FT                   /product="ferrichrome transport system permease protein
FT                   fhuG"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05143"
FT                   /protein_id="ADH05143.1"
FT                   /translation="MMQSILRKQRLIILALLIVIITTIVVGMGLGSASLSYDRLLPTLM
FT                   GQGTFKEEFVLYSLRLPRIVITLLAGMALALSGAILQGITRNDLAEPGILGINSGAGVA
FT                   VAIFFLYFPIDVGSFLYLLPVVGFIGAFLTAVLIYVFSYSKSTGLQPIRLTLTGIGFAF
FT                   ALSGAMIVLISSADRMKVDFISKWIAGNIWGDDWIFVLAMLPWLIVFIPFVFYKANRLN
FT                   ILALNEPVAIGVGIEIEKERRYLLVAAVALAAAAVSVTGGISFIGLMAPHIAKSLVGPR
FT                   HQIFMPIALLIGGWLLLLADTIGRNIVDPNGIPAGIVVALIGAPYFMYLLLKKA"
FT   gene            complement(383008..384024)
FT                   /locus_tag="BMB171_C0326"
FT   CDS_pept        complement(383008..384024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0326"
FT                   /product="ferrichrome transport system permease protein
FT                   fhuB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05144"
FT                   /protein_id="ADH05144.1"
FT                   /translation="MTKDHDNPRSIAFTYKLILSLIAFFLIFMVAMVLGAADTSIKDVW
FT                   LALTSSAKGDKISIIREIRLPREVAAIFVGAGLAVSGAIMQGLTRNPLADPGLLGLSGG
FT                   ANAALALTLAFNPSISYLYLTLACFIGAAIGAIMVFGIGMVKKGGLSPLRIVLAGAAVS
FT                   AFLLAISEGIGIYFKISQDVSLWTAGGVIGTTWSQLKIIIPVISISIFIAILLAKKLTV
FT                   LSFSEEVAIGLGQKIIVIKTILFIIIILLAGASVALVGNMAFIGLMVPHMVRPIVGPDY
FT                   RFVIPMSAIAGASFMLLADTIGRTINAPYETPVAAIVAIVGLPFFLFIVRKGGKTFS"
FT   gene            complement(384097..385017)
FT                   /locus_tag="BMB171_C0327"
FT   CDS_pept        complement(384097..385017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0327"
FT                   /product="ferrichrome-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05145"
FT                   /protein_id="ADH05145.1"
FT                   /translation="MKKLFISLTVLFVLVMSACSNSSTDKKNDAKGSKSETITYQSEDG
FT                   KKVEVPANPKRVVVLSSFAGNVMSLGVNLVGVDSWSKQNPRFDSKLKDVAEVSDENVEK
FT                   IAELNPDLIIGLSNVKNVDKLKKIAPTVTYTYGKVDYLTQHLEIGKLLNKEKEAKTWVD
FT                   DFKKRAQEAGKEIKAKIGEDATVSVVENFNKQLYVYGENWGRGTEILYQEMKLKMPEKV
FT                   KEKALKEGYYALSTEVLPEFAGDYLIVSKNKDTDNSFQETESYKNIPAVKNNRVYEANM
FT                   MEFYFNDPLTLDFQLDFFKKSFLGK"
FT   gene            385351..386400
FT                   /locus_tag="BMB171_C0328"
FT   CDS_pept        385351..386400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0328"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05146"
FT                   /protein_id="ADH05146.1"
FT                   /translation="MNREELFDVTVIGGGPAGLYSAFYSGLREMRTKIIEFQPHLGGKI
FT                   HVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFKPEVVLDTKVESIIRNQDGTFTLKTS
FT                   TGEEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVKSLKRFKGKTVIISGGGN
FT                   SAVDWANELEPIAKKVYVTYRKEELSGHEAQVKQLMNSSAECFFNTSITKLIAGDNHEA
FT                   IEYVELTNHETGEVSHLPIDEVIINHGYERDITLLENSELDVAIIDNYYIAGNANSESS
FT                   VDGLYAAGDILKHEGKLHLIAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRN
FT                   RELIKQMMK"
FT   gene            387193..387390
FT                   /locus_tag="BMB171_C0329"
FT   CDS_pept        387193..387390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05147"
FT                   /protein_id="ADH05147.1"
FT                   /translation="MNLPKSYIEELIQQKKIRALFDGEQYLVNKEQFNTHLEQMEKYKQ
FT                   LVEEILNEPIPEDMDVKDED"
FT   gene            387626..388141
FT                   /locus_tag="BMB171_C0330"
FT   CDS_pept        387626..388141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0330"
FT                   /product="spore coat protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05148"
FT                   /protein_id="ADH05148.1"
FT                   /translation="MSLFHCDFLKDLIGSFVRVNRGGPESQKGTIISVCQDYFVLKNEK
FT                   GELYYYQLKHLKSITKNAKECGSSDCEWEDCACAEDFEALLESFKYCWVKINRGGPEKV
FT                   EGILQDVSCDFVTLIVKEEIILIAIKHIKSVNYNALACGESDESDDSKESSDNSGRARA
FT                   QRQSSRGR"
FT   gene            388774..389442
FT                   /locus_tag="BMB171_C0331"
FT   CDS_pept        388774..389442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05149"
FT                   /protein_id="ADH05149.1"
FT                   /translation="MNELNKSIGENIYVKLIGEKRFKGVLIDVGNDIVVLYNGQDYVYI
FT                   SLYHVQYYKFLRSNDEEISKPDVDSVIKRESPSISLRKVLSTSKGIFTEIYVAGNAPIH
FT                   GYVTSVMNDYIVFYSPVYKTVYISLKHLKWLIPYKENQVPYALNKNELPVNPLNITLAR
FT                   TFEEQLIKMAGKIMVFDLGEESNKIGKMAKIDEGHIEISKARDAKMYVNIQHVKSVHCP
FT                   "
FT   gene            389681..390946
FT                   /locus_tag="BMB171_C0332"
FT   CDS_pept        389681..390946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05150"
FT                   /protein_id="ADH05150.1"
FT                   /translation="MEQFPNSLSITLLGSAGGAAKAVLAILNQAIANEKDPIYEVLKNA
FT                   KFHLVDIKQKDRTYYDELFSNLKGQLYLYEINLQNVVEFKQHLKEKRTSVVIDVSGADT
FT                   IRVLSCCNELGICYINSALENEAVDQDDSLIGFQLTERYTRFEKEKEKFTNTKAIIGSG
FT                   MNPGVVQWMVVELMKERPNERPRACYIVEHDTSFLNDTALIKPHTLYASWAVERFLDEA
FT                   IWSYPMYMSHHRPLYFYEDVYASEYKVKLGEKEFYGCLMPHEEVLILGKNFNMEVGFLY
FT                   RINEYTTNIIRQNLDQVEDLWNWNRKVFNPAEEEVAGEDLVGVLLVYENSETYMYNVMN
FT                   SSQVFRKYKTNATYFQVGCGIYAGLSSLLLDQFEQGAYYVEELLLNTESKYGEYLNLYM
FT                   KDFVMGHNNFTDGLLHDRVRWM"
FT   gene            391084..392310
FT                   /locus_tag="BMB171_C0333"
FT   CDS_pept        391084..392310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0333"
FT                   /product="sporulation kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05151"
FT                   /protein_id="ADH05151.1"
FT                   /translation="MNKYKSLIYEERRALKVFILLFYIIFFLYDAIYYFVYPAMNISGT
FT                   AVGWPEGSLGIGVPIFVIALFPISIYLQKRGYVYSVKYLFLFGYMFINLVNNLMIYLRT
FT                   DRPFEHGSMVEMLLILFAPVFVNRKYFYLVSFSVIGKYVFFTLLLQDLKVIIPLVLCVF
FT                   YFIISHSLLKRFQSYVRTVVEMMNNMKETENLAVIGTMSTTIAHEIRNPLTALKGFTQM
FT                   QKERNPTDTMSYDIMLQEIERVNGFVSELMLLGKPKPTNYERCNIRDILLYVVHLMESY
FT                   ATQYRVKCHLQVDGNLPAINGDDKQLKQVLLNIIKNGIESMPEGGEIHIRAYQKTQGHL
FT                   CISVEDQGFGIENEKLEKIGKAFYTTKETGTGLGLMITYKIIKEHQGSITIQSSVGVGT
FT                   KVEIFLPTF"
FT   gene            392540..392920
FT                   /locus_tag="BMB171_C0334"
FT   CDS_pept        392540..392920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05152"
FT                   /protein_id="ADH05152.1"
FT                   /translation="MELTLNSTVCLHTIQFRKEQKNYIVKDTITGEKYEMPPLWIDALA
FT                   MMRDGFLLGEIEEKLKEEYPSEEVNMLAFTRQLLELELVEMVDGEEIACTKKKEIDCLA
FT                   WVRPRVEQFFLNLNRKYRSKDQ"
FT   gene            complement(392949..393581)
FT                   /locus_tag="BMB171_C0335"
FT   CDS_pept        complement(392949..393581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0335"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05153"
FT                   /protein_id="ADH05153.1"
FT                   /translation="MKVIDLSQTFENNMSQFPGTPKIQLEAVTSVEESGYQVTDFHSVV
FT                   HVGTHCDAPAHFISGATTIDQLPLDQFVGEAVLIDVTHIQERKLPKTVLHNTDIKEGDI
FT                   VIFHSNLSTKWNTEAYEKEAFYLSEELAKELVRLKVKSIGLDFISPDEVTTETSPIHHI
FT                   LLGNDIYLIENLTNLDAIEEKRFFFSAAPLKIKNSDGAFARAFAVIF"
FT   gene            393929..395038
FT                   /locus_tag="BMB171_C0336"
FT   CDS_pept        393929..395038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05154"
FT                   /protein_id="ADH05154.1"
FT                   /translation="MTGNVLNYYAGGNTARGFHNLYEENLKGLDRLFILKGGPGTGKSS
FT                   LIKAIGREWIEKGYDIEFLHCSSDNKSVDGVIIPKLKVGIVDGTSPHVIEPKMPGVVEE
FT                   YINLGIAWDSDKLRKQKLEIERFVSEASKAFQSAYARFKEALVIHDEWEKIYIDNIDFN
FT                   KANELTNQLIQKLFADKSGRQSLVKHRFLGAATPKGAVDFVPNLTEGLPHRYFIKGRPG
FT                   SGKSTMLKKLAKAAEEKGFEVEVYHCGFDPNSLDMVIVRELGFAIFDSTAPHEYFPSRE
FT                   GDEIIDMYALIVTPGTDEKYAKEIRDVSIQYKAKMNEAMSFLAKAKSIRDKLERIYIAA
FT                   MDFSIVDAYKEEIQKEFERIAATVIEKQQ"
FT   gene            395150..395932
FT                   /locus_tag="BMB171_C0337"
FT   CDS_pept        395150..395932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0337"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05155"
FT                   /protein_id="ADH05155.1"
FT                   /translation="MREKIELELERIEKENDVKILFAVESGSRAWGFPSKDSDYDVRFV
FT                   YIHPVEWYLSIHDKRDVIEYPISDDLDISGWDIKKALQLFAKSNPALLEWIRSPIFYSK
FT                   NSNFPELLQQMSEKNFDPKATIYHYLHMASKNYREFLQGENVKLKKYFYVLRPILACKW
FT                   LEEKTTLPPVEFDRLITELSLERSVLDEIEKLLIKKKAGTELDVGLKIKVLNQFLEEQI
FT                   HYYQQYVKGIEKGSGIDIESLNTLFRDMLFEAYEKEHK"
FT   gene            complement(395971..396768)
FT                   /locus_tag="BMB171_C0338"
FT   CDS_pept        complement(395971..396768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0338"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05156"
FT                   /protein_id="ADH05156.1"
FT                   /translation="MELATIPRSTYYDLVKKMNRPDVDADLKAEIKAIYEENEGRYGYR
FT                   RIRDELTNRGQKVNHKKVQRIMKELGLKCVVRMKKYKSYKGKVGRIAPNILERNFHTDA
FT                   PNQKWVTDITEFKLFGEKLYVSPVLDLYNGEIITYTIGSRPTYSLVSDMLEKALERLPE
FT                   THQLLMHSDQGWHYQMRQYVRTLESRAIVQSMSRKGNCYDNAVIENFFGIMKSEFLYIK
FT                   EFENVEHFKIELEKYIDYYNTKRIKAKLKMSPVQYRTHFYQAA"
FT   gene            complement(396807..397325)
FT                   /locus_tag="BMB171_C0339"
FT   CDS_pept        complement(396807..397325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0339"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05157"
FT                   /protein_id="ADH05157.1"
FT                   /translation="MAKFTADEKIQIVLRYLNGNESYREMGRSLGISDTIILNWVNQYK
FT                   QNGLEAFLKRCTNYTQQFKLDVLNFMIENGMSLFETAAIFNIPAPSTISVWKKQLETQG
FT                   IDALQSKKKGRPSMKKDSNKQVKQPLAEGSVEALEARIKQLEMENEYLKKLNALVQNKE
FT                   KSQNKTKRK"
FT   gene            complement(397397..398698)
FT                   /locus_tag="BMB171_C0340"
FT   CDS_pept        complement(397397..398698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0340"
FT                   /product="benzoate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05158"
FT                   /protein_id="ADH05158.1"
FT                   /translation="MQPSAPPHLESTETIFPSSITKLVVFICWLAILADGYDLGIYGAV
FT                   LPKLLEDKSWALSPAHAGTIASYALFGMFIGAILVGTITDLIGRKWTLICCLALFSITM
FT                   GLAAIAPSPELFGLSRFIGGIGLGGVIPTASALTVEYSPKKRQSFIYALMFTGYPLGIV
FT                   LGAILSMLMLEDFGWRIMFGIGMIPLLLIPFIIRYLPESIQFLLSRNRQEEVNQILNRF
FT                   QIEFHVKDKTHQAPSTLRKKNGFFTLFSKEYIKATLLFWITYIMGMFLIYGLNTWLPQM
FT                   MRQAGYPLGSSLSFLLMLNITAAIGALFAGAIADRIGAKIVISISYLMAAICIGLLTIK
FT                   PSVTIIYLLIGLAGIGSVGITQILNAYVTQYFPSHIRATSLGWGLGLGRVGAIAGPILV
FT                   GIIMTMQYDLAWNFYLFSFAGLIAAISVFFIPTK"
FT   gene            complement(398843..400369)
FT                   /locus_tag="BMB171_C0341"
FT   CDS_pept        complement(398843..400369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0341"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05159"
FT                   /protein_id="ADH05159.1"
FT                   /translation="MTSDTFPQLPLSYWIESTQFPTFPRLSENIKTKVAIIGAGITGIT
FT                   TAYLLAKEGIDVVLIDSGRILNGTTGHTTAKVTAQHDLIYDELINHFGVEKARLYYESN
FT                   NKALQFINKTVQTYKIDCNFSNEDSYLYTTTDNGLRNLSKEYEAYQKLNIPCDYVQSLS
FT                   IPIPVQSALVMKNQAQFHPLLYLKTLLEKFVEMGGKVYEQTTAMDVEKGDYPQIITKEG
FT                   HHITCEYVVSCSHFPFYDANSFFFTRMYAERSYALAIKAKTDYPGGMYLSIDDPKRSLR
FT                   YITNNGEKLILIGGESHKTGQGINTMLHYEALYSFAEATFGIDEVPYRWSAQDLITLDK
FT                   LPYIGHINERNPNIFVATGYRKWGMTTGTAAAHLLKDSILKVHSPYKELYAPSRFHANP
FT                   DIKTFLSQNIDVAKHLIEGKIETALRKPEDLEVGEGSVVHVNGKRAGAYKDKEGKLHIV
FT                   DTTCTHLGCEVEWNNGDCTWDCPCHGSRFSIEGDVIEGPADQPLKRVDNE"
FT   gene            400951..402036
FT                   /locus_tag="BMB171_C0342"
FT   CDS_pept        400951..402036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0342"
FT                   /product="Fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05160"
FT                   /protein_id="ADH05160.1"
FT                   /translation="MKELHTFGWYAARVSPHLPKKAFKPVPTRLFGGLAYLLVALAGLI
FT                   SIGVFELNVWANLGIAIVLGLCFASLGFLGHEILHGTVVRKAWLRDFLGAIAFMPLSTG
FT                   PKLWRKWHNATHHVHTQHEENDPDAWPTLEKLKKSKFLSWVYRMPLHVRSFFSFLSLTI
FT                   QFTLHSTRMFFHFIKEFKSSNQKSVWLQLLLPWTVWISLLFIMGPGKWLFAYVIPLLIA
FT                   NFIVMAYIATNHRLNPIVPVNDPLANCLSVTVPRWVDVLHFNFSYHTEHHLFPAMSSKY
FT                   YPLVKEKIKEMWPERYHEMPMTKALAALWNTPRVYYQGSELVDPHREHFYGSLGNGLDP
FT                   HNISYREEHIEEEKSIKKVNQ"
FT   gene            complement(402090..402782)
FT                   /locus_tag="BMB171_C0343"
FT   CDS_pept        complement(402090..402782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0343"
FT                   /product="cystine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05161"
FT                   /protein_id="ADH05161.1"
FT                   /translation="MFEIFISSYPTLLKATIVTLQLTLTSLVLGSLIGLLFAFFRISNN
FT                   KVLNSIAHVYIAIIRGTPLIVQIAILYFGITSVVVFTPFWAGAIALAIHNGAYITEIFR
FT                   GSIQSVDRGQLEAARSLGMPYPLAMRRIILPQAFRLSLPPLGNQFIIGLKDSSLVAYVG
FT                   MSELWGSGLSIAAGNFQQLDTYIIVGAYYLILVLLFTYFVNLLEKRLQRKETNSVQVHK
FT                   RNKKEVSL"
FT   gene            complement(402889..403683)
FT                   /locus_tag="BMB171_C0344"
FT   CDS_pept        complement(402889..403683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0344"
FT                   /product="cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05162"
FT                   /protein_id="ADH05162.1"
FT                   /translation="MKRKLLTIVASITLCTSFILGACSKESSTTSSNSEKEFRYAMSGL
FT                   YKPFNYKENDGKLVGFDVEIGEALAKKMNMKATPVTNPWETLIQGLQAKKYDVILGSMA
FT                   ITEERLKAVSFSNPYYRSGAQIFVAKKNTAISSPEDLKGKKIGVVKASTFKNLVAKYTD
FT                   QITEYDSDITALMDLEPGRVDAVITDQMVGLRMIKEGKSKIKEAGKPLNLDEMGIAIRK
FT                   DDKEMVEKVNKALDEIIKDGTYEKISKKWFGRNILGEEEKTK"
FT   gene            complement(403806..404528)
FT                   /locus_tag="BMB171_C0345"
FT   CDS_pept        complement(403806..404528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0345"
FT                   /product="glutamine transport ATP-binding protein glnQ"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05163"
FT                   /protein_id="ADH05163.1"
FT                   /translation="MIQVRNLVKSFGSLDVLKGIDLEVKEKEVVVLIGASGSGKSTLLR
FT                   CLNFLEMYDEGEIHLQGERIDPKHSNLNKVRENVGMVFQHFNLFPHMTSLENIIEAPIH
FT                   VKKLEKANAQDIGNQLLQKVGLQDKADVTPHLLSGGQKQRIAIARALAMSPKIMLFDEP
FT                   TSALDPELVGEVLQVMKELAEEGMTMVIVTHEMNFAKDVADRVIFMDDGKIVEDAPPVQ
FT                   FFSAPSHERAKQFLRNVL"
FT   gene            404739..406031
FT                   /locus_tag="BMB171_C0346"
FT   CDS_pept        404739..406031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0346"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05164"
FT                   /protein_id="ADH05164.1"
FT                   /translation="MEKERKTFSFGLRTQLMLFTTVLAFITYSTSIFFIYVIYDYFQSY
FT                   VSQTVYNIIVMLLGVVWSGILAYGAAVFLIKPLRKLEEAARKAAEGDIREDVPLPKTDD
FT                   EIKSLSVAFNMMLGNLRGMVKNIDTTFSYTNNQVQQIRKQTGEATRQAQGVSETLAEIS
FT                   SGAEQSAASIQAIVSAVDTTTSIASEVEEKAKQSDTLSSEMVEALGHSTRVFTSLIQGI
FT                   QTLAKENEDSMQNVQKLEERMKQVEHIVSVVSAIASQTNLLALNASIEAARAGEHGRGF
FT                   AVVAEEVRKLADESDHSARNISQLLRNMQDEVQQVAMKMTEQVKIAKEEAKRGEATELI
FT                   LKEMSSSVMEVADATQQISSYMNEQVSHIHQTGAQTKAVAAIAEETSAGSQEVARVTLQ
FT                   QSKNMIVIDQLLKDLEKQATDLKQTIERFSM"
FT   gene            406178..406627
FT                   /gene="argR_2"
FT                   /locus_tag="BMB171_C0347"
FT   CDS_pept        406178..406627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argR_2"
FT                   /locus_tag="BMB171_C0347"
FT                   /product="arginine repressor ArgR"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05165"
FT                   /protein_id="ADH05165.1"
FT                   /translation="MKKEKRQRLIKQFVKEYEIDKQERLVELLAKKDVLVTQATVSRDI
FT                   RELNLTKVPSQEGLMIYKVFSEEHLQTDIKLKKKLREVVVKIDCVDQLMVIKTLPGNAH
FT                   VIGVLFDELDWKEKIGCICGNDTCLIISQSKSDREIIEERLNLII"
FT   gene            406896..408128
FT                   /gene="arcA"
FT                   /locus_tag="BMB171_C0348"
FT   CDS_pept        406896..408128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcA"
FT                   /locus_tag="BMB171_C0348"
FT                   /product="arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05166"
FT                   /protein_id="ADH05166.1"
FT                   /translation="MKHPIHVTSEIGELQTVLLKRPGKEVENLTPDYLQQLLFDDIPYL
FT                   PIIQKEHDYFAQTLRNRGVEVLYLEKLAAEALVDKKLREEFVDRILKEGQADVNVAHQT
FT                   LKEYLLSFSNEELIQKIMGGVRKNEIETSKKTHLYELMEDHYPFYLDPMPNLYFTRDPA
FT                   ASVGDGLTINKMREPARRRESLFMEYIIKYHPRFAKHNVPIWLDRDYKFPIEGGDELIL
FT                   NEETIAIGVSARTSAKAIERLAKNLFSRQNKIKKVLAIEIPKCRAFMHLDTVFTMVDYD
FT                   KFTIHPAIQGPKGNMNIYILEKGSDEETLKITHRTSLMEALKEVLGLSELVLIPCGGGD
FT                   VIASAREQWNDGSNTLAIAPGVVVTYDRNYVSNTLLREHGIEVIEVLSSELSRGRGGPR
FT                   CMSMPIVRKDI"
FT   gene            408159..409157
FT                   /gene="argF_2"
FT                   /locus_tag="BMB171_C0349"
FT   CDS_pept        408159..409157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF_2"
FT                   /locus_tag="BMB171_C0349"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05167"
FT                   /protein_id="ADH05167.1"
FT                   /translation="MLMTRPNLKGRSFLAEKDFTQEELLYFLDLAAELKEKKKNGIPHH
FT                   YLEGKNVALLFEKTSTRTRCAFTVACTDLGANPEYLGKGDIQLGKKESVEDTAKVLGRM
FT                   FDGIEFRGFNHETVESLAQNSGVPVWNGLTDMWHPTQTLADLLTIREHVGKLKNVKLVY
FT                   VGDGRNNVANSLLVGGAIVGMDVRICTPESLWPAQEVIDLAKKYNEQVMITSNVEEAVA
FT                   NADVIYTDVWVSMGEEEKFAERVELLRPYQVNMKMIKETGNKNVIFLHCLPAFHDVETM
FT                   YGEEVYEKYGLKEMEVTDEVFRSKHSKVFDQAENRMHTIKAVMAATLGNME"
FT   gene            409257..410672
FT                   /locus_tag="BMB171_C0350"
FT   CDS_pept        409257..410672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0350"
FT                   /product="arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05168"
FT                   /protein_id="ADH05168.1"
FT                   /translation="MGEDKKLGLFTLTALVVGSMIGGGAFNLASDMAKGAGAGAIIIGW
FT                   VITGIGMIALGLSFQNLTVKRPDLDGGIFSYAKAGFGNFMGFNSAWGYWLSAWLGNVAY
FT                   GTLLFSSLGYFFPIFEGGQNVESIIGASVLLWCVHMLILRGVQSAALVNLVTTIAKLVP
FT                   VFVFIVIGIFAFHIDTFLDGFWGQTGSFSWGAVGSQVKSTMLVTLWVFIGVEGAVVLSS
FT                   RAKNRSDVGKATVIGLIGTLIIYILITLLSLGLMQQADIAGLKNPAMAYLFESVVGKWG
FT                   AIFINLGLVISVLGAWLGWTLLASEIPYLAAKDGVFPKWFAKENKNKAPVNSLWITNGL
FT                   IQIFLLTFVVSDQAYNFAFSLASSAILIPYAFSAFYQLKHSLKSEEADRNKNIIIGLIA
FT                   SIYGVWLVYAAGLEYLLLTMTLYAPGIFIFYNVQKQKSSKQIFTRVELASSVAIGALAF
FT                   FAIYGLITGSITL"
FT   gene            410827..411672
FT                   /gene="arcC"
FT                   /locus_tag="BMB171_C0351"
FT   CDS_pept        410827..411672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="BMB171_C0351"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05169"
FT                   /protein_id="ADH05169.1"
FT                   /translation="MENDVDIVIAHGNGPQVGNILLQQKAAETEKTPAMPLDTCGAMSQ
FT                   GMIGYWMENAIEKALKKRNINKDVATVITRVVVDKKDEAFKNPTKPIGPFYTEEEARKL
FT                   MDETKAVFKEDAGRGWRRVVPSPKPVSIHEHKVINSLVEDGNIVIAVGGGGIPVIDSEE
FT                   GLKGTEAVIDKDFAAQKLAELVDADTLVILTAVDYVYVNYNQPNQKKLEHVTVNQLEEY
FT                   IEEQQFAAGSMLPKIEAAINFVNTNPKRKTIITSLEKVYEALEEKAGTIISKQNVCMYV
FT                   "
FT   gene            411874..412563
FT                   /locus_tag="BMB171_C0352"
FT   CDS_pept        411874..412563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0352"
FT                   /product="Crp family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05170"
FT                   /protein_id="ADH05170.1"
FT                   /translation="MNRRNVVKDLKQFELFAHLTEKKLKGLTEFVYWRTYKKGQFLFLE
FT                   GDSRERIYFMLDGFVKLERVNQNGNLLYDDYVKRYSIFPYGGMFTDRGYNYTAEAMTDV
FT                   EVYYIPTVIFEDMVKSSRTQLMYVVQQLSSILKLNENRVQNITIPNAQDRVIQTLNYLM
FT                   QDLGEQSGEKIVISCPLTTIEISKISGTSRETVSSVLKQLKNDSIVTILDKKITIHDPT
FT                   YFEEISM"
FT   gene            412720..413403
FT                   /locus_tag="BMB171_C0353"
FT   CDS_pept        412720..413403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05171"
FT                   /protein_id="ADH05171.1"
FT                   /translation="MIRIEYDRLVAICYSIGVLLLLKIPNDNELIGEKLFNVYKIPIHT
FT                   YVYMDYKVSNILIVSFILHVIAFILFLKWLGKKESSTFRKMNKIKVVGTSILIVMMPFI
FT                   LNTILQTLNKTWYYAGKTGVEAIEYKKEDSQCRMEKNGENIQPKCIVTLKNYRNHSQAL
FT                   KVVLYDNANENSKSYPVPKPVYLQKHETKQFEFQVPVSYNRGIEKDKVPNIKLHSLHEN
FT                   DTKYN"
FT   gene            complement(413839..414858)
FT                   /locus_tag="BMB171_C0354"
FT   CDS_pept        complement(413839..414858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0354"
FT                   /product="FAD-dependent oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05172"
FT                   /protein_id="ADH05172.1"
FT                   /translation="MKQTKLTGRIVVPTDPDYDVARMNLNLSIPKLPCIIVFCQNNKDV
FT                   CNALKWARERHIPFRLRSGRHSYENFSLLNRGLIIDVSEMHRITVNTEKLTATIEAGAN
FT                   LGTVYKELWNYGVTIPAGTSASVGVVGLALGGGIGMLSRLFGLTCDQLMEVEMVQACGK
FT                   FGAKLIRANEQENSNLFWACRGGGGGNFGIVTSLTFRVHPIKNVSIFSITWEWEDFIAA
FT                   FQAWQNWAPYIDERLTSSIELFAKQRNKIEAQGEFVGSPSELHSLLSPLLETGSPSLFI
FT                   EEVPYIKAVEFFNGGNIPENFKRSGSYVYKPIPLKGIQIMQSFLMHQIKMLVFGINRS"
FT   gene            415103..416767
FT                   /locus_tag="BMB171_C0355"
FT   CDS_pept        415103..416767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0355"
FT                   /product="exo-alpha-1,4-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05173"
FT                   /protein_id="ADH05173.1"
FT                   /translation="MNKTWWKEAVAYQIYPRSFMDSNGDGIGDLQGIIAKLDYLKDLGI
FT                   DVIWICPMYKSPNDDNGYDISDYQDIMDEFGTMADFDALLDEVHKRDMKLIIDLVINHT
FT                   SDEHPWFIESRSSKDNPKRDWYIWHDGKDGAEPNNWESIFNGSAWEYDEETEQYYLHLF
FT                   SRKQPDLNWENKEVREVLYDTVNWWLDKGIDGFRVDAISHIKKEEGLKDMPNPKGLKYV
FT                   PSFDKHMNVKGIQPLLEELKENTFSKYDIMTVGEANGVKIEDAELWVGEEQGKFNMVFQ
FT                   FEHLSLWDAEKKKDLDVVGLKKVLTKWQKGLENKGWNALYIENHDKPRIVSTWGDDKQY
FT                   WRESATALGAMYFFMHGTPFIYQGQEIGMTNVQLPNIEDYDDVAIKNLYREKIAEGVPH
FT                   QDMMEIIWASCRDNSRTPMQWNDEMNAGFTTSTPWFSMNPNYKEINVEKQKNEEKSIFN
FT                   FYKKMIALKKEHDVLNYGTYDLLLEDDPQIYAYTRTLQDEKVIVISNISKEEAVYNEGS
FT                   FALERKRLLLNNYEVAEHEEVTTIALKPYETRVYRIS"
FT   gene            416973..418610
FT                   /locus_tag="BMB171_C0356"
FT   CDS_pept        416973..418610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0356"
FT                   /product="PTS system, glucose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05174"
FT                   /protein_id="ADH05174.1"
FT                   /translation="MKITSFDFWQKFGKALLVVVAVMPAAGLMISIGKLIGMSAGDVNA
FT                   VHTIARVMEDIGWAIITNLHILFAVAIGGSWAKDRAGGAFAALLAFVLTNRITGAIFGV
FT                   NAEMLADSKVKVSSVIAGDLIVKDYFTSVLGAPALNMGVFVGIITGFLGATLYNKYYNY
FT                   NKLPQALAFFNGKRFVPFVVIIWSTVTAIVLSLLWPFIQSGLNEFGRWIAASKDSAPVV
FT                   APFVYGTLERLLLPFGLHHMLTIPMNYTELGGTYTMLTGSKVGQVVAGQDPLWLAWITD
FT                   LNNLLANGDTKAYNDLLNNVVPARFKAGQVIGSTAALMGIAFAMFRNVDKEKRAKYKPM
FT                   FLSAALAVFLTGVTEPIEFMFMFIAPVLYVVYAITTGLAFALADLINLRVHAFGFIELI
FT                   TRTPMMVNAGLTRDLINFVIVSLVFFGLNFTLFNFLIKKFNLPTPGRAGNYIDNEDEAS
FT                   EGTGNVQDGSLATKVIDLLGGKENIADVDACMTRLRVTVKDLDVVAPEAQWKQNGALGL
FT                   IVKDKGVQAVYGPKADVLKSDIQDMLGA"
FT   gene            418615..419406
FT                   /locus_tag="BMB171_C0357"
FT   CDS_pept        418615..419406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0357"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05175"
FT                   /protein_id="ADH05175.1"
FT                   /translation="MKLLTLNCHSWQEENQIEKIQYLAKVIQEEEYDVIALQEVSQSIQ
FT                   AENVCGNKKKDNFGLLLLEELKALHVKDYNITWDFSHIGYDVYEEGLAIITKHNIIKED
FT                   TFFISENEDTTYWKTRKIVSTTIAYNGKDITFYSCHLGWWNDEEESFKGQVDRLMERVD
FT                   SNKLAFLMGDFNNNARLKGEGYEYMMQKGLYDTYELAIEKDEGTTVQGEIAGWDENKHN
FT                   LRIDLILCNQSKKVHSSKVIFNGTNRNVISDHFGVEVQLDI"
FT   gene            419712..422687
FT                   /locus_tag="BMB171_C0358"
FT   CDS_pept        419712..422687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0358"
FT                   /product="Phage infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05176"
FT                   /protein_id="ADH05176.1"
FT                   /translation="MKQIWRIYKTDLRNVAKHWAAIVIVLGLMILPSLYAWFNIKASWD
FT                   PYGNTKEVPIAVSNQDAGSNLRGKDINIGDEIVDSLKKNKNLGWKFVDEKQAIYGVERG
FT                   DYYASITIPKDFSEKIATVLDENPQKPELDYYVNEKVNAIAPKITAKGASGITEEISKN
FT                   FVKTANGEIFKIFNDLGIDLETNLPSIEKVKDLVFKLEAQFPEMNTLMDKALDDATRAE
FT                   DVVKVAQKELPVVESVMNDGQEALGNLDKFFARNDETLQRAPGTIKNNLMVMQKGLDGA
FT                   AAITDFLKNPSFDSNLTLPDPAKFPVLPNITIPQVPQIPEIPALPQVNGEGYKNIAKNI
FT                   NQTVNNVFSSIRVGTTYAQGVINGLQNGNFDPEKAKQDLNKVSETLQGRADSVSYLIDV
FT                   FTKFKESASTDFGKEFFQKRIEKLTNLKSAIENANGGVKDIANIIGTGQEVKQDVRDAA
FT                   NKKLDAINNLVNQAEADYNATFVADFEKAVSTAEQLKNTAENVKEDAQQLRGNLNQDIK
FT                   KANELVNQTNEALDSGREKYDKAVNDYSRLKTELEKAREDLSNKGVNGLDSTKVALNDL
FT                   NGQFKASWNLVNDMIPVLESTNKVLADVNSDKNLNGTISKLNKAKDGLQKGMELTDKGI
FT                   DAINKGQKPAADVIESINQVSKSVSGQIGDILAKYDSEITPNFNAAIARTKEMSKNTSQ
FT                   ILKEADKKLPDVKKLLEDSSKGLVDGKKKLADIKAEMPATEKKIKELADKIRDFESEED
FT                   LKDIIRLLKNDVEKQSDYFANPVNLKENKLFAMPNYGSAMSPFYTVLALWVGALLMVSL
FT                   LTVEVHEEGANYKSHEIYFGRLLTFLTIGLSQAFIVSMGDIFLLGTYVVDKFWFVLFSL
FT                   FIGGVFVCIVYSLVSIFGNVGKSMAIILLVLQVAGSGGTFPIQMTPAFFQAIYPFLPFT
FT                   YAISAIRETVGGMLWDIVTRDLLVLSAFVVVMIVAALLLKTPINKSSEKFVENAKGSKI
FT                   IH"
FT   gene            complement(422728..424917)
FT                   /gene="topB1"
FT                   /locus_tag="BMB171_C0359"
FT   CDS_pept        complement(422728..424917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB1"
FT                   /locus_tag="BMB171_C0359"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05177"
FT                   /protein_id="ADH05177.1"
FT                   /translation="MSKSVVIAEKPSVARDIARVLKCDKKGNGYLEGSKYIVTWALGHL
FT                   VTLADPESYDVKYKKWNLEDLPMLPERLKLTVIKQTGKQFNAVKSQLLRKDVNEIIVAT
FT                   DAGREGELVARWIIDKVKLNKPIKRLWISSVTDKAIKDGFANLKPGKAYDNLYASAVAR
FT                   SEADWYIGLNATRALTTRFNAQLNCGRVQTPTVAMIASREDEIKNFKAQTYYGIEAQTM
FT                   EKLKLTWQDANGNSRSFNKEKIDGIVKRLDKQNATVVEIDKKQKKSFSPGLYDLTELQR
FT                   DANKKFGYSAKETLNIMQKLYEQHKVLTYPRTDSRYISSDIVGTLPERLKACGVGEYRP
FT                   FAHKVLQKPIKPNKSFVDDSKVSDHHAIIPTEGYVNFSAFTDKERKIYDLVVKRFLAVL
FT                   FPAFEYEQLTLRTKVGNETFIARGKTILHAGWKEVYENRFEDDDVTDDVKEQLLPHIEK
FT                   GDTLAVKLIMQTSGQTKAPARFNEATLLSAMENPTKYMDTQNKQLADTLKSTGGLGTVA
FT                   TRADIIDKLFNSFLIEKRGKDIHITSKGRQLLDLVPEELKSPTLTGEWEQKLEAIAKGK
FT                   LKKEVFISEMKNYTKEIVSEIKSSDKKYKHDNISTKSCPDCGKPMLEVNGKKGKMLVCQ
FT                   DRECGHRKNVSRTTNARCPQCKKKLELRGEGAGQIFACKCGYREKLSTFQERRKKESGN
FT                   KADKRDVQKYMKQQNKEEEPLNNPFAEALKKLKFD"
FT   gene            425312..426121
FT                   /gene="thiM"
FT                   /locus_tag="BMB171_C0360"
FT   CDS_pept        425312..426121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="BMB171_C0360"
FT                   /product="hydroxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05178"
FT                   /protein_id="ADH05178.1"
FT                   /translation="MNMKEISKVVDLVRESNPLVHNITNVVVTNFTANGLLALGASPVM
FT                   AYAKEEVAEMASIAGALVLNMGTLRPEEVEAMLLAGKSANVNNVPVLFDPVGAGATSYR
FT                   TEVARHIPAEIELASIRGNAAEIANVINERWEIKGVDAGTGNGNVVSIARQAADELNTV
FT                   AVITGKEDVVTDGERTIVIRNGHPILTKVTGTGCLLTSVIGAFVAVEKDYVKAAVAALT
FT                   FYGVASELAAAKTVEKGPGSFQIEFLNQLANTTSSDIEKYGKIEELE"
FT   gene            426191..426796
FT                   /gene="thiE"
FT                   /locus_tag="BMB171_C0361"
FT   CDS_pept        426191..426796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BMB171_C0361"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05179"
FT                   /protein_id="ADH05179.1"
FT                   /translation="MGSNNCTRDPLAVLKEALDGGVTIFQFREKGEGSLIGEDRVRFAK
FT                   ELQTLCNEYSVPFIVNDDVELAIELDADGVHVGQDDEGITSVREKMGDKIIGVSAHTIE
FT                   EARFAIENGADYLGVGPIFPTSTKKDTKAVQGTKGLAYFREQGITVPIVGIGGITIENT
FT                   AAVIEAGADGVSVISAISLAESAYESTRKLAEEVKRSL"
FT   gene            complement(426912..428225)
FT                   /locus_tag="BMB171_C0362"
FT   CDS_pept        complement(426912..428225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0362"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05180"
FT                   /protein_id="ADH05180.1"
FT                   /translation="MFWLQFLTLLLCIFIGARLGGVGLGVMGGVGMAILVFVFHLQPTA
FT                   PPIDVMLMILAVITAAGALQAAGGMDYLVHLAEKALRKNPKRITFFAPIVTYLFTLCAG
FT                   TGHVAYSVLPVIAEVSRESGIRPERPMSIAVIASQQAITASPISAATVALLAMLADYKI
FT                   TLLDILKVSIPSTFIACMIAAFVASKMGKELNEDPEYLKRLKEGMIPKLEEKKAFVGVK
FT                   GAKLSVILFLVGTFLVVLLGSFEALRPGWIVDGKLARLSMPNTIEMVMLTIAALIIIFC
FT                   KPNVESIVSGNVFKAGATAVVAIFGIAWMGDTFFNGNLNMIQGSIQHLVTSAPWLFAIA
FT                   LFILSILLYSQAATVRALMPLGLSLGIPPALLIAMFPAVNGYFFIPNYGTIVAAINFDR
FT                   AGTTGIGKYVLNHSFMIPGLIATFTSIGIGMLLISIMF"
FT   gene            428728..430470
FT                   /locus_tag="BMB171_C0363"
FT   CDS_pept        428728..430470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0363"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05181"
FT                   /protein_id="ADH05181.1"
FT                   /translation="MKKYWHKLSFLQKNVLLTVLVILTLVGSMGALSFNMFQNSMMSLF
FT                   ERQSIETGEIVLKKLDVELVRDMAKDPTAEKVKKEKLTEKLDEVSKELKSVGQTYVTGA
FT                   KPNEKRELQLVGLTTELTNAFPIKPGDYYEQPAHWMKAYDKVIDTKKAQMTEVYEDEIG
FT                   SWVTILEPITDGENNIIAIVAADLDASIVPITKEKFMIQGLLFIIISLAIATITQFFIV
FT                   RHSLAPLKDLREGLRKIGEGDLSIKLKERPDDIGIINVYFNNTIEKFKGIIDKVRQTAE
FT                   QVSSSSQELSASTEENSMAVQEIASSIEGLRVGAQSQKTSVQQCLGIVHGMEDKVEEIT
FT                   GAAKQVAVASEGMEQHSIEGNEVIGQIINQMSLIQNAVQDLSSIIYSLETRSKEISDIV
FT                   TVITGISNQTNLLALNASIEASRAGAAGRGFAVVADEVRKLAEQTEASAKDIAKLIGET
FT                   QAETEDAVVSMQKGSKEVETGISLVQSSGDFFEKISKSAQSVTDQVKAVSGNSSDILQN
FT                   SQNIVQVVNELSHIANTYANSSSNVEESMKEQEISVQDIAELATSLSWLSQELQELIGE
FT                   FKSE"
FT   gene            430607..434188
FT                   /locus_tag="BMB171_C0364"
FT   CDS_pept        430607..434188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0364"
FT                   /product="peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05182"
FT                   /protein_id="ADH05182.1"
FT                   /translation="MKLAISYSEMVKEFLGKVEGSIKIPKDVQGTELRIKRKTELFSNL
FT                   THIVDLIGATATWLYHISKEKHIVVLYHVRGSLFPITIEVSNFLSYESLNLQIEEQLEQ
FT                   IKEMNEEEIEEFQNGNTLYEMSPIIIGETYYELKDTNTLQFVFSKNMQSVEIIFNSVNW
FT                   KETTITRYAQQIQGVLINKLQNNNNHINNFNVITEAEMALYSQVNDTTAVYPEKSIVDM
FT                   FYNTVTQFPNRIALSSREGTLTYEELNKKSNQIAHMLIKNGVQLGDYVGIFMKRSIDTV
FT                   VSMVAILKAGAAYVPIDPDYPESRIQYIIQDSQAKVILMKETPITCDGVQTVSMYDSET
FT                   YEDTDVKLSIHCDDVAYMIYTSGSTGNPKGTMLAHRGVVNLYTWMKKQYELTEEDVFAQ
FT                   FPSFSFDASVWESFASLFCGGNLYVLLEEERLSVEAFANAIYKVKATSILALATIFVRQ
FT                   VATYLAEEDIYKLASLKRIAIGGEMLPVEVIKLWRERIGTNVEIHNVYGPTECTVVTTT
FT                   YKIPSQLNEDVASIPIGKPCANYQVMILDENMNLCPIGVPGELYIDSVGLAKGYFNKPN
FT                   KTIEAFIPNPFNPIVNIYKTGDIVKLLEDGNIEFLHRKDDQVKIRGHRIELGEIQSKIS
FT                   QNHNIKENAVFAKKSKEGSQYLIAFYTTLNKKEIPELVYQLQEQLPDYMVPSKLIYINE
FT                   LPLTPNKKIDVKKLAQLEEKYEPVRLQEYVAPSNKAEKQIANAWAEVLGISKVGVHDDF
FT                   FTIGGHSLKVLRVLTLLKEDFSHLTIQDFFKERTIYGLARIEREVKVEKEEVFREYKVI
FT                   HEPDTITYANVLEENQISNVFLTGATGYLGSHILYELLRDTSATIYCLVRPTKDVQQRI
FT                   IDTLTGYFNDICEEWLQRIQAVAGDLGEEYLGMSEEEFMFISSKMDTIIHCGADVRHFG
FT                   DVKQFENINVQGTSRMLTLAEKGATFHFISTIGIPLELAVDQWDTYMKTGDFNYSVDLE
FT                   NVYSNSKLQAENIVREAMKNGLRGNIYRAGNLACHSETGSFQQNIEGNAFYRLIKTMLL
FT                   IGKAPNVKWKVDFTPIDFASKSIVSYLQDAQIIGETLHICHPHQIEFEQFIQLIGECGY
FT                   NLEMVPLSEYVNTGLALAKGNEVIAELIASQVAGDGAQQSEIVMGTRRTNKWIKKKELI
FT                   VPAINKEFIQQLLAHGEKVGYFPKIMK"
FT   gene            434444..434764
FT                   /locus_tag="BMB171_C0365"
FT   CDS_pept        434444..434764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05183"
FT                   /protein_id="ADH05183.1"
FT                   /translation="MSQQVTMSFSVVPQAKTKDVYSVVDKAIEVVQQSGVRYEVGAMET
FT                   TLEGELDVLLDVVKRAQQACVDAGAEEVITSIKIHYRPSTGVTIDEKVWKYRDEYAKPE
FT                   AI"
FT   gene            434736..435509
FT                   /locus_tag="BMB171_C0366"
FT   CDS_pept        434736..435509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0366"
FT                   /product="hydroxymethylpyrimidine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05184"
FT                   /protein_id="ADH05184.1"
FT                   /translation="MNMQNQKQSKLITTIWLILLIAIWEGSVSLFKIEPWILPKPSAIV
FT                   QELIGMKDLLLPNTMQTLQEVIIGLFFAILLGTSIAIIMDVIPLFRILINPLLVISQTI
FT                   PIVVLAPLFIIWFGYGMLPKVMVVILVCFFPIALSILEGFQTVDKNMLKLLQTMKATKW
FT                   QVYQKVKFPAVLPYFFSGLKIAVTYSVMGAIIGEWLGASEGLGVMLTRATKSFLTARVF
FT                   GVAAIIVMVTLCLYFIVEFMARITAPWIYRKDGRK"
FT   gene            435506..436504
FT                   /locus_tag="BMB171_C0367"
FT   CDS_pept        435506..436504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0367"
FT                   /product="hydroxymethylpyrimidine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05185"
FT                   /protein_id="ADH05185.1"
FT                   /translation="MKKGLKVMLAALVAVGVAGCNPAKKEESASKDQKVKVVLDWFPNT
FT                   NHTGLYVAQTKDYYKKQGLDVEIIQPGDNVTAEQMIASGKADFAISAQENVTLARVEGI
FT                   PVVSVGAIIQHNTSAFASLKKDNMTSPKDFEGKRYGGWGGPAEEATLKTIMDKHQADFN
FT                   KVEKIILGQTDFFKSIGRDADFEWIYYGWDGIEAKRQGKELNTIMVKDLDPALDFYSPV
FT                   IITSEKHTKQDKDFVKKFMSATTEGYNFAIKEPKEAADILIKAVPDVNKDLVQESQKWL
FT                   STKYQDDAKAWGVQKEEIWTNYMNFLYDNKVIKKKIDVKDAFTNEFLPSEK"
FT   gene            436642..437250
FT                   /locus_tag="BMB171_C0368"
FT   CDS_pept        436642..437250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0368"
FT                   /product="hydroxymethylpyrimidine transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05186"
FT                   /protein_id="ADH05186.1"
FT                   /translation="MIANVEKPTSGNVTYNDKQVQEQDVVSYMPQQDLLLPWRSALQNI
FT                   VLPLEIEGKPKKQRLTEGMEALKQFQLDEYADHYPDELSGGMRQRISFLRTYLCEKPIM
FT                   LLDEPFGKLDAFTKMEVHSWLLNSWHQEKQTIVMVTHDLDEAILLSDRVFILSQRPASI
FT                   VGEVQVKLPRPRTMDMLTSLELKKDKEEILSVLAPYMKK"
FT   gene            437310..437441
FT                   /locus_tag="BMB171_C0369"
FT   CDS_pept        437310..437441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0369"
FT                   /product="ABC transporter ATP-binding protein uup"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05187"
FT                   /protein_id="ADH05187.1"
FT                   /translation="MALQEALQQYKGTVLIVSHEPSFYESWITKVWNIEDWNTEQYE"
FT   gene            complement(437885..439909)
FT                   /locus_tag="BMB171_C0370"
FT   CDS_pept        complement(437885..439909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0370"
FT                   /product="endochitinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05188"
FT                   /protein_id="ADH05188.1"
FT                   /translation="MRSQKFTLLLLSLLLFLPLFLTNFITPNLALADSPKQSQKIVGYF
FT                   PSWGVYGRNYQVADIDASKLTHLNYAFADICWNGKHGNPSTHPDNPNKQTWNCKESGVP
FT                   LQNKEVPNGTLVLGEPWADVTKSYPGSGTTWEDCDKYARCGNFGELKRLKAKYPHLKTI
FT                   ISVGGWTWSNRFSDMAADEKTRKVFAESTVAFLRAYGFDGVDLDWEYPGVETIPGGSYR
FT                   PEDKQNFTLLLQDVRNALNKAGAEDGKQYLLTIASGASQRYADHTELKKISQILDWINI
FT                   MTYDFHGGWEAISNHNAALYKDPNDPAANTNFYVDGAINVYTNEGVPVDKLVLGVPFYG
FT                   RGWKSCGKENNGQYQPCKPGSDGKLASKGTWDDYSTGDTGVYDYGDLAANYVNKNGFVR
FT                   YWNDTAKVPYLYNATTGTFISYDDNESMKYKTDYIKTKGLSGAMFWELSGDCRTSPKYS
FT                   CSGPKLLDTLVKELLGGPISQKDTEPPTNVKNIVVTNKNSNSVQLNWTASTDNVGVTEY
FT                   EITAGEEKWSTTTNSITIKNLKPNTEYTFSIIAKDAAGNKSQPTALTVKTDEANTTPPD
FT                   GNGTATFSVTSNWGSGYNFSIIIKNNGTTPIKNWKLEFDYSGNLTQVWDSKISSKTNNH
FT                   YVITNAGWNGEIPPGGSITIGGAGTGNPAELLNTVISEN"
FT   gene            440281..440652
FT                   /locus_tag="BMB171_C0371"
FT   CDS_pept        440281..440652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05189"
FT                   /protein_id="ADH05189.1"
FT                   /translation="MDVFLNIAEEKIRQAIRNGDLDYLPGKGKPLQLEDLSMVPPELRM
FT                   SYKILKNAGMIPPEMELQKDILKIEDLIACCYDEEERKKLREELTAKTLRFQQVMEKRK
FT                   IKDSSAFRMYQGKLFRKLR"
FT   gene            440663..440977
FT                   /locus_tag="BMB171_C0372"
FT   CDS_pept        440663..440977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0372"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05190"
FT                   /protein_id="ADH05190.1"
FT                   /translation="MTTFKTIEELANYIEEQQLVLLFIKTENCGVCDVMLRKVNCVLEN
FT                   YDYVEKIEILLQDMQEIAGRYGVFTGPTILLFHNGKEILRESRFISLENLERIIQLFEE
FT                   "
FT   gene            441148..441288
FT                   /locus_tag="BMB171_C0373"
FT   CDS_pept        441148..441288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05191"
FT                   /protein_id="ADH05191.1"
FT                   /translation="MIARMMAVHMIVEALLGEIAEEAAVAVGIDENAPYIGVFLFKQTF
FT                   D"
FT   gene            441362..441505
FT                   /locus_tag="BMB171_C0374"
FT   CDS_pept        441362..441505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05192"
FT                   /protein_id="ADH05192.1"
FT                   /translation="MKREPKVKNKGKVVLFLLAAGGVFLVKLAFKFGTIHMIRTWFEST
FT                   FS"
FT   gene            441586..442167
FT                   /locus_tag="BMB171_C0375"
FT   CDS_pept        441586..442167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0375"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05193"
FT                   /protein_id="ADH05193.1"
FT                   /translation="MRRSAEEIKKEIAYKAESLFSQKGYAATSMEEICEITERSKGSIY
FT                   YHFKSKEELFLFVVKQHTYDWLEKWNEKEKLYSTSTEKLYGLAEYHVEDIQQPISNAIE
FT                   EFSMSQVVSKEILEELLALTRESYVMFEKLIEAGIQSGEFREDNTRDLMYIVNGLLSGL
FT                   GVLYYELDYKELKRIYKKAIDVLLKGMAAE"
FT   gene            442234..443466
FT                   /locus_tag="BMB171_C0376"
FT   CDS_pept        442234..443466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0376"
FT                   /product="macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05194"
FT                   /protein_id="ADH05194.1"
FT                   /translation="MNALFKNRAFMLVMASDILQQFAIWIRNMALLYFIMERTNNDPVS
FT                   VSLLSVMEYAPIFIFSFIGGALADRWNPKRTMVAGDVLSVLSIIGIVLLLKLDYWQAIF
FT                   FATLISAIVGQFSQPSSSRIFKRYVKEEEIANAIAFNQTLQSLFLIFGPVVGSLVYTQL
FT                   GLFTSLYSLIILFLLSAIALSFLPKWVEKEQVARDSLKNDIKEGWKYVLHTKNLRMITI
FT                   TFTIIGLAVGLTTPLEVFLVIERLGMEKEAVQYLAAADGIGMLIGGIVAAIFASKVNPK
FT                   KMFVFGMGILAMSFLVEGLSTSFWITSFMRFGTGICLACVNIVVGTLMIQLVPENMVGR
FT                   VNGTILPLFMGAMLIGTSLAGGLKELTSLVTVFCIAMALILLAIGPVLRMQIKKEDVAN
FT                   KEALTNSLASK"
FT   gene            443580..443774
FT                   /locus_tag="BMB171_C0377"
FT   CDS_pept        443580..443774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0377"
FT                   /product="PbsX family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05195"
FT                   /protein_id="ADH05195.1"
FT                   /translation="MKNQIYELRTENNISQGALADKCKVSRQTINAIENNKYDPSLALA
FT                   FRLAEVLGTTVDKLFLYKQ"
FT   gene            complement(443844..445127)
FT                   /locus_tag="BMB171_C0378"
FT   CDS_pept        complement(443844..445127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0378"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05196"
FT                   /protein_id="ADH05196.1"
FT                   /translation="MKKMSRQEKSWILYDWANSVYSLVITTALFPIYFKAAAKEAGLSG
FT                   ATSTAYWGYANSFATLLISILAPILGTVADYKGFKKRFFTFFFGLGIVFTSMLAVVPTS
FT                   QWYLLLGCYMLALIGFAGANIFYDAFLVDVTSEDRMDRISTRGFALGYIGSTIPFIGCI
FT                   ALIILSQKGTIPLSVGIASQISFAITALWWGLFTIPMLKNVEQTHYIERHPRPIRMSFK
FT                   RLADTFKNIKEYKTVFMFLIAYFFYIDGVDTIITMSTAYGTDLGISATNLLIILFVTQI
FT                   VACPFALLYGKSSETFTGKKMLYVGIIIYIIICTYAYFLKTTLDFWILAMLVATSQGGI
FT                   QALSRSYFAKLVPKESANEFFGFYNIFGKFAAIMGPVLVGVTTQLTGKTNAGVLSIIVL
FT                   FIIGGFLLTRVPENNTSVTPPSPKTKTL"
FT   gene            complement(445236..446549)
FT                   /locus_tag="BMB171_C0379"
FT   CDS_pept        complement(445236..446549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0379"
FT                   /product="phosphoglyceromutase/phosphopentomutase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05197"
FT                   /protein_id="ADH05197.1"
FT                   /translation="MDKALTNHVIILSFDCLSALDFPILQKLPHFQSLIKKGTVVEKVE
FT                   PIYPSVTYPSHSTIVTGNYPNKHGVVSNTLLQPGRESPDWHWYRKSIKGTTLYDEARKA
FT                   NLTTAALLWPVTGRANIDYNLPEIFPNRPWQNQVLVSLFSGSPLYQLDLNRRFGHIRNG
FT                   LSQPELDDFVLASAVHTIQTKKPNIMFVHFTDLDTQRHYHGFESNETIAAIQRHDERLG
FT                   KIIQALKESDLYEESTIIALGDHSALSENKSIQLNVLFHQRGLISLNKKRKLVDWKAYC
FT                   QSCDGSAYVYVKDKNDTDTIREVQLLLEELLQNKQNGIEFILHDEAAKDCGADGNCLFM
FT                   LEAREGYYFTENYTGDFIKEITEKDVTPSKKYTFGTHGYSPTKPNYETIFIAAGKGIKS
FT                   GVTVPYMRLIDEGPTIARLLGLHLGETDGAIVEDLLQL"
FT   gene            446704..446997
FT                   /locus_tag="BMB171_C0380"
FT   CDS_pept        446704..446997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05198"
FT                   /protein_id="ADH05198.1"
FT                   /translation="MDWLDGFGIFYIIGGITIILVFAISYLLKKRFPDKQFDIIFALSL
FT                   ILLCLASFPVTMIVIGGWEGMGYGFIGFFVLLGTLIGMIAHQLVKITRKSYV"
FT   gene            447345..448775
FT                   /gene="proS1"
FT                   /locus_tag="BMB171_C0381"
FT   CDS_pept        447345..448775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS1"
FT                   /locus_tag="BMB171_C0381"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05199"
FT                   /protein_id="ADH05199.1"
FT                   /translation="MAKEQVQAITKMEEDFAQWYTDIVKKAELVDYSSVKGCMILRPYG
FT                   YALWENMQKVMDEKLKETGHENVYMPMFIPESLLQKEKDHVEGFAPEVAWVTHGGDEKL
FT                   AERLCVRPTSETLFCEHFSKIVQSYNDLPKLYNQWCSVVRWEKTTRPFLRTTEFLWQEG
FT                   HTIHETAEESQAETLNILNLYASFCEDYLAIPVIKGQKTEKEKFAGAKATYTIESLMHD
FT                   GKALQTGTSHNFGTNFSEAFDIKFLDRNGKWQYVHQTSWGVSTRMIGGLIMVHSDNNGL
FT                   VMPPKVAPVQVVIVPIAQHKEGVLAKATELQAHIQKVARVKIDASNKTPGWKFNEYEMK
FT                   GIPIRLEVGPKDIEKNQVVLVRRDTKEKEFVPMDQLEERIPALLEEIHIALFNKAKAFR
FT                   DENTYVATNFEEMKKIADEKQGFIKAMWCGELACEEKLKEEFGVSSRCMPFEQEHLAEE
FT                   CICCGKEAKQMVYWGKAY"
FT   gene            complement(448891..449913)
FT                   /locus_tag="BMB171_C0382"
FT   CDS_pept        complement(448891..449913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0382"
FT                   /product="surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05200"
FT                   /protein_id="ADH05200.1"
FT                   /translation="MTKIFILASTLSLSFFSGLNIGNATTENFQPLTNAIVQNSDHFAE
FT                   GNSKDNNIPPGNNGSQDDTGSGDNGSGGNGSGGNGSGGNGSGGSGSGGNGSGGNGSGDN
FT                   GSGGNGSGDNGSGGNGSGGSGSDGSGSGGNGSGGNGSDGNGSGDNGSGGNGSGGNGSGG
FT                   NGSGGNGSGGSGSDGSGSGGNGSGGNGSGGNGSGDNGSGGNGSGGNGSGGNGSGGNGSG
FT                   GNGSGGNGSGGNGSGGNGSGGNGSGGNGSGGNGSQGGNRVKGDSSSQGGNGSQGGNRVK
FT                   GDSNSQEGNGSQGGNVKDNTKKQGDKLPNTATHYPISILMGLSTFLIGMLLFIRRKNVK
FT                   "
FT   gene            complement(450223..450363)
FT                   /locus_tag="BMB171_C0383"
FT   CDS_pept        complement(450223..450363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05201"
FT                   /protein_id="ADH05201.1"
FT                   /translation="MIRTSRHNSFININNSRSANTDSGNSMFIHYFFGYIYKFLNNLFS
FT                   A"
FT   gene            complement(450412..450570)
FT                   /locus_tag="BMB171_C0384"
FT   CDS_pept        complement(450412..450570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05202"
FT                   /protein_id="ADH05202.1"
FT                   /translation="MSSVQFSIYKNCSPNPCSKGEHNKVIFLSSTTIPLFSKRCTIHII
FT                   VNRYWNF"
FT   gene            450598..450993
FT                   /locus_tag="BMB171_C0385"
FT   CDS_pept        450598..450993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0385"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05203"
FT                   /protein_id="ADH05203.1"
FT                   /translation="MLIEEKTFEEVASISGLIRLVSKYKGKGKWNGKRIFELYDKGDRE
FT                   VAQAVGIFFKHLAIGISNLAYIFNPETIIIGGGITDRGNEFLKEVKEEVSKYLNQEIYN
FT                   NCEIELAQNGNCAGMIGAIYHFLHHHK"
FT   gene            451122..451718
FT                   /locus_tag="BMB171_C0386"
FT   CDS_pept        451122..451718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0386"
FT                   /product="tellurium resistance protein terD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05204"
FT                   /protein_id="ADH05204.1"
FT                   /translation="MPIILEKGQKIDLTKGQPKVAKLQVGLGWDPIGQSGGFLSSLFGS
FT                   KPNVDCDASVVMLEGNRFLNKNDLVYFGNKLSTCGSIIHSGDNLTGEGAGDDETIFVEL
FT                   HKVPSRINRLVFVVNIYDCVNRRQDFGMIRNAYIRIQNPQTGEELARYNLSDNYAGKTT
FT                   LIAGEMYRHGSEWKFSAVGEGTQDKNLSEIVSRYQ"
FT   gene            451741..452325
FT                   /locus_tag="BMB171_C0387"
FT   CDS_pept        451741..452325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0387"
FT                   /product="tellurium resistance protein terD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05205"
FT                   /protein_id="ADH05205.1"
FT                   /translation="MASISLKKGQKVDLTKTNPGLSKVLVGLGWDTNRYDGQNDFDLDV
FT                   SIFLVGANGKVSGAEDFVFYNNPKGANGAVEHLGDNRTGEGEGDDEAIKVDLKNVPAHI
FT                   ERICFTITIYDGEGRSQNFGQVSNSFVRILDEEKNAELIRYDLGEDFSIETAVVVGELY
FT                   RHAGDWKFNAIGSGFQGGLASLCNNFGLDVE"
FT   gene            452411..452989
FT                   /locus_tag="BMB171_C0388"
FT   CDS_pept        452411..452989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0388"
FT                   /product="tellurium resistance protein terD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05206"
FT                   /protein_id="ADH05206.1"
FT                   /translation="MVIQLQKGQKIDLGKTSPGLTKAVIGLGWDIKSYDGGADFDLDAS
FT                   AFLLDANGKCTKETDFIFYNNLQSPCGSVLHTGDNRTGEGEGDDEQLVVDLKKVPADVH
FT                   RIAITVTIYDAEGRSQNFGQVGNAFVRLANEETSEEVLRFDLGEDFSIETAVVFCELYR
FT                   HNGQWKFNAVGSGFQGGLGALVRAYGLDA"
FT   gene            453062..453853
FT                   /locus_tag="BMB171_C0389"
FT   CDS_pept        453062..453853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0389"
FT                   /product="TerC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05207"
FT                   /protein_id="ADH05207.1"
FT                   /translation="MSILQGILDTYAQFFDLDMWIKVLQDPVSWGLIGTLVVLEGLLSA
FT                   DNALVLAVMVKHLPEEKRKKALFYGLIGAYVFRFIAIGIGMFLIKLWWVKLLGALYLAW
FT                   LSVKYFIDKRKGASEEDEAHGMNQNSILFRMFGVFWGTVAMVELMDIAFSVDSVLAAFG
FT                   VSNEVWILLLGGMLGILMMRGIAGVFLKLLERIPELETTAYILILIIAAKMLLSLIEIE
FT                   ISHTLFFIILVVAFGATFILHYMKNSGQAREEVAATKEDNK"
FT   gene            453963..455594
FT                   /locus_tag="BMB171_C0390"
FT   CDS_pept        453963..455594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0390"
FT                   /product="tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05208"
FT                   /protein_id="ADH05208.1"
FT                   /translation="MFSRFTLQPYALKDESDLKQFETLLEKRPQYELTENEMKFSYIAC
FT                   RILGVPNDVDEYFNELFDYSEAKGIEVLHEQNLNKVIDSEKLRHIQEVFGLHQEAPNGL
FT                   TVNRLVAHLSGKQLLPKVDNPDLQHYIHTTFIAVLKLYEKQHNQSLKTEGFRRFLIDII
FT                   KLSENYVAKWFSTINYKKQMPRIIWYGDAQESRIYFLYFLIMLGCDVLYYHPEGKDGFE
FT                   NIDEEGRTFVVSHSSRISLEPFPDRRRERVATVAYQASKEIEQVLHHDNSLLYKPWQFR
FT                   SYTPVARTLKTTYDELFLITKEKAFVRPTFFVENKHIYIPSLFAKISGVSKNDKEYFQR
FT                   LKAVTSFDNSLLINTFPFTKEQKANFQYHYRDALDRAGKLHPDLIMNSHWWPHKRLPEG
FT                   LQHGIAEAIIHTCESEMCKPIAKETKQDVALYVFAQLSQIPPNILEQLEKFDYSQDVPK
FT                   IVIFNNEKSGELTRSDAVLLLFLNQIGVDVFHFNPTGRNDIEPYIEAGAFDSHWLEEVN
FT                   FDLEFHGSSAYKNLSQTIKGLFRPFL"
FT   gene            455613..456695
FT                   /locus_tag="BMB171_C0391"
FT   CDS_pept        455613..456695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0391"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05209"
FT                   /protein_id="ADH05209.1"
FT                   /translation="MNNPVVLDPKTELNEQTAQDVRLQLRQDADVQRIYNAVDIKDQLE
FT                   LIELGKEPSMEISRFADQILHTMSLSKIEDSGELLKQLGKIMDRFDSKDFAEEKSGFFS
FT                   RMFKKADKMIEQIFSKYQTMGREIDKVYVEITKYQDEMKKSIGTLDGLYEQNLKYYLDL
FT                   EKYVVAGEMLLERLNTELVPMYEERVRNNDQLAGIELESLKNSVEILEQRIDDLEKARM
FT                   VALLTAPQIRMIQRGNNKLIGKINTAFITTIPIFKNGIIQAVNAKRQKLVADSMAELDR
FT                   RTNELLKKNAQNIATQSVEVARLSGSSSIKMETLEETWNIISRGMQETQQIEEQNKRER
FT                   EESRKRMATLTENIKKELQG"
FT   gene            complement(456883..459549)
FT                   /locus_tag="BMB171_C0392"
FT   CDS_pept        complement(456883..459549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0392"
FT                   /product="calcium-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05210"
FT                   /protein_id="ADH05210.1"
FT                   /translation="MSNWYSKTKDQTLIDLETNEQNGLTDEIVSERLKQYGSNELATKQ
FT                   KRTLWQRIFAQINDVLVYVLIIAALISAFVGEWADASIIALVVVLNAVIGVVQESKAEQ
FT                   ALEALKKMATPKAIVKRNGELKEIPSEHVVPGDIVMLDAGRYIPCDLRLIETANLKVEE
FT                   SALTGESVPVDKDAIYHPSMQSDEQVPLGDQKNMAFMSTLVTYGRGVGVAVETGMNSQI
FT                   GKIATLLHEADDDMTPLQKSLAQVGKYLGFVAVAICIVMFLIGFLQGRDTLEMFMTAIS
FT                   LAVAAIPEGLPAIVSIVLAIGVQRMIKQNVIIRKLPAVEALGSVTIICSDKTGTLTQNK
FT                   MTVTHFYSDNTYDRLESLNVNNDAQRLLLENMVLCNDASYTNESQTGDPTEIALLVAGT
FT                   TFNMQKDHLEKIHERVNEVPFDSDRKMMSTVHTYDEGYYSMTKGAIDKLLPRCTHIFKN
FT                   GKIEILTDSDKNQILEAAGAMSQEALRVLSFAFKQYNSNNVDINHLEENLIFIGLVGMI
FT                   DPPRTEVKDSITECKKAGIRTVMITGDHKDTAFAIAKELGIAEEISEIMIGTELDNISD
FT                   TELASKINHLNVFARVSPEHKVKIVKALRTKGNIVSMTGDGVNDAPSLKQADVGVAMGI
FT                   TGTDVAKGAADVVLTDDNFSSIVKAVEEGRNIYRNIKKSILFLLSCNFGEIIALFLAIL
FT                   LGWATPLRPIHILWVNLITDTLPALSLGVDPEDPDVMKEKPRHAKESLFSGSVPFLIFN
FT                   GVIIGLLTLIAFIAGAKFYTGDTNLFPLFPERIDDDALLHAQTMAFVVLSFSQLVHSFN
FT                   LRSRTKSIFSIGIFTNKYLVFSLLIGVLMQVCIISIPPLANIFGVHALTMRDWGFVLLL
FT                   SIIPLVVNEIIKLVKKN"
FT   gene            complement(459743..459967)
FT                   /locus_tag="BMB171_C0393"
FT   CDS_pept        complement(459743..459967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05211"
FT                   /protein_id="ADH05211.1"
FT                   /translation="MDLSVKSEENVEYMVEAIKEKLRMVNAGAMRAASFNEEMYEDLRD
FT                   IYDHVMKRETFSISEMQAITEELGTLIKK"
FT   gene            460106..460606
FT                   /locus_tag="BMB171_C0394"
FT   CDS_pept        460106..460606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0394"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05212"
FT                   /protein_id="ADH05212.1"
FT                   /translation="MKKCTKKGRNKNMVQVLFVCLGNICRSPMAEAIFRNLVVKEGLEE
FT                   KIVIDSAGTGDWHVGHPPHKGTQKILKENAVTFEGIKARQVEKEDLTKFDYIIAMDNKN
FT                   IADLKSLGKTGGYIGRLSDFVPDGGWTDVPDPYYTGNFQEVYDLVTEGCAKLLAFIRNE
FT                   QGI"
FT   gene            460660..461175
FT                   /locus_tag="BMB171_C0395"
FT   CDS_pept        460660..461175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05213"
FT                   /protein_id="ADH05213.1"
FT                   /translation="MAKKNNIARNIAIGVAAGVAVSMLKKENREKVKNTAEKAKTKMIE
FT                   IGENAKIKEKVQTVTDKGRELADFNVVKAKVAEIKKLTPSVVETLKETKEIFSKKKVEP
FT                   EEKPETIEIQAVSPKVDELKAEEEPVVAEDGGMKEARELFIKDSNAVEKKTEAYIELKQ
FT                   DKEEKKSV"
FT   gene            461182..462048
FT                   /gene="yihY"
FT                   /locus_tag="BMB171_C0396"
FT   CDS_pept        461182..462048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yihY"
FT                   /locus_tag="BMB171_C0396"
FT                   /product="ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05214"
FT                   /protein_id="ADH05214.1"
FT                   /translation="MRKILEKVRRNRTYSFGKDLYDRTMRDDVAGLAAQLAYFFLLAIF
FT                   PGLVFLITLLGFIPIQTEDVLSLLEVYVPDDAMNLIEVNVDKVVNQQNGGLLSFGLLSM
FT                   LWFASNGVNAVMNAFNRAYDVKETRSFITTRALSIVFTLAIIFMIVFALIVPVFGQVIG
FT                   AAVFKALGLSDSFSFVWSITRLVASFFVLFALFSFLYTFAPDRKLKRREVISGALFATV
FT                   GWIVVSYSFAYYVDKFANYANTYGGLGGIIILMLWFYLTGWVILLGGEINGLLHHYRTG
FT                   DNNSRNE"
FT   gene            complement(462236..464161)
FT                   /locus_tag="BMB171_C0397"
FT   CDS_pept        complement(462236..464161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0397"
FT                   /product="Zinc uptake P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05215"
FT                   /protein_id="ADH05215.1"
FT                   /translation="MNSEVKTLHAKETISHPSLWDTLKKHYELVFAVASGIFILVGWLF
FT                   TKNDAMNVGITCYILAYIVGGYAKAKEGIEDTIEEKELNVEMLMLFAAIGAAIIGYWAE
FT                   GAILIFIFALSGAMESYTLSKSQKEISALLDLQPEEALRISTGTEERVPVGELQINDII
FT                   LIKPGERIPADGTIHNGETNIDEAAITGEPIPNEKRHGDEVFAGTVNLRGAIEVKITKP
FT                   SDQTLFQKIIRLVQSAQSEKSPSQLFIEKFEGTYVKGVLLVVALMMFVPHFLLDWSWNE
FT                   TFYRAMILLVVASPCALVAAITPATLSAISNGARNGILFKGGIHLERLASVKAIAFDKT
FT                   GTLTEGKPTVTDVYVRENITEKEVLYITASIESHSTHPLAESIVKYAQHAYDITLKKPE
FT                   KVEDVTGFGLKGILENNAYKIGKADFIGEETKTFHNGISASLEKEGKTVVYISDEGGIL
FT                   GLIALKDTLRQETIAAIRDLQSIGVEAIMITGDNEETAKAIASESNIKEYYASCLPETK
FT                   VETIKKLKEKYGTVAMVGDGINDAPALATASIGVAMGEGTDVALETADVVLMKNELSRL
FT                   SQAIRLSKRMNRIVKQNVIFSLVVIAMLICSNFLQFLALPFGVIGHEGSTILVILNGLR
FT                   LLKGSK"
FT   gene            464433..465383
FT                   /locus_tag="BMB171_C0398"
FT   CDS_pept        464433..465383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0398"
FT                   /product="drug/metabolite exporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05216"
FT                   /protein_id="ADH05216.1"
FT                   /translation="MKTEKFFTHPIGVFIAAIVATFLWGSAFPFIKLSYVELGIQPQEV
FT                   GEQILFAGYRFFLSGFMLLLFFKVLGKDMSFKKGTGKQLIQIGLFQTFLQYICFYIGMS
FT                   YSSGIEGAIISGTSSFFQILLAHFLYKDDALNMRKIIGVSIGFCGVVLVNMPSDGSLSF
FT                   HFGIGSLLLLSAAMLYSYGNILAKEGSKTLDVGYMTAYQMMFGSIGLLCIGALQVGVMP
FT                   FTFSLHALLMLIYLSFLSAAGFCIWNTIMKYNKVGKVSMYMFFIPVFGVLLSSMILGEA
FT                   IHSFVLLGLACVAAGIIVVNRTSAKQKIEKEKQVA"
FT   gene            465504..466184
FT                   /locus_tag="BMB171_C0399"
FT   CDS_pept        465504..466184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05217"
FT                   /protein_id="ADH05217.1"
FT                   /translation="MNLLYVVLIGQILLFLIGAIYAMRQTKRTKDNMPLSLAIRLILSF
FT                   SLTGSAIWIWLQDPSVEYSTWVALGMTLSTVGDLFMAGLIPIGHRLIGGMVTFALAHCF
FT                   YVKAFLQTGISWNGFWIGLLVYGLFLIVGWFFFIRNDKQDKLFTIGALIYGLWVGGMAC
FT                   FAFALYYENTGIWWIPAFGGLLFVISDFIIGVTDIGGRKLKYEPLWIWFTYVAAQMCIV
FT                   YVGL"
FT   gene            466362..466898
FT                   /gene="lepB_3"
FT                   /locus_tag="BMB171_C0400"
FT   CDS_pept        466362..466898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB_3"
FT                   /locus_tag="BMB171_C0400"
FT                   /product="Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05218"
FT                   /protein_id="ADH05218.1"
FT                   /translation="MMQKKKRWREFFGTIAIACLLVFLAKIFVFFPTTVKGASMRPTLQ
FT                   DGDKVIVNKLAKQFESYGREDIIVMKTDNFYVKRVIGLPGDIIEMRNDQLYVNSEVKDE
FT                   EYLDSNKKQAEKKLMNLTEDFGPITVPENKIFVMGDNRLISKDSRNGLGFIDREDVLGK
FT                   LAGIYYPFEHMKIIK"
FT   gene            complement(466936..469698)
FT                   /locus_tag="BMB171_C0401"
FT   CDS_pept        complement(466936..469698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0401"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05219"
FT                   /protein_id="ADH05219.1"
FT                   /translation="MTIENQFIQKVYYKTFLTEETSTPASEVLGEAYINESKNEFSNIS
FT                   NIRFAQGEFYYQNKDFEAAIFKWEKVNNALALWATKNIADAYFELGFLPKAEEIYQSIQ
FT                   TEDTTLTMEVSLQLLSLYIEQDRLGLAFKTISEAVAFQPDYPNITAIARSFYEKQEDWN
FT                   NAIELAVQEGIRTQSLHWFDTLITYINKGFTKNIKPEYFYESLKALYAVDQAQFKELVI
FT                   ALWNSYQHESLYLPWIQSINHLFLHIETDNNDDWNEISTRYQETYFALITGNHFMHELN
FT                   GLVPNLLTNWFSLTKAKDSLVVSAAVLAWNEVSPTSLESLLVKSAGSLLSNTSAEADVN
FT                   METVSHLFETIAVWAEKNDVDLSHQFTLLVHELCDLNVTPILIAGTSDHDKTSFVNSIL
FT                   GENILTETLTTPILFKDASQTEITEFTELDIRNIPNLDEFHQITATSAQSELEKKCIEI
FT                   KLPSRFLRKNKFTFLITPSIQGQLDKNNAYFEYLQAADSLVYVLNSSSPLHSQEIDTLI
FT                   YLREQVPNLQIHFVSHTNNTTTDEKLISKLKVHFPDAQFFPYSPSQESSQQLGDVTESI
FT                   LSNLAKRDIEKERIEKLIWFTQKTIAYLINERVELENTLVKSVRWNKHISVKLTGFINN
FT                   LTALEKDKIRSITESYLLTKEEITRDIHSQIPELLQSCSDLVQEDSDFKLVHEELNAAM
FT                   NERVQKHVQQVLLPKFTGSIQEWIETAHNEFIQAQAYLDEMSETFNKLYKEERMKLPCD
FT                   FKLLDDWNRDVVRMTNRITVTNINILLRFTPTQFFLKSAGKLFGNMQKNQSMLANKYKQ
FT                   YIETEDYTEIAHTISKQFFLQFEVFEGALERDIMMFFKDPLNILKQNVDAAQLEIKEDE
FT                   QTLATLRSNPETYHDPLALFKLQLLQHKFVLSTTKKHEDIFVSNESPTV"
FT   gene            470185..470778
FT                   /locus_tag="BMB171_C0402"
FT   CDS_pept        470185..470778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0402"
FT                   /product="alkaline phosphatase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05220"
FT                   /protein_id="ADH05220.1"
FT                   /translation="MEQHIGELIAHYGYFGIVIALAGGIVGLPIPDEFLLTFVGYNVSK
FT                   GVMSGTAAFLSGLAGAMLGITLSYILGLKLGLPVLKKYGPKIRIKEHHIEKTHILFEKY
FT                   GPFLLMIGYFIPGVRHLTAYFAGVSNLTLWRFCLYAYGGALIWISVFIGLGWKLGEKWR
FT                   FVEYSLHHYGIWILLISAVVTCFVWLYIKKKKNR"
FT   gene            complement(470790..471218)
FT                   /locus_tag="BMB171_C0403"
FT   CDS_pept        complement(470790..471218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0403"
FT                   /product="transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05221"
FT                   /protein_id="ADH05221.1"
FT                   /translation="MSSWLLFALLSAIAAALVSIFGKFGLDGIDANVATTIRSIIMALF
FT                   MIGVIIIQGKFQNIGDVLLNKKALLFITLSGIAGASSWLFYFLALKTGKVSQVAPVDKL
FT                   SVVFSIILAMIILGEKLNFMTGVGVVFITAGVLFIAFS"
FT   gene            complement(471427..471573)
FT                   /locus_tag="BMB171_C0404"
FT   CDS_pept        complement(471427..471573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05222"
FT                   /protein_id="ADH05222.1"
FT                   /translation="MKREERKNMIEFIEKKKGIERDELLFMTDDEVEHIYNVTYFLYEE
FT                   IAE"
FT   gene            complement(471728..472144)
FT                   /locus_tag="BMB171_C0405"
FT   CDS_pept        complement(471728..472144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0405"
FT                   /product="general stress protein 26"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05223"
FT                   /protein_id="ADH05223.1"
FT                   /translation="MHLKEKIATIIQGQRTGVLSTVRNEKPHSAFMMFFHEDFVLYVAT
FT                   DRQSKKITDIEQNPNVHVLLGREGKKLDEDYIEVEGLASIEEDSTLKNKFWNNSLKRWL
FT                   LGPEDPNYVLIKINPDTIYYIDGAGTTEPEFLRL"
FT   gene            472324..473379
FT                   /gene="cax"
FT                   /locus_tag="BMB171_C0406"
FT   CDS_pept        472324..473379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cax"
FT                   /locus_tag="BMB171_C0406"
FT                   /product="calcium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05224"
FT                   /protein_id="ADH05224.1"
FT                   /translation="MFNKIFLIVALIGVPLSVLGKTLHWPETIMFAVYCVTIIALAGFM
FT                   GRATESLAIVSGPRIGGLLNATFGNAVELIISIFALQAGLIEVVLASLTGSVLGNLLLV
FT                   GGLSFFVGGLKYKRQSFNVYDARHNSALLIFAVVVAFVIPEIFSMKMDAGKTYQLSIGV
FT                   SIIMIIMYLAALLFKLVTHRGVYQHKSDEVAHEEEPEWSKGKALLILAIATLAVAYVSE
FT                   ALVHTFETVAKSFGWSELFIGVIIVAIVGNAAEHASAIIMAYKNKVNIAVEIAIGSTLQ
FT                   IAMFVAPVLVLLSMFFAQRMPLVFTIPELVSMITAVFLTIAISNDGDTNWFEGGTLLAA
FT                   YVIMGIGFYLL"
FT   gene            473459..474256
FT                   /locus_tag="BMB171_C0407"
FT   CDS_pept        473459..474256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05225"
FT                   /protein_id="ADH05225.1"
FT                   /translation="MKRVYSICLSTMVSFILLFPNMSFAKTTVGTKMPSSVLNISKDNT
FT                   FPNDAQDLPRLQPSKFAQELLKTANIKIENPDLIRMFNETTISNAPLAVGYRAKIYLGQ
FT                   WALHYESVDTSINWEYKQVNRNVYDNRGGDRLYPLRYKQETQKTVEGDLTADMKDAADV
FT                   KKMMLLKALEKVQLPLSFKTTIGYGTGHERVYNISPSQLGYLYAYTPAVNEKGKVTFGE
FT                   VYLVLKGNQKRLVVKNITSQGIGAAIPIHDHLFFKFISSSHSQ"
FT   gene            complement(474292..475419)
FT                   /locus_tag="BMB171_C0408"
FT   CDS_pept        complement(474292..475419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0408"
FT                   /product="thioredoxin-like oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05226"
FT                   /protein_id="ADH05226.1"
FT                   /translation="MTISQKMKPITPSYDPWEAYMDLEEYGKLLLTNVEFTTTTLCNMR
FT                   CEHCAVGYTLQPKDPNPLPMDLLLKRLDEIPHLRSLSITGGEPMLSKKSVDNYVTPLLK
FT                   YAHERGVRTQINSNLTIDLARYEQIIPYLDVLHISHNWGTIDDFVEGGFAMMERKPTYE
FT                   QRAKLFERMITNSKALSDAGVLVSAETMLNKRTLPHIEHIHRQIVEEMGCKRHEVHPMY
FT                   PSDFASNLEILTKAEIRDAIEHLLEIRDENVWMLFGTLPFYACSDDEKDIATFKKLQES
FT                   KNVTVRNDPDGRSRLNVNIFDGNIIVTDFGDVPLLGNIQTNTLQEAYEKWSTSKTAKSL
FT                   SCHCPAVKCLGPNVLVKNSYYPTEDFLSKTANITL"
FT   gene            475633..475815
FT                   /locus_tag="BMB171_C0409"
FT   CDS_pept        475633..475815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05227"
FT                   /protein_id="ADH05227.1"
FT                   /translation="MGKAIQDKDTQLVYLKERLNMFIEVIDTIEPEEVELEDVDRLLAM
FT                   LDELELKCEQFKKDE"
FT   gene            476022..477542
FT                   /gene="fumA"
FT                   /locus_tag="BMB171_C0410"
FT   CDS_pept        476022..477542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fumA"
FT                   /locus_tag="BMB171_C0410"
FT                   /product="fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05228"
FT                   /protein_id="ADH05228.1"
FT                   /translation="MEKLQESMYQLIVETSTNLPKDVRRAIQQAKERENAGTRSAMALG
FT                   TITNNIKMADDNISPICQDTGMPTFKIYTPVGVNQLKLKEAIYNALERATKDGKLRPNS
FT                   VDSLFGDNSGNNLGPGTPVIKFEQWEKDYIDARLILKGGGCENKNIQYSLPCELEGLGR
FT                   AGRDLEGIRKCLLHAVYQAQGQGCSAGVIGVGIGGDRTSGYELAKNQLFRTLDDVNPVP
FT                   ELQHLEEYVLENANKLGIGTMGFGGETTLLGCKIGVYNRLPASFYVSVAYNCWAYRRLG
FT                   VKIHPETGDIMDWLYQEGEDTLQHEVQEKTEQREIVLQAPITEEQIRELRVGDVVTING
FT                   MMYTGRDAIHKHLMDNDCPVDLNGQIIYHCGPVVVKDENDNWQIKAAGPTTSIREEPYQ
FT                   GDIMKKFGIRAVIGKGGMGAKTLAALEEHGGVYLNAIGGAAQYYAECIKEVKDVDFLQF
FT                   GIPEAMWHLRIDGFKAVVTMDSHGNSLHADVDKTSLEKLASFKEPVFK"
FT   gene            477670..478452
FT                   /gene="pdaA"
FT                   /locus_tag="BMB171_C0411"
FT   CDS_pept        477670..478452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaA"
FT                   /locus_tag="BMB171_C0411"
FT                   /product="spore coat N-acetylmuramic acid deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05229"
FT                   /protein_id="ADH05229.1"
FT                   /translation="MKYKWLYIGLIFSIMMALVPVSALAYTNTPHNWGIPRPKNETVPD
FT                   AGKLYTDLLQKNGGFYLGDTKKKDIYLTFDNGYENGYTGKILDVLKEKKVPATFFVTGH
FT                   YIKTQKDLLLRMKDEGHIIGNHSWSHPDFTAVNDEKLREELTSVTEEIKKVTGQKEVKY
FT                   VRPPRGVFSERTLALTKEMGYYNVFWSLAFLDWKVDQQRGWQYAHNNVMTMIHPGSILL
FT                   LHAISKDNAEALAKIIDDLREKGYHFKSLDDLVKGNQP"
FT   gene            478512..479375
FT                   /locus_tag="BMB171_C0412"
FT   CDS_pept        478512..479375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0412"
FT                   /product="DNA-3-methyladenine glycosylase II"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05230"
FT                   /protein_id="ADH05230.1"
FT                   /translation="MWSEHVTLEYPYHFEEVLKRVSFDPLSVIQLDEKVIYIPLCIDEE
FT                   QVVVRLQGIGTVQNPQFWISSQTGDPEKVMKRMRAIFHWNEPFQDIQNHFLNTSLRPLF
FT                   ETYAYTPIILEFDYFACLLRCIIHQQINLKFATVLTEQFVKRYGTEKNGVFFFPTPEIV
FT                   ANISIEELREQKFSQRKAEYIVGLGRSIVSGTLNLASIENGTEEDISAQLLPIRGIGAW
FT                   TVQNFLMFGLGRKNMFPKADIGIQRAVQGIFQLDDKPDDAFLEKVKQECEPYCSYAALY
FT                   LWKSIE"
FT   gene            479386..480765
FT                   /locus_tag="BMB171_C0413"
FT   CDS_pept        479386..480765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0413"
FT                   /product="tRNA(Uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05231"
FT                   /protein_id="ADH05231.1"
FT                   /translation="MIQKQHESKLEVGQTFPVTIKRLGINGEGVGYFKRQVVFIPGALP
FT                   GEEVVAETTKIQRGFAEAKVKKVRKASPHRVKAPCPVYEECGGCQLQHLDYKEQLNQKR
FT                   DIVVQAFEKYMKNSMEEKIRPTLGMENPWHYRNKSQLQVGRKDEKVITGLYKQNSHQLI
FT                   DIAHCMIQHKATNEATKVVRRILEKLNVSIYNEKKQKGLVRTIVTRTAVQTGEVQVTLI
FT                   TTKEELPNKEQFIAEVQKQMPAVKSIMQNVNWRKTSVIFGDKTFKLAGKEVIQETLGDL
FT                   SFELSARAFFQLNPEQTVVLYNEAKKAAALTGNEKIVDAYCGVGTIGLWLANDAAEVRG
FT                   MDVIPEAIADARKNAKRHGFTNTKYEAGKAEQWLPKWVKEGWRPDVIVVDPPRTGCDDK
FT                   LLETILKVKPKQVVYVSCNPSSLARDVQALMKSYEVEYVQPVDMFPHTAHVENVVKLVR
FT                   K"
FT   gene            480822..481559
FT                   /gene="truA2"
FT                   /locus_tag="BMB171_C0414"
FT   CDS_pept        480822..481559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA2"
FT                   /locus_tag="BMB171_C0414"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05232"
FT                   /protein_id="ADH05232.1"
FT                   /translation="MHNYKLTIQYDGARFKGWQRLGNNDNTIQGKIESVISEMVGKEIE
FT                   IIGCSRTDAGVHALNQVANFQSDEKLVEHKVKKYLNQYLPNDISITNVEEVHDRFHARY
FT                   NSKAKTYLYKIWNEEHTNPFMRKYSMHVNKKLNVKSMKAAAKHLVGSHDFTAFSNAKSK
FT                   KKSMVREVYTLDVMEEAGFVQIRVSGNGFLHNMVRKIVGALIEVGLGQLDAEAIPNILE
FT                   EKQRNQINCLAEASGLYLENVEF"
FT   gene            complement(481604..481807)
FT                   /locus_tag="BMB171_C0415"
FT   CDS_pept        complement(481604..481807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05233"
FT                   /protein_id="ADH05233.1"
FT                   /translation="MSNDKKLKLLQYLYFFPAMLCMMLFINADVSSSPYAKLLGTIFGS
FT                   FAAIMLAAFWNLKIRIKNEKSS"
FT   gene            complement(481891..483294)
FT                   /gene="rocR1"
FT                   /locus_tag="BMB171_C0416"
FT   CDS_pept        complement(481891..483294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocR1"
FT                   /locus_tag="BMB171_C0416"
FT                   /product="arginine utilization regulatory protein rocR"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05234"
FT                   /protein_id="ADH05234.1"
FT                   /translation="MRTEEINLKQIIEMNMLYETLLNELDIGIHIINEESKTIIYNRKM
FT                   MEIESMERSDVLYKSPLEVFAFEENKNSTLIEALKFGKTKKNIKQTYFNNKGQEITTIN
FT                   DTFPIIENGKIKGAIEISKEISNLKQTIKIGPSRKQSTKFTFDHIIGDSEAIQSIITEG
FT                   KRVIRTSSSILLVGETGTGKELFAQSIHNESQRSTKPFISQNCAAIPDTLMESLLFGTN
FT                   RGAFTGAIDKSGLFEEANGGTLLLDEINSLSPILQAKLLRAIQEKTIRRIGGTHEKEID
FT                   VRIIATINEDPFEAIAHNRLREDLYYRLSVVTLCLPPLRERKEDIPALVQHFIEKYNTQ
FT                   FGLNVTDVDVNVREFFYAYDWPGNVRELEHIIEGSMNLIENETIITAFHLPTRFRERIK
FT                   TEFNMQHALTTHNTDAPKTLKHTIEKMEKNYINQILKENHGNISQAAKFLGLSRQNLQY
FT                   RIKKLHLHI"
FT   gene            483569..483823
FT                   /locus_tag="BMB171_C0417"
FT   CDS_pept        483569..483823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05235"
FT                   /protein_id="ADH05235.1"
FT                   /translation="MKTVIECVYSPCYGKVEKLFVTESSYVYEWEKLALIGTIDKQKVE
FT                   IKIGISGYIESLEVVEGQAIADQKLLITVRDDLLVTGSD"
FT   gene            483930..485351
FT                   /locus_tag="BMB171_C0418"
FT   CDS_pept        483930..485351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0418"
FT                   /product="arginine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05236"
FT                   /protein_id="ADH05236.1"
FT                   /translation="MMNQNQGLKRELKSRHIFMIALGGVIGTGLFLGSGYTIHEAGPGG
FT                   AIVAYLVGGFVMYLTMLCLGELAVAMPDAGSYQTYATKHISPAAGYVVGWMSWLNWSAT
FT                   IGIELIAVSILMKRWFPDVPSWIWCVVFAVLLFAINALSSRSFAEVEFWFASIKVITII
FT                   AFIILGGAAMFGFLDMKGNEPAPMFSSFTDYGGLFPNGLSAILITMIAVNFSFQGTELV
FT                   GIAAGESENPEKTIPKAINNTVWRILVFFVLSIFILAGLFPWQQAGVIESPFVVVFDKI
FT                   GIPYAADIINFVIITAVLSVANSGLYATSRMLWSMSNQGMISPIFGKLSKNGVPIYALI
FT                   VSTIVGCLSLLSGIYAEDTVYLWLLSIAGFGAILVWASIALSNLLARRSYIKQGGDVKE
FT                   LKFKTPLYPFVPLLALVLNLTVIVGMAFIPEQRMALYCGIPFMIVCLLFYRATRNKARK
FT                   VEHIEKTNTTEVESL"
FT   gene            485448..486722
FT                   /locus_tag="BMB171_C0419"
FT   CDS_pept        485448..486722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0419"
FT                   /product="acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05237"
FT                   /protein_id="ADH05237.1"
FT                   /translation="MNPEVSQLLKQIDSRKEELLELTKTLIRFETPAPPARNTNEAQEF
FT                   VADFLRKRNFSIDKWDVYPNDPNVVGVKKGAKSDSYKSLIINGHMDVAEVSADEAWETN
FT                   PFEPFIKDGWLVGRGAADMKGGLAGALFAIQLLQEAGIELPGDLIFQSVIGEEVGEAGT
FT                   LQCCKRGYDADFAVVVDTSNLHMQGQGGVITGWITVKSPQTFHDATRRQMIHAGGRLFG
FT                   ASAIEKMMKIVQSLQELERHWAVMKTYEGYPSGTTTINPAVIEGGRHAAFIADECRLWI
FT                   TVHFYPNETHEQIIKEIEEYIGKVAAADPWLSENPPQFKWGGESMIVDRGEIFPSLEID
FT                   SEHTAVKTLSSVHESILSKNAILDMSATVTDGGWFSEFHIPAIIYGPGTLEEAHSVNEK
FT                   VEVEQLIEFTKVITAFIYEWCHTEK"
FT   gene            complement(486822..487475)
FT                   /locus_tag="BMB171_C0420"
FT   CDS_pept        complement(486822..487475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0420"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05238"
FT                   /protein_id="ADH05238.1"
FT                   /translation="MPKENPNERLSRLIKKLLKERALSMRQLGMLTNIDPATISRIMNG
FT                   KQPPKQKHLQKFAECLQVPPQLLFDEMYPDSPHINKEKTDMYTSLDTIQQTLQSSNLFD
FT                   FDYTTTRVKQELENYERYAQTTEGEKRIHDSFASKLEQIDSAGPFIEQLTDMYQQFCNE
FT                   TISKEERAVLGSALLYFILSTDIIPDYLFPIGYLDDAIAVELAKEKLIELKRKT"
FT   gene            487605..488216
FT                   /locus_tag="BMB171_C0421"
FT   CDS_pept        487605..488216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0421"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05239"
FT                   /protein_id="ADH05239.1"
FT                   /translation="MSTAGLFSIFLIGIASNLDNAGVGIAYGIRKIRISWFNNFIIAFF
FT                   GFLFTLLAGFFGNWIALFISEFTANLIGAIVLGIIGVFILCQPFLGQRNTVGSKDGNVL
FT                   MGILRDPEKADFDGSKTISFSEAIVLGIALSINNIAGGFDAGITNLNLWLTATISGVFS
FT                   FICISGFAYVGKRFLAEYLGKWATVIAGVLLILIGIDQLL"
FT   gene            complement(488184..488372)
FT                   /locus_tag="BMB171_C0422"
FT   CDS_pept        complement(488184..488372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05240"
FT                   /protein_id="ADH05240.1"
FT                   /translation="MPFFLMIKCFPAPHTNPPFLKEIRISMEKSTSIYAIPCCISKEIL
FT                   EPCFLLSLQQLINPNKN"
FT   gene            488331..488489
FT                   /locus_tag="BMB171_C0423"
FT   CDS_pept        488331..488489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05241"
FT                   /protein_id="ADH05241.1"
FT                   /translation="MGRGKAFDHKKKGHDHQPPKGAFIHKDVNEHTLEEEELPVNIEAY
FT                   KNSLKKH"
FT   gene            complement(488512..488853)
FT                   /locus_tag="BMB171_C0424"
FT   CDS_pept        complement(488512..488853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05242"
FT                   /protein_id="ADH05242.1"
FT                   /translation="MKLIFQMGKQPVLEKTILLFILSIVESLKLKVVSLDEAHRYIFNL
FT                   EVLELLMDRNIDDQVLELIHFGMGLEDIYHVLPEELEHTIEELKWLCIQVLSEYSMHEE
FT                   SEQLIEDIR"
FT   gene            complement(489028..489957)
FT                   /gene="glsA1"
FT                   /locus_tag="BMB171_C0425"
FT   CDS_pept        complement(489028..489957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glsA1"
FT                   /locus_tag="BMB171_C0425"
FT                   /product="glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05243"
FT                   /protein_id="ADH05243.1"
FT                   /translation="MQCIETNNLQQLLEQVKPYTKKGKLATYIPELGNANPDDLGIAIF
FT                   HKETEYIHAGNSQTLFTLQSISKVITLALALLDRGEEYVFSKVGMEPTGDPFNSIIKLE
FT                   TTSPSKPLNPMINAGALAITSMLAGKDNEEKMERILHFVREITDNPTINYSSKVADSEL
FT                   ETAYLNRSLCYYMKQNGIIDCDIEELMDLYTRQCAVEVNCIDLARIGLIFAMDGYDPYK
FT                   KKQIIPKHITKICKTFMVTCGMYNESGEFAIRVGIPAKSGVAGGIFGCVKGDMGIGIFG
FT                   PALDANGNSIAGFKILELLSAQEGWSIF"
FT   gene            490283..491785
FT                   /locus_tag="BMB171_C0426"
FT   CDS_pept        490283..491785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0426"
FT                   /product="PTS system,N-acetylglucosamine-specific IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05244"
FT                   /protein_id="ADH05244.1"
FT                   /translation="MLQFLQRIGKALMLPIAVLPAAGLLLRLGQPDVFDIPVMAQAGAA
FT                   VFDNLALIFAIGIAIGLSVDGSGAAGLAGAIGYLVMKNSIDALSKGYSTAELQGKLGKV
FT                   QDLIGNSANVDPSKLADTMTQVSKAAELSTKVDMKVLGGIIVGVIAGLLYNKFHKIKLP
FT                   EWLGFFAGKRFVPIVTSVVMLILGILFAQIWPTIQNGIDALAHGIVNLGAIGSGLFGLL
FT                   NRLLIPIGLHHVMNTYFWFVFGDFTNAAGNVVNGDIARFLAGDKTAGMFMTGFFPVMMF
FT                   GLPAACFAMIAAAKPEKRKAVTGMLAGLALTSFLTGITEPIEFSFMFLSPVLYGIHAVL
FT                   TGLSLFITTSLGIHDGFSFSAGAIDYALNFGIATKPVLLAGIGLIYAAIYFIVFYFLIK
FT                   KFDLKTPGREDDDELVEDGDAPVAGSIGETYVAALGGKENLTVIDNCATRLRLQVKDAG
FT                   QVNEAALKRAGAKGVMKLSNTSVQVIVGTNVESVADDMKKHV"
FT   gene            492444..493286
FT                   /locus_tag="BMB171_C0427"
FT   CDS_pept        492444..493286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0427"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05245"
FT                   /protein_id="ADH05245.1"
FT                   /translation="MANKEQQVPNNSETTFYIGSISKAFVATAIMQLKDQNKLQVEDTV
FT                   AKYIPDFPQGNNIQLKHLLTHTSGIPEYEQGKEDISHEELIKRIGNQKRIGGPGEKWKY
FT                   SDSNYSILAYIAEKVSGQSLEEYIKQHIFATAGMKHSGFGTALEQTRFPSTGYKIVNNN
FT                   MTTPNIPSMSQLYGCGDIYTSAHDLYLFNEALYSGKLISKESYDQMFTGGKKDYGFGWY
FT                   VDPGSYSNHGVMPGWNCLNGFSKNGSVYVVLLSNIQNNIKSFGKVNNDIYSILRNIEV"
FT   gene            493442..493843
FT                   /locus_tag="BMB171_C0428"
FT   CDS_pept        493442..493843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05246"
FT                   /protein_id="ADH05246.1"
FT                   /translation="MCLFRKYWHKLSRLFNRQLDYFLDNKLLPAVERLLFSQNFARFIQ
FT                   RNSKQATEEVIESSRFQSIICNILKECNTSPFKEIAKQYLGKSVEITVTVGQLTGVIVA
FT                   VGDDFLTLQEGIGTEVLLPFTSIISIKEA"
FT   gene            493860..494054
FT                   /locus_tag="BMB171_C0429"
FT   CDS_pept        493860..494054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05247"
FT                   /protein_id="ADH05247.1"
FT                   /translation="MVFTDELRNHVGELVQVVTAVEIIAGVLLSVTDGAVIVRTSPSYG
FT                   PPEDVVVRIPIIAYVRLEG"
FT   gene            494068..495612
FT                   /locus_tag="BMB171_C0430"
FT   CDS_pept        494068..495612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0430"
FT                   /product="cell wall biosynthesis glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05248"
FT                   /protein_id="ADH05248.1"
FT                   /translation="MRVSVVIPVHNEASTLSKVLVEVRKLEPYEVIIVDNGSTDGTKEI
FT                   ALQHNCRVIYYRDSLGNDVGRAIGAREAKGEIVLFLDGDIVMKSEELYNFIKGIRQGHE
FT                   IVLNNLTWSVYLKMRPHYTTVGKYMLNRYLNKKEFVVGSLIAIPHAISRKVIEKLGWWN
FT                   LADPALFQAMAMSRGVDISDMASVDVIYTNKVRPVHTGTSPGSPYPKATSRIMGDHLRA
FT                   LQYVIETYGKRGGFSENNRDREFVGKYKPVLLQKNKAKYSAIIPVSEEKITIRSVIKEV
FT                   KEAGVDEIIVVANGADVETVKQAKLENVIVVEFTKALGHNVARAIGAMHATADICLFVD
FT                   SDLVIPAKKLTLFLHAVEDGNDVVLNDLQCLLDMFHPADPISMGKYFVNLIAKRPDLWN
FT                   NSLTAVPHAIHKKVIEKIGYDSLIIPPLAQVKAILEGFSITTVELVDVIKTNRVRPEQH
FT                   EFVNGRISAFDRIFGDQLEAVAYLLQCTDERGGFTDGDRDRDVIQQLRREEENTNE"
FT   gene            495605..496846
FT                   /locus_tag="BMB171_C0431"
FT   CDS_pept        495605..496846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0431"
FT                   /product="UDP-N-acetyl-D-mannosamine 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05249"
FT                   /protein_id="ADH05249.1"
FT                   /translation="MNSSKVAIIGLGYVGLPLAVHFAERGHTVLGLDKDIRKIDSIIKG
FT                   ESYIPDVSSKELQSLLTKKKLTVNTPDQGIADFQNSDYVIVTVPTPINEQREPDLSALI
FT                   SASHYIQQNLQKGQTFIFESSTYPGTLEEVILPIISQNGKKVGEDFYIGYSPERIDPAN
FT                   SQYSVQAIPKVISGQTEKCKQKVKDLYSTIFDEVVPVSSPKVAEMCKLFENIQRLVNIS
FT                   LVNELNTLCESLGIDFYEAIEAASTKPFGFTPYWPGPGIGGHCIPVDPLYFQWRIKKNG
FT                   AISQLIEAAHIINEEMPEKMVRKVKSVVQSPATVLIVGIAYKKDVNDLRESPALPIIQL
FT                   LRNQGYEIEYHDPYISFAEIGDKVYQSVSLDEEKVKKADCILILTDHSNIDWKLFKGMD
FT                   RVIDTRGIVKKVSK"
FT   gene            496843..497808
FT                   /locus_tag="BMB171_C0432"
FT   CDS_pept        496843..497808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0432"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05250"
FT                   /protein_id="ADH05250.1"
FT                   /translation="MSKKCLITGGAGFIGSHLAEELMRRGYEVTVVDNFYKGKNKYHKE
FT                   LMKEIRVIPISVLDKNSIYELVDQHDVVFHLAAILGVKTTMEKSIELIETNFDGTRNVL
FT                   QAALKGKKKVVFASTSEVYGKAKPPFSEEGDRLYGATSKIRWSYAVCKTLEETLCLGYA
FT                   LEGLPVTIVRYFNIYGPRAKDGPYAGVIPRFIRAALQGEDILVYGDGKQTRCFTYVSDA
FT                   VEATIRAMDEKVNGEIINIGSENEKSIKEVAEVIKKLTNSSSKIVQVPFEEVYPHGFEE
FT                   IPNRRPDVTKLKELVQFQAKVTWENGLKETIKWFREQNNG"
FT   gene            497801..499345
FT                   /locus_tag="BMB171_C0433"
FT   CDS_pept        497801..499345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0433"
FT                   /product="cell wall biosynthesis glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05251"
FT                   /protein_id="ADH05251.1"
FT                   /translation="MAKSLSVIIPACNEVDTISDVIQSVRPLNPVEIIVVANGCNDGTE
FT                   DVADRLGCKVIKHTELLGNDVGRAVGAKHAIGDVLLFIDGDFAIPTSKLKLFLNPILYD
FT                   QADVVLNNLDALFLKRQKTTSITVWRQILNAMLEREELKMNSLLDVPHALTKEVVQSIG
FT                   YECFVNPIVAHLRLVQSKWRISRHCAIDVITPNKFRPFQHAAYGTNLSQSEKRMIGDHI
FT                   EAVAERILSSDERGGYYDGNRKRDSVYHTLSFEEFYQGWGVTSDFYKGKQLSVVIPVQD
FT                   EEKTIGNVIEELRKIEPFEIIVVVNGSSDKTKKIAKDKGATTIVYKEALGNDVGRSLGT
FT                   YFAKGEIVLFIDGDFVIPASELYPFAKAIADGTDVALNDLNHYLDLRVPLHLVTAFKYA
FT                   LNLACDRKDLGVGSLIAVPNAFSRKCLKEIGYRSLLAPCVAQVKAILSGFEVACVSRVE
FT                   VDKMNRIRPSEHFAKIGHPPAVLRIIGDHIEGLDQIIALTDNRGGFYDGNRKRDVL"
FT   gene            499688..501937
FT                   /gene="pfl"
FT                   /locus_tag="BMB171_C0434"
FT   CDS_pept        499688..501937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfl"
FT                   /locus_tag="BMB171_C0434"
FT                   /product="formate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05252"
FT                   /protein_id="ADH05252.1"
FT                   /translation="MTQVLENVKNAWENFKGEKWKAEIDVRDFILNNVNVFEGDESFLA
FT                   EATEATKQLWDQVMDLTTKERENGGVLDMDTKIVSSITSHDPGYLNKDIEKVVGFQTDK
FT                   PFKRSLQPYGGIRMAEQACESYGYEMDKELSRIFREWRKTHNQGVFDAYTPEMRNARKS
FT                   GVITGLPDAYGRGRIIGDYRRVALYGIDHLIEAKKADLNLTGGVMSEDTMRLREELSEQ
FT                   MRALQELKEMAASHGFDISKPATNAQEAFQWLYFAYLAAIKEQNGAAMSLGRTSTFLDI
FT                   YIERDLANGTLTEEEVQEIVDHFIMKLRLVKFARTPDYNELFSGDPTWVTESIGGMALD
FT                   GRPLVTKNSFRFLHTLDNLGPAPEPNLTVLWSKQLPENFKNYCAKMSIKTSAIQYENDD
FT                   IMRPEYGDDYGIACCVSAMRIGKQMQFFGARANLAKALLYAINGGKDEKSKAQVGPEYA
FT                   PITSEVLNYEEVMHKFDMTMEWLAGLYLNTLNVIHYMHDKYSYERIEMALHDTNVLRTM
FT                   ATGIAGLSVVADSLSAIKYAKVKPIRDENGIAVDFEIEGDFPKYGNNDDRVDEIAVNLV
FT                   KTFMNKLRKHKTYRNSVHTMSILTITSNVVYGKKTGNTPDGRRTGEPFAPGANPMHGRD
FT                   TKGALASLLSVAKLPYEDAQDGISNTFSIIPKALGKEDDVQVRNLVSMLDGYAVKEGHH
FT                   LNINVFNRETLMDAMEHPEKYPQLTIRVSGYAVNFIKLTREQQIDVINRTMHESM"
FT   gene            502008..502739
FT                   /gene="pflA"
FT                   /locus_tag="BMB171_C0435"
FT   CDS_pept        502008..502739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="BMB171_C0435"
FT                   /product="pyruvate formate-lyase activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05253"
FT                   /protein_id="ADH05253.1"
FT                   /translation="MVKGRIHSVESCGTVDGPGIRYVIFTQGCLLRCQYCHNADTWEIG
FT                   KGKEITVEEVMQDVTCYLPFIEASGGGITVSGGEPLLQLDFLIELFKKCKAAGIHTTID
FT                   SSGGCYSEEPEFQNKLDILMDYTDLVLLDLKHIDSKKHRKLTGKPNEHILQFARYLSDK
FT                   NKPIWVRHVLVPGVTDNEEDLQKLSSFIQSLSNVQKVEVLPYHKLGVYKWEALGHKYPL
FT                   ANVEPPTEKNVEHAKYILQAV"
FT   gene            503152..504318
FT                   /locus_tag="BMB171_C0436"
FT   CDS_pept        503152..504318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0436"
FT                   /product="diacylglycerol glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05254"
FT                   /protein_id="ADH05254.1"
FT                   /translation="MIKNPKVLILTAHYGNGHVQVAKTLEQTFRQKGIEDVIVCDLFGE
FT                   SHPFITDITKYLYLKSYTIGKELYRLFYYGVEKIYDKKIASWYANFGRKRLKTLLQVEK
FT                   PDIVINTFPIIAVPELKKQTGISIPVYNVLTDFCVHKIWIHREVDRYFVATDHVKELMV
FT                   DIGVPAEQIVETGIPIRSSFELKVNPEIIYTKYQLCKNKKILLIVAGAHGVLGNVKELC
FT                   QSFMAVPNLQVVVVCGKNEALKQDLLSLQKQNSDALKVFGYVENIDELFRVTSCMITKP
FT                   GGITLSEAAALQVPVILYKPVPGQENENAMYFERKGAAVVIRDDSEVFAKTEALLQDDV
FT                   KLLQMKEAMKSIYLPEPAGHIVDAILAENHAEPRHIPIKSPALAQSFT"
FT   gene            complement(504687..504806)
FT                   /locus_tag="BMB171_C0437"
FT   CDS_pept        complement(504687..504806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0437"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05255"
FT                   /protein_id="ADH05255.1"
FT                   /translation="MDKKKRDKAKNTLSSTQEVLYQREFQKADRAAGYRSKSI"
FT   gene            complement(504916..505473)
FT                   /locus_tag="BMB171_C0438"
FT   CDS_pept        complement(504916..505473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05256"
FT                   /protein_id="ADH05256.1"
FT                   /translation="MLKKRDLHDSHVLYELMVDPAVFPFVRQKAYSYEEYLFLTKQTIE
FT                   AEERGELISRTILDEWGNPIGTITLFDVQEKAGFLGTWLGKPYHGKGYNKLAKDSFFSE
FT                   LFYELDIETIFMRIRKINIRSIKAAEKLQYVNLANETRKAVYDEINANEEVYNLYEIPK
FT                   DQYTLATMRDTAFQDAHQLKEA"
FT   gene            complement(505702..506844)
FT                   /locus_tag="BMB171_C0439"
FT   CDS_pept        complement(505702..506844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0439"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05257"
FT                   /protein_id="ADH05257.1"
FT                   /translation="MKILLKQAIVYPITSQKFQGDVLVTGERITEVKPFIQPTQDMTVI
FT                   DARALHLLPGFIDVHTHLGLYDEGTGWAGNDANETSEVSTPHIRSLDGIHPLDIAFQDA
FT                   VQNGITTVHVMPGSQNIIGGTTCVIKTAGTCIDHMIIQEPAGLKIAFGENPKKVHSNGT
FT                   KESITRMGIMGLLRESFYEAQHYGHEADFRMLPILKALRREIPVRIHAHRADDISSALR
FT                   FATEFNLDLRIEHCTEGHFLVEELSKHNLKVSVGPTLTRRSKIELKNKTWDTYHILSKN
FT                   GVEVSITTDHPYTPIQYLNICAAVAVREGLDEKTALEGITIFPARNLRLEDRIGSIEVG
FT                   KDADLVLWTHHPFHYLAKPVLTMIDGKIIYKKNKKTSLFF"
FT   gene            complement(506984..507889)
FT                   /locus_tag="BMB171_C0440"
FT   CDS_pept        complement(506984..507889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0440"
FT                   /product="cell division inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05258"
FT                   /protein_id="ADH05258.1"
FT                   /translation="MKIAISGGTGFIGKSLSTFFIQKGYTVYILTRKKTTETSDPNLQY
FT                   VQWTPDLQTFPLSSIDVVINLAGESINSRWTKQQKKAILNSRIQTTKGLIKQLQGLHTK
FT                   PHTFINASAIGYYGTSEIESFTEQHETPGNDFLANTVYSWEQEASKARSLGIRTIYARF
FT                   GVVLGANGGALPKMLLPYQFYIGGTIGSGKQWLSWIHIDDVVRMMDFIIHKKEIDGPLN
FT                   MTAPTPIRMKEFGENIATIMNKPHWLPVPSFIIQTLLGEMSILVLEGQRVLPIKAIEHG
FT                   YQYTFPAIDHALQNILSHTM"
FT   gene            507971..508783
FT                   /gene="recX"
FT                   /locus_tag="BMB171_C0441"
FT   CDS_pept        507971..508783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="BMB171_C0441"
FT                   /product="recombination regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05259"
FT                   /protein_id="ADH05259.1"
FT                   /translation="MAVITKIEVQKRSKERFNIYIDKGQGEEYGFSVDQVILIKHGLQK
FT                   GLEIDEIELGNILYNEEVQKAYLQAISYLSYQMRTKQEIEDFLRKKEVGQAIISEVVSK
FT                   LLHDRYINDKEYAVLYTRTQSNVNRKGPTVIKRELLNKGVQDLIITHSLQEYPKEKQIE
FT                   NALFLIEKKKKSYQKHSFLQMKLKLDEMLVRKGYSREVIQICLEELKDEKDDEKQQEAL
FT                   HYHGNKYYEKYKKHDGWTFENKMKQALYRKGFSIDEIEIFLQMKREEE"
FT   gene            508794..509111
FT                   /locus_tag="BMB171_C0442"
FT   CDS_pept        508794..509111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0442"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05260"
FT                   /protein_id="ADH05260.1"
FT                   /translation="MNMPKRYSEMTPHELREEIGALKEQAVKAEQLGIVNEFDVLMRKM
FT                   AMARAYMTDINKFHIGETYELVEEPGVLFKITYFNGVFAWGYKQNDNEEIGIPISLLQE
FT                   K"
FT   gene            509647..509913
FT                   /locus_tag="BMB171_C0443"
FT   CDS_pept        509647..509913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05261"
FT                   /protein_id="ADH05261.1"
FT                   /translation="MNDIYETLTKELLDKNDKLSYAQARAWVELLWEDFQTTYAKSGRY
FT                   QGDEMTEQVVRSWINNHGVRLHEMRTNNPKYSHLINQEDHLKH"
FT   gene            complement(509938..510918)
FT                   /locus_tag="BMB171_C0444"
FT   CDS_pept        complement(509938..510918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05262"
FT                   /protein_id="ADH05262.1"
FT                   /translation="MDTATHLVMGITLGSLATLDPAIAQSDIGPQAVMLATIAGSNIPD
FT                   IDTVLKLRNNAKYIRNHRGITHSIPAVILWSFLISGISFAFFSEAPYLHLLLWSFIAVF
FT                   LHVFVDIFNAYGTQALRPFTKKWVALGIINTFDTVIFFIHILAIACMLVGSHKGYTALA
FT                   AYILMIVYYIGRIMMHRNIRSVVHKRFKNVEKIIISPSYRFYHYHLAVVTADYYYVARW
FT                   HRGNIMIYDKFDRVPFPDNNIMRAAKQDENISAFLSFSPVYRWDIFDHDHYYEVRFIDL
FT                   RYRSKDYYPFVAIVQLDHNLNIINSYTGWIFSEEKLRKKLELLPH"
FT   gene            511068..512165
FT                   /gene="mutY"
FT                   /locus_tag="BMB171_C0445"
FT   CDS_pept        511068..512165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BMB171_C0445"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05263"
FT                   /protein_id="ADH05263.1"
FT                   /translation="MTLEILNNFNIEQFQNDLIGWFEEEQRDLPWRKNKDPYRVWVSEI
FT                   MLQQTRVEAVKPYYANFMGKFPTLEALANADDEEVLKAWEGLGYYSRARNLHAAVKEVK
FT                   EVYGGVVPSDVKKIEKLKGVGPYTKGAILSIAYGIPEPAVDGNVMRVLSRILSVWDDIA
FT                   KPKTRKVFEEIVREIISVENPSYFNQGLMELGALICIPKNPSCLLCPVREHCRGYAEGV
FT                   QKELPVKSKAKAPKMVPIVAGVLQTEDGRYVINKRPSTGLLANMWEFPNAELGEGIRNQ
FT                   KEQLIDYMKEKFELEVSIDEYAMNVQHTFTHRTWDIFVFYGKVTGNIVDTDTLKFVSKE
FT                   VFEQLPFSKSHRTIYENCVEKITMQ"
FT   gene            complement(512201..512407)
FT                   /locus_tag="BMB171_C0446"
FT   CDS_pept        complement(512201..512407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05264"
FT                   /protein_id="ADH05264.1"
FT                   /translation="MTELTMISKNEWKEDELAYFHHSLQQVLPYLNVEGQSIYKEIVVE
FT                   IESRGGLQEGEASWTHGTKISYD"
FT   gene            512551..512832
FT                   /locus_tag="BMB171_C0447"
FT   CDS_pept        512551..512832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0447"
FT                   /product="small, acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05265"
FT                   /protein_id="ADH05265.1"
FT                   /translation="MSKKQQGYNKATSGASIQSTNASYGTEFATETNVQAVKQANAQSE
FT                   AKKAQASGAQSANASYGTEFATETDVHAVKKQNAKSAAKQSQSSSSNQ"
FT   gene            513021..513281
FT                   /locus_tag="BMB171_C0448"
FT   CDS_pept        513021..513281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05266"
FT                   /protein_id="ADH05266.1"
FT                   /translation="MNDFDKLVGEQLETMDELLKLQAHLEKYQQIEMNEKDTCDKKELH
FT                   FIRQEIYRTEVALKMLHEKFEEQTNSVIQSFATEKMISNLG"
FT   gene            513556..514086
FT                   /locus_tag="BMB171_C0449"
FT   CDS_pept        513556..514086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05267"
FT                   /protein_id="ADH05267.1"
FT                   /translation="MGFPKEGEKVQIHSYKHNGSIHRMWEETTILKGTQSLVIGANDRT
FT                   VVTESDGRTWITREPAICYFHANYWFNVIGMLREDGVYYYCNLSSPFAYDPEALKYIDY
FT                   DLDIKVYPDMTYTLLDEDEYEKHSEIMQYPPVIDTILKRNVAHLTQWIHQRKGPFAPDF
FT                   VDMWYERYLMYRN"
FT   gene            514141..515901
FT                   /locus_tag="BMB171_C0450"
FT   CDS_pept        514141..515901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0450"
FT                   /product="multidrug ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05268"
FT                   /protein_id="ADH05268.1"
FT                   /translation="MQGIKRYLQFVKPYRWLIAITIIIGLVKFGIPLIMPWLLKYIIDD
FT                   VIQGAGSLQDKTSQLITAIGIAFFIFAVLRPPIEYYRQYFAQRIANTILYDLRKHIFGH
FT                   LQKLSLRYYSNTKTGEIISRVIHDVEQTKDFVITGLMNVWLDTATIAIAIIVMFSMNIK
FT                   LTFVALLILPIYVIAVKYFFGRLRKLTKERSQALATMQGYLHERIQGMQVTRSFALEEY
FT                   EGKQFEKRNNEFLTKALTHTSWTARTFSAVNTLTDLGPLLVIGFAAYEVIQGQLTLGTM
FT                   VAFVGYMDSLYSPLRRLVNSSTTLTQSFASMDRVFELLDEKYDIVNVPNAVQTKKLNGE
FT                   IVFDNVSFRYNVDEKEILHNLSLTMQPGEKVALVGASGGGKSSLASLIPRFYDVSEGTV
FT                   YVDGIDVRKYNMRNLRSHIGIVLQDNLLFSDTIGANILYGNPKATEKEVIAAAKAAQIH
FT                   DFIIDLPDSYNTVVGERGVKLSGGQRQRVAIARVFLKNPSVLILDEATSALDLENERYI
FT                   QEALQTLAADRTTIIIAHRLATITHVDTIIYIEDGEIKETGSHEELMQKRGFYYNLYQL
FT                   QHITETAPLA"
FT   gene            complement(515916..517061)
FT                   /locus_tag="BMB171_C0451"
FT   CDS_pept        complement(515916..517061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0451"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05269"
FT                   /protein_id="ADH05269.1"
FT                   /translation="MYSIMLYIHYDKRKDLIKGMKLGARILKTGIAITLALFACILLQL
FT                   PSPVFAGISAIFAVQPSVYRSYLTALEQIQANVIGAIFAIAFATAFGHNPFIIGLTCIL
FT                   VIALTLQLRLENTISIALVTVIAIMEYQGEDFFSFALLRFATIMIGIIAASLVNLVFMP
FT                   PKYETKLYHRIVDNTEEIVKWIRMNSRQASDFTTLKTDIDRMKEKMIKLNHYYLLYKEE
FT                   RSYTKKVKFAKIRKLVLFRQMLATTSRALSTLKSLHRTENELRYMPEEFQESIQNELDS
FT                   LTHYHEQVLLKFIGKAKKQQSVEMLDEVETGKQELIDIFMEYQNKDDEEAYKTWLHLFP
FT                   LISSIINYSEEVEHLDLLVDSFYTYHKPEKELQIDDKKEDE"
FT   gene            complement(517361..521797)
FT                   /locus_tag="BMB171_C0452"
FT   CDS_pept        complement(517361..521797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0452"
FT                   /product="glutamate synthase [NADPH] large chain"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05270"
FT                   /protein_id="ADH05270.1"
FT                   /translation="MLNKKNTWTPSLFRDYRNAEHDACGIVSVMEKRKIATKENIDLCI
FT                   QSLVKMNHRAGFINGEGDGIGIHIDIPKTLWNEKLKSSGYNPTIVDHPHFIVGHFFLNK
FT                   KENITALKDYIRTQLNNKNFTIIFESDDATNSDALGPLGKQEEPLFWQVALIAENEIIN
FT                   IEQTLFSVTIKIEENEAIHVASLSHDHVVYKVLGAGDTLVAYYNDLQHPLIASTMTLGH
FT                   NRYSTNTLSNFFRVQPFSILGHNGEINTIAKLRDQAEMIDVPLTAGGSDSQDLNRTLET
FT                   LLVQYGYSLFEAMEILFPPIINEIKLYETPLQDLYTYIREAWGHFAQGPAGIISRFKDE
FT                   AVFSVDSLGLRPVWKVETESSYIFSSEPGVVSPTKYVAEPKPLAPGEKVGLKWNEQDEL
FT                   VLYEYDKYQIQVYNRFKKRIDTTNYHLNLSIPETKKIQGLCDSVQVETKQYVAFGWDRE
FT                   HIQLLEQMATKGVEPIRSLGHDSPLAALDTDRRNIADFIKESVAVVTNPAIDRDREIEH
FT                   FSTRTVLGERPSLLSGAKRPFVVEMLSPIILEGSVAQPIAEELHTITYEQLIELFKTHN
FT                   SIATISATFSSSETLQCALSRISSEAIAAVNNGASLLVLDDAKAHLNERLWIDPHLVTA
FT                   KVHQALSENKLRRNCSLVIRSGALRSLHDIVTLYGLGADGINPYLLFATVNDGTKTPIT
FT                   NLYNALNKGLEKVISTIGIHELRGYGRLYSSIGLHEEIANILQITNFFGSNDLAFSLES
FT                   LVEDAKIRAEDYNNPKIRMRKSFHIFPRIWKAIGDVAKGNSYDDYRDKLSELEENNPIA
FT                   IRHLVQTKQTKHVVPTEEVSIGIKNHNLPFIISSMSFGSQNEIAFRAYAEAADQLNMIS
FT                   LNGEGGEIKDMIGKYPHTRGQQVASGRFGVNAELLNSSNLIEIKIGQGAKPGEGGHLPG
FT                   SKVTAKIAEARNATIGSDLISPSNNHDIYSIEDLAQMITEIKTANQLAKVAVKVPVVPN
FT                   IGTIAVGIAKAGADFINISGFDGGTGAARIHALQHVGLPVEIGVKAAHNALLEASMRHK
FT                   VEIWADGGIRSVNDALKIMLLGANRIGFGTLSMIAIGCTTCRGCHLDTCHVGIATQIES
FT                   EAQAKEHGLRRFVPRELESAVAGLLNLFTSFGVELKRLTGQLGYTNLQAIVGRSDLLEQ
FT                   VRGENLLNLRNLLQIIEHPSVTTTEGVPEKQFKTVHSADSKELVGVGVEQRVMGGLESC
FT                   YRVRSKLYEATQLEPLTLKYTNGSIPGNGLGAYNSENLFIHVNGGAQDGIGKTSFGGGI
FT                   YITKSKGKDGVYYNGSVGKGFGYGAQKGALYVQGNADARAGIRLSGADMIIGGRITKPL
FT                   REKEQGNIGAYSNIKGFAFEYMTNGRALVLGDPGPWICAGMTGGVVYLRRDSNLGLTEQ
FT                   ALKRRIAKGANVTLQPISKNGLKDVTELLLDYIRVLNEHEQYEEVALLTPLLDDIQNKF
FT                   FEIIPKKEQADPSISTE"
FT   gene            complement(521996..523294)
FT                   /gene="hemL1"
FT                   /locus_tag="BMB171_C0453"
FT   CDS_pept        complement(521996..523294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL1"
FT                   /locus_tag="BMB171_C0453"
FT                   /product="glutamate-1-semialdehyde aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05271"
FT                   /protein_id="ADH05271.1"
FT                   /translation="MNFTKSEALHKEALEHIVGGVNSPSRSFKAVGGGAPVAMERGKGA
FT                   YFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKE
FT                   AMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTL
FT                   GTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGF
FT                   LEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGG
FT                   KKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQQEGLYEKLDELGAMLEKGILE
FT                   QAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSK
FT                   YEAWFLTTEHTKEDIEYTIEAVGRAFAALADNK"
FT   gene            523422..524435
FT                   /locus_tag="BMB171_C0454"
FT   CDS_pept        523422..524435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0454"
FT                   /product="daunorubicin resistance ATP-binding protein drrA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05272"
FT                   /protein_id="ADH05272.1"
FT                   /translation="MKSVIEVQGLRKEFTAYSSRPGLKGAFRDLLNRNYKIVPAVNDVS
FT                   FTVKQGEMVGYIGENGAGKSTTIKMLTGILTPTSGQITVNGMNPHKQREEFVRTIGVVF
FT                   GQRSQLWWDIAVQESFRLLKKVYGVSDAQYKEHMEHVIETLDIGPLLDKPVRKLSLGQR
FT                   MRCELAAALIHNPPLLFLDEPTIGLDVLVKLKIREFLKEMNERYKTTILLTTHDITDIE
FT                   ALCERVIMLDEGNIMYDGSLNNLRTQWGAEKEIHFQFVAPVSYQALSMVMPDNHVVWSK
FT                   AKEENAWVAKIPNEEVIISMLISKVVQAFQIKDLKINEVSTEEIIRNIYEEGITHG"
FT   gene            524428..525219
FT                   /locus_tag="BMB171_C0455"
FT   CDS_pept        524428..525219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0455"
FT                   /product="daunorubicin resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05273"
FT                   /protein_id="ADH05273.1"
FT                   /translation="MGKYIEMIRIRFLMMLAYRTNYYSGILIYTINIGAYYFLWQAIYS
FT                   GKENIESLSISQMTTYIAIAWMARAFYFNNIDREIAMEIQEGRVAVELIRPYNYLGMKV
FT                   MQGLGEGIFRFAFFSIPGMVIVTLLFSLQITTNFQTWLYFFLSLIFSFIINTQINLMTG
FT                   MLTFFLFNNSGIMYAKRVVIDLFSGLLLPISFYPLWAQKAMMFLPFQAISYIPSMIFSE
FT                   GIQGSKLYEALVFQVIWAIVLIIPIVLMWRTARKRLIVQGG"
FT   gene            525224..526009
FT                   /locus_tag="BMB171_C0456"
FT   CDS_pept        525224..526009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0456"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05274"
FT                   /protein_id="ADH05274.1"
FT                   /translation="MLYINLFLQYASQYIKTKLEYRGDFIVGLLSDLSLQAVNLIFILV
FT                   VFGHTQALKGWSREEVIFIYGFFLVPFAIFSAFFNIWDFNDRYIIKGEMDRVLTRPIHS
FT                   LFQIILERMELESLIGAITGIVVMGYAAVELQLSFYWYDFFLFILMVGGGALVYGGIFV
FT                   TLASLGFWSDAKSSIMPLMYNIGNYGRYPVNIYNRVIRFILTFVLPFAFVGVYPAAYFL
FT                   RKTEWNSYAFATPIVGVICFTIAITLWNQGVKRYRGAGN"
FT   gene            complement(526315..526494)
FT                   /locus_tag="BMB171_C0457"
FT   CDS_pept        complement(526315..526494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0457"
FT                   /product="hypothetical protein protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05275"
FT                   /protein_id="ADH05275.1"
FT                   /translation="MLPYFSLSITDLITKAKGSVYPISASAIAIHRPIPIGDMSPYPTD
FT                   NKVTALKYKQTSTS"
FT   gene            526531..526986
FT                   /gene="bcP"
FT                   /locus_tag="BMB171_C0458"
FT   CDS_pept        526531..526986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcP"
FT                   /locus_tag="BMB171_C0458"
FT                   /product="thioredoxin-dependent thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05276"
FT                   /protein_id="ADH05276.1"
FT                   /translation="MITVGEMAPEFTLEGSNGEEVRLADFRGKNVVLYFYPKDMTPGCT
FT                   TEACDFRDAYGVFQEKDTVILGVSPDSANRHLKFIEKHELPFTLLVDEDHKVAELYDVW
FT                   KLKKNFGKEYMGIERSTFLINKDGELVKEWRKVKVKGHIEDVLSYIK"
FT   gene            527287..527715
FT                   /locus_tag="BMB171_C0459"
FT   CDS_pept        527287..527715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0459"
FT                   /product="peroxide operon regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05277"
FT                   /protein_id="ADH05277.1"
FT                   /translation="MVKEELKEALEMLKNTGVRITPQRHAILEYLVESMTHPTADDIYK
FT                   ALEGKFPNMSVATVYNNLRVFKEVGLVKELTYGDASSRFDYVTSQHYHVICEKCGKIVD
FT                   FPYGGLEKLEEEAAKTTGFVINSHRLEIYGVCPECHKA"
FT   gene            complement(528412..528768)
FT                   /locus_tag="BMB171_C0460"
FT   CDS_pept        complement(528412..528768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05278"
FT                   /protein_id="ADH05278.1"
FT                   /translation="MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMM
FT                   VGFLAVIASTVVYFWIGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRDLEG
FT                   KEFDEKYNKKSYKS"
FT   gene            529176..530715
FT                   /gene="rrf_12"
FT                   /locus_tag="BMB171_C5122"
FT   rRNA            529176..530715
FT                   /gene="rrf_12"
FT                   /locus_tag="BMB171_C5122"
FT                   /product="16S ribosomal RNA"
FT   gene            531320..534239
FT                   /gene="rrl_12"
FT                   /locus_tag="BMB171_C5123"
FT   rRNA            531320..534239
FT                   /gene="rrl_12"
FT                   /locus_tag="BMB171_C5123"
FT                   /product="23S ribosomal RNA"
FT   gene            534332..534447
FT                   /gene="rrs_12"
FT                   /locus_tag="BMB171_C5124"
FT   rRNA            534332..534447
FT                   /gene="rrs_12"
FT                   /locus_tag="BMB171_C5124"
FT                   /product="5S ribosomal RNA"
FT   gene            534455..534529
FT                   /locus_tag="BMB171_C5166"
FT   tRNA            534455..534529
FT                   /locus_tag="BMB171_C5166"
FT                   /product="tRNA-Asn"
FT   gene            534532..534623
FT                   /locus_tag="BMB171_C5167"
FT   tRNA            534532..534623
FT                   /locus_tag="BMB171_C5167"
FT                   /product="tRNA-Ser"
FT   gene            534641..534715
FT                   /locus_tag="BMB171_C5168"
FT   tRNA            534641..534715
FT                   /locus_tag="BMB171_C5168"
FT                   /product="tRNA-Glu"
FT   gene            534720..534795
FT                   /locus_tag="BMB171_C5169"
FT   tRNA            534720..534795
FT                   /locus_tag="BMB171_C5169"
FT                   /product="tRNA-Val"
FT   gene            534822..534898
FT                   /locus_tag="BMB171_C5170"
FT   tRNA            534822..534898
FT                   /locus_tag="BMB171_C5170"
FT                   /product="tRNA-Met"
FT   gene            534902..534977
FT                   /locus_tag="BMB171_C5171"
FT   tRNA            534902..534977
FT                   /locus_tag="BMB171_C5171"
FT                   /product="tRNA-Asp"
FT   gene            534987..535062
FT                   /locus_tag="BMB171_C5172"
FT   tRNA            534987..535062
FT                   /locus_tag="BMB171_C5172"
FT                   /product="tRNA-Phe"
FT   gene            535081..535156
FT                   /locus_tag="BMB171_C5173"
FT   tRNA            535081..535156
FT                   /locus_tag="BMB171_C5173"
FT                   /product="tRNA-Thr"
FT   gene            535167..535250
FT                   /locus_tag="BMB171_C5174"
FT   tRNA            535167..535250
FT                   /locus_tag="BMB171_C5174"
FT                   /product="tRNA-Tyr"
FT   gene            535258..535331
FT                   /locus_tag="BMB171_C5175"
FT   tRNA            535258..535331
FT                   /locus_tag="BMB171_C5175"
FT                   /product="tRNA-Trp"
FT   gene            535351..535426
FT                   /locus_tag="BMB171_C576"
FT   tRNA            535351..535426
FT                   /locus_tag="BMB171_C576"
FT                   /product="tRNA-His"
FT   gene            535490..535564
FT                   /locus_tag="BMB171_C577"
FT   tRNA            535490..535564
FT                   /locus_tag="BMB171_C577"
FT                   /product="tRNA-Gln"
FT   gene            535570..535644
FT                   /locus_tag="BMB171_C5178"
FT   tRNA            535570..535644
FT                   /locus_tag="BMB171_C5178"
FT                   /product="tRNA-Gly"
FT   gene            535659..535729
FT                   /locus_tag="BMB171_C5179"
FT   tRNA            535659..535729
FT                   /locus_tag="BMB171_C5179"
FT                   /product="tRNA-Cys"
FT   gene            535740..535824
FT                   /locus_tag="BMB171_C5180"
FT   tRNA            535740..535824
FT                   /locus_tag="BMB171_C5180"
FT                   /product="tRNA-Leu"
FT   gene            complement(536032..536166)
FT                   /locus_tag="BMB171_C0461"
FT   CDS_pept        complement(536032..536166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05279"
FT                   /protein_id="ADH05279.1"
FT                   /translation="MYKYNREEFEKKFLEITKLTADHVLISTGGVGFNFMSPGWRNSL"
FT   gene            536704..537423
FT                   /locus_tag="BMB171_C0462"
FT   CDS_pept        536704..537423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05280"
FT                   /protein_id="ADH05280.1"
FT                   /translation="MGRKWNNIKDKKASKDANTSRIYAKFGREIYVAAKQGEPDPESNQ
FT                   ALRVVLERAKTYNVPRTIIDRAVEKAKGGSEENYDELRYEGFGPNGAMVIVDTLTNNVN
FT                   RTAADVRAAFSKNSGNMGVNGSVAYMFDATAVIGLEGKTSDEVLEILMEADVDARDILE
FT                   EEDSVIVYAEPDQFHAVQSALKGAGVEEFTVAELTMLAQSDVTLPEDAQAQFEKMVDAL
FT                   EDLEDVQQVYHNVDLGE"
FT   gene            537570..538031
FT                   /locus_tag="BMB171_C0463"
FT   CDS_pept        537570..538031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0463"
FT                   /product="Mutator mutT protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05281"
FT                   /protein_id="ADH05281.1"
FT                   /translation="MEHKTPKHIVAVAGYLTNEKNEVLLTKVHWRADTWELPGGQVEEG
FT                   EALDQAVCREIKEETGLTVKPIGITGVYYNTSMHILAVVFKVAYISGEIKIQPEEIQEA
FT                   KFVDLNEENIDEYITRPHMKSRTLDAMRATHFIPYETWEVQPYNLIGRL"
FT   gene            538525..539301
FT                   /locus_tag="BMB171_C0464"
FT   CDS_pept        538525..539301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0464"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05282"
FT                   /protein_id="ADH05282.1"
FT                   /translation="MKERVLSRVNYHQKVALNPMTKLFYKAIILLLLLSCTLLFIGNVM
FT                   IEKSDISKLHVPAKLEVPESLTHAFIATEDKRFYHHNGLDYIAIIRASVENIKAGGVVQ
FT                   GGSTITQQLSKNAFLTNERTFSRKWKEIFYTKKIERTFTKDEILKLYVSNIYYGEGAWG
FT                   IEKAANLYFGKKVNQLTLAESAMMAAVVKAPAYYSPAQNYDKAVERRNVVLRLMEKEGY
FT                   ISHDEYVQAVSEKLVIRHDIKIEQSMLNSARKKAVS"
FT   gene            539489..540139
FT                   /locus_tag="BMB171_C0465"
FT   CDS_pept        539489..540139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0465"
FT                   /product="Thiol-disulfide oxidoreductase BdbD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05283"
FT                   /protein_id="ADH05283.1"
FT                   /translation="MKSNKLMALGIVFSIAVLIVIGTIAYSIINDKKDKGNEMFAYSTQ
FT                   QSLGKDDAPVKVVEFGDFKCPACRTWDVTVLPRLKEEYIDKGKVQLYFINFPFIGKDSD
FT                   LGAAAGEAIYKQDKDSFWIFYDEIYQNQKKDTEEWITEDLLLSIVKEKLPKVDVEQFKK
FT                   DLHSKDIKEKVSKDSDRAQKLKVQGAPSVYVNGNLANPDFDSMKKAIDKELKK"
FT   gene            540255..540328
FT                   /locus_tag="BMB171_C5181"
FT   tRNA            540255..540328
FT                   /locus_tag="BMB171_C5181"
FT                   /product="tRNA-Gly"
FT   gene            540528..541670
FT                   /locus_tag="BMB171_C0466"
FT   CDS_pept        540528..541670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0466"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05284"
FT                   /protein_id="ADH05284.1"
FT                   /translation="MDFEQLKQDVIAYSKTIGIDKIGFASASPFEELKQRLIQQQQLNY
FT                   QSGFEEPDIEKRTNPQLLLPGAKSIIAIALAYPSKLKNAPLSKRGERRGIFCRASWGQD
FT                   YHLVLRDRLQKLEAYLIEKLPDIEVKSMVDTGELSDRAVSERAGIGWSGKNCSIITPEF
FT                   GSYVYLGEMITNVPFPPDKPIEDQCGGCTKCIDICPTGALIQGGQLDSKKCIAFLTQTK
FT                   GFLPEEYRDKIGNRIYGCDTCQTVCPKNKGMDFHNHPEMEPDPELVKPLLTPLLTISNR
FT                   DFKEKYGIMSGSWRGKKPLQRNAILALAHFKEASAIPDLIGVMKDDPRPVLRGTAAWAL
FT                   GKIGGDGVGEAIEKAMEREKDEEVLHEMNRGLELLAQKKE"
FT   gene            541715..542602
FT                   /locus_tag="BMB171_C0467"
FT   CDS_pept        541715..542602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05285"
FT                   /protein_id="ADH05285.1"
FT                   /translation="MVVKTKIENQVQQFLAYITEKRTNVDGIAEDLLQMALRKKQLFQR
FT                   RSAHIVKATADVSFIRQLNSNDHQEIDYQIHFKYLIKHKELFYIEEEQLKRRVCLNNSR
FT                   IIGDSAIEVSEEIRMGETLERDITKEKYGSYQYNRLEAVKYAERWWDDRNPMYRNFPDN
FT                   CTNFISQCLHTGEVPMNGYPNIRKGWWQRENQWSWSWAVAHSFYWYLSGATTGLRAEAV
FT                   ERPEELILGDVIAYDFEDDGRWNHTTIVVAKDADGMPLVNAHSANSRRRYWNYEDSSKY
FT                   TPQMKYKFFHIING"
FT   gene            542661..543149
FT                   /locus_tag="BMB171_C0468"
FT   CDS_pept        542661..543149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0468"
FT                   /product="RNA methyltransferase, TrmH family,group 2"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05286"
FT                   /protein_id="ADH05286.1"
FT                   /translation="MGVHVVLYQPEIPANTGNIARTCAATGTELHLIRPLGFSTDDKML
FT                   KRAGLDYWQHVKITYYDSIEEFYEKNKDGEFFYLTKYGEKAHTAFDYSKREKDYYFVFG
FT                   RETNGLPANVIEENFDHCLRIPMTDKVRSLNLSNTAAILIYEAFRQQNYPGLDLEIVY"
FT   gene            543277..545346
FT                   /locus_tag="BMB171_C0469"
FT   CDS_pept        543277..545346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0469"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05287"
FT                   /protein_id="ADH05287.1"
FT                   /translation="MKEEYSNQNTFLSMIDMDLIRQGLLHAIQDLVFILKVIDNETFQY
FT                   MYVNKIGMDYARLSEECYGKTFAEVLPKDIAGILQRQYAKVVREAKAHTFCDVVNLPKG
FT                   EIHYESSLNPVCDEEGICQFVICITRDITAQIEEKTKIEEKQMLFKSLLEYNNDSIISI
FT                   DSIGRVTYANPATYEIFGYRYEELNNKFIFEFINKEYEKDFQIIFKGSMQGKAKQIVSK
FT                   KYVHKEGYELYISLRTIPIIVNGEIVGIYIVTRDVTRQVLNEMRTEYLAYYDQLTGLMN
FT                   RISCTNKLNTFLNESVNFALVFIDLDEFHRINDTFGHKEGDKVLQKVTECLSNLKIEGM
FT                   HLFREHDDQFVMLIENITKEYVEEVAKSILKNISEYFVIEEEDVYLSASIGIVMAPADG
FT                   EDEKILFQRVDAALEKAKEKGKGHYHFYCSGLDCEREQRFIIENQLHRAIEKNEFFLYY
FT                   QPQINIETKKIASMEALIRWENKELGFVSPNQFIPLAERTGFIIKLDEWVVNQVCQQLR
FT                   EWLNKGYEVVPIAVNISARHFRSITLIEMITRALNKYNVSAHLLAIEVTEGALIHKDIS
FT                   KRVLLQLKEQNLKIHLDDFGTGYSSLSYLKTYPIDTLKIDRSFMEGIHIDERDTNITAA
FT                   IIHLAHTLELNIIAEGVEKKEQIQFLKEKNVKLVQGYYYSRPLSKYDMENMYYK"
FT   gene            545732..547627
FT                   /locus_tag="BMB171_C0470"
FT   CDS_pept        545732..547627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0470"
FT                   /product="Serine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05288"
FT                   /protein_id="ADH05288.1"
FT                   /translation="MDILKKIEQHRAAEERLQWEGTFAEYLELVKERPWVAQTAHSRIY
FT                   NMIKDAGIEEVDGRRKYNFFSNQLFGLEDALERLVEEYFHPSAKRLDVRKRILLLMGPV
FT                   SGGKSTLVTMLKRGLETYSRTDRGAIFAIKGCPMHEDPLHLIPHHLRDDFFDEYGVRIE
FT                   GNLSPLNVMRLEQEYGSRIEDVVVERIFFSEDRRTGIGTFSPSDPKSQDIADLTGSLDF
FT                   STIAEYGSESDPRAYRFDGELNKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAGRF
FT                   ALISADELIVAHTNETEYRSFIANKKNEALHSRIIVMPVPYNLRVSEEEHIYEKMIRES
FT                   DVSNVHIAPHTLRVAAMFTILTRLKDPKRPDIDLIKKMRLYDGETVEGYNAIDVEELQR
FT                   EYQDEGMKGIDPRYVINRISSTIIRKEVPSINALDVLRSLKDGLDQHPSISNEDRERYM
FT                   NFISLARKEYDEIAKKEVQKAFVYSYEESAKTLMDNYLDNVEAYCNKSKLRDPLTGEEM
FT                   SPDEKLMRSIEEQIGISENAKKAFREEILIRISAYARKGKRFDYNSHERLREAIQKKLF
FT                   ADLKDIVKITTSTKTPDENQLKKINDVVARLIDEHGYNSSSANELLRYVGSLLNR"
FT   gene            548081..549256
FT                   /gene="yhbH"
FT                   /locus_tag="BMB171_C0471"
FT   CDS_pept        548081..549256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbH"
FT                   /locus_tag="BMB171_C0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05289"
FT                   /protein_id="ADH05289.1"
FT                   /translation="MGEENQPNYTISQENWSLHRKGYDDQQRHQEKVQEAIKNNLPDLV
FT                   TEESIVMSNGKDVVKIPIRSLDEYKIRYNYDKNKHVGQGNGDSKVGDVVARDGSGGQKQ
FT                   KGPGKGQGAGDAAGEDYYEAEVSILELEQAFFRELELPNLKRKEMDENRIEHVEFNDIR
FT                   KTGLWGNIDKKRTMISAYKRNAMGGKASFHPIHQEDLKFRTWNEVLKPDSKAVVLAMMD
FT                   TSGSMGIWEKYMARSFFFWMTRFLRTKYETVDIEFIAHHTEAKVVTEEEFFSKGESGGT
FT                   ICSSVYKKALELIDNKYSPDRYNIYPFHFSDGDNLTSDNARCVKLVEELMKKCNMFGYG
FT                   EVNQYNRHSTLMSAYKNIKDENFRYYILKQKADVFHAMKSFFREESGEKMA"
FT   gene            549385..552300
FT                   /locus_tag="BMB171_C0472"
FT   CDS_pept        549385..552300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0472"
FT                   /product="internalin protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05290"
FT                   /protein_id="ADH05290.1"
FT                   /translation="MKQNKRKRINAMIIAAALSLPFAVYSTPALAAVAIEANKTGQGLE
FT                   DGTYDAVIKAYKDKTNEESMAAVYIKDPKLTIENGKKIVTATLSDSDFFQYLKTEDIHT
FT                   PGVFHDVKVISEDKKKNGTKVIQFEVGELGKRYNMRMHIYIPTMAYDNKYQVQFEVNTL
FT                   NLDKDVPEAQKENKEDKVDQQDANVIVDKQLQKYINKYNLNRDNVDAPITKKDLLQIKT
FT                   LSIYSGKEINKITGLEYMTNLEKLTLRESNVKDISAISKLRGLKYVDLTSNSIESIHPI
FT                   EQLENINMLFLRDNKISDLTPLSKMKKIKTLDLIGNNIKDIQPLFTLSTMKQLYLANNQ
FT                   ISDLTGIDRLNNVELLWIGNNKINNVESISKMSNLIELEISDSEIKDISPLSQLGNLQV
FT                   LNLEENYISDISPLSTLTNLHEINLGANEIFDVRPVEELGKRISIDIQRQKIFLNEASV
FT                   DEEIKIPVYNLKGEPLQNINLQSEGATLNNGFIKWNSPGEKIYEFKLDTNSTESKIRFN
FT                   GTVIQNIVEKQKESQNVILDKTLQQHINKENLGRENVNAPITKEDLLQIKKLEILKEKG
FT                   NEIKDITGLEYMTNLEKLTLEGVGLKNIEFISNLKQLNNVNVSHNQIEDITPLSSLENL
FT                   QWLNLADNHIKDVTVIGSMLNLFSLNLAGNEIRDVRPLIQLGQWFTIDVGRQNIILNDS
FT                   KINEEIQIPVYDLEGESIENIQLVSEGGTFNNGVIKWSTPGEKVYKFDLDSDEISIRFN
FT                   GTVIQNIVEKEEEKEPVKEIEETKEEEKEPVKEIEETKEEVKEPVKEVEEAKEEVKEPT
FT                   KEVEEVKEEVKEPTKEVEETKEEEKEPVKEVEETKEEVKEPVKEVKEEVKEPTKEVEEA
FT                   KEEVDEPTTGVEGSKAEVKETGKEIEGSKDTVNQSAVVQEQNVNNQVVKENKPAVNKQE
FT                   ESKKSLGATGGQENTSTLLSGIALVLSALSMFVFRKRLFKK"
FT   gene            552457..553320
FT                   /locus_tag="BMB171_C0473"
FT   CDS_pept        552457..553320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0473"
FT                   /product="2''-aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05291"
FT                   /protein_id="ADH05291.1"
FT                   /translation="MYVSSILKIEEVAAFIANMNKDATHHVGYCGDEKEELLQTIIHDF
FT                   SDIGWEQSFVATYENNNLIGLLGFDVDEVKKCAEIWGPFIIAENWEEVALHMWKELIEK
FT                   VPFHIERFYGFYHVENNNYARLMRNLHAKEQGRHSILVLNNIVEHRIICNVEEALPQVF
FT                   EQFIALHNHVFSNTYYDGNEIIERLSNTNKLFVSMKNDKLEGYVYVEVNPEFQEANIEF
FT                   IATAENSRRKGVGERLLQKAIQYIISFQGMKEIELCLNTNNDRAMKLYKKVGFEEKACL
FT                   QHYIIE"
FT   gene            complement(553422..554972)
FT                   /gene="opuD1"
FT                   /locus_tag="BMB171_C0474"
FT   CDS_pept        complement(553422..554972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opuD1"
FT                   /locus_tag="BMB171_C0474"
FT                   /product="glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05292"
FT                   /protein_id="ADH05292.1"
FT                   /translation="MIKKENSVFYISFLLTTLFIIWGITPASWIQGYDLQSVTSSLNSF
FT                   ILNKFGWFYSLLMTTMIILAAYLAFSKYGSIRLGKDGEKPKYNYPSWLSMLFGAGMGIG
FT                   LLFYGIAEPISHFTDPLTGKAGTEESAKLAMQYSFFHWGLFPWSLYAMVALTIAYFTFR
FT                   KQKGSTIGATVTPLFNRSKNSRIGKTVDILAVLATVFGIVPSVGIGAQQIAGGLSYLFP
FT                   SIHNTLLTQLVLIAIFAVLYLTSAQTGLDRGIKYLSNLNFSLAGILLISFLLLGPTVFI
FT                   MKYFTSTLGSYIGALPSMGLNLGAFSEKSSSWIENWTIFYWGWWISWSPFVGTFIARIS
FT                   KGRTIKEFIFGVVLVPTLICTFWFAVFGGTAIHMEMFQSLGIADEIAKNGTEIGLFAVI
FT                   SHLPFSTFLTIIGLILVATFFVTSADSATFVVSMQTSNGSLSPKNSLKLIWGLTIAIIA
FT                   AILLQAGGLNALQIAAIIAALPFSIVVVLMVTSLFKELKKEDVNSQTKEIPKKIKKVM"
FT   gene            555219..558116
FT                   /locus_tag="BMB171_C0475"
FT   CDS_pept        555219..558116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0475"
FT                   /product="collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05293"
FT                   /protein_id="ADH05293.1"
FT                   /translation="MNKKSKINKVMLSISTMALSLGALQTHAAAEEKVPYNVLKTKPVG
FT                   IEKSVDEVGHISKVDETLSFQERLKVGDFSQRPASITKKTAVKQVKESYSMADLNKMND
FT                   QELVETLGSIKWHQITDLFQFNEDAKAFYKDKGKMQVIIDELAHRGSTFTKDDSKGIQT
FT                   FTEVLRSAFYLAFYNSELSDLNERSFQDKCLPALKAIAKNPNFKLGTVEQDTVVSAYGK
FT                   LISNASSDVETVQYASNILKQYNDNYTTYVNDRMKGQAIYDIMQGIDYDIQSYLTEARK
FT                   EANETMWYGKVDGFINEINRIALLNEVTSENKWLVNNGIYFASRLGKFHSNPNKGLEVV
FT                   TQAMHMYPRLSEPYFVAVEQITTNYNGKDYSGNTVDLEKIRKEGKEQYLPKTYTFDDGS
FT                   IVFKTGDKVSEEKIKRLYWAAKEVKAQYHRVIGNDKALEPGNADDVLTIVIYNSPDEYQ
FT                   LNRQLYGYETNNGGIYIEETGTFFTYERTPEQSIYSLEELFRHEFTHYLQGRYEVPGLF
FT                   GRGDMYQNERLTWFQEGNAEFFAGSTRTNNVVPRKSIISGLSSDPASRYTAERTLFAKY
FT                   GSWDFYNYSFALQSYLYTHQFETFDKIQDLIRANDVKNYDAYRENLSKDPKLNKEYQEY
FT                   MQQLIDNQDKYNVPEVADDYLAEHAPKSLTEVKKEISDTLPMNDTKMTKHNSQFFNTFT
FT                   LEGTYTGSVTKGESEDWKAMSKRVNESLEQLAQKEWSGYKTVTAYFVNYRVNSSNEFEY
FT                   DVVFHGIAKDDGENKAPTVNINGPYSGLVKEGIQFKSDGSNDEDGKIVSYLWEFGDGST
FT                   SAEVNPVHVYEREGSYKVSLRVKDDKGKESRSETTVTIKDGSLTESEPNNRPEEANRIG
FT                   LNSTIKGSLIGGDHTDVYTFNVASAKDIDISVLNEYGIGMTWVLHHESDMQNYAAYGQA
FT                   NGNHIEAKFNAKPGKYYLYVYKYDNGDGTYELSVK"
FT   gene            558363..558911
FT                   /locus_tag="BMB171_C0476"
FT   CDS_pept        558363..558911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05294"
FT                   /protein_id="ADH05294.1"
FT                   /translation="MVLFGYPLETIYLYGFIIATILTVIYIFFGDIFESIFSFGGGSVS
FT                   VVTLLLSFFAMLCGLSYIGEYLFSFNSITIFGAAFAISFIGVFIMKILILKPIAEAEQN
FT                   TVQRMDEFIGCKGEVITTIPTEGFGEVLILSQFGSNAIPAKTVGKKDISQGTEVIIEGV
FT                   QDGVLLVQNIAYSLKKPKL"
FT   gene            558924..560498
FT                   /locus_tag="BMB171_C0477"
FT   CDS_pept        558924..560498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0477"
FT                   /product="Flottilin"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05295"
FT                   /protein_id="ADH05295.1"
FT                   /translation="MTIPLIIGGVLLAILILLILVFITKYRTVGPDEALIVTGNWLGGG
FT                   KNVVTTDDGKKIKIIRGGGTFVVPIMQRAEPLSLLNYKLEVGTRDTYTKQGVPVTVNGV
FT                   SIIKVGSTIEEVSTAAEQYLGKETEELKVEAKEVLEGHLRAILSSMTVEDAYSNREQFA
FT                   QKVHEVASTDLKKMGLRIVSFTIKEIMDKNGYLDALGQPQIATVKRDATIANAEREKEA
FT                   RIEKARAEKEAKEAEYQRDAQIAEAEKHKELKVQSYKREQEQARADADLSYELQQAKAQ
FT                   QGVTEEQMRVKIIEREKQIELEEKEIARREKQYDAEVKKKADADRYAVEQSAEAEKVKQ
FT                   IKKADADQYKIEAEARARAEEVRVEGLAKAEIEKAQGQAKAEVQKAQGTAEADVIRLKG
FT                   LAEAEAKQKIAEAFELYGQAAIMDMVLKMLPSYAKELASPLSNIDKITVVDTGGGGKNS
FT                   GAGKVAGYATDLMATMQETLKASSGIDLKELLEGFAGKGAVQQLSSDKPVVSVVEDEKK
FT                   EVEKDKE"
FT   gene            560747..562723
FT                   /locus_tag="BMB171_C0478"
FT   CDS_pept        560747..562723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0478"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05296"
FT                   /protein_id="ADH05296.1"
FT                   /translation="MFQGKLRSSSLKTKLLVSFIIILILPSIVIGWTSYQQAKTNFNET
FT                   ILNSAKDNIKILDNVINKELDSKKVDATYFTKLFTQSSYHADQIQNIQNKLEEYNKLHP
FT                   EMEAIYTGSGNGQFIQSPAIQMPDGYNPTERDWYKEAVKKSGEVIVTAPYKSKTTGNIV
FT                   ITLAKQNEDKSGVLGIDLIINNIVTTSKMVNIGKEGYVAIFDQDKNVVAHPKMKPGEKL
FT                   EEKLSKELYKQEAGDFHYSLDGEDRNITFKTNKKTGWKIAGIMPSKEIIEAAEPIFYKT
FT                   VTVLGISLIIGGIVIYFIIASIIKPLKQLVISSKKISEGDLTESITVHSKDEIGQLGES
FT                   FNEMAASLQSVISNINTSASHVAASSEELTASMKQTSEATEQITQAIEQVSSGAEIQTK
FT                   EVEEGATLLEEVTEGIQRVADSSSLVSTASMYTKKKAENGGKLVEQTVNQMQLIHESVS
FT                   QSDKIIGLLDDKSKQIGAILEVIQHIAEQTNLLALNAAIEAARAGEQGRGFAIVADEVR
FT                   KLAEQSGQSSTEIGKLVKEIQFDIKETVSSMNQVGAEVQSGLVVANETKQSFAEILKST
FT                   NDTVVQIDSMVDVAKQMTVDAKQVSASINEIAATIEENAASVQNIAGSSEEQLASVDEI
FT                   NAAAVHLSQMAEELQEMISKFKV"
FT   gene            563211..564482
FT                   /locus_tag="BMB171_C0479"
FT   CDS_pept        563211..564482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0479"
FT                   /product="two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05297"
FT                   /protein_id="ADH05297.1"
FT                   /translation="MVGGDNKGVLLEGKSYVSKATGSLGPSLRGKVPIRNQENEIIGVV
FT                   SVGFSMADIHGAVEVYGKRVFWITIIGLLIGVIGSIYLAASIKRMMFGMEPEEISSLYE
FT                   EHSTVIQSVREGIIVIDKNGMISLVNQAAYDILSLDKQQNIIGEFILNVIPNSTILDVL
FT                   QTGEEQFDRQLNIKGQAVIANRLPIKVKNKVTGVVSSLRLKSEMDQLTAELSQTKQYTE
FT                   ALRAQAHEYNNLLYTLSGLIQLESYEDALELIHKETAVYQDFVQFIMKRIQNPWLGGIL
FT                   IGFYNRARELKIDFMLDRESGLEKLSPHIESNYVVSILGNLITNAFEAIEKNEENDKKV
FT                   RMFVTDIGEEILIEVEDSGQGIHDEIITSIFYKGFSTKEGGERGYGLAKVKELVEDLNG
FT                   SIAIEKGDLGGALFIIALPKERGE"
FT   gene            564485..565177
FT                   /locus_tag="BMB171_C0480"
FT   CDS_pept        564485..565177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0480"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05298"
FT                   /protein_id="ADH05298.1"
FT                   /translation="MGEEIEVLIVEDDIRIADIHRRFTEKIEGFKVIGTATTGEQAKEW
FT                   LELVKPQLVLLDVYLPDMQGTELVTYIRHHLHDTDIIMITAASETDVVRHALRGGVTDY
FT                   IVKPLMFDRFKASLEGYQKKIIQLKKNNQLSTEQIEYLWSQRGVKGDQIEYAPKGIDPL
FT                   TLAKIKKHMLTVNEEGITAEVLSSMVGVSRSTARRYLEYLISGKKVHAELIYGSVGRPE
FT                   RRYFLVSS"
FT   gene            complement(565225..566529)
FT                   /locus_tag="BMB171_C0481"
FT   CDS_pept        complement(565225..566529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0481"
FT                   /product="Ca2+/citrate complex secondary transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05299"
FT                   /protein_id="ADH05299.1"
FT                   /translation="MLALLGFAMVFVFMFLIMTKRMSALVALILIPSVFALIGGFYADM
FT                   GPMMLEGIQKLAPTGIMLMFAILYFGIMIDSGLFDPVISKILKFVKGDPLKIVVGTAIL
FT                   TIIVSLDGDGTTTYMITVSAMYPLYKRLGMNPLILAGVVMLGAGVTNLTPWGGPTARVM
FT                   SALGLEASELFTPLIPGMIAGAIWVVFVAYYLGKKERKRLGIMDVQYLKQMQTMDEQAA
FT                   TVEAAVHKRPKLLWINFLLTATLLVCLILEVMPLPVLFTVAFAIAVMINYPNLEQQKER
FT                   IASHAGNVLAVVSLVFAAGIFTGILSGTKMVDAMANSVVTLIPDALGPQLPIITALLSM
FT                   PFTFFMSNDAFYFGVLPILTKAAATYGISAAEMGRASLLGQPVHLLSPLVASTYLLVGM
FT                   AKVDFGEHQRFTLLWAVGTTMVMLITGIVIGIIPI"
FT   gene            566784..567038
FT                   /locus_tag="BMB171_C0482"
FT   CDS_pept        566784..567038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05300"
FT                   /protein_id="ADH05300.1"
FT                   /translation="MKTRIEEIYSSYEGKVEEIFINESSYVYEWEKLLMIRKNDGELKK
FT                   IAVGISGNIRLVNVEVGQEISADTLLVKLEDDLLITGCE"
FT   gene            567174..567677
FT                   /locus_tag="BMB171_C0483"
FT   CDS_pept        567174..567677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0483"
FT                   /product="lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05301"
FT                   /protein_id="ADH05301.1"
FT                   /translation="MKVKYVVLAICLCFVFTVVGCGKKETAAVAIDEKHDKCDICQIGV
FT                   TDNQFATEIILENGKALKFDDIGCMYKWMEINSDEKTKEKFVRDYDSKDWISLEDATYV
FT                   YDKTITTPMAYNVISFKNKKDAESFVSNYKGKVLSYKELAEHKWEMNKEMMGKPKAGNH
FT                   GGHH"
FT   gene            568084..568833
FT                   /locus_tag="BMB171_C0484"
FT   CDS_pept        568084..568833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0484"
FT                   /product="ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05302"
FT                   /protein_id="ADH05302.1"
FT                   /translation="MTVVACDKQEEPESKPVHVKNEKKKEKHKEQEESKEEKSINLMDK
FT                   QLLLSATLGDTETAMKLIQDGANINVEGDNGETPVLAATYQNHVETVKALIGAGANIEI
FT                   KDEKKSNPLLYASREGYTDIVKVLINAGVNTKETTRSGGTALISASERGHVEVVKELLE
FT                   HTDIDVNYKNERGGTALLEAIVLGNGSENHKKVIQLLIDHGADVNMANKEHLTPLQYAE
FT                   KRGFKDIVNMLRVAGANEVVQPQQPVE"
FT   gene            568988..569251
FT                   /locus_tag="BMB171_C0485"
FT   CDS_pept        568988..569251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05303"
FT                   /protein_id="ADH05303.1"
FT                   /translation="MAIVKNEKVVSVCCSARSTPVAAEASVETLAEFQGNGYGTDVVTA
FT                   WAISIQEKRRIPLYSTAWDNFSLQAVASKLKIINYGMNLHID"
FT   gene            569560..570126
FT                   /locus_tag="BMB171_C0486"
FT   CDS_pept        569560..570126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0486"
FT                   /product="glycerol uptake operon antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05304"
FT                   /protein_id="ADH05304.1"
FT                   /translation="MFKEPYIAMIKDWKGYKAYKKLPKTVFLMTGSMLELPERVYELQK
FT                   HGHDVFLHCDFIQGLNTNTEEALLYIQDVIGAQGIISTKGSTIRNANKIGLKTIQRIFI
FT                   VDTLSLTKSIENCKTTKPNAVEIMPGIMPSIIKQLVEEIEFPIIAGGLIQTREDAEIAI
FT                   RAGASAISTSHYEVWIQEEKRSATL"
FT   gene            570123..571220
FT                   /locus_tag="BMB171_C0487"
FT   CDS_pept        570123..571220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0487"
FT                   /product="SN-glycerol-3-phosphate transport ATP-binding
FT                   protein ugpC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05305"
FT                   /protein_id="ADH05305.1"
FT                   /translation="MIELKNVSKVYKNAEETAVKGISVHIKKGEFFVLVGPSGCGKSTL
FT                   LRMIAGLEEISSGDLIINERVANDLEPKDRNLSMVFQNYALYPHLSVEENILFGLKVRK
FT                   VQKEERQKRLMEAIEMVGLKEYVKMKPGQLSGGQRQRVALARAIVSQAPICLMDEPLSN
FT                   LDAKLRAQMRIEIREIQQRLGITMIYVTHDQIEAMTMGDRIMVLNKGSIQQVGTPLNIY
FT                   NEPANEFVASFIGSPSMNINDGEVNKEKGVLHIGQLQIPLSIRQLKQLPEGTIRIGMRP
FT                   EHIALSEEGQEVTLQSVEVLGNESILNFAVNGTTWSAKVIGQLLLNKGDKVKLLFSQEK
FT                   LCFFNENTNERLKVVAEEELKVVAK"
FT   gene            571220..572152
FT                   /locus_tag="BMB171_C0488"
FT   CDS_pept        571220..572152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0488"
FT                   /product="SN-glycerol-3-phosphate transport system permease
FT                   protein ugpA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05306"
FT                   /protein_id="ADH05306.1"
FT                   /translation="MIEVSKLPVQTKVSKKKKLWERTKDLRIGLLFLAPSILLFSIFLF
FT                   YPLFRTIYYSFYLTDIHGEANLFVGLENYQYLFSDPAFYKSIKSTLLFVLYTVPTSIIF
FT                   ALFLALIANGKVRGIGLFRVLFSSTMGISVAASAVIWLFLFHPSVGLFNNILASMNLPA
FT                   IAWLTSPDWALFSVSVTTVWVNTGFAFLVILGGLQNIDTSLYESASIDGASYLYKLRRV
FT                   TLPMLSPTLFFIVTVTLISAFQSFGQIDILTHGGPNDATNLIVYSIYKEAFVNHQFGTA
FT                   SAQAMVLFVFIFVATLLQFKFAERKVHYK"
FT   gene            572149..572970
FT                   /locus_tag="BMB171_C0489"
FT   CDS_pept        572149..572970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0489"
FT                   /product="SN-glycerol-3-phosphate transport system permease
FT                   protein ugpE"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05307"
FT                   /protein_id="ADH05307.1"
FT                   /translation="MIVKQWKQNFLLYMLLIISAVMVFFPVLYAFLISFMTPDDIQMRR
FT                   LFPTQFTFDNFINIFQKVPLFTYLYNSLIVSTVVMIGQLIVSSLAAYAFVFLQFKGRNL
FT                   IFFLFISTMLIPWEATMVPNFLTIQNFGWINSFAGMTVPFFATAFGIFLLRQHFMTLPN
FT                   ELKEAAFIEGIGNIRFLFSVVIPYCKTSFITLGVYSFLTTWNMYLWPLLVTTDEKVRTV
FT                   QIGVKQLQSQEVATDWGSVMAGVTVIVIPTLILLFLGQKQLQQGLTKGAIK"
FT   gene            573025..574368
FT                   /locus_tag="BMB171_C0490"
FT   CDS_pept        573025..574368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0490"
FT                   /product="glycerol-3-phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05308"
FT                   /protein_id="ADH05308.1"
FT                   /translation="MVATMALSSAACSNSKTEGKPEVQAKVAPVEKNGDKTVIRFWHAM
FT                   GGKTQGVLDGLVADYNKSQNKYEIKAEFQGTYEESLTKFRTMSATKEAPALVQSSEITT
FT                   KYMIDSKKITPIDSWIKKDKYDTSKLEKAITNYYSVDGKMYSMPFNSSTPVLIYNKDAF
FT                   AKAGLDPEKAPKTYAELQEAAKKLTIKEGGNVKQYGFSMLNYGWFFEELLATQGALYVD
FT                   NENGRKDAAKKAVFNGKEGQKVFGMLDDLNKAGALGKYGASWDDIRAAFQSGQVAMYLD
FT                   SSAGVRDLIDASKFNVGVSYIPYPEDSKQNGVVIGGASLWMTNMVSEETQQGAWDFMKY
FT                   LTKPDVQAKWHTATGYFSINPDAYNEPLVKEQYEKYPQLKVTVDQLQATKQSPATQGAL
FT                   ISVFPESRDAVVKALEAMYDGKNSKEALDEAAKATDRAISISARTSQK"
FT   gene            574806..575510
FT                   /locus_tag="BMB171_C0491"
FT   CDS_pept        574806..575510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0491"
FT                   /product="Serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05309"
FT                   /protein_id="ADH05309.1"
FT                   /translation="MKRILVISDIHGEIEKFEHLLEEAQYDAKQDQLILLGDYVDRGPN
FT                   ARAVIEKVRELKKEGALILKGNHEDMMIKALTTNEERSWNHWVKRNGGDKTLYSYGFVE
FT                   EDIAVNEKDFQKPILHSRVLEEHIKFIQELDHYIETEEYIFVHAGVEPMKRVSESEPYT
FT                   LMWIRNEFHNGYSGEKVIVFGHTETKTLHGSEDCGVYFGSNRIIGIDGGAVYGGQLNCL
FT                   ELPSKKVYVIKN"
FT   gene            575706..576377
FT                   /locus_tag="BMB171_C0492"
FT   CDS_pept        575706..576377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0492"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05310"
FT                   /protein_id="ADH05310.1"
FT                   /translation="MRLLVVEDNASLLESIVQILRDEFEVDTAINGEDGLFLALQNIYD
FT                   AILLDVMMPGMDGFEVIQKIRDEKIETPVLFLTARDSLEDRVKGLDFGGDDYIVKPFQA
FT                   PELKARIRALLRRSGSLTTQQTIRYKGIELFGKDKDVQVDGKGMKLSLKQYELLEYLVQ
FT                   NSGKILMREQIFDRVWGFDSDTTVAIVEVYVHHLRKKLEPFGYQKDIQTVRGIGYILKE
FT                   Q"
FT   gene            576389..577624
FT                   /locus_tag="BMB171_C0493"
FT   CDS_pept        576389..577624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0493"
FT                   /product="two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05311"
FT                   /protein_id="ADH05311.1"
FT                   /translation="MFQKTRIRLTIVNSLVFILLIGILGSIIYSYTYKRIYSEVDQSIK
FT                   MIAQYREKLDVKVPPRKRMENIQIGDPRVTRITWNGKIVKIEGDNRKFRSIFEENLESF
FT                   SPEKLEELQDIEVQGRYFRAFSLQKDGEIVQIVRDITAEEGMLNTLFLILVIGCSIGSL
FT                   CAIGIGFFLAGRALVPIQSSWEKQQQFVSDASHELRTPLAVIQSKTDVLFQSPSATIEE
FT                   KAMDISTISKECRRLSKLVSNLLLLARSDSNQIEMDKKIFELDKLLEEIVAPYKEIASY
FT                   QEKEMMLKVERGVSFMGDRERIHQMMVILLDNAMKYTNEGGHIQIDCTQTSNSIRIQVK
FT                   DDGIGVKEEDIPKLFDRFYQGDKARSTSEGAGLGLSIANWIVEKHYGKISVESKWGDGT
FT                   CFEVIFPKNQKI"
FT   gene            577720..577839
FT                   /locus_tag="BMB171_C0494"
FT   CDS_pept        577720..577839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05312"
FT                   /protein_id="ADH05312.1"
FT                   /translation="MKKRLGVCEWGLSIIMLSQAAMRCMYSIKKTRGMMGKKV"
FT   gene            577856..578677
FT                   /locus_tag="BMB171_C0495"
FT   CDS_pept        577856..578677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05313"
FT                   /protein_id="ADH05313.1"
FT                   /translation="MKKKMMTVFTIGVMSLSILGGASPSETQKGKTDYTQRSKEQLNNG
FT                   KIHAVHTEEKAEKLGIETEGKEQITLEKEIHETEVGREAEQLGISIEGKDVGMLSEEIY
FT                   ETKVKQEALKLGISIENTSIVDLITQINAIKIKDEADKLGISTDGKEIEDIAEEIYGKK
FT                   VREEAGKLDISQKGKEIEELAQEVYEQKVQEEAKKHHIDLYGKDIYQILREINEQKVLQ
FT                   MADELNMDKMNMNIQELAEKIKKDQPEKGKELNFVPMVRTDADAFYSYLTN"
FT   gene            578703..579440
FT                   /locus_tag="BMB171_C0496"
FT   CDS_pept        578703..579440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05314"
FT                   /protein_id="ADH05314.1"
FT                   /translation="MKWYICTALLGAAIWSVYTNGIPKYVEKLTFSNIQRGKETEFSNN
FT                   DEKVILANVPLIQQLPELDRGCEVTSLAMMLQYAGVSVDKMTLANEIKKVDFIDDGVRG
FT                   NPNEGFVGNIYTFSESGYGVYHGPLFQLAEKYLPNKAVDLTGKNIEEIYKSIKAGQPVV
FT                   MITNATFAPLDEAEFTTWETNSGDVSITYNEHCVVLIGYDQESVYIRDPLEDSLDVKVP
FT                   RETFEQAWVQMGSQAISYVKRAK"
FT   gene            579723..581705
FT                   /locus_tag="BMB171_C0497"
FT   CDS_pept        579723..581705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0497"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05315"
FT                   /protein_id="ADH05315.1"
FT                   /translation="MQKIFNWVKCMSINKKLIISFFIILTIPGIIIGGVSYQTAKTNFE
FT                   HQMTDKAKENISILNTVISQNIEEKFVDATYFADILTEDTYLNGQEEIVRTKLAQYIKL
FT                   HPEVEGIYIGTETGKFIREPFIQMADGYNPTDRSWYKEAHENKGKVIVTAPYQSASTKN
FT                   MVVTIAKEVKDGKGVIGINLNLDNILKISKMINIGEKGYAVILDQNKQIVSHPSRKPGA
FT                   KVTDPWIKPIYEDKQGNVSYTEQDDKKNLIFATNEKTGWKVVGVMFDEEITQAASPVFY
FT                   KTLIVIAIAIAFGSILIYFITKSITRPLRKIAESAYKISKGDLTEKITIHSKDDIGKLG
FT                   NSFNEMSTSLQDVITQISFSAEHVAASAEELTASVQQANDATDQITIAMEQVSGGAESQ
FT                   SQGVEEGAATLQQVNTAIQDVTGSAESISISSLHARQRAEEGEDLVEQTAKQMQSISRS
FT                   VSESDAIIKLLDEKSKQVGAISEAIQNIATQTNLLALNAAIEAARAGEQGRGFAIVADE
FT                   VRKLAEQSGESSGEIANLIAEIKADIEHTVKAMDNVNGEVQQGLDVVTKTKVSFTEILS
FT                   STTHIVSQVNQMVETTKRIAGDANEVTNAIDEIAAAAEENTASMQSVAASTEEQVNSME
FT                   EISSASQNLAEMAEELQAMTSKFKV"
FT   gene            581784..583388
FT                   /locus_tag="BMB171_C0498"
FT   CDS_pept        581784..583388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0498"
FT                   /product="sensory histidine kinase DcuS"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05316"
FT                   /protein_id="ADH05316.1"
FT                   /translation="MKKRKRLWNLWKTITLLVCTVVIFSLLVTDILISHNVERTTEDSQ
FT                   AEKAKTIAHIVANDSIVIDGLVGKADTSAIQTYTNRILQNTGVQFIVVMDMNGIRKSHP
FT                   NPQKIGHHFIGGDEGPALKGKEHVSLAEGTLGISMRVFVPIFSETGEQLGAVAVGISAD
FT                   NVKERVKESRHIIYIGVGVGVLVGIIGAILLARHIKKSLFGLEPHRIAKILEERNTMLQ
FT                   SVKEGIIAVDKEARVTLINNEAKRLFKKSGLEEDFIGKDVELYMPNSRIKEVLQTGEVQ
FT                   LNEEQNIYGITIVTNRVPLYVKGEIVGAIATFRDKTEIRKLAEELTGIRLYAEALRAQS
FT                   HEFMNKMHVVLGLTHMKQYEELQKYISGMVSEHQYEIGGVMKRIKSPVFAGFLLGKLSY
FT                   AREKNIKLIISEDSYMPEIDDESITHELITIVGNLIDNALEAVTNCEKKRVEVKIQHGD
FT                   ILTITVQDTGKGIQEKEIEQLFTKGYSTKGDNRGYGLYLVKESIQRINGEIHMHSLVGK
FT                   GTTITIEIPKGRDERQI"
FT   gene            583385..584092
FT                   /locus_tag="BMB171_C0499"
FT   CDS_pept        583385..584092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0499"
FT                   /product="two-component response regulator yufM"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05317"
FT                   /protein_id="ADH05317.1"
FT                   /translation="MIKVLIVEDDPMVAMLNTHYLEQVGGFELVQAVNSVKSAIEILEK
FT                   SRVDLVLLDIFMPEETGFELLMYIRNQEKEIDIIMISAVHDMGSIKKALQYGVVDYLIK
FT                   PFTFERFKEALTIYREKLTFMKEQQKISQSELDSLILQKEKREPTVTKELPKGLTKQTL
FT                   QLIWQKIESLNGRVFTTDEMAQLVGISRVSIRKYVMFLTDIGVLENEMMYQHVGRPVSK
FT                   LRCVDQKKIEFYV"
FT   gene            584215..585561
FT                   /locus_tag="BMB171_C0500"
FT   CDS_pept        584215..585561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0500"
FT                   /product="malate-sodium symport"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05318"
FT                   /protein_id="ADH05318.1"
FT                   /translation="MGIQKNVEAVSFSEGNEVQRESFASKIMNVKIGVIPLPLYVVLAA
FT                   IIYGASVYNKLPADMIGGFAVIMIMGIFLGDIGMRIPILKNIGGPAILSLFIPSLLVFF
FT                   NWMNPASMEAATMLMKKSNFLYLYISCLVVGSILGMNRKVLVQGFVRMFIPLVVGTLAS
FT                   VAVGLLVGSLFGFEMKHTFFFIIVPIVSGGIGEGILPLSLAYSDILNESSATFVSQLIP
FT                   AAIIGNMFAIVSAGYMKRLGEKKPELSGNGVLVKTDNQAELLKEQNTEKPIDFSLMGAG
FT                   LLIACTFFIFGGFASKFIGIPGAIIMIFSAALVKYFKLMPAKMEQGAFHLYKFISKNLT
FT                   WPLMVGLGLLYIPLKDVAAVLSVGYVVVCASVVLTMVASGFLVGKVMKMYPVESAIVTG
FT                   CHSGLGGTGDVAILSASNRMELMPFAQISTRLGGAAMVVTATILLKMFS"
FT   gene            585621..586820
FT                   /locus_tag="BMB171_C0501"
FT   CDS_pept        585621..586820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0501"
FT                   /product="NAD-dependent malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05319"
FT                   /protein_id="ADH05319.1"
FT                   /translation="MLANQINERSLLLHKELVGKIEITSKVEVNSADDLSLTYTPGVAE
FT                   SCKAIAADEETVYDYTARGNMVAVVSDGTAVLGLGNIGPKAAMPVMEGKSILFKKFANV
FT                   DAFPLCLGTTDVDEIVTLVKNLEPTFAGINLEDIAAPRCFEIEKRLKEETNIPVFHDDQ
FT                   HGTAIVVLAAVINALKVVSKQMDNVKIVINGAGSAGIAIGKLLLKAGAKHITLVSLEGI
FT                   VCEGETWMNEAQIEVSKKTNREHVRGTLKEAIHQADIFIGVSAPNVLTKELVQTMNEKA
FT                   IVFAMANPIPEIFPEDALEAGAAVVGTGRSDYANQVNNVLAFPGIFRGALDVRATDITE
FT                   EMKLAAAYGIANIITDEERNANYVIPNPLDKRVVPSVAEAVAKAAIDSGVAQITKIPRY
FT                   "
FT   gene            586898..587026
FT                   /locus_tag="BMB171_C0502"
FT   CDS_pept        586898..587026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05320"
FT                   /protein_id="ADH05320.1"
FT                   /translation="MFLHYLFNSIATCLPFTKTSVTATITSIIFFISHLSSFHFLL"
FT   gene            complement(587113..587637)
FT                   /locus_tag="BMB171_C0503"
FT   CDS_pept        complement(587113..587637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05321"
FT                   /protein_id="ADH05321.1"
FT                   /translation="MKKIGTMLLLSFLITGCTQTQPDSKEQKKDVIATSSTQVNAPSFF
FT                   HLSVLKDVNWEETPSFVEGKMPLKGIEGKVAMADSPIIANEQNEIMWHFLDSEIPTGKL
FT                   SIIALKQGSVTPTQVLFQKETSKQTWTTSNTIDSTTNELPLTMSLPSSGLWLLNIYVNE
FT                   KYYDQFVITAE"
FT   gene            complement(587825..588751)
FT                   /locus_tag="BMB171_C0504"
FT   CDS_pept        complement(587825..588751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0504"
FT                   /product="drug/metabolite exporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05322"
FT                   /protein_id="ADH05322.1"
FT                   /translation="MNNGRRIGLIMIITGATLWGLSGPMIQWLFQHTNVSSIDFLTIRL
FT                   LLAGIFILSFLLIKKQNIFQIWKHPRYSIQLIIFSILGMLGAQYAFIETVHISNAVTAT
FT                   LFQFLGPVLITMYVAFEQRKFPASMQLFAIIAALIGTYFIITNGSIENIVLSKEAIIFG
FT                   LLTAIGFAFYTLHPASLIKECGTTVVIGWGMLIGGMALLIYNRSFGWNQFSQTLTLKTF
FT                   SMLILIIISGTLSFLLYIGSLKYLAATETSILSSIEPLVAAIVSITWLNESFGTYQLLG
FT                   GVCIVLSVIFLTMPQKETEPTYTTEQI"
FT   gene            588872..590272
FT                   /locus_tag="BMB171_C0505"
FT   CDS_pept        588872..590272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0505"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05323"
FT                   /protein_id="ADH05323.1"
FT                   /translation="MLELTPNLNMNSKKALYVQLYEYIKKEIKDGSIVPFTKLPAKRKL
FT                   AIHLQVSKNTVEAAYEQLLAEGYIESISRKGYFVCKIEQMAHVEDSGERIEEVPFQEKS
FT                   YKFDFTQTGIDTNAFPFNMYRKIVNEIWQPHNNELLFLGHPQGEATLREEITNYLYESR
FT                   GVRCSASQIVLGAGTQILVKLLFQLLKGSNYAVENPGYHRKMVVFEQGEARVQMLSLDR
FT                   DGICIADLENSNANVVFVTPSHQFPYGMIMPITRRMQLLQWAKKEESRYIIEDDYDSEF
FT                   RYSGKPIPALQGLDTEGKVIYMGTLSKALLPSLRMSYMVLPKKLIKKYQQQYLFYTQSV
FT                   SRMDQEVIRRFLNEGYWEKHIHKMRVVYRKKRDRLVFEIEKYFSNRVEVIGEDSGLHIL
FT                   LKVHNRMREEELIQEAAKHSIKIYPVSTYYKDGTAPENVVLLGFAILSEEEIAKAIQLL
FT                   HTAWFTRK"
FT   gene            complement(590305..590817)
FT                   /locus_tag="BMB171_C0506"
FT   CDS_pept        complement(590305..590817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0506"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05324"
FT                   /protein_id="ADH05324.1"
FT                   /translation="MDIHVLTKDEAEIYLELRVEGLKQNPEAFSSSYEDIINKECAIEY
FT                   KAQKLAQDENYTLGAFKDGKLIGVATLETKPYVKQEHKAKIGSVYVSPKARGLGAGKAL
FT                   IKECLELAKSLEVEQVMLDVVVGNDGAKKLYESLGFKTFGVQERSLKYNGQYWDEEHMV
FT                   LFLDENK"
FT   gene            complement(590963..592417)
FT                   /locus_tag="BMB171_C0507"
FT   CDS_pept        complement(590963..592417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0507"
FT                   /product="two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05325"
FT                   /protein_id="ADH05325.1"
FT                   /translation="MSKLSLKIGTYFLILALCIETIAFVSFYKSLSKMRIVEETDALLE
FT                   KGNRYSKKIKSRERRDEYYKEMKHAEHNKNPKRPVYPEFDITNEAAHLVESESISNSDI
FT                   AIIITDHNGKIISTSEPVTKDMQKQLTCKTETVPDGGLVVERNWKKSKFITTVSPLNTT
FT                   KFQGKLYMLLKTSFLENMLLKLMNQFLIISVLTIILTTISVFVFSRVITEPLVKMKRAT
FT                   EKMSKLNKPIQLGIKRNDELGSLAKTIEDLSSELTYMKKERNEFLASVAHELLTPLTYM
FT                   KGYAKVAKRDSLTKEEREEYLQIIEDETDSVTDLVQDLFMLVQLEQHQFVIKKQKVLLQ
FT                   PFLERMVEKTKTTLTNKQMQLHVYCKDDLEVCIDERRMEQVMLNLLHNAYQHSPENTAI
FT                   TIRVLMETDSFTISVQDEGEGIPEEDIPHIFDRFYRVDKSRTRATGGKGIGLAVAKEIV
FT                   ELHNGSILVTSQLGAGTNFIIELPFE"
FT   gene            complement(592483..593154)
FT                   /locus_tag="BMB171_C0508"
FT   CDS_pept        complement(592483..593154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0508"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05326"
FT                   /protein_id="ADH05326.1"
FT                   /translation="MVKILLVDDEERMLRLLDLFLSPRGYFCMKATSGLEALKLIEQKE
FT                   FDIILLDVMMPSMDGWDTCYQIRQISNVPIIMLTARNQNYDMVKGLTMGADDYITKPFD
FT                   EHVLVARIEAILRRTKKDGFVSFNGIEWDKTKHTVTVYDEKISLTPIEFSLLGLFLQNT
FT                   NRAYSRDDLIEKIWGYETDIEYRTIDSHIRNIRDKLRKKGFPIEDYLETVYKVGYKWKS
FT                   E"
FT   gene            593486..593608
FT                   /locus_tag="BMB171_C0509"
FT   CDS_pept        593486..593608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05327"
FT                   /protein_id="ADH05327.1"
FT                   /translation="MNSKEEISKKEKQDRNTVVMCVAVSMVIIISCVNKILGIL"
FT   gene            complement(593989..594495)
FT                   /locus_tag="BMB171_C0510"
FT   CDS_pept        complement(593989..594495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0510"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05328"
FT                   /protein_id="ADH05328.1"
FT                   /translation="MEIRLLTTEDAEIYLKVCMEGLTKNPEAFSSSYEDVLKHEDPVAA
FT                   MAKRLSNPDKYTLGVFKDNDLIGIATLETKPFIKQEHKAKIGSVFVSPKARGLGAGRAL
FT                   IKAIIENADKLHVEQLMLDVVVGNDAAKKLYESLGFQTYGVQERSLKHNGQYWDEEHMV
FT                   LFLND"
FT   gene            complement(594729..595535)
FT                   /gene="fdhD1"
FT                   /locus_tag="BMB171_C0511"
FT   CDS_pept        complement(594729..595535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD1"
FT                   /locus_tag="BMB171_C0511"
FT                   /product="formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05329"
FT                   /protein_id="ADH05329.1"
FT                   /translation="MGPTQETYTIVRYQSGTFSKQLDEIVTESPITIKLNGEEYVTVVC
FT                   TPNYIEDMVIGFLISEGIISSYNDVEELWVQKDNGIVHVKSSKVNPLYQTLYNKRYVTS
FT                   CCGKGRQGFIFVNDAAKAKDLHDIHVKITPEECFYLMNTLQQSSTTFRQTGGVHNTALC
FT                   DRNNILLSRMDIGRHNALDKIYGHCLRNDISVKGKIIAFSGRISSEILLKVSKIGCEIV
FT                   LSKSAPTKLALQLAHDLGITVVGFIRNDSCNIYTHPKRIDGYQSNV"
FT   gene            complement(596318..596497)
FT                   /locus_tag="BMB171_C0512"
FT   CDS_pept        complement(596318..596497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05330"
FT                   /protein_id="ADH05330.1"
FT                   /translation="MNPASPNIDFSINALHGHTVTHCPQLTQDESFILTPLSHITRGRS
FT                   KLQSIDIVSFTCKF"
FT   gene            596496..598772
FT                   /locus_tag="BMB171_C0513"
FT   CDS_pept        596496..598772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0513"
FT                   /product="formate dehydrogenase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05331"
FT                   /protein_id="ADH05331.1"
FT                   /translation="MTGLKPDVLDPMIDFVKDVEPGYSSILAVSEVEAAMRKTKVNKTK
FT                   TVCTFCGVGCSFEVWTKDRHILKVQPVSDAPVNGISTCVKGKFGWDFVNSEDRITKPLI
FT                   RQGDMFVEASWEEALEVVASNMQHIKSEYGSDAFGFISSSKVTNEENYLMQKLARQIYG
FT                   TNNVDNCSRYCQSPATDGLFKTVGMGGDAGTVKDIAEAGLVIIVGANPTEGHPVLATRV
FT                   KRAHKLHDQKLIVADLRKHEMAERADLFIHPRQGTDYVWLAGITKYIIDQDWHDKKFIA
FT                   ENVKNFDEYSKMVEKYTLDYTEEITGISKENLKEMARMVYEADGTCVLWGMGVTQNTGG
FT                   STTSAAISNLLLVTGNYRRPGAGAYPLRGHNNVQGACDMATLPNWLPGYQAVSDDALRA
FT                   KFEKAYGTTIPKAPGLNNIAMLLAADEGKLRGMYVMGEEMALVDSNANHVQHILANLDF
FT                   LVVQDMFLSKTARFADVILPAAPSLEKEGTFTNTERRIQRLYEVLKPLGDSKPDWWILQ
FT                   KVARALGGDWNYESPSEIMDEIASLAPLYSQATYDRLEGWNSLCWGSHDGSDTPLLYVD
FT                   GFNFPDKLARLSLDEWVPPVVAPDEYDLLLNNGRMLEHFHEGNMTNKSAGILSKVSEVF
FT                   VEISPELALERNVKDGGLVELASPFGKIKVQALVTDRVTGKELYLPMHATVNEEAINIL
FT                   TGTATDLYTCTPAYKQTMVKMRVLREKGKRPLPSSNPRDKKRNPQNGVEIQQKWQRKQY
FT                   VSLVD"
FT   gene            598785..599267
FT                   /locus_tag="BMB171_C0514"
FT   CDS_pept        598785..599267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05332"
FT                   /protein_id="ADH05332.1"
FT                   /translation="MAKEITVIKKKVVTEEEQKQQVADELLNELSNNREAVEETMQLLA
FT                   QLQKAGILDAAISLLAAKEDVSKIAVEQLNREPVKNALNNMMGAGEALSSVDPEITKQI
FT                   TSSLVTGLQFATDELNSGKKTKVMDFFKVLKDPDINRAITFGFSFLKAFGQGLEKK"
FT   gene            599284..599436
FT                   /locus_tag="BMB171_C0515"
FT   CDS_pept        599284..599436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05333"
FT                   /protein_id="ADH05333.1"
FT                   /translation="MGSSHHFFHYMYKSVHVKRNILLLKRWIRTGNMESISNTVLEFGG
FT                   IYATP"
FT   gene            599423..601294
FT                   /locus_tag="BMB171_C0516"
FT   CDS_pept        599423..601294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0516"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05334"
FT                   /protein_id="ADH05334.1"
FT                   /translation="MQHRKKLSIPGVMRHSFQTVKFAFWNVLTFQLAYKLLAAIVFVPL
FT                   FGIIFNKLLYFGGYANATNDELLAFLKTPYGILAIVILSLLALFLIFTEFAVLIIISYF
FT                   AHKRQKVKLRPILYKTVTYLPTLFTYCLPGFILYAVVLLPLLNMGYETALIPQIQIPNF
FT                   ITGELFKTTMGQVGYYTFFAVVAYLNLRWIFVLPIVVLEQKPFRVAARKSATLVKESFF
FT                   KVLFFLVGFFISIGIVYVVFLGMYLLCLWGVYEFTNPKGTFALLAESTISVFLTSTLYL
FT                   FSFIVTPFYIMAITRLYLQKVPVEDVLLEEGLDYSKTKADKCFFQKHRWKFIGVYIVGI
FT                   ITAGMVVAFIVTFISNSYKEPIIMAHRGYISKGVENTKEAVQGAIDVKADYAEIDVLQT
FT                   KDGELAVIHDLKLKRLANANVHVSDLTMAELRQLTLSQDGLSGQISTLDEIIKLANGKI
FT                   KLNIEVKLHGGEKDFVNKVLKTIKDNEFEKQCVIQTLHYPLIKEFKRANPDIKVGYILY
FT                   ASRANLKNVKADFYVAEEYMLNKKLVKEARKLNKPIYVWTVNDMENLKAYYKLNVDGII
FT                   TDYPEDARETIKMLKEQEAEESDLFDKITETTDDLFSKLFISYPAAS"
FT   gene            601664..602797
FT                   /gene="ald1"
FT                   /locus_tag="BMB171_C0517"
FT   CDS_pept        601664..602797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ald1"
FT                   /locus_tag="BMB171_C0517"
FT                   /product="alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05335"
FT                   /protein_id="ADH05335.1"
FT                   /translation="MRIGVPAEIKNNENRVAMTPAGVVHLIRNNHEVFIQKGAGLGSGF
FT                   TDAQYVEAGAKIVDTAEEAWNMEMVMKVKEPIESEYKHFSEGLILFTYLHLAPEPELTK
FT                   ALIEKKVVSIAYETVQLENRSLPLLAPMSEVAGRMAAQIGAQFLEKNKGGKGILLAGVP
FT                   GVKRGKVTIIGGGQAGTNAAKIAVGLGADVTIIDLSAERLRQLDDIFGNQVKTLMSNPY
FT                   NIAEAVKESDLVIGAVLIPGAKAPKLVTEEMIKSMEPGSVVVDIAIDQGGIFETTDRIT
FT                   THDNPTYEKHGVVHYAVANMPGAVPRTSTLALTNVTVPYAVQIANKGYKEACLGNSALL
FT                   KGINTLDGYVTFEAVAEAHGVEYKGAKELLEAETVSC"
FT   gene            602997..604316
FT                   /locus_tag="BMB171_C0518"
FT   CDS_pept        602997..604316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0518"
FT                   /product="alanine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05336"
FT                   /protein_id="ADH05336.1"
FT                   /translation="MLGIGAIIGTGVLVLTGLVAARDAGPAVIFSFMIAAIVCGFAALC
FT                   YAEVASTLPVSGSVYTYSYATIGEFVAHLMGWTLLSVYVVTTAAVAGGWTGYFHNLVSG
FT                   LGLEIPKALLTIPSQGGMVNLPAVIVTLVITWLLSRGTKESKRVNNIMVLIKIGIVVLF
FT                   IAVGVFYVKPENWIPFAPYGLSGVFAGGAAVFFAFLGFDALATSAEEVKNPQRDLPIGI
FT                   IASLVICTIIYVVVCLVMTGMVSYKELDVPEAMAYVLEVVGQDKVAGVIAIGAVIGIMA
FT                   VIFAYIYATTRVFFAMSRDGLLPESFAKINKKTEAPTFTVWLTGIGSALIAGFIDLKEL
FT                   SNLANIGALLTFAMVGVSVIILRKTHPKLQRGFMVPLVPILPIISIACCLFLMVNLPLK
FT                   TWMYFGAWLAIGVVVYFVYSKKHSHLKDDGSSQDNLEQAN"
FT   gene            604645..605022
FT                   /locus_tag="BMB171_C0519"
FT   CDS_pept        604645..605022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0519"
FT                   /product="cadmium efflux system accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05337"
FT                   /protein_id="ADH05337.1"
FT                   /translation="MAGNKVETPQETCSQTIIHEEVVEQVKQTIPTDESLSKVAELFKV
FT                   LGDRTRTRILHALFEAEMCVCDLAYLLGMTQSSISHQLRVLKQAKLVKNRKEGKVVYYS
FT                   LADQHVIHIFEQAFEHVNEEE"
FT   gene            605046..607412
FT                   /locus_tag="BMB171_C0520"
FT   CDS_pept        605046..607412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0520"
FT                   /product="Zinc-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05338"
FT                   /protein_id="ADH05338.1"
FT                   /translation="MAEALVKKKLMLEGLDCANCAMKIEKGVGNIEGVNSCSVNFATKT
FT                   MILETAQNKENEVVTEAKQLVTKLEPHIKVQEEQKNKIAKEVFILEGLDCANCAMKIEN
FT                   KVKEMPAVSEATVDFVSKKLRVEVANKRELEATVANITNVVQKLEPDVKVVREEKNGHD
FT                   HGHSHDHGEANVKKMVGRLVVGGILTAIAALAGLPQIVTIPLFVLAYLLIGGDIVWRAV
FT                   RNITRGQVFDENFLMAIATVGAFAIQQYSEAVAVMLFYQVGELFQSIAVNRSRKSITSL
FT                   MDIRPDYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVPLDGKVIEGTSMVDTSALTGE
FT                   SVPREVEVGNDVLSGFVNQNGVLTIEVTKEFGESTVSKILDLVQNASSKKAPTENFITK
FT                   FARYYTPVVVITAAIMAFIPPLILEGATFSEWIYRALVFLVISCPCALVVSIPLGFFGG
FT                   IGGASKSGVLVKGSNYLEALNDVKYIVFDKTGTLTKGVFKVTKMEPSEGTTSEELLEYA
FT                   AFAEVYSNHPIAQSIRKAYGKSIDEKIIDDYNEISGHGTVVKVQGKEIFAGNAKLMRKE
FT                   NIEFKQPETVGTLVHVAVDGRYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAK
FT                   PVGEAVGKELGLDEVHAELLPQQKVEEIEKIDAAKHGKEKIAFVGDGINDTPVLARADV
FT                   GIAMGGLGSDAAIEAADIVIMTDEPSKIATAVKIAKRTRSIVWQNIIFALGVKGIVLLL
FT                   GAFGIATMWEAVFSDVGVTLLAVLNAMRVLRVKDL"
FT   gene            complement(607616..609079)
FT                   /locus_tag="BMB171_C0521"
FT   CDS_pept        complement(607616..609079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0521"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05339"
FT                   /protein_id="ADH05339.1"
FT                   /translation="MTHYKDDSYALHTDLYQINMAYTYWKDGIHNRRSVFDLYFRKLPF
FT                   ENGYAVFAGLEKIVEYIENFSFTESDIAYLAELQFEEEFLHYLQNMKFTGTIRSMQEGE
FT                   VVFNNEPLLRVDAPLGEAQIIETALLNIVNYQTLIATKAARMKHAASNDELLEFGTRRA
FT                   HEFDAALWGTRAAFIGGFSSTSNVRAGKRFGIPVAGTHAHSFVQAYRDEYVAFKKYAET
FT                   HKKCVFLVDTYDTLKSGVPNAIRVAKEFGDRIDFYGIRLDSGDMAYLSKKARKLLDEAG
FT                   FTNTKIIASSDLDEYTIMHLKSQGAKIDVWGVGTKLITSFEQPALGAVYKLVAIEDTDG
FT                   KLNDTIKISSNPEKITTPGLKRIYRIINRVNDHAEGDYIALDSEEPGKEERLKMFHPVH
FT                   TYISKFVTNFEARELHKDIFVNGERTYELPSILDIQKYNEQSLSLFWEEYMRTLNPEEY
FT                   PVDLSQECWDHKMNYIQTVREQVEKNIQK"
FT   gene            609279..610550
FT                   /locus_tag="BMB171_C0522"
FT   CDS_pept        609279..610550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0522"
FT                   /product="transcriptional activator NprR"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05340"
FT                   /protein_id="ADH05340.1"
FT                   /translation="MQQTLEKIGKQVFYKRLQQKMTQEELCQGICSVSYLSKIENGKIE
FT                   ASEEILQLLCTRLEIAVTDLRDVEEDVKGKLDEWLNALVHLDKQQVERIYEELQGEMKH
FT                   VLDFEIINYYKLLYTRYLIMKRDISALEEELDKLKKVYKKYSPFQKLLYMYSRGLLCCL
FT                   QYRWKDGLDYLLKTEVMAKEQGYHETGLYYNIALAYTHLDIHHLAIHFVNMALEGFRSE
FT                   YKFRNIINCQILIAVSYTEKGQYEEALKMYESILREATSFADKDVLLAITLSNMGSIYY
FT                   KKGKYQQAKKYYLDSLQLQKQIDLNYLDTIYEMALVCIKLEELEEARTLIDKGIDAAKQ
FT                   EERFNAKLYLLLMLRYKYFEEAKDYKAFLENEAIPLYKSAGNKIELKKVYVELAEHFSS
FT                   LSRFEESNRYYRLVIDLMNDNKEE"
FT   gene            610553..610684
FT                   /locus_tag="BMB171_C0523"
FT   CDS_pept        610553..610684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05341"
FT                   /protein_id="ADH05341.1"
FT                   /translation="MKKMVFGVLAFILTLTVAGGVHQYSSKPDIVGQQAKTVEQVNL"
FT   gene            610851..612551
FT                   /locus_tag="BMB171_C0524"
FT   CDS_pept        610851..612551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0524"
FT                   /product="bacillolysin"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05342"
FT                   /protein_id="ADH05342.1"
FT                   /translation="MKKKSLALVLATGMAVTTFGGTGSAFADSKNVLSTKKYNETVQSP
FT                   EFISGDLTGATGKKAESVVFDYLNAAKGDYKLGEKSAQDSFKVKQVKKDAVTDSTVVRM
FT                   QQVYEGVPVWGSTQVAHVSKDGSLKVLSGTVAPDLDKKEKLKNKNKIEGAKAIEIAQQD
FT                   LGVTPKYEVEPKADLYVYQNGEETTYAYVVNLNFLDPSPGNYYYFIEADSGKVLNKYNK
FT                   LDHVTNEDKSPVKQEAPKQDAKAVVKPVTGTNKVGTGKGVLGDTKSLNTTLSGSSYYLQ
FT                   DNTRGATIFTYDAKNRTTLPGTLWVDADNVFNAAYDAAAVDAHYYAGRTYDYYKATFNR
FT                   NSINDAGAPLKSTVHYGSKYNNAFWNGSQMVYGDGDGVTFTSLSGGIDVIGHELTHAVT
FT                   ENSSDLIYQNESGALNEAISDIFGTLVEFYDNRNPDWEIGEDIYTPGKAGDALRSMSDP
FT                   AKYGDPDHYSKRYTGTSDNGGVHTNSGIINKQAYLLANGGTHSGVTVTGIGKDKLGAIY
FT                   YRANTQYFTQSTTFSQARAGAVQAAADLYGATSAEVAAVKQSFSAVGIN"
FT   gene            complement(612615..613163)
FT                   /locus_tag="BMB171_C0525"
FT   CDS_pept        complement(612615..613163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05343"
FT                   /protein_id="ADH05343.1"
FT                   /translation="MAETIQNFLTEYYSIAIPLSILINIIISLLGFIPSIFLTAINIQL
FT                   FGVTNGTVISIAGEALGAIISFYIYRMGLQKFTHDKVNKYPKVERLLYVEGREAFLLVL
FT                   SFRLIPFIPSSIVTLFAALGKMSLLSFSIASTIGKIPALLIEVYSAYHVMNGTNEAKWI
FT                   VTIAGCIGLYYLWKKWRKK"
FT   gene            613556..614077
FT                   /locus_tag="BMB171_C0526"
FT   CDS_pept        613556..614077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05344"
FT                   /protein_id="ADH05344.1"
FT                   /translation="MMKRISSLFFSSLLALMLILSGCAGKEQKTEKQTGNQATSVEKIS
FT                   DNILDEMEGPPKNGHTIERHVGKSEEDLKNRLKTDKVSAASTYYDKETATKAVKDSLKQ
FT                   HDKEIQDWLKNSKEARLVLNTTHSFPVGKTVIKKNMSVKDKLVKTVTVLARDKSGELGF
FT                   KIITSYPSDK"
FT   gene            614094..614366
FT                   /locus_tag="BMB171_C0527"
FT   CDS_pept        614094..614366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05345"
FT                   /protein_id="ADH05345.1"
FT                   /translation="MYTTLQYFLKSYCTLSIHEDEIVSVMEEFIEQEDEEIVLKLRDEL
FT                   INMKKKNAWEEACVLAAKQGNRMWSLEETKDHLETFLLLLQKKKA"
FT   gene            complement(614409..615671)
FT                   /locus_tag="BMB171_C0528"
FT   CDS_pept        complement(614409..615671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0528"
FT                   /product="vancomycin B-type resistance protein vanW"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05346"
FT                   /protein_id="ADH05346.1"
FT                   /translation="MKLSKILIGSAIAGGILLCVGGVGGYQYVSKLNNQLDTTALPNTT
FT                   FEGISLDGKNKKDIQAIINQKVTELDQKSLTYIFQNDKQTYTWKDLGINYKEKAIIDKI
FT                   FKEQEGNVMNRYKMRKQAENGELKRDYKLTPQLNATAYETFIKDKYNETLKNPVNAELS
FT                   IEGSTVNISQSQNGEKIDKGKLSGLTNEAITTGKSDVTLPVTFIKPERSTEDIQKMGIK
FT                   EVIAEYSTPMAGRNGNQSFNVNKSANTLSGVIVAPDETFSFNGRVGVTDAAHGYKSAAV
FT                   YSQGKVIQSAGGGVCQVSSTLYSAALRADLGIVSRSNHSMPVNYLPLGQDAAVADYGPD
FT                   LKFKNNTGNHIYIQAFSNGGSITTRIFGTNTGKNVEVSSQVISRTSDKITAVTYKKVTQ
FT                   NGEVISNGQISKSVYKSAPKE"
FT   gene            complement(615907..616923)
FT                   /locus_tag="BMB171_C0529"
FT   CDS_pept        complement(615907..616923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0529"
FT                   /product="LytR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05347"
FT                   /protein_id="ADH05347.1"
FT                   /translation="MMKSDTNNNTRAKKGRSKKKRLLWFLLIPLLIVALGAGGYSFHIY
FT                   SKAKSVLNNAYAELGRGDKSSKREKAVKPMTDNISVLIMGVDESDIREKGYGKATRTDA
FT                   LLLATINKNDKSVKLVSIPRDSRVYIKSRDKYDKITHAHVFGGVDSTIDTVENFLDVPV
FT                   DYYVKFNFKSFIKIVDSLGGITVDVPVEFTEQNSKDEADAIHLKKGRQHLNGEEALALA
FT                   RTRHIDSDYMRGQRQQLVLEAIAEKALSLNSINKIGGLLDAVDKDLKTNLTFDDMMTIT
FT                   KNSMDSNLKMEKMQVEGTDKYIGGIYYYVPNEKSVDTISTTLQKHLGVTNKNEHKKL"
FT   gene            complement(617110..618288)
FT                   /locus_tag="BMB171_C0530"
FT   CDS_pept        complement(617110..618288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0530"
FT                   /product="nucleoside permease nupC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05348"
FT                   /protein_id="ADH05348.1"
FT                   /translation="MKFITFFVGLIVVFLLAYIASNNKKHIKFKPIFIMLIIQLILTYL
FT                   LLNTEIGLILIRIISSLFTKLLEYAADGINFVFGGLANKGEMPFFLTVLLPIVFISVLI
FT                   GILQHFKILPFFIRWIGYFLSKINGLGKLESYNAIASAIVGQSEVFITVKKQLAQIPKH
FT                   RLYTLCASAMSTVSMSIVGAYMTMIEPKYVVTALVLNLFSGFIIILIINPYDVKDDEDI
FT                   LEIKGEKQSFFEMLGEYILDGFRVAIVVGAMLIGFVALISCINDLFLIIFGITFQQLIG
FT                   YVFAPIAFLIGVPSSEIVAAGSIMATKLVTNEFVAMMDLSKISNSLSPRTVGIISVFLV
FT                   SFANFSSIGIISGAVKGLNEEQGNVVARFGLKLLYGATLVSILSAIIVSIML"
FT   gene            618287..618766
FT                   /locus_tag="BMB171_C0531"
FT   CDS_pept        618287..618766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0531"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05349"
FT                   /protein_id="ADH05349.1"
FT                   /translation="MVSPLKEIFCYICFSFQGRICIFGKERNRESMNICRVHHVAIICS
FT                   NYETSKDFYTRILGFKEINEVYRKERDSYKLDLCVGEEYQIELFSFPNPPERKSFPEAA
FT                   GLRHLAFAVTNIEEAVKHLNQCGVETEPIRIDEITGKKFVFFQDPDGLPLELYEV"
FT   gene            619532..620173
FT                   /locus_tag="BMB171_C0532"
FT   CDS_pept        619532..620173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0532"
FT                   /product="magnesium and cobalt efflux protein corC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05350"
FT                   /protein_id="ADH05350.1"
FT                   /translation="MVPRTEVVGLYEDEPFETHIKVIAQEKYTRYPVFGEDKDEIIGMV
FT                   NVKDLFIRYMDGNRDEECSIMPYTRPVIEVLENIPIHDLLLQMQRKHIPLAVLYDEYGG
FT                   TAGIVTLEDILEEIVGEIRDEYDEDENPPIEHISEGYKIVEGKVLISEVNDLLGIHLIA
FT                   DDVDTIGGWIMVQKQIVAEGDIIEKHGFYFKVLEKDMHQIKRVEIRKVEE"
FT   gene            620347..621780
FT                   /gene="aspA"
FT                   /locus_tag="BMB171_C0533"
FT   CDS_pept        620347..621780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="BMB171_C0533"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05351"
FT                   /protein_id="ADH05351.1"
FT                   /translation="MIATKDIRIEKDFLGEKEVPSVAYYGVQTLRAVENFPITGYRIHP
FT                   SLITAMAIVKKAAALANIDTGYLAKDIGHEIAEAAQEIVDGKFHDQFIVDPIQGGAGTS
FT                   INMNTNEVIANRALERMGYEKGAYAKISPNTHVNMAQSTNDAFPTGIHIATLMMLEKLL
FT                   ITMEELHSAFRKKAKEFDHVIKMGRTHLQDAVPIRLGQEFEAYSRVLARDIKRIKQSRQ
FT                   HLYEVNMGATAVGTGLNANPMYIEQVVKHLRTFSGFPLVGAEHLVDATQNTDAYTEVSA
FT                   ALKVCMMNMSKIANDLRIMASGPRVGLAEIQLPARQPGSSIMPGKVNPVMAEVINQVAF
FT                   QVIGNDHTICLASEAGQLELNVMEPVLVFNLIQSISIMNNGFRVFREYCIEGITANEEL
FT                   LKQYVEKSVGIITAVNPHIGYEVASRIAREAIETGKSVRELCLEHGVLTEEELDIILDP
FT                   FEMTHPEIAGASLLKNKKM"
FT   gene            complement(621820..623439)
FT                   /gene="lldP1"
FT                   /locus_tag="BMB171_C0534"
FT   CDS_pept        complement(621820..623439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldP1"
FT                   /locus_tag="BMB171_C0534"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05352"
FT                   /protein_id="ADH05352.1"
FT                   /translation="MSTWTQIYDPLNNIWLSALIAALPIFCFIICLMGFKMKSYMAGLY
FT                   SVIVAIILAIFVYKMPATVAVASAGFGVLSGFYPICTIVIAAIFLYKLTVKTEQFNIIR
FT                   DSISSITNDQRLQVLLIAYSFGAFLEGAAGLGVPVAITAALLVGMGFNPLKAAGICLVA
FT                   NIAGGAMGAMGIPVTVPAQLTQLDALTIGRQTVLILPFISIILPFLLVSMVDGIKGIKE
FT                   TWQGILVSGVSFAITQFAVTYFLGAELTNIFAAVVSMIALALFLRVWQPKSSTKEEKQE
FT                   TTVSHTFNQILYAWSPFVFLTAFVTIFNLKPIKALFAPDGALANLVFNIQFPGLHNAVM
FT                   KTTPITKADTPFAAVFKFDVFSSTTTAIVLAIIVSLIVYRVKGKMVKELMIETMKELKA
FT                   PVYTICSVIALAYVENYSGMSSTLGLAFSSTGNAFPVLSPILGWIGVFITGSVVSSGSL
FT                   FAPLQAVTADQLNIVPSTLVALNVVGGTMAKMVSPQSVAVACAAVGLVGKESALFKTAM
FT                   KYSLIFLAVISLLQLNAVFNIF"
FT   gene            624262..624549
FT                   /locus_tag="BMB171_C0535"
FT   CDS_pept        624262..624549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0535"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05353"
FT                   /protein_id="ADH05353.1"
FT                   /translation="MSQNQFECRISEEDVQMLRALAHPLRLRLVMELMQRGTCNVTQLQ
FT                   EVLEIPQSTVSQHLTKLKQNKVVRFERRGLEVYYQIHNDKVSAVVKTLFS"
FT   gene            624741..624920
FT                   /gene="sspH"
FT                   /locus_tag="BMB171_C0536"
FT   CDS_pept        624741..624920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspH"
FT                   /locus_tag="BMB171_C0536"
FT                   /product="acid-soluble spore protein H"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05354"
FT                   /protein_id="ADH05354.1"
FT                   /translation="MDVKRVKQILSSSSRIDVTYEGVPVWIESCDEQKGSAQVYDVSNP
FT                   GESVHVDVTALEEK"
FT   gene            complement(624958..626307)
FT                   /locus_tag="BMB171_C0537"
FT   CDS_pept        complement(624958..626307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0537"
FT                   /product="di-/tripeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05355"
FT                   /protein_id="ADH05355.1"
FT                   /translation="MDAALKLDKAGEQQSPKKHPPGLYLLFFTEAWERFSYYGMRGLLV
FT                   LYLTTSLVSGGLGFDKAVAVQIYGIFTMLVYFTPIIGGWLTDHFITKRHAITIGGIIMA
FT                   IGNFVLFSMNTKTGLFLGLGLLVIGNGFFKPNISTLLGQLYSENDSRRDSAFTIFYMGI
FT                   NLGALIAPFICGYFADYRYGFLTACIGMIIGQLAFNFLAPRYLGSIGTTVVGKQSKEKN
FT                   AKAIEKKPLTTQEKKRTAAILILTCFVVFFWAGFEQAGSSLTLYTDKFVDRTIGGFTIP
FT                   TPWFQSVNPLFIILLALPVSALWIKLSKTKNGDLKIPTKMALGMILLGIGYLVLTLAVL
FT                   KTGSDEGNITMKANLLFIVFTYMFHTIGELFLSPIGLSMVSAIAPVKLASLLMGVWLAG
FT                   TGFANLLAGQLAAFTQSLGYLEVFASIGIIVIVLGLVLLMFSKKIAHMME"
FT   gene            complement(626688..627656)
FT                   /locus_tag="BMB171_C0538"
FT   CDS_pept        complement(626688..627656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0538"
FT                   /product="Iron(III) dicitrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05356"
FT                   /protein_id="ADH05356.1"
FT                   /translation="MNFMRKKSFTVFVFLLAFSMLLSACGKSNNKEESTKEDNKKEVVT
FT                   VEHAMGKTEVPANPKRVVILTNEGTEALLELGVKPVGAVKSWTGDPWYPHIKDKMKDVK
FT                   VVGDEGQVNVETIASLKPDLIIGNKMRHEKVYEQLKAIAPTVFSETLRGEWKDNFKFYA
FT                   KALNKEKEGQKVVADYESRMKDLKGKLGDKVNQEISMVRFMPGDVRIYHGDTFSGVILK
FT                   ELGFKRPGDQNKDDFAERNVSKERISAMDGDVLFYFTFDKGNEKKGSELEKEYINDPLF
FT                   KNLNAVKNGKAYKVDDVIWNTAGGVIAANLLLDDIEKRFVK"
FT   gene            627829..628833
FT                   /locus_tag="BMB171_C0539"
FT   CDS_pept        627829..628833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0539"
FT                   /product="ferrichrome transport system permease protein
FT                   fhuB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05357"
FT                   /protein_id="ADH05357.1"
FT                   /translation="MLLKTNRAKWIGLFVGIIAVVICIWGSIIFGYTNTSWKLALDAFF
FT                   HFNGSNEHIIIQNVRLPRALIAASVGASLAIAGCLMQTLTKNPLASPDFIGLNSGAAFF
FT                   IVVAIVIFSVTSLSAFTWIAFLGAAVAAVLVFASSSLGKEGTTPLKLTLAGVAISALFS
FT                   SLTQGVLVLNEKALEEVLFWLAGSVQGRKLEILQSVFPYLLIGWIASFMMAGKVNTLMM
FT                   GEDVAKGLGQRTILMKSFVLLIIVLLSGGSVAVAGPIGFIGIITPHFARFLVGVDHRWR
FT                   VPYSGLLGAILLILADIAARYVIMPQEVPVGVMTAFIGAPFFIYIARKRGLSK"
FT   gene            628830..629888
FT                   /locus_tag="BMB171_C0540"
FT   CDS_pept        628830..629888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0540"
FT                   /product="Iron(III) dicitrate transport system permease
FT                   protein fecD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05358"
FT                   /protein_id="ADH05358.1"
FT                   /translation="MKKYIPFRIGKGELSFLMYKRACLVLLSLLVVLIGLFFASAGMGD
FT                   MKIAPYDVWQAITGNGDAMSNMVVNKFRMPRILIAILVGIALAVAGCILQGLVRNPLAS
FT                   PDIIGITGGASVAVVLFLALFSDKNNALTVSIHYMPLAAFAGATIVAVFVYLFAWKNDG
FT                   LSPISLVLIGVGFWALTKAATTLFMLLAPIYQASQANVWITGTVYGSSWQNVMVLAPWV
FT                   LILTVISFIAARHLNAQELGDDIAVGLGVPLTKSRVFMLLLSTALIGGAVAFAGGIGFV
FT                   GLMAPHISRRLVGSLYGALLPVAAIVGAILVLAADLIGRTIFTPLEIPAGVFTSAIGAP
FT                   YFIYLLYKSRNS"
FT   gene            629901..630722
FT                   /locus_tag="BMB171_C0541"
FT   CDS_pept        629901..630722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0541"
FT                   /product="Iron(III) dicitrate transport ATP-binding protein
FT                   fecE"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05359"
FT                   /protein_id="ADH05359.1"
FT                   /translation="MQKALETKRLTLSYGETIIIDELNLEIPKGEITIFIGSNGCGKST
FT                   LLRSLARLLKPTTGDILLDNQAIQSMQTKQIARQMAILPQGPQAPEGLTVLQLVKQGRY
FT                   PYQTWLKQWSEKDEEMVQKALAATGMTEFAERDVHALSGGQRQRAWIAMTLAQDTDIIL
FT                   LDEPTTYLDMTHQIEVLDLLFELNETEQRTIVMVLHDLNLACRYADNIVAIQDKQIYAQ
FT                   GKPEEVVDEKLVRDVFRMDCQISTDPLFGTPLCIPHGRGRRVVKEVAQAMR"
FT   gene            complement(630751..631482)
FT                   /locus_tag="BMB171_C0542"
FT   CDS_pept        complement(630751..631482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0542"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UBIE"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05360"
FT                   /protein_id="ADH05360.1"
FT                   /translation="MAFTESDVYNNTAFFEQYMKRRYRENSPNESIEKPVFFQLIGHVQ
FT                   GKQILDLGCGDAKFGAELLEKGCYSYTGIEGSELMYEKAKKQLENKNGSVHFLNLKDYT
FT                   YPSSTFDLVTSRLALHYIEHLDTIFKNVFQTLKTNGTFTFSVQHPVITSSFESLQTSGK
FT                   RTSWLVDDYFKLGKRVEPWIEQEVIKYHRTTEEYFTLLQQAGFTITSLKEATPNPTYFQ
FT                   DEEEYKRRLRIPLFLLFSCTK"
FT   gene            631696..632886
FT                   /locus_tag="BMB171_C0543"
FT   CDS_pept        631696..632886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0543"
FT                   /product="2-amino-3-ketobutyrate coenzyme A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05361"
FT                   /protein_id="ADH05361.1"
FT                   /translation="MSSKTLAKFLEENLEDLKSKGLYNVIDPLESSNGPIITIGGKEYI
FT                   NLSSNNYLGLATDSRLQEAAIGAIHKYGVGAGAVRTINGTLDLHIKLEETIAKFKHTEA
FT                   AIAYQSGFNCNMAAISAVMDKNDAILSDELNHASIIDGSRLSKAKIIVYKHSDMEDLRQ
FT                   KAIAAKESGLYNKLMVITDGVFSMDGDVAKLPEIVEIAEELDLMTYVDDAHGSGVLGKG
FT                   AGTVKHFGLSDKVDFQIGTLSKAIGVIGGYVAGKQNLIDWLKVRSRPFLFSTALTPADA
FT                   AACMRSIEILMESTELHDRLWENGRYLKQGLKELGFNIGESETPITPCIIGDEVLTQEF
FT                   SKRLNEEGVYAKSIVFPTVAKGTGRVRNMPTAAHTKEMLDEAILKYEKVGKEMGII"
FT   gene            632931..633896
FT                   /locus_tag="BMB171_C0544"
FT   CDS_pept        632931..633896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0544"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05362"
FT                   /protein_id="ADH05362.1"
FT                   /translation="MKKILVTGSLGQIGSELVMKLRDVYGASNVIATDIRETDSEVVTS
FT                   GPFETLDVTDGQKLHDIAKRNEVDTIIHLAALLSATAEKNPLFAWNLNMGGLVNALEAA
FT                   RELNCKFFTPSSIGAFGPSTPKDNTPQDTIQRPTTMYGVNKVAGELLCDYYHQKFGVDT
FT                   RGVRFPGLISYVAPPGGGTTDYAVEIYYEAIKKGAYTSYIAEGTYMDMMYMPDALQAII
FT                   SLMEADPSKLVHRNAFNITAMSFEPEQIAASIRKHIPTFTMDYAVDPARQTIADSWPNS
FT                   IDATAAMKEWGFKAEYDLDKMTTDMLAKLKKKLTAELVMN"
FT   gene            633956..634378
FT                   /locus_tag="BMB171_C0545"
FT   CDS_pept        633956..634378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0545"
FT                   /product="phosphohydrolase (MutT/nudix family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05363"
FT                   /protein_id="ADH05363.1"
FT                   /translation="MQRVDVVYALIHDEETDKILMVHNVEQNVWSLPGGAVEKGEILEE
FT                   ALIREVKEETGLTATLGGLVAINEKFFEESGNHALFFTFRANVEKGELIAEDEGEISAV
FT                   EWVDRTIANERFPYYDGGFEYLLEVAIPYKFQPETK"
FT   gene            complement(634416..636299)
FT                   /locus_tag="BMB171_C0546"
FT   CDS_pept        complement(634416..636299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0546"
FT                   /product="von Willebrand factor type A domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05364"
FT                   /protein_id="ADH05364.1"
FT                   /translation="MRQIFSDKKIDASLFLQMENLMYALLKEDDAYLEYGYKAYYDEIE
FT                   KKVVISHFWDDRKEEDTVIGLKSEVFLKALGNKHYSDMTLIRSYAIELQESPLKKFLTQ
FT                   LFVLLEDLRVEEIVKNLRPGTKHVFKRRKEMYRNYFSSQNEINRVRNYHGDRLFCLCYL
FT                   SLTSDKYEMFNNEYFEQIEAILHETFQARNTEDIMYIVEKIRYRLEELLESDMLNNYFG
FT                   HAPLYLSVLADEKNCRVEDLANDDTQLIDDDENKNKMDESFSTWHRENKNNENENFLRF
FT                   ELESGTKTNMMGDTARESEDGDQALGSVQGTSQKSTQSNFDGADTEEARASHASSQNDG
FT                   AYGKYNTGASHTFKEARKPNPDEKKDYQAIKSVVNKDVKELKKIIEKTIENKTNANSDK
FT                   YYGRLRKKFLRIYTEKQPRMFYKKGQESQELDVAFQLLVDCSGSMYNKMEETKKSVVLF
FT                   HEALKSLKIPHAISGFWEDASSAKPEDKPNVIHEVVNYKNSTLPNVGPEIMQLREEEDN
FT                   RDGYIIRIVSEKLAKRPEKHKFLLVFTDGEPSALDYQQDGILDTHEAVKLARKSGMEVI
FT                   GIFIEEGEAKEATYQLMKNIYNHHFLVANHAEDLRLKIKPLLKKLLLKTIE"
FT   gene            complement(636303..637196)
FT                   /locus_tag="BMB171_C0547"
FT   CDS_pept        complement(636303..637196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0547"
FT                   /product="NorQ protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05365"
FT                   /protein_id="ADH05365.1"
FT                   /translation="MLEQFHIHADLKQQLSTIHEKNKQEAGENAHLIGTKIYKASDNSI
FT                   IEDAITALLLGKNILLKGPTGSGKTVLAETLSSLFQKPMHSINCSVDLDVEGILGYNTL
FT                   QTKDGASEVSFVNGPLMKAMKNGHFLYIDEINMAKPETLPLLHGALDYRKMITNPFTQE
FT                   VVYGDDEYRVIAAINEGYVGTSELNEALKNRFVIIEVPYIQGDTLKELLLAESKLKDVA
FT                   TIEKFVAFASDLMPLARDGRVSEEAASIRGIIDACDLGVYIPVMRAIERSIIAKLNDET
FT                   EQMTVRELAESYFFEG"
FT   gene            complement(637324..638853)
FT                   /gene="cls1"
FT                   /locus_tag="BMB171_C0548"
FT   CDS_pept        complement(637324..638853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cls1"
FT                   /locus_tag="BMB171_C0548"
FT                   /product="cardiolipin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05366"
FT                   /protein_id="ADH05366.1"
FT                   /translation="MKKPIVQLLLIFTIVSIVLFLLNTSYISLYTFVGALWSITIVGIS
FT                   FVIFIENRSPQSTLAWFLVLALLPIIGVLLYAIFGRSRWRRKKHLHRSEEQRKLFREIL
FT                   EGRRLELLLTVPLNERSIHLTEVIQKFGGGPAADKTTTKLLTNGDQTFSEILRAIEQAK
FT                   HHIHIQYYIYKSDEIGTKVRDALIQKAKDGVIVRFLYDGLGSNTLRRRFLQPMKEAGIE
FT                   IVEFDPIFSAWLLETVNYRNHRKIVIVDGEIGFTGGLNVGDEYLGRSKKFPVWRDSHLK
FT                   IEGKALYKLQAIFLEDWLYASSGLNTYSWDHFMNRQYFPGKEILNAEGAVQIVASGPSS
FT                   DDKSIRNTLLAVMGSAKKSIWIATPYFIPDQETLTLLRLSAIAGIDVRILYPGKSDSII
FT                   SDQASQSYFTPLLKAGASIYSYKDGFMHAKIVLVDDTIATIGTANMDVRSFELNYEIIS
FT                   VLYESKTVHDIKRDFEEDFKHSTEIKWNSFQKRSIKKRILESFMRLISPLL"
FT   gene            639068..639421
FT                   /locus_tag="BMB171_C0549"
FT   CDS_pept        639068..639421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05367"
FT                   /protein_id="ADH05367.1"
FT                   /translation="MNYIENNGLYYRNHHGGHNHGGHNHNGGHHHHGGHNHYDHHHHHG
FT                   GGWGWGGGSSWGGGFFPGSFAGGVLGGLTAGALTGATSGGYYPAPYPVAYPSPYPVTYP
FT                   MPYPGYQQIPYSY"
FT   gene            639902..641605
FT                   /locus_tag="BMB171_C0550"
FT   CDS_pept        639902..641605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0550"
FT                   /product="sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05368"
FT                   /protein_id="ADH05368.1"
FT                   /translation="MLEQRGHALYDSSLRDLKLALDESSIVAITDRKGLITYVNDKFCE
FT                   ISKYKREELIGKDHRILNSGHHPKTFFQDLWKRILNGKVWTGEIRNRAKDGTYYWVKTT
FT                   IVPFLNEKGEPYQFIAIRNDISSRKEAEHRLRLSESRYRELAYHDALTSLPNRLQLITT
FT                   VNELIADKKEFGMIYFDLDRFKLVNDTLGHMIGDLLLSEVASRLHYVLGEKDVLARLGG
FT                   DEFVLLTKNHRQDDMSQLATSVLSCFQAPFMLEGHEVYISASLGLCSYPQDGQDVETLL
FT                   KNSDLAMYSAKEQGRNAACFFTDELRAKINRRMKVEFALQKAIRDEELDVALQPIIDLK
FT                   TKRYSGIEALVRCMTEDGPISPSEFIPVAEESGLIIKLGDWVLEKSCRLFKTLPNYQEG
FT                   LKLSVNLSIQQLMQKRFILSVRSILKRTGFPPNRLILEITESIAVRHFDYIIATLQELR
FT                   NMGVLIALDDFGTGYSSLYYLKQLPLDIVKIDRNFIREFHYDHAQPERTIVKSVIEIAH
FT                   SLNLAVVAEGVETVEQESLLQSMSCDYVQGFYYAKPLSVGELKEKLITDF"
FT   gene            complement(641637..643034)
FT                   /locus_tag="BMB171_C0551"
FT   CDS_pept        complement(641637..643034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0551"
FT                   /product="arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05369"
FT                   /protein_id="ADH05369.1"
FT                   /translation="METKKWGLWVLTAFVIGNMVGGGVFMLPANLAQVSGPMGSTLAWS
FT                   ITGLGVFMIALVFGNLAIRKPELKAGPQSYAQAMFPSKKAGKVAGYSMAWGYWAANWAA
FT                   TASVIISFAGYLSTFFPVLQSKQILFSINGFSLELGKGLTFLVCSLMLWGIQYILSQNI
FT                   DRAGNMNLLATIAKIIGFTMFIVITLFIFNASNFGDGQTFMNEAGQSISLGGQINSAAI
FT                   ATLWAFIGIESAVMLSNRAKSQRDVKKATIFGLIIALLIYMSITLLTMGALPQDALKES
FT                   QKPLVDALNLAIGNKGAYIMALLALISLFGSTVGWIVVSSEVPYQAAKNGLFPKFFGKT
FT                   NKKGSPAKSLLITNVMTQIFLFSTISGTVSEAYSFAIVVATLAYLIPYLVSTLYQLKLV
FT                   ITGETYDILPGSRVKDGIITTLALVYSIWVIKTGTADLKTFFLGIGLFVLGLILYPVLM
FT                   KDSQKTD"
FT   gene            643487..644197
FT                   /gene="treR"
FT                   /locus_tag="BMB171_C0552"
FT   CDS_pept        643487..644197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="BMB171_C0552"
FT                   /product="trehalose operon transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05370"
FT                   /protein_id="ADH05370.1"
FT                   /translation="MMSKYEQIYTEISKSIDNKQLKEGCKIPSETELMKQYEASRGTVR
FT                   KAVDLLQERGYVQKIHGKGVFVLKRKNIEFNFGGIVSFQEENERLGRHCITEVVEMDKE
FT                   KATKDIAKLLNVKEKTEIDHIKRVRNIDGEKVILDINHFVSEFIPGLTKEIATASIYKY
FT                   IEKELGLHISYSQRVIEVQPCTEDDRKYLDLNGTDYVVVVKNFTHLYDGSQFEYTESRH
FT                   RLDIFHFSDVARRK"
FT   gene            644339..645766
FT                   /gene="treB"
FT                   /locus_tag="BMB171_C0553"
FT   CDS_pept        644339..645766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="BMB171_C0553"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05371"
FT                   /protein_id="ADH05371.1"
FT                   /translation="MGKDYRKTAEEVLQYIGGKDNIEQAAHCVTRLRIALKDESKIDND
FT                   KLQSVSLVKGAFHNAGIFQIVIGPGDVDRVYAELITLAGMKESTVADVKDSGNQKLNPA
FT                   QKFVKIFSDVFMPILPAIVTAGLLMGINNLLGAKDLFFDGKNLLDVYPNLGGLWDLINM
FT                   MANTAFVFLPALVGWSATKRFGGSPILGIVMGLMLVHPALLNAWDYGKAATGLEGQKIE
FT                   YFNILGLFQIEKVGYQGQILPVLVAAFVLSKVEIFLKKHVPNAIQLLVVPITTIVVTGV
FT                   LALGIIGPVTRHIGDLLTVGLVGVYETVPVVGAVLFGALYAPLVITGMHHMFIAIDLQL
FT                   IAQHGGTFIWPMIALSNIAQGSAALAMFWISKNQNDKSMASTSAISAYFGITEPAMFGV
FT                   NLRNKFPFYAAIIGSAVAAIFITLNGVLAPAIGIGGLPAFISIIPKSIPMFIVGMIIAV
FT                   VIPFTLTWLFAKRVKQK"
FT   gene            645780..647441
FT                   /gene="treC"
FT                   /locus_tag="BMB171_C0554"
FT   CDS_pept        645780..647441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treC"
FT                   /locus_tag="BMB171_C0554"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05372"
FT                   /protein_id="ADH05372.1"
FT                   /translation="MKDWHKSVVYQIYPKSFNSYYNRETGDIKGVTEKLDYLKELGVDY
FT                   IWLTPIYQSPQNDNGYDVSDYYSIDPSYGTMEEFEELLAEAKVRNIEIMLDIVVNHSST
FT                   EHKWFKEAKEDKNSPYRNYYIWRDEKNNWQSKFGGSAWKYDEKTEQYYLHLFDETQADL
FT                   NWENEKLREEVYDMMRFWLDKGVTGFRLDVINLISKDQCFLNDEGSTATSDGRKYYTDG
FT                   PRVHEYLQEMNRNVFAGKDVITVGEMSSTTIDNCIKYSNPERNELSMTFSFHHLKVDYP
FT                   NGDKWMKAEFDFIKLKEIMSSWQIEMQKGGGWNALFWCNHDQPRIVSRFGDDGKYRNES
FT                   AKMLATAMHMLQGTPYIYQGEEIGMTNPKFESIEQYRDVESLNIYDIKLKEGLSKEEII
FT                   GILKQKSRDNSRTPMQWNEEMNSGFTTSTPWISVAENFKEINVEKALEDKESVFYHYKK
FT                   LIELRKTYDVITEGEYAILDKNDPKIWAYTRTTESEVLLVINNFYGEEITYSVPAHVQL
FT                   DGMKQEILLSNYKDASKDITKLSLRPYESIVYRYTK"
FT   gene            complement(647473..648597)
FT                   /gene="gerKC"
FT                   /locus_tag="BMB171_C0555"
FT   CDS_pept        complement(647473..648597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKC"
FT                   /locus_tag="BMB171_C0555"
FT                   /product="spore germination protein KC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05373"
FT                   /protein_id="ADH05373.1"
FT                   /translation="MFQKRVKLLFILCTSSLLSGCWDQEPLREARLAYSIGYDITEENK
FT                   LQQTLELVKSSSGEQSSFENEIHSANGHNIRDTSDALKKNVTGNIRYFKYGVQLLGTKI
FT                   LKKGILPYLDVSFRDPTNPTALVKLIAVDGETSEILEKKKVGNLLIGDFLKKKVKSLED
FT                   MSVFPKETLETAATKMLDPGKDFTLPSIKIKGKEVITNGLALFNNDKLTGHLPLKQSVL
FT                   FVLLTGKMGTSARITQKLTSDESEKTSDYLTMEISNRKLKRDLKITTDKKGNVYAHIKL
FT                   QLKVIALEAPRDNLYKMDERKKLNKELSTQLTKEAKKITKKLQKANCDAFGIGRHLIAY
FT                   HPDLWKKKNWNKDYAKVKFKPEVEVNILYSGVLK"
FT   gene            complement(648578..649693)
FT                   /gene="gerKB"
FT                   /locus_tag="BMB171_C0556"
FT   CDS_pept        complement(648578..649693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKB"
FT                   /locus_tag="BMB171_C0556"
FT                   /product="spore germination protein KB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05374"
FT                   /protein_id="ADH05374.1"
FT                   /translation="MRTVTNTQSKISLVQFTFFVIQCQIGVGILSLPNRLHPIAKGGGW
FT                   ISALIAGLAIQLIILLMWLFLKRFPDADMYESVCMLFGNKFGKLLGFAYVFYFTLIGMT
FT                   VMLNACNVIKVWVLQATPWYAILLLFTIACCYIAYNTFKVIVRFYVMASILILPMALLI
FT                   ALGLSRADFSYIFPITEAGWWNIIQASKETITAMYGFEIILIAFPKVNGSSVAKLKAIS
FT                   IANGFVTLFYTFTVWICYIVFSPKQIELIPEPVAYLLRSLHIGIIDRTDLLFIPIWMIT
FT                   VVASIASYYCAASIGVGHIFNLANHKKAVPIVGIIAFSVALFIDTPEELKVISTFTDKF
FT                   TYIFIVVLPLLFLLYSVIRNKKGEQYVPKKS"
FT   gene            complement(649665..651167)
FT                   /gene="gerKA"
FT                   /locus_tag="BMB171_C0557"
FT   CDS_pept        complement(649665..651167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerKA"
FT                   /locus_tag="BMB171_C0557"
FT                   /product="spore germination protein KA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05375"
FT                   /protein_id="ADH05375.1"
FT                   /translation="MTEKKEQQESTGQKHMFPSLPENINYIENKLSHSDDIKKLDLPFQ
FT                   NGKGIIIYIESLADPNLIHQLALEPLLTRSDLSLDKAFSTLNMKKETNLNYGVQLLLQG
FT                   KSLYFHEHVESFCIFETALSLKRDITEPDNEGIVRGPHTGFVEDLATNLASIRKLIKSP
FT                   NIVVKYFTLGEEMHTKVAIAYMQNIANDDLVTEVKRRLETIKTDALMPPGYIQEFIEDT
FT                   SFSPFPQQLNTERPDRTAANLMEGRIAILSDGDPTALIVPVTLFAFYQSPDDYNNRWIV
FT                   GSFVRMIRLVSFLIAFLLPAIYIATVAFHPDVLPLELVYTIKASLEKVPLPPIFEALLM
FT                   ELIFELLREAGIRLPSRVGQTIGIVGGLVIGDAIVKAGLVSYTMIIVVALTAISSFLVP
FT                   SNDMSSAVRILRFPLMILAAIFGYVGISFGLIITFVHLCQLHSFHTPYLSPVAPMRIKD
FT                   MKDSFVRLPIWSFWERPHDPKPKKMQRQHVTREDEDGDKHAK"
FT   gene            651317..652003
FT                   /locus_tag="BMB171_C0558"
FT   CDS_pept        651317..652003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0558"
FT                   /product="CAAX amino protease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05376"
FT                   /protein_id="ADH05376.1"
FT                   /translation="MTLRDMWGWKEILYLFMFVFVIVPVTVESLFYKYILEIIGNSLYA
FT                   GVLMGFIMAVIFTTVVYLFCIKRYKLSWKDIGIRKLSWKDLLWTVGAVIFLIVASIAVL
FT                   VIMEKMGISFENSKTETVQNDKSIYSFCIVVIGAAIISPIYEEILYRGVFYTFFRDRYG
FT                   MWGGMFISSIIFTVVHIPTYNTLLVNFLSGVVFAWLYEKTNSILSAMIAHALFNFIAVL
FT                   LTFVSN"
FT   gene            652027..652998
FT                   /locus_tag="BMB171_C0559"
FT   CDS_pept        652027..652998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0559"
FT                   /product="putative protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05377"
FT                   /protein_id="ADH05377.1"
FT                   /translation="MEIAVERVFTKEILKRAVNLFHVTVEEKPLGDFENYIFKAKGDND
FT                   EDYVLRLTHSSHRSKQEVEAELDFLRYVAENGAKVAGPLYSTSRNLVEEIVAEDGTFFF
FT                   ASLFIYAKGEQVKGAESPYWGDAYFEAWGKAIGQLHRLTMDYPKTDYRDTWEEDESGIV
FT                   NELEDGQVKEIAAVLMDEIKALPVERETFGLMHGDIHQGNFHYDGKELTIFDFDDAAYN
FT                   YFIHDLAMVLYYSVLFTPWTAEEKTDFARKQLQVLRKGYEYEHRLADSWYESLPLFLRL
FT                   RDIGLYGTLQKKFKGKDMPDNFLKLSEELYERIIKREAIVNI"
FT   gene            653155..654618
FT                   /locus_tag="BMB171_C0560"
FT   CDS_pept        653155..654618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0560"
FT                   /product="Sodium/proton-dependent alanine carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05378"
FT                   /protein_id="ADH05378.1"
FT                   /translation="MLEAFVNWLNNIVWSPALVYLCLGVGLYFSIRTKFLQVRHVGEMV
FT                   KLTFQGEKSEAGVSSFQALALSLSGRVGTGNIAGVATAVAFGGPGAVFWMWAVAFLGAG
FT                   SAYVESTLAQIYKTKHQGQFRGGPAYYIEKGLGVKWYALVFVAATILATGLLLPGVQAN
FT                   SIAVSLETAFGINTTVSGAILVVVLALIIFGGVKRIVNVAQVVVPFMAIGYILVACVIV
FT                   AMNIEKLPEAFMLIIRSAFALEAAFGGIIGLAISWGVKRGIYSNEAGQGTGPHAAAAAE
FT                   VSHPAKQGLVQAFSVYIDTLFVCSATAFMMIITGMYNVFDASGKNFIVNKLNGAQPGPG
FT                   YTQAAVEFVFPGFGNGFVAISLLFFAFTTIMAYYYIAETNIAYLNRDKDRPWMSMVLKF
FT                   VFLGAVFYGCIKTAATAWALGDIGVGIMAWVNIIAILLLQKPALVALKDYEKQKKEGKD
FT                   PVFDPGPLGIKNADFWEHEYGKDKKEEVS"
FT   gene            654750..655481
FT                   /locus_tag="BMB171_C0561"
FT   CDS_pept        654750..655481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0561"
FT                   /product="glutamine transport ATP-binding protein glnQ"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05379"
FT                   /protein_id="ADH05379.1"
FT                   /translation="MLIEFRNVNKYYGNFQVLKNINVQVKKGEVVVVVGPSGSGKSTLL
FT                   RCINQLEAITDGELIVQNTEVHNKKTDMNDLRRNIGMVFQHFYLYPHKTVLQNITLAPI
FT                   KVNKISKEEAEKTAMFYLEKVGIPEKASVYPHQLSGGQQQRVAIARGLAMQPEIMLFDE
FT                   PTSALDPEMIGEVLDVMKTLAKEGMTMVVVTHEMGFAREVADRILFMDDGQIIEDTTPA
FT                   NFFANPEQERARLFLSRVLNH"
FT   gene            655494..656324
FT                   /locus_tag="BMB171_C0562"
FT   CDS_pept        655494..656324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0562"
FT                   /product="glutamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05380"
FT                   /protein_id="ADH05380.1"
FT                   /translation="MLKMKKLFTLIVFSCLFVLVVAGCGSKKDEAKETNTKQGGAVEQI
FT                   KKRGKLVVGVKNDTNLFGLKNPSTGQVEGFDVDVAKALAKKILGDEKKLELKEVTSKTR
FT                   IPLLKNGDIDAIIATMTITEERKKEVDFSDVYFKAGQSLLVKKGSEIKSIDDVKKGVKV
FT                   LAVKGSTSTNNIRQKSPEATVLEFENYSEAFTALKAGKGDVLTTDNAILYGMAKQDSNY
FT                   EVVGKIFTDEPYGIAVQKGADDLTKEINSLLKDMKANGEYDKLYEKWIGQKQEK"
FT   gene            656425..657081
FT                   /locus_tag="BMB171_C0563"
FT   CDS_pept        656425..657081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0563"
FT                   /product="glutamine transport system permease protein glnP"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05381"
FT                   /protein_id="ADH05381.1"
FT                   /translation="MPDFSILTNNIDMYLEGFKYTVMSSVIALIGSFILGVILAVMRIA
FT                   PIRILNWIGSAFVEFVRNIPLVLIAFIFYFALPVIGITLNGFVAGTVTLTVYTAAFIAE
FT                   VIRAGILSVAKGQMEAARSSGLTYVQGMYYIVLPQAMKIVIPPLGNQFLNLVKNSSILG
FT                   IIAGMDLMYQGDLISTKTFVTFDVYIFVGMFYLILTIPLSMLVRYLEKRLAKEAV"
FT   gene            657082..657726
FT                   /locus_tag="BMB171_C0564"
FT   CDS_pept        657082..657726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0564"
FT                   /product="glutamine transport system permease protein glnP"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05382"
FT                   /protein_id="ADH05382.1"
FT                   /translation="MDFKGAITGDHILFLLKGLLITLEVALIAIVLSFIIGSVIGILRY
FT                   TKIPVVSQVLGVIVEVIRNLPLLLIIFFTYFALPEAGLKLEIITAAIVALTIFEAAMIS
FT                   EIVRSGLLSIEKGQVEAARSSGLTYVQALWHIILPQALRRMVPPLVSQFISLLKDTSLA
FT                   VVISLPELMHNAQIISGQNVNYMIPTFIVVACMYFIVNYSLSILSRRLELR"
FT   gene            657930..659357
FT                   /locus_tag="BMB171_C0565"
FT   CDS_pept        657930..659357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0565"
FT                   /product="arginine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05383"
FT                   /protein_id="ADH05383.1"
FT                   /translation="MQQPTNEKLHRTMKSRHLFMIALGGVIGTGFFLGSGYTINQAGPG
FT                   GAILSYLVGGFIMYLTMLCLGELTVAMPVSGSFQKYATKFIGPGTGFMIGWLYWLGWAV
FT                   TVGLELTSIGLMMKRWFPNVDVWVWCLVFGVILYASNAISAKSYAELEFWFSSIKVITI
FT                   LAFVVLGGSALLGFISYDGKEAAPLFSNFVSDGGLFPNGLAAVLLTMITVNFSFQGTEL
FT                   IGIAAGESENPEKTIPRAIRNTVWRIMLFFILTMTILVGLISWKEAGVIESPFVVVFDK
FT                   IGIPYAADIMNFVIITALLSVANSGLYAATRILWSLANEGMAPTSFQKVNKRGIPITAL
FT                   VVTIAVAGLSLFTSFLAEDTVYMYLLSIAGLSAVSSWIIIALSQLRFRSQYIKGGGKLE
FT                   DLKYRTPLYPIVPILALITNSIVVISLAFIPEQRMALYCGIPFIIFCYIYYYISKKRQK
FT                   PMKVEMEKTNETNNQTR"
FT   gene            659332..659709
FT                   /locus_tag="BMB171_C0566"
FT   CDS_pept        659332..659709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0566"
FT                   /product="OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05384"
FT                   /protein_id="ADH05384.1"
FT                   /translation="MKLTIKHDDIEADLSYGQLVIGKENGYSPLQLLISSIAGCSAIVF
FT                   RTILEKKRITYDTFTIETEIGRSEALSKPVESVHLHYKIKAENITEEQLDKALQLAVKN
FT                   CTIVQSVKDSIKVTETIELIK"
FT   gene            659770..660207
FT                   /locus_tag="BMB171_C0567"
FT   CDS_pept        659770..660207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0567"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase
FT                   (asymmetrical)"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05385"
FT                   /protein_id="ADH05385.1"
FT                   /translation="MMECLGCKLANEEEKIYKIYEDDYVTCFLDHEPFYTGHTLIVPKQ
FT                   HVVEVDELDDVVAKSIMDASKLIAKAIKVLYKPDGITICQNGGIFNELTHYHMHVVPRY
FT                   KERSFAEFYTVQSGEKKNHNLEEIKTLLEEEIEKTLHTKKA"
FT   gene            complement(660229..661197)
FT                   /locus_tag="BMB171_C0568"
FT   CDS_pept        complement(660229..661197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0568"
FT                   /product="DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05386"
FT                   /protein_id="ADH05386.1"
FT                   /translation="MLKRKKVIHLSKAKRLLDILIFASAKKTFTAQEIADEFNISVRTV
FT                   HRYILDLSDMGLPIYAEQGRNGGYKVLTNRVIPPILFTEEEAVSIFFAFQSLSYYRDLP
FT                   FNTEINSVTHKLYSSLQHDAKTKVDKIRSYIAFWNPKRTIDTPLLNEVLTAAIENKNLH
FT                   FQYESKSGIKTKHVHPIGVYAHDGLWYLPSYDFGRKKVLLYRIDRILSILSMEENTDTF
FT                   MNLEEWFASNSNVVHNPTQLHVLLTTEGVRQCKSVPYLEEFVIVNEDGTGYIHSTIDKG
FT                   EINFITPLFYRLGKDAKVLEPKELIDGLRMRAKEVLSMYED"
FT   gene            661277..661798
FT                   /locus_tag="BMB171_C0569"
FT   CDS_pept        661277..661798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0569"
FT                   /product="pyrimidine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05387"
FT                   /protein_id="ADH05387.1"
FT                   /translation="MSREIVLFIAASLDGYIAKENDDLEWLMETEGEGDNGYTEMYETI
FT                   DTIIMGKKTYDYVVEHTETFPYLDKSCYVFSRSEKGSDGNVEFVNEDVVEFTKRLKAKE
FT                   GSKIWMVGGGELLREFFKNNLIDEYVVTITPHILGSGVPLFQDKNPEINLTLTDTKRFG
FT                   QFVNLYYKVK"
FT   gene            complement(661964..663355)
FT                   /locus_tag="BMB171_C0570"
FT   CDS_pept        complement(661964..663355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0570"
FT                   /product="two component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05388"
FT                   /protein_id="ADH05388.1"
FT                   /translation="MKRISIQFGFYFLIVTLLIESVLFILLYYSLVNTRVNEEMTALLK
FT                   RGNSHRDVLEKYYDEQTISHVALMESEAETTVVITNANKEILAKSNEINTTINDHISKM
FT                   QTRTDHNGAIIENHWKTSNYICTVSPIVVDGKHEGYVYMFLGTESIEKLVNGLTKQFII
FT                   AGAITFLLTVITIFLLSRLLTKPLLHMKHATEKMSKGDLSVSLTTTRNDEIGELASSIQ
FT                   TLANDLHYMKTERSEFLASVAHELRTPLTYVRGYADIALKESTPSEQRLRYLSIIKDES
FT                   DYITNLVQDLFSLAQMEQHNFSIQVKEVHLHTFLTRICEKVNAMYKERYIKVSFSCPPT
FT                   LLVNLDEQRFEQVVVNILNNAYRHSKEHSHINISITEEHKRISITIEDEGEGIPLEDLP
FT                   HIFDRFYRVDKARSRATGGTGLGLSIVKEIVELHGGTITVTSEVDHGSCFIISLPSVKK
FT                   HDYHQ"
FT   gene            complement(663367..664044)
FT                   /locus_tag="BMB171_C0571"
FT   CDS_pept        complement(663367..664044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0571"
FT                   /product="two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05389"
FT                   /protein_id="ADH05389.1"
FT                   /translation="MIDILLVDDEPRMLELLTLYLTPIGYNCVCATSGEEAILHIENQN
FT                   FKFVLLDIMMPKMDGWETCKKIRSFSNIPIIMVTARDQTVDVVQGLKIGADDYVTKPFH
FT                   EEELFARIEAVLRRTNEHKQIQYHGIVWDETKHFVSVHNEELLLTPIEFSLLGLFLRHV
FT                   NYVLNRDQLIERIWGLNTNTEDRTVDSHIRNLRDKLRKANFPIDHHLKTVYGVGYRWIN
FT                   TEQ"
FT   gene            664229..665467
FT                   /locus_tag="BMB171_C0572"
FT   CDS_pept        664229..665467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0572"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05390"
FT                   /protein_id="ADH05390.1"
FT                   /translation="MTRIFGITIITAVGLAACGQTNTDHKNHESTKEKKTEQKEMKMNQ
FT                   EVTAPKEMNQGASNDLLTTSLKNVTRLNTNDPSQMAVLTSQTIWPATHKENQPGAVILV
FT                   PASEWQLGIASADFIHHPNNGPILFIEKEKIPEMTLKEIKRLNPIGTKDGTQIMVMGDV
FT                   GTSALEQLKGYKVKQIKETDPAIFAKDVDKEYADITGSYPNSVIIGSSAEEGRLYTTPA
FT                   VNWISHMPEPLLYTEKNKVPEATIEALKMRKDKANIYVLGPEKIVSKEVEKELSKYGKV
FT                   TRISGETPTENSIAFAKFKDEKTKFGWGFTKPGHGLSFVSSKTPDLAVAGAPFSHMGKH
FT                   APVVLLEEGKASQTVYDFLASIQPKFKDDPTLGPYNHGFLLGNTSDISFETQGILDERL
FT                   EIVQESGQGHGGH"
FT   gene            665624..667075
FT                   /locus_tag="BMB171_C0573"
FT   CDS_pept        665624..667075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0573"
FT                   /product="Sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05391"
FT                   /protein_id="ADH05391.1"
FT                   /translation="MFQTIKNDWFSNVKGDVLSGIVVALALIPEAIAFSVIAGVDPTVG
FT                   LYAAFCIAVTISFVGGRTGMISAATGAMALLMVTLVKDHGLQYLFATTILTGIVQIIFG
FT                   VFKLSSFMKFVPKSVMSGFLNSLGILVFTAQLPHFKNATWQMYALVVLGLAIIYLFPRI
FT                   TTAVPSTLISIIIVTSIALMSGLQLKTVGDMGSLPKELPFFSIPDVPFTLETLGIILPY
FT                   AVMLAIIGLLESLLTASVLDDMTHTESNKHKEARGQGIANIVAGFFGGMAGCAMIGQSV
FT                   INIKSGGRGRLSTFVAGGFLIVLLFVLGDYVVHIPMAALVAVMIMVSIGTFDWNSVATI
FT                   HKVPKGNAFVMIVTVVVVLITHNLGLGVIIGTVISAVLFAFNMAKIHVKHLYIENKKIY
FT                   EIHGQLFFASTADFINAFSLDEGIKEIEMNFTHAHVWDDSAVASIDKVIMKYEQSGVKV
FT                   SITGLNERSSKLVANLATYNKRIAS"
FT   gene            667141..667563
FT                   /locus_tag="BMB171_C0574"
FT   CDS_pept        667141..667563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0574"
FT                   /product="universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05392"
FT                   /protein_id="ADH05392.1"
FT                   /translation="MYKQIILACDGSEHALRAAEHATYIAKCSEETNVEVVYVVDNRTA
FT                   KSDIIQGQTDLETISASRKDKLKEIEGLLKKENISYTITILHGDPGDTIVQYVNTGDID
FT                   LVIAGSRGLNTLQEMVLGSVSHKIAKRVKCPVMIVK"
FT   gene            complement(668002..669351)
FT                   /gene="glpT"
FT                   /locus_tag="BMB171_C0575"
FT   CDS_pept        complement(668002..669351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="BMB171_C0575"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05393"
FT                   /protein_id="ADH05393.1"
FT                   /translation="MFFTQLFKPAPHAERLPADRVDSEYRKLRLQVFLGIFIGYAGYYF
FT                   VRKNFSLAMPYLIEQGFSKGELGVILSAVSIAYGLSKFLMGIVSDRCNPRYFLAAGLFL
FT                   SGIINIIFGSFSFITTSIILMFVLQFLNGWVQGMGWPPCGRTMVHWFSISERGTKMSIW
FT                   NVAHNVGGALMPSLVTLGLYFFADDWKSIFYFPGILSILVGIYVLITMKDTPQSCGLPS
FT                   IEEHTGEYPPDEKVKDRERELSVKEILFKYVLNNKFLWYIAIANVFVYFVRYGVVDWAP
FT                   TYLVEEKSFTHSSSRTAYALYEWAGIPGTLLCGWMSDKLFKGRRAPAGILFMVGVFIAV
FT                   LVYWLNPPGNPMVDSIALVAIGFLIYGPVMLIGLHALDLAPKKAAGTAAGLTGFFGYLG
FT                   GAAFASAAMGFIVDAFGWDGGFILLLASCVLAMFFLALTLNTGSVKSKQA"
FT   gene            669621..670079
FT                   /locus_tag="BMB171_C0576"
FT   CDS_pept        669621..670079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0576"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05394"
FT                   /protein_id="ADH05394.1"
FT                   /translation="MPNDMTHIDKIQALAFSIGKKMQTELLEQMQATGLTPPQFYILKI
FT                   LDHYGASRATTLAKKMYVKPSAITVMIDRLIDQELVERYHDKDDRRVVIIELTKKGKAR
FT                   VEEAMTARNEHIAKYFSHLELQEREDLLRLFEKLETIICGTQEKKENN"
FT   gene            670099..671712
FT                   /locus_tag="BMB171_C0577"
FT   CDS_pept        670099..671712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0577"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05395"
FT                   /protein_id="ADH05395.1"
FT                   /translation="MEQQENQNRKLLLIGLVIAMLFAALDGTIVGTAMPRIVGDLGGLS
FT                   LMTWLTTAYMLTSTTVVPIAGKLADLLGRRNVYITGLVIFMIGSALCGMANGMTELIIF
FT                   RGIQGLGGGIMMPMAMIIIGDMFTGKERAKWQGIFGALYGLASVIGPQVGGWIVDAVNW
FT                   RWVFYINLPVGILATIFIAMGLKSHKQTGPIKIDIAGIFTMILGVVSLLLALTFGGKDY
FT                   AWDSWQIIGLFALAVIGIVSFVIVETKAEEPILPMHFFKNRTFTILNAIGFFMSIGMFG
FT                   AIMFVPFFMQGIVGVSAAESGTIMTPMMITMIVMSIIGGQLVLKVGVKPQIIAGMLIMA
FT                   GGFWLLTTMDMHTTKLTATSYMMVIGLGMGLVMPTLTLALQESFPKKDLGVVTSSSQFF
FT                   RQIGGTFGITILGSIMNNTSGTTLTNKLVPVLDTFPKEAGQMVTKFKDMIHTDPQGLYS
FT                   MLFSPEALKQMPEAFANSIVPILKNSLVDSLHTVFLTGLVFIVVGAIFTIFLQKIKLSD
FT                   RKKDAEEPAVEEKEKTVSYS"
FT   gene            671850..672821
FT                   /gene="rbsR"
FT                   /locus_tag="BMB171_C0578"
FT   CDS_pept        671850..672821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="BMB171_C0578"
FT                   /product="ribose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05396"
FT                   /protein_id="ADH05396.1"
FT                   /translation="MSTIKDVAKLAGVSVATVSRVLNKNGYVHEDTLKKVERAIEMLDY
FT                   KPSTVARSLYNKKSRLIGLVVPNIVNPFFPEVARAVEDVAHKQGYTVVLCNSDESLEKE
FT                   KQYIDVLRQNNVDGFIVATNPQNSVNYMNLSVPVVAIDRMFNERIPTVYADNYAGSQAA
FT                   TKLLLDKGCKHIAHIRGPRDVSTANERFEGFVDVITQNNLSYMIAESTFEPANSERVAM
FT                   ELLEEYPHIDGIVAGNDLIAIGIVKAALQKGIAIPDDLQIIGFDGISLTEMMYPSITTV
FT                   AQPIYEMGKIATELLLEQMEGNTLEEKHYRLPIEIIERNTTK"
FT   gene            672835..673731
FT                   /gene="rbsK"
FT                   /locus_tag="BMB171_C0579"
FT   CDS_pept        672835..673731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="BMB171_C0579"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05397"
FT                   /protein_id="ADH05397.1"
FT                   /translation="MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQA
FT                   VAAARLGANVAMVGAVGNDDYGTVVRKNLENERIFIDYVVPVTDRTTGIAHIVLAEEDN
FT                   SIVVVQGANALVNKSVVDRSKDLLVKADMVVLQLEIPLETVKYVLAICEEHNIPVMLNP
FT                   APAQVLSEEILEKATYITPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHN
FT                   GTEIVHVPSIAVDVVDTTGAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQ
FT                   GGMPTRDRVREVQVIVG"
FT   gene            673728..674123
FT                   /gene="rbsD"
FT                   /locus_tag="BMB171_C0580"
FT   CDS_pept        673728..674123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="BMB171_C0580"
FT                   /product="D-ribose pyranase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05398"
FT                   /protein_id="ADH05398.1"
FT                   /translation="MKKHGVLNSEIAAVLASLGHTDTVVIADCGLPIPDGVKRIDLAVE
FT                   IGKPSFLEVLQVVADDMAIEKVTLAEEVIINNAEVNKEIEQKLIEPAFEYVSHEQFKEH
FT                   TKKAKAIIRTGEATPYANVILHAGVIF"
FT   gene            674136..675626
FT                   /gene="rbsA"
FT                   /locus_tag="BMB171_C0581"
FT   CDS_pept        674136..675626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="BMB171_C0581"
FT                   /product="ribose ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05399"
FT                   /protein_id="ADH05399.1"
FT                   /translation="MGMHIEMKNISKAFNGNPVLKNAQFMIETGEVHALMGENGAGKST
FT                   LMKILTGVYKKDGGTIKIDGQERTFKNAKEAEEYGIAFIHQELNILPNLTVAENMFLGK
FT                   ELMYGKTGILRTRQMNAIAQQQLAELGLHVRGAMLAEELSVGQQQIIEIAKALMTNASV
FT                   IIMDEPTAALTDREIETLFTVINKLRKEGVSFVYISHRMEEIFSICDAITILRDGEYVG
FT                   KRLIPETSFDEVVSMMVGRSIGERYPERNSQIGDVIFEMRNGTKKGKFENVSFQVRKGE
FT                   ILGVAGLMGAGRTDIMKAIFGYEPLDSGQIFINGQEVKIDSPIDAIRQRIAFITEDRKS
FT                   EGLVLDFSIRENLALPNLENLSKGSVLSNELEQQFTEDMMKLLNVKASSGEQAVKSLSG
FT                   GNQQKIVIAKWLGIHPQLLILDEPTRGVDVGAKKEIYSIMNKLTEQGDAVIMVSSELPE
FT                   VLGMSDRVLVIHEGKVGGILGKDEASQESIMALATGGE"
FT   gene            675629..676564
FT                   /gene="rbsC"
FT                   /locus_tag="BMB171_C0582"
FT   CDS_pept        675629..676564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="BMB171_C0582"
FT                   /product="ribose ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05400"
FT                   /protein_id="ADH05400.1"
FT                   /translation="MAKKGNVLQQLGSLIGLVLIIVVITALNPAFIEIPNLFNILRQVS
FT                   INALIAFGMTFVILTGGIDLSVGSILALSSALVAGMMASGMDPFLAMAVGLLAGLVMGI
FT                   VNGIIIAKGKVAPFIATLATMTIFRGLTLVYMDGRPITGLGDHLMFQMFGRGYFLGIPV
FT                   PAVTMMIAFAVLYFILKKTTFGRRTFAIGGNEEAAALSGINVTRIKVMIYGLSGILAAL
FT                   AGIVLTSRLDSAQPTAGTSYELDAIAAVVLGGTSLSGGRGWIVGTFIGVLIIGVLNNGL
FT                   NLLGVSSFFQQVVKGLVILLAVLIDRRKEA"
FT   gene            676579..677505
FT                   /gene="rbsB"
FT                   /locus_tag="BMB171_C0583"
FT   CDS_pept        676579..677505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="BMB171_C0583"
FT                   /product="catabolite control protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05401"
FT                   /protein_id="ADH05401.1"
FT                   /translation="MKKWLLILVACIMVITAGCSMEPPEWAKDSSDKGRNKTIKVGFSV
FT                   STLNNPFFVTLKKGAEKKAKDSGIELIAVDAQNDAAKQTNDVEDLIQKGVDVVVINPTD
FT                   SDAVASAVSAANAANVPVITVDRVANSGKVVSHIASNNIEGGQMASDYIRELVGEGANV
FT                   AELEGIPGSSAARERGKGFHNVADKSLKVVAKQAADFDRAKGLSVMENILQANSDIKAV
FT                   FAHNDEMALGALEALKSAGKTDVVVVGFDATEDAVKAVNDGRMAATVAQKPELIGEKAM
FT                   QTAKEITQGKKVDKSIPIELELIKKNK"
FT   gene            677540..678187
FT                   /locus_tag="BMB171_C0584"
FT   CDS_pept        677540..678187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0584"
FT                   /product="putative translaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05402"
FT                   /protein_id="ADH05402.1"
FT                   /translation="MKFFIDTANINEIKEANELGVLAGVTTNPSLVAKEGVDFHERIRE
FT                   ICNVVEGPVSAEVISLEADKMIEEGKELAKIAPNVVVKVPMTTEGLKAVKAFSDLGIRT
FT                   NVTLVFSAVQALLAARAGATYVSPFLGRLDDIGHNGMDLIRQIAEIFAIHGIETEIIAA
FT                   SVRHSVHVTDAALNGAHIATIPANVIASLVKHPLTDQGIEKFLADWEKTQEK"
FT   gene            678570..680969
FT                   /gene="inhA"
FT                   /locus_tag="BMB171_C0585"
FT   CDS_pept        678570..680969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="inhA"
FT                   /locus_tag="BMB171_C0585"
FT                   /product="immune inhibitor A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05403"
FT                   /protein_id="ADH05403.1"
FT                   /translation="MRRKAPFKVLSSLAIAAIIGCTSVMSAPLAYAETVAKEKDSVSTT
FT                   PIDYNLIQEDRLAEALKERGTINPASSKEETKKAVEQYIEKKQGDQANKEILPDAHSQE
FT                   TSDFTKKVKEKKMEEKENVKKAEKNVSLEQKPEPNKKQLNGQVPTSKAKQAPYKGSVRS
FT                   DKVLVLLVEFSDYKHNNIDQTPGYMYSKDFSREHYQKMLFGNEPYTLFDGSKVKTFKQY
FT                   YEEQSGGSYTTDGYVTEWLTVPGKASDYGADGSSGHDNKGPKGARDLVKEALYAAAEKG
FT                   LDLSQFDQFDRYDTNGDGNQNEPDGVIDHLMVIHAGVGQEAGGGKLGDDAIWSHRSKLA
FT                   VDPVAIEGTKSKVDYFGGKVAAHDYTIEPEDGAVGVFAHEFGHDLGLPDEYDTKYTGNG
FT                   SPVEAWSLMSGGSWTGKIAGTEPTSFSPQNKDFLQKNMGGNWAKILEVDYDKIKSGVGV
FT                   PTYIDQSVTKSNRPGVVRVNLPGKSVETIKPEFGKHAYYSTRGDDMHTTLETPFFDLTK
FT                   GTNAKFDYKANYELEAECDFVEVHAVTEDGTKTLIDRLGEKVVQGDKDTTDGKWIDKSY
FT                   DLSQFKGKKVKLQFDYITDPAVTYKGFAMDNVNVTVDGQVVFSDDAEGQSKMNLNGFVV
FT                   SDGTEKKAHYYYLEWRNYAGSDNGLKAGKGPVYNTGLVVWYADDSFKDNWVGVHPGEGF
FT                   LGVVDSHPEALVGNLNGKPAYGNTGMQIADAAFSFDKTPAWSVNSLTRGQFNYSGLQGV
FT                   TTFDDSKVYSNKQIADAGRKVPNLGLKFQVVGQAEDKSAGAVWIKR"
FT   gene            complement(681628..682656)
FT                   /locus_tag="BMB171_C0586"
FT   CDS_pept        complement(681628..682656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0586"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05404"
FT                   /protein_id="ADH05404.1"
FT                   /translation="MYSFANMIGNIIAGAAVDKFGAKKILYISMGITSFIVLLYTVVQS
FT                   GEQLLVVRFMHGFSDGFLIPAAFTFLSKQTNAKRQGKAMALSGAAVGTAAIVGPAFSGI
FT                   MKATAGVEWVFITISILMALGTIVSLFFLPNNVSRKDTSRTQMMNKEDMVELLKSEPLL
FT                   QAYIGAFTLMFSQGIVTYMLPVKVEALALKASTTGMMLSVFGITAILFFLLPTNRIYDR
FT                   FNRSKLMLIGIAVMAFALSLLGLFATKGMLFIVMMIYGIGFAILFPSINALLVENTTDD
FT                   NRGKAFGLFYAFFSLGVVAGSFTVGAIGASPSISFIIGTAFLLTFAGMIYVRSKVKKTM
FT                   MG"
FT   gene            683008..684060
FT                   /locus_tag="BMB171_C0587"
FT   CDS_pept        683008..684060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0587"
FT                   /product="(R,R)-butanediol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05405"
FT                   /protein_id="ADH05405.1"
FT                   /translation="MKALLWHNQRDVRVEEVPEPTVKPGTVKIKVKWCGICGTDLHEYL
FT                   AGPIFIPTEEHPLTHVKAPVILGHEFSGEVIEIGEGVTSHKVGDRVVVEPIYSCGKCEA
FT                   CKHGHYNVCEQLVFHGLGGEGGGFSEYTVVPEDMVHHIPDEMTYEQGALVEPAAVAVHA
FT                   VRQSKLKEGEAVAVFGCGPIGLLVIQAAKAAGATPVIAVELSKERQELAKLAGADYVLN
FT                   PATQDVLVEIRNLTNGLGVNVSFEVTGVEVVLRQAIESTSFEGQTVIVSVWEKDATITP
FT                   NNLVLKEKEVIGILGYRHIFPAVIKLISSGQIQAEKLITKKITVDQVVEEGFEALVKDK
FT                   TQVKILVSPK"
FT   gene            684179..684523
FT                   /locus_tag="BMB171_C0588"
FT   CDS_pept        684179..684523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0588"
FT                   /product="potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05406"
FT                   /protein_id="ADH05406.1"
FT                   /translation="MLSFMLTLKRMLKACLRAWKDKEFQVLFVLTILTLISGTIFYSTV
FT                   EGLRPLDALYFSVVTLTTVGDGQFSPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQL
FT                   PSILSNRKKE"
FT   gene            684777..685628
FT                   /gene="plC"
FT                   /locus_tag="BMB171_C0589"
FT   CDS_pept        684777..685628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plC"
FT                   /locus_tag="BMB171_C0589"
FT                   /product="phospholipase C"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05407"
FT                   /protein_id="ADH05407.1"
FT                   /translation="MKKKVLALAAAITLVAPLQSVAFAHENDGGQRFGVIPRWSAEDKH
FT                   KEGVNSHLWIVNRAIDIMSRNTTLVKQDRVALLNEWRTELENGIYAADYENPYYDNSTF
FT                   ASHFYDPDNGKTYIPYAKQAKETGAKYFKLAGESYKNKDMKQAFFYLGLSLHYLGDVNQ
FT                   PMHAANFTNLSYPQGFHSKYENFVDTIKDNYKVTDGNGYWNWKGTNPEDWIHGAAVVAK
FT                   QDYAGIVNDNTKDWFVRAAVSQEYADKWRAEVTPMTGKRLMDAQRVTAGYIQLWFDTYG
FT                   NR"
FT   gene            685705..686706
FT                   /gene="sph"
FT                   /locus_tag="BMB171_C0590"
FT   CDS_pept        685705..686706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sph"
FT                   /locus_tag="BMB171_C0590"
FT                   /product="sphingomyelin phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05408"
FT                   /protein_id="ADH05408.1"
FT                   /translation="MKGKLLKGVLSLGVGLGALYSGTSAQAEASTNQNDTLKVMTHNVY
FT                   MLSTNLYPNWGQTERADLIGAADYIKNQDVVILNEVFDNSASDRLLGNLKKEYPNQTAV
FT                   LGRSSGSEWDKTLGNYSSSTPEDGGVAIVSKWPIAEKIQYVFAKGCGPDNLSNKGFVYT
FT                   KIKKNDRFVHVIGTHLQAEDSMCGKTSPASVRTNQLKEIQDFIKNKNIPNNEYVLIGGD
FT                   MNVNKINAENNNDSEYASMFKTLNASVPSYTGHTATWDATTNSIAKYNFPDSPAEYLDY
FT                   IIASKDHANPSYIENKVLQPKSPQWTVTSWFQKYTYNDYSDHYPVEATISMK"
FT   gene            686814..687986
FT                   /locus_tag="BMB171_C0591"
FT   CDS_pept        686814..687986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05409"
FT                   /protein_id="ADH05409.1"
FT                   /translation="MDRGIFKEVPLPCAFLDEVALDRNIQSIIELSGNKKIRIASKSLR
FT                   SVPIMQKILAANDRFQGIMCFSPREVLFLIEQGFNDLLLGYPAYDERALCEISLLTKKG
FT                   FIITCMVDCEEHIVYLEKIAEKSKGCFRVCLDIDMSSRFFQFHFGVQRSPVKNVQDALK
FT                   VVEKVRRSSYLMLDGVMGYEAQIAGVGDHIPNQWLKSKVISYLKQKSVLEVKERREYIV
FT                   KAIQKLGIELRFVNGGGTGSIKTTEKDNSVSEITIGSAFYSPKLFDYYKEVKFHPAVGF
FT                   ALPVVRKPVPFIYTCLGGGYIASGAVGKDKEPEVWRPKGAKLLALEGAGEVQTPIFYSG
FT                   EERVDIGESILFRHSKAGELCERFPFLYRVKKGEIVGEYSTYRGDGQCFL"
FT   gene            687974..689290
FT                   /locus_tag="BMB171_C0592"
FT   CDS_pept        687974..689290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0592"
FT                   /product="flavin-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05410"
FT                   /protein_id="ADH05410.1"
FT                   /translation="MLSIKGQKWRNWTGNVEGTPHYTMYPESIQDVVEVVGLARKKGRK
FT                   IRVVGSGHSFTPLVQTEEVLVSLDELKGIVNIDEEKMVAEVWAGTKLYDLGKLLEEKGY
FT                   AQENLGDIDSQSIAGAISTGTHGTGITFGSLSTQVIEITAVLSNGESIVCSEAENVEYW
FT                   RAFQLSLGMLGIIVKIKLKVIPAYSLVYESEKQSLSTVMNKLEEYKKHRHFEFFVFPYS
FT                   DEVQVKLTNETTHTGSDLKWHKLKVELLENRMFSLLSKGCKWFPSISKGVSRLSAKAVP
FT                   NTKIIGPSYEVFATSRTVPFYEMEYSIPSKYMRTVVEEISNLIEKKKYKVHFPIECRYV
FT                   KGDDIWLSPAYGRDSAYIAVHMYKGMKYAAYFGEVEKIFLKYEGRPHWGKMHTLSYEQL
FT                   QDIYPEFHSFLQARKSLDELGMFFNPYAEKLFIPLFAGQ"
FT   gene            complement(689344..690495)
FT                   /locus_tag="BMB171_C0593"
FT   CDS_pept        complement(689344..690495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0593"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05411"
FT                   /protein_id="ADH05411.1"
FT                   /translation="MTAYLFPVKTAFILFPFLAMFLLIPFLIFNYRKYGYLNKWRSFIL
FT                   YSLLLYLLNAYFLVILPLPQTFDTCSLQPANTQHMQLSPFYFIQEISSHTSAVLTKPAT
FT                   YFYLLKESAFLQVAFNVLLTVPFGIYLRYYFRRSFLQTICISFFLSLFFELTQVTGLYG
FT                   IYNCAYRLFDIDDLFLNTLGGVIGFIIAPIFTYFLPKTNELDSHIDLETKPVGFIRRLI
FT                   AMQIDWIFLSIVVPVVKNKGNSFFVSNMQSYTNMYELIFITCSILIYFILIPYFTNGKT
FT                   IGKALLRIHLKGKSDRITLKELFIRYGIFYFALGGINYILSSSSMLNHTEPLVLLVTLL
FT                   FLFIINGLFIIHVLLHVFSRDKLLFYEHISHTRNAITLKKADK"
FT   gene            690667..690870
FT                   /locus_tag="BMB171_C0594"
FT   CDS_pept        690667..690870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05412"
FT                   /protein_id="ADH05412.1"
FT                   /translation="MRYELFSVSGDHITTFESAWRFQEGEQIFVHDDQTKRNFIIIRLT
FT                   HDVFQQNKHVIRLYCQEKKVYA"
FT   gene            complement(691465..692277)
FT                   /locus_tag="BMB171_C0595"
FT   CDS_pept        complement(691465..692277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0595"
FT                   /product="undecaprenyl pyrophosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05413"
FT                   /protein_id="ADH05413.1"
FT                   /translation="MEQFYYVLKYLILGLFQGLTEPIPISSSGHLVLAQHLLGLKIEGF
FT                   SFELLVNSASLLAVLLIYRNDLIRLTKNGLSYIFTRAEDAKSDFFFIIYLVIATIPAGV
FT                   IGVLFKDYIDQYLKGVKMVGISLLITAVGLWIIRNLRGRKNDGDLSMKDAIIVGLAQAC
FT                   ALIPGISRSGATIVAAMLLGMKQETALRFSFLLYIPVSLGGLLLSITDIANDPNLDTLF
FT                   VPYVVAFIATFIMTYISLKWFMNIMAKGNLKYFSFYCIIVGVLTLIFL"
FT   gene            complement(692414..693355)
FT                   /locus_tag="BMB171_C0596"
FT   CDS_pept        complement(692414..693355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0596"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05414"
FT                   /protein_id="ADH05414.1"
FT                   /translation="MFTQKKSLQHTIAQLEERIQELEAELKQKDIEKQETISTIHDRVQ
FT                   SVVQEHQLVNNQHNTLQSLVQQLSSCFENVSTRTTHSNELNNEMLQKEQSLIQSIAEII
FT                   DCSNEGKESVHRLLIVINKLGEQSQRTSNSMNHLSERSKEIEQIVEVIQNIAAQTNLLA
FT                   LNASIEAARAGEHGKGFAVVANEVRKLAESTAESTKNIGNLTKKIQEEIEKAYDNTKDN
FT                   LHLVDEGVEMSADTNARIENILVMIQTLQNGATNVIKAIENQKSCNDDILREFANTQQM
FT                   FQKLNTTIMNHIHDAEKVDVQLSKSLQETVTS"
FT   gene            693576..694868
FT                   /locus_tag="BMB171_C0597"
FT   CDS_pept        693576..694868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0597"
FT                   /product="cell wall-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05415"
FT                   /protein_id="ADH05415.1"
FT                   /translation="MNYFKRISCLVLAGIIGLSSTVAVKAESNDEKLNNMQQQLQQNDA
FT                   EMQKKEQEKQAVSKEIKGIENELHNLNNTIAKNKEDQAAIQRKIDETHKQIEQKKEEII
FT                   VLEDKVLARKDIMRKRMVSVQNSSNTSLVVEVVVESKNFADFLQRMNAVSTILEADKEI
FT                   LRLQEQDLRQIEEDKKTIDEKEASLVVDKQKLAKAQAELQDNLKKRQDNLQTVQAKYNE
FT                   VASQLNLAAEEKAKIESNMKAVQETIAREQEAARIAAEERAKAEAAAKAEQEALAKAQA
FT                   EIAEKQKQEKANKPAEPVANNNSKVEPTKPAQPEPSSKPTAGGKEIYVEATAYTADPGE
FT                   NGYAPGQQVFSAWGPGGKGYNLTANPGMKLIAVDPSVIPLGKTVNVEGYGVAIAADTGG
FT                   AIKGHRIDVLMPDKGSSSSWGRRTVKVTILN"
FT   gene            694981..695199
FT                   /locus_tag="BMB171_C0598"
FT   CDS_pept        694981..695199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0598"
FT                   /product="PbsX family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05416"
FT                   /protein_id="ADH05416.1"
FT                   /translation="MTILNRVKELRARFNFTQSVLAEKVGVTRQTIAAIEKGDYVPSLL
FT                   LALTICDVFQLKMEDVFVLNKEGEEDE"
FT   gene            695192..695665
FT                   /locus_tag="BMB171_C0599"
FT   CDS_pept        695192..695665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05417"
FT                   /protein_id="ADH05417.1"
FT                   /translation="MNRIVFSYIINVLYTALACWTFVEFYSVITELADIIKNEKFPFEV
FT                   WFNGVPFILLFIGAIIVTIFYRIQKKKYKNLSFWMYPLLFPLEDEREKAITDKACRTTF
FT                   VSLWFVLPCAVGFLTFSPIINEYLPGYPLYILFSIFFIQMTVFHVSLYRNKLA"
FT   gene            695783..696415
FT                   /locus_tag="BMB171_C0600"
FT   CDS_pept        695783..696415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0600"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05418"
FT                   /protein_id="ADH05418.1"
FT                   /translation="MNKQRIYSIVAILLFVVGGVLIGKPFYDGYQAEKKQTENVQAVQK
FT                   MDYEKHETEFVDASKINQPDLAEVANASLDKKQVIGRISVPSVSVELPVLKASTEKNLL
FT                   SGAATVKENQVMGKGNYALAGHNMSKKGVLFSDIASLKKGDKIYLYDNENEYEYAVTGV
FT                   SEVTPDKWEVVEDHGKDEITLITCVSVKDNSKRYVVAGDLVRTKAKK"
FT   gene            696555..697634
FT                   /locus_tag="BMB171_C0601"
FT   CDS_pept        696555..697634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0601"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05419"
FT                   /protein_id="ADH05419.1"
FT                   /translation="MRQQVKKLLLTTSIALLVAPISAYAHPGRTDANGGHTCRTNCEKW
FT                   GLQYGEYHYHNKPASSSGATSPAPSQNNNSAVEAERQAEAQRNTEAEKQRNAEAQRKAE
FT                   EERQRVAEEQRKAEEARKQEEAQRQADMEKGQLEGQKNGETDFKAGKNDAEVHVAGKSD
FT                   AYKQAFKATYAAVWSLEEQKKTHFEKGKEQGLAQETMDDSQVAPEFKVNFADGFKVGNK
FT                   ERTEKIEKEQAELGEKTGKELAEKNPGNREKEVYVKAYETAYEKGYKSTKKVVEKAGYK
FT                   YAFENYDLKVPAKYERNELLKKWFTEGFKSNKKAAEIREEGYKKGDSWFSFFYKSFVPS
FT                   EYEEHKELYEQAIEKGKTA"
FT   gene            complement(697665..699050)
FT                   /locus_tag="BMB171_C0602"
FT   CDS_pept        complement(697665..699050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0602"
FT                   /product="di-/tripeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05420"
FT                   /protein_id="ADH05420.1"
FT                   /translation="MESAIQLEREQQRKKKHPPGLYLLFFTEMWERFSYYGLRGLLTLY
FT                   LTTALVSGGLGFSPAWALSIYGFYTGACYFTPMIGGYLTDRFLGRRKAITIGGITMAIG
FT                   NLTLFALQNQLGLYLGLALIIIGNGFFKPNISTLVGELYEENDPKRDSAFTIFYMGINV
FT                   GSFLAPLVCGFLSENLFKTTVDGVVHYGFRYGFLAASIGMIIGQILFTTLSNRFLGNIG
FT                   KKPTRDLQTAAGQPSVGDTPLTKKEKQRTAVIVILTCFVVFFWAGFEQAGSSLTLYTNK
FT                   FVDRSVFGWEVPTSWFQSVNPLFIILLAPVISALWAKLATRKQGDLKIPTKMGLGMILL
FT                   GIGYIILVIATLKTGSDEHNITEKANLLFIVFTYLFHTLGELFLSPVGLSMVSALAPVK
FT                   LASLLMGVWLASSGIANILGGQLASFTTSLGYAEVFTVIGAVAIVLGCVLLLISKKLVK
FT                   WMD"
FT   gene            699303..700604
FT                   /gene="brnQ1"
FT                   /locus_tag="BMB171_C0603"
FT   CDS_pept        699303..700604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ1"
FT                   /locus_tag="BMB171_C0603"
FT                   /product="branched chain amino acid ABC transporter carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05421"
FT                   /protein_id="ADH05421.1"
FT                   /translation="MKLLQKKEILLISLMLFSMFFGAGNLIFPPFLGYEAGEHVWISLV
FT                   GFIISATGLPILGVISIAKAGSFQTLAGRVHSSFAIIFPCIVYVFIGPGLGIPRAGSLA
FT                   FEMGPGQLFPEAGNGLLLFYTVIFFSIVYWLSLSPSKLMGLFGKVLTPLLLCMIALIFI
FT                   KNMFTTVGDMKEPIGNYGQAPMFQGFLDGYLTMDALAALIFGIVIANALRAKGIEDDKG
FT                   LAKYMSIAGIGAGLLLSIIYVILGYVGAISGSLGTFDNGAKVLAQVMITLFGQGGVVLL
FT                   GLIFTIACLCVSIGLVTSSSQFFARAFPKVSYKLWAFIVSVVSMILANLGLTQILKVSV
FT                   PILGFIYPIALTLIILGLFHQYIGKYTYVYAVTVLVVAIFSAIDILNKNVMMNQWTAAL
FT                   KYIPFYTEGVGWIVPAIVGMCLGFIISIFLNKNK"
FT   gene            700746..702467
FT                   /locus_tag="BMB171_C0604"
FT   CDS_pept        700746..702467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05422"
FT                   /protein_id="ADH05422.1"
FT                   /translation="MKKDLDKKIEALETAIETIQEALAELKVKQREIEVENAQQHVSKE
FT                   KKEYIETVMEEKPKEEIVKIKEPLQEPELKQVDISAFKPEPFNIIKFCQTWLPRVFVGI
FT                   MLLGVIWLFKAGVDAGLLTPAIRIVFGIALSIGLYYIGDIQIKRERQALGLVLAGGSIT
FT                   GIVLTTFAAHYLYGFIPASVAFLCNIAWVILGIYLAKRYQSEYLTIFVAVGAFFVPFLL
FT                   NSTTPNPYIFFGYETVLTLSLLWYALKNRYKYLYMISYAVAAIVLFVFFAVMSMLVENL
FT                   QIQLTIVYGLIHLLLFWHMFTERSFILEPRLAIFSANAVFFILAISKIPDFTTWGLITS
FT                   AFVHAAMFVCEYRKNRHSTFTNLLFGFAMGAFSLAILYEYSLVNAAIVLLLQGFLGMVT
FT                   SIKVKQQIKLYVSATVYAIGMIQTIFSPFDQFISAGFVAHLILIGTFYYCMREAKEVLA
FT                   SFGKYMYSIVLYWFMIIVFITITRIGEVLSTDGSVISVSVSLLWMVYALFAVWFGRNRN
FT                   MNEILYAGLVVLVVTVGKLFLLDLPEVSMMIRAVLFLIVGSIGIVISRMFFSKEEK"
FT   gene            complement(702503..704050)
FT                   /locus_tag="BMB171_C0605"
FT   CDS_pept        complement(702503..704050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05423"
FT                   /protein_id="ADH05423.1"
FT                   /translation="MKNKKWITFSLATAITLSIGTSFIPSTYAESSVDPAPEIAAKVVN
FT                   QNNGKKVLFDNTHGQTAGTADWVIDGGFSDFGNGIAKNGYHVKELRKSTPITYEDLKDY
FT                   NVFIVPEANIPYKKSEQDAMLQYVKNGGSIFFIADHYNADRNKNRWDSSEVFNGYRRGA
FT                   WDNPAKGMSNEEANSQAMQGVESSDWLSDNFGIRFRYNALGDVSAKTIVSPEQSFGITK
FT                   GVSSVAMHAGSTLAITNPKLAKGLVYLPENPSKWNNAVDSGVYNGGGIAEGPYAAIAKV
FT                   GLGKAAFIGDSSPVEDATPKYVREDSGQTKKTYDGYKEENDAILLENIVNWLSNKETFT
FT                   SLDQVNGLQLDSPTALQTFEQPSLSTEPQPEPWSAPNAGYQWFNTNTFKPGSYGYNGAV
FT                   TTSDYVVTHPSILPNNEIFQMKIQVNNLLPNTTYNNYSLGIFTTGGTQVAKVQNANGTW
FT                   PSTFGYSSAFSFTTNSLGSAEKVVNVQIDSNTTGQATLRLRQNTTTKYNETVTINKK"
FT   gene            complement(704232..705623)
FT                   /locus_tag="BMB171_C0606"
FT   CDS_pept        complement(704232..705623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0606"
FT                   /product="proline-specific permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05424"
FT                   /protein_id="ADH05424.1"
FT                   /translation="MQHTNKSGTLNRGLKERHITLMSLGSAIGVGLFLGSASAIKLAGP
FT                   SILLGYMIAGLVIFFIMRALGEMAIEQPVAGSFSKYAYDYIGPLAGYITGWNYWFLWVV
FT                   TCMAEITAAGIYMQYWFPDIPRWTWALLALLLMSAFNFLSVKVFGELEFWFALIKIVTI
FT                   ICMIVVGAGIILFGFGNGGIATGISNLWTHGGWFPNGFSGLLLSMQMVLFAYLGVELIG
FT                   VTAGEAQNPKKTLAKAIDNVFWRILLFYVGALFVMMAIYPWNELGEKGSPFVLTFQQIG
FT                   IAKAAGIINFVVLTAALSSCNGGLFSTGRMLYTLAQQKKAPERFGRLNKNGIPSQGIVA
FT                   TAIVLLIGVILNYLVPAKVFTWLTSISTFGAIWTWGIILVAQIKFRKSLPTQNKQKLSY
FT                   KMPLYPLSSYFSLVFLVLVLGIMAYSEDTRIALIVGPIWLIGLAIVYYMKGFHKIDETP
FT                   NSKIS"
FT   gene            705905..707197
FT                   /locus_tag="BMB171_C0607"
FT   CDS_pept        705905..707197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0607"
FT                   /product="guanine-hypoxanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05425"
FT                   /protein_id="ADH05425.1"
FT                   /translation="MFQLQKYNTSVKQEFLAGITTFFTFAYILVINPKILSDAGVPFDQ
FT                   AFTATIIATVVGTVGMAIFANYPIVIAPAMGMNAYFAYSVVQKAEGITYVVAFSAVFVT
FT                   GIIFLLLSFTSFRQKLILAIPDSLKHAIAGGIGLFIAFIGLRLSGIIVDHPSNLVTIGD
FT                   FHSPAVILTLIGLILAAVLMTLRVSGALFISMIVTGIIAFFTGQLKFADKIVAMPHLPE
FT                   GIIVSNPINAFSDVIEYGLYGVVFSFLLVLLFDTTGALLGLIKQAGLITDNTEKRFGKA
FT                   FIADAIGGTTGSIFGTSPTAATIESSAGIAAGGKTGLTGIVVVGLTIITAFFSPVIASL
FT                   SSVAAITAPSLIIVGSLMAQSIRDINWNEFEDALPAFLIFVGIPLTSSIANGIAIGFLV
FT                   YPVLKIVKGKGMEVHPLLYLFTILFGCHLFL"
FT   gene            707329..707529
FT                   /locus_tag="BMB171_C0608"
FT   CDS_pept        707329..707529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0608"
FT                   /product="PbsX family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05426"
FT                   /protein_id="ADH05426.1"
FT                   /translation="MAVSKIKVARVQLDLTQQQLAEKVGVTRQTISLIEKGKYNPSLDL
FT                   CLKICYAVDKTLNDLFWEEKE"
FT   gene            707534..707962
FT                   /locus_tag="BMB171_C0609"
FT   CDS_pept        707534..707962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05427"
FT                   /protein_id="ADH05427.1"
FT                   /translation="MKIVKDERLMIEGLKHIRLVFILQNIFILGIVFYRYVLQDAGYES
FT                   VSDLLMVFMGGIVVINFLNLKNSVEVYEHTGGVSRSYFMKLLLIPVSIVIGILAICIVV
FT                   TPDISIKEISMTGFIMFACFLVPSLFIYIYMKKIKSED"
FT   gene            complement(708004..708441)
FT                   /locus_tag="BMB171_C0610"
FT   CDS_pept        complement(708004..708441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0610"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05428"
FT                   /protein_id="ADH05428.1"
FT                   /translation="MITVKNIEGSETYVLRQKILRPNQTLADCKYPSDYETDTFHLGAF
FT                   INDQLISIASFSKEMHPDLQAGMHYRLRGMATLPEFRNNHAGSSLIQKAEQILQERQAN
FT                   MLWCNGRITVADYYKRLGFQEHGEIFEIEPIGLHKVLYKRI"
FT   gene            complement(708766..710595)
FT                   /locus_tag="BMB171_C0611"
FT   CDS_pept        complement(708766..710595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0611"
FT                   /product="Na+/H+ antiporter NapA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05429"
FT                   /protein_id="ADH05429.1"
FT                   /translation="MEHHTSVLSLMVVVAIAFFVPLLLQRFKLKALPVVVAEIIAGIFV
FT                   GKSGFNIIEPDIWLQVLSTLGFIFLMFLSGLEIDFSIFKQKGKKNTTNEPNTFQAASII
FT                   FLFIFILSYALSLLFVWLGFVDNAMFMTLIISTISLGVVVPTLKENNLGKTAIGQIILL
FT                   VAVIADLVTMILLAVFVGLNSESGQSMWLLLLLFGAGIVIYFVAKRFKNIPYLDSLKAG
FT                   SVQIDTRAVFALILILVGLSESVGAENILGAFLAGVLVSLLSPNEDMVEKLDSIGYGFF
FT                   IPIFFVMVGVNLEVWSIFKEPSSMLMIPILIVGLFISKLLPSLVLRKWYPRNIVLGSAI
FT                   LLTSTLSLVIAAAQIGEKLEIISPSLSASLILSAVITCIFAPILFKKMFPKVETPKPKV
FT                   AIIGASRITLPLSLDLKREDYDVTLYMMRQNKINDEEATSHDFPIVKLDDITIASLTEQ
FT                   TAFDADRVVVATSDDEQNLLLAEHAKELGVEHVIASVEDPLLQEKATQEHIAVFSTINS
FT                   TRILLRALIDKPSLVRLITTANETVREVELRSNKYNGVALRRLPFLGDVLVIQIYRGNK
FT                   ALIPHGDTRLQHGDTLLVTGSKEHIDTLKNILE"
FT   gene            complement(710813..710962)
FT                   /gene="qoxD"
FT                   /locus_tag="BMB171_C0612"
FT   CDS_pept        complement(710813..710962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxD"
FT                   /locus_tag="BMB171_C0612"
FT                   /product="cytochrome aa3 quinol oxidase polypeptide IV"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05430"
FT                   /protein_id="ADH05430.1"
FT                   /translation="MAVAQALLQLIMFMHLKEGEGRVQILTMIYSFFVATATVGLTVWI
FT                   FFSM"
FT   gene            complement(711125..711727)
FT                   /gene="qoxC"
FT                   /locus_tag="BMB171_C0613"
FT   CDS_pept        complement(711125..711727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxC"
FT                   /locus_tag="BMB171_C0613"
FT                   /product="cytochrome aa3 quinol oxidase polypeptide III"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05431"
FT                   /protein_id="ADH05431.1"
FT                   /translation="MAALDKSLPLEYQSEQSRLNILGFWIFLGAEIMLFATLFASYLVL
FT                   AGRTADGPTPAQLFELKTLLIQTLLLLTSSFTCGIVIHEMRKHNQKAMLGWFVLTLLLG
FT                   AGFLFFEIEEFIMYIGEGATIQTSAFLSGFFVLLGTHGAHVTGGIIWAICVIIQILKRG
FT                   LTPVTARKVFIISLYWHFLDLVWVFIYTLVYLNGMVA"
FT   gene            complement(711741..713675)
FT                   /gene="qoxB"
FT                   /locus_tag="BMB171_C0614"
FT   CDS_pept        complement(711741..713675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxB"
FT                   /locus_tag="BMB171_C0614"
FT                   /product="cytochrome aa3 quinol oxidase polypeptide I"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05432"
FT                   /protein_id="ADH05432.1"
FT                   /translation="MKLDEFFVTGDPIIYGADASIVLVTLAIIFVLTKYKKWKWLWDEW
FT                   LTTVDHKKIGAMYIISAVIMLFRGGMDGLMIRAQLTFPETTYLNAEHYNGIFTTHGTVM
FT                   ILFMAMPFVMGLMNLVVPLQIGARDVAYPFLNALSFWLFFVGAMLFNIAFVIGGSPDAG
FT                   WTSYFPMAGTEFTSGVGNNYYAIALQISGLGTLMTGINFLVTILKMRTPGMTLMRMPMF
FT                   TWSILITTIIIIFAFPVLTVALALMTFDRLFDAHFFTMASGGMPMLWANLFWVWGHPEV
FT                   YIVILPAFGIFSEIISTFSRKRLFGYSAMVYSMVAISLLSFVVWLHHFFTMGAGPAVNS
FT                   FFSISTMAISIPTGVKIFNWLFTLYKGRIRFTVPMLWSLAFIPNFVVGGVTGVMLGMAA
FT                   ADYQYHNSYFLIAHFHYVLIAGTVFAMLAGFTFWYPKMTGHMLNERLGKWTFWIFMSGF
FT                   NICFFPMYFLGLDGMTRRMYTYSESLGWGWLNQIASVGAVMMGIGFLLLCYNVIWSARH
FT                   GERDTTGDPWDGRTLEWATHSPVQHYNFAKLPEIKEADAFWYMKKRGETVTPAAEDIKP
FT                   IHMPSNSGVPIIASGFFGLAGFALVFSWFWLAAIGGIGILACLIYRSFDYDEGYYISVD
FT                   EIKKTEHIA"
FT   gene            complement(713709..714722)
FT                   /gene="qoxA"
FT                   /locus_tag="BMB171_C0615"
FT   CDS_pept        complement(713709..714722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qoxA"
FT                   /locus_tag="BMB171_C0615"
FT                   /product="cytochrome aa3 quinol oxidase polypeptide II"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05433"
FT                   /protein_id="ADH05433.1"
FT                   /translation="MIFTLKSVHLCLFFNNISKTIAFYKLIGLYCFIGIVSIQGERRFS
FT                   IVQLKKAFWKLASLLPLSLLLFLGGCDKKLAVLNPQGPVAKAQYDLIVWSFLLMSLIIA
FT                   IVFILFTVILIRYREKPENMDYEPPEQHGNTLLEIIWTLVPVIIVIALSIPTVKATYAS
FT                   EEVPKESKHIKPVEIYVTSANWKWLFSYPEEKIETVNYLNIPAGVPIQFKLTSVGPMNA
FT                   FWVPELGGMKYTMDGMIMDLYLQADKPGSYLGRSANFSGEGFTHMEFEVEAKTKEKYDK
FT                   WVKEVQETAPKLTEAKYNEIVKPGVVGRMTFSSHHLSYVDPKSLEYCDYNYYKNKK"
FT   gene            complement(714867..716282)
FT                   /locus_tag="BMB171_C0616"
FT   CDS_pept        complement(714867..716282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0616"
FT                   /product="arginine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05434"
FT                   /protein_id="ADH05434.1"
FT                   /translation="MNQQIEQTDLKRTMKSRHLFMIALGGVIGTGLFMGSGQIVHNAGP
FT                   GGAILAFLVGGFVMYLTMLCLGELSVAMPEAGSFQSYASKFISPGFGFVVGWMYWLNWA
FT                   VTVGVELTTVSILMKRWFPDVSSWIWCVTFAAALFLVNALSAKAYAEAEFWFASVKVAT
FT                   IVIFIVLGGAVMFGLLDFNGKPAPMLHNFTENGGLFPNGALAVLLTMITVNYSFQGTEL
FT                   IGIASGESENPEKTIPKAIKNTIWRTLFFFVLAISVVVGLLPWQEANLVESPFVLVFDV
FT                   AGVPYAADIMNFVIITAVLSVANSGLYANSRMLWAMAKQGMASPAFTKLTKKGVPLNAL
FT                   IFSLIFASLSLLTSVFAADTVFLVLTSIAAMAAVVVWMSIAASQFFFRRNFVKNGGNIN
FT                   DLKYRTPLYPLVPIVAFSLNFITFVSLAFIPDQRIALYCGIPFMIICYILYQVKYKKIV
FT                   TLEQPRTVIQEIN"
FT   gene            716659..717369
FT                   /locus_tag="BMB171_C0617"
FT   CDS_pept        716659..717369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05435"
FT                   /protein_id="ADH05435.1"
FT                   /translation="MKKLKYLFVFGIILAAAFFIGKDKIMQKAQVLRLEFLSEMKEAAM
FT                   IEDVPFIKQLPELPRGCEVTSLAMLLQYKGVQVDKMQLASEIHRVPFEQNGLRGNPYEG
FT                   FVGNIYTKAEPGYGVYNKPIFDLAEKYVPEKVINLTGRDMQDIYKVISSGSPVWVIINT
FT                   TFKPLAESSFETWNTSSGEVKITYYEHSAVVIGYDQNFVYVNDPLKNNPRLAVPRTEFE
FT                   KAWEQMGKQAITIL"
FT   gene            complement(717685..717798)
FT                   /locus_tag="BMB171_C0618"
FT   CDS_pept        complement(717685..717798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05436"
FT                   /protein_id="ADH05436.1"
FT                   /translation="MHYTFICRNKIKLIFFMNRKSIHIGSNRNCFARMFTY"
FT   gene            717793..718677
FT                   /locus_tag="BMB171_C0619"
FT   CDS_pept        717793..718677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0619"
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05437"
FT                   /protein_id="ADH05437.1"
FT                   /translation="MHACGHDGHIAILLGVVHKLVEEREKIKGEIRFLFQHAEENFPGG
FT                   AEEMVAAGVMEGVDYIIGAHLWASLEVGKIGVIYGPAMAAPDVFKIKIEGKGGHAGIPH
FT                   ETVDSIAIGTQVVSQLQQIVSRLTNPLDSLVISVTQFHAGTTHNVIPEQAEIEGTVRSL
FT                   RHELRGETEKKIERIVKHITESYGAKYTFSYEYGYRPVVNDYEATELIEQTALQLYGRD
FT                   RVVRLQPTMAGEDFSAFLQKAPGTFFFIGAGNKEKGIIYPHHHPRFTIDEDALPIGVEV
FT                   FVSAIMNFISKGE"
FT   gene            718873..720345
FT                   /locus_tag="BMB171_C0620"
FT   CDS_pept        718873..720345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0620"
FT                   /product="Sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05438"
FT                   /protein_id="ADH05438.1"
FT                   /translation="MTALLIIILFLFLALFLGIRAQHGKDMNLEQWSVGGRGFGTIFVF
FT                   LLMAGEIYTTFTFLGGSGWAYSKGAPTFYILGYGALAYLLSYFLLPPIWKYAKEHNLVS
FT                   QSDFFAKKYRSKALGLIVSIVGVVSIIPYLVLQLKGLGIIVSEASYGRVSPVVAVWIGA
FT                   IVITIYVMVSGIHGSAWTAALKDIMILFIVMFLGIYLPYHYYGGFQPMFEAVEAAKPGF
FT                   LSLPEEGMSISWFVSTIILTALGFYMWPHTFASAFSAKNEKVFRKNAAIMPLYSLVLLF
FT                   VFFAGFAAILQVPGLKGADVDLSLFRLALQTFDPWFIGIIGSAGVLTALVPGSMLVMAA
FT                   STLLAKNIYRTIVPSASDRQVAKMAKLFVPVVTLVAVLFTFKGGETIGALLLMGYSIVT
FT                   QLFPALVCSLFPRQIITKQGAIAGMGVGLLVVAYITLSGSTIATMFPSFPQYIKDLNVG
FT                   IVALLINIIVMFVVSGFTKGVFIKKNTIIVEK"
FT   gene            720577..722046
FT                   /gene="gerLA"
FT                   /locus_tag="BMB171_C0621"
FT   CDS_pept        720577..722046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLA"
FT                   /locus_tag="BMB171_C0621"
FT                   /product="spore germination protein KA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05439"
FT                   /protein_id="ADH05439.1"
FT                   /translation="MLELEGNLFEVMKEIRDELGSPNDLTIREVALAGSFTRSAVVFLC
FT                   GLTDKDNVYKYVIRTLQYEEIINEEAVVQTLLDRFISIAEVGVKTKFPDIMNAILAGDT
FT                   VILIDNIQTAIVINSRAWEKRSLEPPVTEDLIRGPRVGLNEDINVNKMLIRRSLRDPKL
FT                   RFQSYIMGKRSQKEVTLVYIEDIINPHIVKELDRRLQSIVTDVVLETGTIEQLIQDNNL
FT                   SPFPQFLNTERPDNIIASLAKGKAAILVDGSPFALIAPLVFVDIFQSVEDHYERWVIGT
FT                   LLRFLRMGSGIIAVLLPAMYVALVSYHQGLIPSKLAYSIAGAREGVPFPAYIETLMMAL
FT                   TMELIREAGIRLPKPMGQTIGIVGGLVIGEAAVNAGIVNPFLVIIIAVTAIATFSLPVY
FT                   SITITFRILLFVFVLAATAFGLYGIILALIALAIHITNLTSVGIPYTTPIAPAFYKDWK
FT                   EEFIRMPKSMLKDRPEYLQTKDSTIRPKERK"
FT   gene            722140..723171
FT                   /gene="gerLB"
FT                   /locus_tag="BMB171_C0622"
FT   CDS_pept        722140..723171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLB"
FT                   /locus_tag="BMB171_C0622"
FT                   /product="spore germination protein LB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05440"
FT                   /protein_id="ADH05440.1"
FT                   /translation="MPRDIANQTLFSDGWIILLLGGLICAVLGWFVTRVAILFPKQNFV
FT                   QYTSAHLTKPVAYTISSILVLTFAALTAYESRMISVISQTYLFSDTPIQLLSFFFLLVV
FT                   IYGIAGSRAALLRLNVIFLPIVLIAIVLLSLLNINLVEINNLLPAFQTKVSQYAVGVKN
FT                   SIFTFIGFEVALFYAVLLNDKTAKKAPMAVAKAVMVNVLSYILIYVTCISVFTYMTTRG
FT                   LTYPTIELGKEIEIGGGFLERFDAIFFTTWIITIYNTTAMYYDVASLLFCAMFPKVKKH
FT                   IFIFVSAPIIFMVNMIPSSLNTLSSYGTYLAWIDMGFVVLAPLLVFIVYKIKRRNGRNE
FT                   TPS"
FT   gene            723155..724321
FT                   /gene="gerLC"
FT                   /locus_tag="BMB171_C0623"
FT   CDS_pept        723155..724321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerLC"
FT                   /locus_tag="BMB171_C0623"
FT                   /product="spore germination protein LC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05441"
FT                   /protein_id="ADH05441.1"
FT                   /translation="MKHLLKIIIVMFFVGPISGCSELQEIEERGFVVGAAYDIVKEKKV
FT                   NPIMKGTYQMVLPSKLSQQGGQGSGDSENYINVSAKADSVFEQIRIIAKKISRTLFFPH
FT                   IQVIIFSDELLANPYVLQNTLDVYFRDHEMRRNIRLFVSKKNAESILKQSAKPENLPAQ
FT                   YIDMLAEHPPKNAQMIEAARIGEVQGKMIADRSFALPLLGLTKQGVQMEGAALIRGKDN
FT                   KCVGTLSGEQTLGMNYIIGKKIEGFFTVRKKNQLITYEVHKLRRKIKVSTEHATKPKFD
FT                   IHVFTEGTLAELHFNEPKQVMNEKVLKKELSKEMKKRIEKSIQLVQKKYKVDVLELGEV
FT                   YKRHNYKEWRKISKNWDQGQNYFSNAEITVYVHPTIEHSGSALPKKVK"
FT   gene            complement(724533..725933)
FT                   /locus_tag="BMB171_C0624"
FT   CDS_pept        complement(724533..725933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0624"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05442"
FT                   /protein_id="ADH05442.1"
FT                   /translation="MESHSASKALPLDYIIQHAQTLSKEDIRDDIVGDIYRTSASICKE
FT                   SVQYTNTDKLYRSEKLDKIFTSPIWGFPIMLGILSIIFYLTIAGANVPSDMIAEFFGWA
FT                   EGYLTSWFQAAHAPEWLHGILILGLFRGIGAVISVMLPPMAIFFPMFALLENYGYLPRV
FT                   AFNMDRLFKRSGAHGKQSLTMAMGFGCNAAAIMSTRIIESPRERMLAILTNNFVPCNGR
FT                   WPMLILMASLFMAAGYTGSMQTLVTAGVVVGMVVLGVIMTLTVSWVLSKTALKGVPTHY
FT                   TLELPPYRKPKVWNTIVRATLDKSIYVLKRAIVVAAPAAALTWLLANIFIGDTSLLMYF
FT                   VNFLDPFAKMLGLDGFILAAFILGLPANEIVIPILLMSYLSTGALTEIDDFNQIKNLFL
FT                   ENGWTWLTALNTMLFSLLHFPCGTTLVNIYKETKSAKWTFLSFAIPTVIAIVVTFLSTQ
FT                   LVHWLGLV"
FT   gene            complement(725911..726633)
FT                   /locus_tag="BMB171_C0625"
FT   CDS_pept        complement(725911..726633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0625"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05443"
FT                   /protein_id="ADH05443.1"
FT                   /translation="MSKHRIALAGNPNTGKSTLFNTLTGLKQHTGNWTGKTVLKAEGEY
FT                   EHNGSNYTLIDLPGTYSLYSNSADEEVARDYIIFEKPEVTVVVIDATAMERNLNLALQV
FT                   MEMTNNVVICINLIDEAEKKGIVIDEKKLAKSLGVPVVKISARNRVGIGHLLNVIAKVA
FT                   NKKLIPTPIKITYSEKIENMIQELEPQIYKVFGDTYPARWIALRILDGDKNFLTTLQKH
FT                   HNEPLVREVVINGISLSQ"
FT   gene            complement(726630..726803)
FT                   /locus_tag="BMB171_C0626"
FT   CDS_pept        complement(726630..726803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0626"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05444"
FT                   /protein_id="ADH05444.1"
FT                   /translation="MKRRLLDLGFIPGATIKVLQRSPLGDPVAYQVSNTTIALRKEESS
FT                   LIFGVLIGDDFR"
FT   gene            727397..728299
FT                   /locus_tag="BMB171_C0627"
FT   CDS_pept        727397..728299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0627"
FT                   /product="phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05445"
FT                   /protein_id="ADH05445.1"
FT                   /translation="MVMKKGIKFSLAALVVAGALVGCGKAEDTTSKDTAKGSDNTKQEL
FT                   SGTIAAAGSTALLPLAEEAGKKFMEKNSKVSIQVQGGGSGTGINQVASGAVQIGNSDVP
FT                   SGDKIKDAEKAKELVDNKVAGIAFALVVNKDVKVDNLTMQQVQDIFTGKVTNWKEVGGK
FT                   DEKINVINRPASSGTRATFEKTIMKDAKINDGTGTTQDSNGAVEQAINSTPGSVSYLAM
FT                   SYMVGEKKGALQTVKIDGAEPKVENIASGKYPFWSYEYMVTKGEAKEATKAYIDYVKGK
FT                   DFEKQVEDMGYIPMSKLNK"
FT   gene            728371..729261
FT                   /locus_tag="BMB171_C0628"
FT   CDS_pept        728371..729261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0628"
FT                   /product="phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05446"
FT                   /protein_id="ADH05446.1"
FT                   /translation="MKGKKQINYVKSEYIGRSLVTFCGIFIVLITLAIIAFICGKGIQS
FT                   FTQSGISFTEMLTSTKWNPNADQGSFGALIFIVGSTVVSLGAVIISAPIAIALAIFMNL
FT                   ISPKFGNKVLKPVLELLVGIPSVVYGLLGVTILVPLLRDSFGGVGFSLIAGIVVLSIMI
FT                   LPTIASIASDAIRSVPFDYLEASYGLGSTKWQAISRVIVPAAKKGILTGVVLGLARAFG
FT                   EALAVQMVIGNTIKLPEGIYSPTATLTGILTMDMTNTLNGTAWNNALWTLAMILLVISF
FT                   LFILVIRAIGQRGER"
FT   gene            729264..730184
FT                   /locus_tag="BMB171_C0629"
FT   CDS_pept        729264..730184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0629"
FT                   /product="phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05447"
FT                   /protein_id="ADH05447.1"
FT                   /translation="MNARTVNKVWTGIFYAVAALVVALLVFLVFEILQKGWGFWDPNFL
FT                   FGEPSNTRAGGGIGPQLFNSFYMLVITLIISIPLGLGAGIYLAEYAKQGRFLNFVRLCI
FT                   ETMASLPSIVVGLFGLLVFVTMTGWGYTVMGGALALTILNLPGLTRVCENAISEVPQNV
FT                   KEASLGLGATKWQTIARIIIPSSLPQIITGIILAAGRIFGEAAALIYTAGLTSPILNSA
FT                   ADFSSPAHPLNPFRPAETLAVHIWKLNSEGVIPDAKLIATKSAAVLIIMVLLFNVISRL
FT                   IASILHKRFTGTKRKSKTTKKVKAA"
FT   gene            complement(730416..733460)
FT                   /locus_tag="BMB171_C0630"
FT   CDS_pept        complement(730416..733460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0630"
FT                   /product="acriflavin resistance plasma membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05448"
FT                   /protein_id="ADH05448.1"
FT                   /translation="MDRLTKFSLKNRAAIIIMIFLISILGVYSGSKLPMEFLPSIDNPA
FT                   ITVTTLSQGLDAETMTKDVTNPLEKQFRNLEHVDTITSSTYEGLSRIDIAYTSKANMKD
FT                   AAREVEKAVNTIKLPKDVTKPVVSQLNTSMIPLAQITIQKQNGFSKADEKQIEKEIVPQ
FT                   LENIDGVANVMFFGKSTSELSIVLDPNQLKNKNVTSQQVLTVLQGKETSTPAGAITVNQ
FT                   EEYNLRVIGDIKNVNDIKNITVAPQVKLQDIAQIEIKQHYDTISHINGEEGTGLIIMKE
FT                   PSKNAVAIGKEIDKKVKEIDKEYKDQFSIKLLASTHEQVENAVTSMGKEVILGAIAATL
FT                   IILIFLRNFRTTLIAVVSIPLSILLTLFLLHQSNITLNILTLGGLAVAVGRLVDDSIVV
FT                   IENIFRRLQKDSFSKDIILDATKEVAVAITSSTLTTVAVFLPIGLVSGAIGKLMLPMVL
FT                   AVVYSILSSLIVALTVVPLMAFLLLKKTKHRKPSSSSRYVATLKWALSHKFIILLTAFL
FT                   LFVGSIAAYILLPKANIKSEDDTMLSINMTFPAHYNAESQKQKAFDFEKKLLSNSDITD
FT                   VILRMGSSAEDAQWGQTTKNNLASIFVVFKKGSDIDQYIKELKKEHKTFEPAELDYIKT
FT                   SYSSSGGGNNLQFNVTATNEADLKEAATIVETKLKSMDDLSKVKTNLEDSKKEWQIHID
FT                   QTKAEQLGLTPEIAAQQVAFLMKKSPIGEITINNEKATIMIEHKKENINKQEDILNTNI
FT                   LSPINGPIPLKDIATISEKQTQTEIFHKDGKETIQITAEASNEDLSKVNTAVNKAMTDL
FT                   DLPGGAKVNIAGATESMQENFTDLFKIMGIAIGIVYLIMVITFGQARAPFAILFSLPLA
FT                   AVGGILGLIISRTPVDVNSLIGALMLIGIVVTNAIVLIERVQQNREHGMETREALLEAG
FT                   STRLRPIIMTAITTIVAMLPLLFGQSQAGSMVSKSLAVVVIGGLAVSTALTLVVVPVMY
FT                   ELLDKIGRKRRSRRKISTSTETPDI"
FT   gene            734126..735665
FT                   /gene="rrf_13"
FT                   /locus_tag="BMB171_C5125"
FT   rRNA            734126..735665
FT                   /gene="rrf_13"
FT                   /locus_tag="BMB171_C5125"
FT                   /product="16S ribosomal RNA"
FT   gene            736270..739189
FT                   /gene="rrl_13"
FT                   /locus_tag="BMB171_C5126"
FT   rRNA            736270..739189
FT                   /gene="rrl_13"
FT                   /locus_tag="BMB171_C5126"
FT                   /product="23S ribosomal RNA"
FT   gene            739294..739408
FT                   /gene="rrs_13"
FT                   /locus_tag="BMB171_C5127"
FT   rRNA            739294..739408
FT                   /gene="rrs_13"
FT                   /locus_tag="BMB171_C5127"
FT                   /product="5S ribosomal RNA"
FT   gene            739413..739488
FT                   /locus_tag="BMB171_C5182"
FT   tRNA            739413..739488
FT                   /locus_tag="BMB171_C5182"
FT                   /product="tRNA-Val"
FT   gene            739497..739580
FT                   /locus_tag="BMB171_C5183"
FT   tRNA            739497..739580
FT                   /locus_tag="BMB171_C5183"
FT                   /product="tRNA-Tyr"
FT   gene            739592..739666
FT                   /locus_tag="BMB171_C5184"
FT   tRNA            739592..739666
FT                   /locus_tag="BMB171_C5184"
FT                   /product="tRNA-Gln"
FT   gene            739671..739746
FT                   /locus_tag="BMB171_C5185"
FT   tRNA            739671..739746
FT                   /locus_tag="BMB171_C5185"
FT                   /product="tRNA-Lys"
FT   gene            739761..739841
FT                   /locus_tag="BMB171_C5186"
FT   tRNA            739761..739841
FT                   /locus_tag="BMB171_C5186"
FT                   /product="tRNA-Leu"
FT   gene            739871..739945
FT                   /locus_tag="BMB171_C5187"
FT   tRNA            739871..739945
FT                   /locus_tag="BMB171_C5187"
FT                   /product="tRNA-Gly"
FT   gene            739962..740050
FT                   /locus_tag="BMB171_C5188"
FT   tRNA            739962..740050
FT                   /locus_tag="BMB171_C5188"
FT                   /product="tRNA-Leu"
FT   gene            740054..740127
FT                   /locus_tag="BMB171_C5189"
FT   tRNA            740054..740127
FT                   /locus_tag="BMB171_C5189"
FT                   /product="tRNA-Arg"
FT   gene            740138..740211
FT                   /locus_tag="BMB171_C5190"
FT   tRNA            740138..740211
FT                   /locus_tag="BMB171_C5190"
FT                   /product="tRNA-Pro"
FT   gene            740228..740300
FT                   /locus_tag="BMB171_C5191"
FT   tRNA            740228..740300
FT                   /locus_tag="BMB171_C5191"
FT                   /product="tRNA-Ala"
FT   gene            740321..740413
FT                   /locus_tag="BMB171_C5192"
FT   tRNA            740321..740413
FT                   /locus_tag="BMB171_C5192"
FT                   /product="tRNA-Ser"
FT   gene            740468..740560
FT                   /locus_tag="BMB171_C5193"
FT   tRNA            740468..740560
FT                   /locus_tag="BMB171_C5193"
FT                   /product="tRNA-Ser"
FT   gene            740581..740657
FT                   /locus_tag="BMB171_C5194"
FT   tRNA            740581..740657
FT                   /locus_tag="BMB171_C5194"
FT                   /product="tRNA-Met"
FT   gene            740661..740736
FT                   /locus_tag="BMB171_C5195"
FT   tRNA            740661..740736
FT                   /locus_tag="BMB171_C5195"
FT                   /product="tRNA-Asp"
FT   gene            740745..740820
FT                   /locus_tag="BMB171_C5196"
FT   tRNA            740745..740820
FT                   /locus_tag="BMB171_C5196"
FT                   /product="tRNA-Phe"
FT   gene            740830..740905
FT                   /locus_tag="BMB171_C5197"
FT   tRNA            740830..740905
FT                   /locus_tag="BMB171_C5197"
FT                   /product="tRNA-Thr"
FT   gene            740909..740979
FT                   /locus_tag="BMB171_C5198"
FT   tRNA            740909..740979
FT                   /locus_tag="BMB171_C5198"
FT                   /product="tRNA-Trp"
FT   gene            740990..741066
FT                   /locus_tag="BMB171_C5199"
FT   tRNA            740990..741066
FT                   /locus_tag="BMB171_C5199"
FT                   /product="tRNA-Ile"
FT   gene            741075..741149
FT                   /locus_tag="BMB171_C5200"
FT   tRNA            741075..741149
FT                   /locus_tag="BMB171_C5200"
FT                   /product="tRNA-Asn"
FT   gene            741151..741222
FT                   /locus_tag="BMB171_C5201"
FT   tRNA            741151..741222
FT                   /locus_tag="BMB171_C5201"
FT                   /product="tRNA-Glu"
FT   gene            741351..741770
FT                   /locus_tag="BMB171_C0631"
FT   CDS_pept        741351..741770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0631"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05449"
FT                   /protein_id="ADH05449.1"
FT                   /translation="MTRVRDLMSTHIVHCTPLDNVYEAAVKMKEESIGLIPVVENEQVV
FT                   GLVTDRDLVVRGIAEKHPGSNKITNIMTTNIISVSPNDSIEKATELMAQHQIRRLPVVD
FT                   SGQLIGMLALGDLAIRESADDQAGFALSEISERTE"
FT   gene            742092..743243
FT                   /locus_tag="BMB171_C0632"
FT   CDS_pept        742092..743243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0632"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05450"
FT                   /protein_id="ADH05450.1"
FT                   /translation="MKAVQGDPNWNLVTDTYIEPNNFAELFSLLVPCHPKGEGKERTIL
FT                   VWKEKEFYKEENLAAFIVYGMNKAKKLPQFHKDEIPTLVRILRLCQEIGWYEEANDFMI
FT                   AQGLAEFVHTSLEYETWDLLTQSVALNYLIIKYRIGELTDRDIEIWDRVKFNEKCITDC
FT                   KHLLSHKEVLEFTFFYMCKRAKSLSKEQLNSDMMSLAMYCNTFVYDLYTHDLLRKYRKC
FT                   TDFLSYYGPSQAVLACQRAVLSQISDRLDPLKTTHVDDYLYVMKEMMEHMTIGVMDRYG
FT                   HFIGKLLSYVPFFEMIQVPQHAYYCEELLYICKGIEYKEETLRNYIFIQLHDCLPSFFR
FT                   LFLKNKRYATIHDILFYWCDDEQRMSLEKKYNLSFIYEKYACG"
FT   gene            complement(743484..743816)
FT                   /locus_tag="BMB171_C0633"
FT   CDS_pept        complement(743484..743816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05451"
FT                   /protein_id="ADH05451.1"
FT                   /translation="MPRNIPLIIEYVAFLGLICCLIIYNTNIVFLSIIIAFVALEIMME
FT                   SFQVQLKQKIAHIYNAIFLLSALITNIISNGFYLSTVFPVFFMAVLLFVARYINVPYNQ
FT                   KQKQEA"
FT   gene            complement(743822..744976)
FT                   /locus_tag="BMB171_C0634"
FT   CDS_pept        complement(743822..744976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0634"
FT                   /product="cell wall endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05452"
FT                   /protein_id="ADH05452.1"
FT                   /translation="MNMKATALTATTVAIASLLPSMGETNVQKANAEQLSNIKTGYVKV
FT                   DQVALHTEDNVKSTSIDTIRFNTKVNIIETTNGWYKVSVHNKVGYVQKDAILLKNKLQS
FT                   NDQYIVNANALNVRSEPNLESSILDVLPNGKFITVQEDQGEWYKISHNGQTGYVQKAFI
FT                   SNGSQPLVKGITVQNNTKYTVATPNLNVRSTASTSSALLGSLQNGTQVQVVETVGTWYK
FT                   IRFGTGYGYVAKHYVVQNQPQAKTDQPSSIPAAFKFPAQGRISSTFDIRWEQMHYGIDI
FT                   AAPGNVSIQAAAAGKVVKSYYSASYGNVVFIAHQINGKLYTTVYAHMKDRTVQAGDQVQ
FT                   TGQLIGHMGNTGHSYGQHLHFELHNGEWNFEKTNAVNPLPYLVR"
FT   gene            745607..746302
FT                   /locus_tag="BMB171_C0635"
FT   CDS_pept        745607..746302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0635"
FT                   /product="transcriptional activator tenA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05453"
FT                   /protein_id="ADH05453.1"
FT                   /translation="MKFCDRLLETVQPVWEMSHNHPFVVGMGDGTLEKDKFQYYIIQDY
FT                   LYLLDYAKLYAIGVVKATNPQVMGKFAEQIDGILNGEMTIHKQYAKRLGISIEEIESAK
FT                   PSAKNLAYTNYMMSVSQNGTLAELIAALLPCMWSYWEIGKRLNDIPGARDHEFFGEWIQ
FT                   GYSSEEYGNLCIWLIDLLNEMAVGKSEKELERLEEIFLYSSRFEYLFWDMSYRKEMWGF
FT                   EEQEHTTVS"
FT   gene            746271..747020
FT                   /locus_tag="BMB171_C0636"
FT   CDS_pept        746271..747020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0636"
FT                   /product="hydroxymethylpyrimidine transport ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0636"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05454"
FT                   /protein_id="ADH05454.1"
FT                   /translation="MRSKNILQFHNVSFHYDEKPIIHELNASIYEKEFVSIIGPSGCGK
FT                   STLFRLITGLEKVSTGQIELTETKNHPVGYMPQKDMLLPWRTIIENAALPLECQGVQKK
FT                   EAEVKAKELLHKFGLQGYEQKYPKDLSGGMRQRVSFIRTLLTGGEILLLDEPFSALDAL
FT                   TKTSLQEWLFEQWQEWEKTILFITHDVEEALFLSNRVLVVEQQPITTLTERTVPLDHNR
FT                   TRKDLYKPEVLALKDELLSMLQRQVLV"
FT   gene            747020..747772
FT                   /locus_tag="BMB171_C0637"
FT   CDS_pept        747020..747772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0637"
FT                   /product="hydroxymethylpyrimidine transport system permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0637"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05455"
FT                   /protein_id="ADH05455.1"
FT                   /translation="MNRLKELVPAITLSSILLAVWEIGARIVDEMYILPSPSAIVMKIW
FT                   KLKDILFTVHLPATLYVVLIGVVISIVLGVGLAMLMNASTWMERAFYPLLVASQTIPIT
FT                   ALAPLFVLWFGYTIWSKVVVTVLITFFPIAVNTYDGLRSTKKEWEELLVTYGATKRDIF
FT                   LKLKLPSALPYFFSALKIAVPLSVIGAAIGEWLGAQAGLGYFSKRMMTQLDGAGVFAPI
FT                   VLLSLLAIFFVVIISILEKKFISWRKHS"
FT   gene            747769..748770
FT                   /locus_tag="BMB171_C0638"
FT   CDS_pept        747769..748770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0638"
FT                   /product="hydroxymethylpyrimidine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05456"
FT                   /protein_id="ADH05456.1"
FT                   /translation="MKFLKRIFVFTLLIALIAGCSSNSASDKSKKEKEITVMLDWYPNA
FT                   VHSFIYAAIEKGYFKEEGVKVNIKFPSNPTDPLTLAAAGKVTVGLYYQPDVVMARANEQ
FT                   IPVKSIGAVVRSPLNHVVSLKSAGIQSPKDLEGKTVGYSGTPLSEMYLKTMVKEAGGNP
FT                   DTVKVVDVGFDLVPALITKKVDAVTGAYINHEVPVMRHEGHEPAYFNPADYGVPNYHEL
FT                   VFVTGDKTLKKDKEALQAFLRGTKKGYDFMKKNPDEALNILLNHQEKENFPLVPEVEKE
FT                   SMKILLEKMETKDEPFLSDSKESWEKQNKWLKDKGMTKETVPADELFENILK"
FT   gene            748781..749401
FT                   /gene="tenI"
FT                   /locus_tag="BMB171_C0639"
FT   CDS_pept        748781..749401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tenI"
FT                   /locus_tag="BMB171_C0639"
FT                   /product="transcriptional regulator TenI"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05457"
FT                   /protein_id="ADH05457.1"
FT                   /translation="MKNELHVISNGHMPFEELVNVAMQIESEIDYLHIREREKSTKELY
FT                   EGVESLLMEGFPASKIVINDRIDIAILLNIPRVQLGYRSTDVKSVKEKFSYLHVGYSVH
FT                   SLDEAIVAFKNGADSLVYGHVFPTDCKKGVPARGLEEISDIARCLSIPITAIGGITPEN
FT                   TVDVLTNGVSGIAVMSGIVSSSNPYSKAKSYKESIRKWAEKHV"
FT   gene            749394..750503
FT                   /gene="thiO"
FT                   /locus_tag="BMB171_C0640"
FT   CDS_pept        749394..750503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="BMB171_C0640"
FT                   /product="glycine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05458"
FT                   /protein_id="ADH05458.1"
FT                   /translation="MCEKYDVAIIGGGVIGSSVAHFLAERGHKVAIVEKQSIASEASKA
FT                   AAGLLGVQAEWDAYNPLFELARESRAIFPQLAAVLREKTGVDIGYEEKGIYRIAQNEDE
FT                   KERILHIMDWQQKTGEDSYFLTGDHVREKEPYLSESIIGAVYYPKDGHVIAPELTKAFA
FT                   HSAAISGADIYEQTEVFDIRIENNKVTGVITSEGIVTCEKVVIAGGSWSTKLLSYFHRD
FT                   WGTYPVKGEVVAVRSRKQLLKAPIFQERFYITPKRGGRYVIGATMKPHTFNKTVQPESI
FT                   TSILERAYTILPALKEAEWESTWAGLRPQSNHEAPYMGEHEEIKGLYACTGHYRNGILL
FT                   SPISGQYMADLIEGKQENHLLDSLLSRRV"
FT   gene            750519..750722
FT                   /gene="thiS"
FT                   /locus_tag="BMB171_C0641"
FT   CDS_pept        750519..750722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BMB171_C0641"
FT                   /product="sulfur carrier protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05459"
FT                   /protein_id="ADH05459.1"
FT                   /translation="MNLKINGNQIEVPASVKTVAELLTHLELDNRIVVVERNKDILQKD
FT                   DHTDTSVFDGDQIEIVTFVGGG"
FT   gene            750725..751495
FT                   /gene="thiG"
FT                   /locus_tag="BMB171_C0642"
FT   CDS_pept        750725..751495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BMB171_C0642"
FT                   /product="thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05460"
FT                   /protein_id="ADH05460.1"
FT                   /translation="MLNIGPFSFHSRLLLGTGKFPDFDVQQKAIDVSEAEILTFAVRRM
FT                   DIFDAKQPNLLEKLDVKKYTLLPNTAGAKNAEEAVRIAKLAKASGLCDMIKVEVIGDDR
FT                   TLLPDPVETLKASEMLLEEGFIVLPYTSDDVVLARKLQELGVHAIMPGASPIGSGLGIV
FT                   NPLNLSFIIEQATVPVIVDAGIGSPADAAFAMELGADGVLLNTAVSGAKDPIKMAQAMK
FT                   LSIEAGRLGFEAGRIARKRCATASSPLEGMSVVE"
FT   gene            751488..752507
FT                   /locus_tag="BMB171_C0643"
FT   CDS_pept        751488..752507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0643"
FT                   /product="thiamine/molybdopterin biosynthesis
FT                   ThiF/MoeB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05461"
FT                   /protein_id="ADH05461.1"
FT                   /translation="MNNRYSRQELFSPIGEEGQQKIREKHVLIIGAGALGSANAEMFVR
FT                   AGVGKITIVDRDYVDWSNLQRQQLYAESDVKNNLPKAIAAKKRLEEINSDVTIEALVQD
FT                   VTAEELEELVINVDVIIDATDNFETRFIVNDISQKYSIPWIYGACVGSYGLSYTILPSK
FT                   TPCLSCLLQSIPLGGATCDTAGIISPAVSLVVSHQVTEALKLLVEDYESLRDGLVSFDM
FT                   WKNEYSCMNVQKLRQHNCPSCGENALYPYLNKENTSKTAVLCGRNTVQIRPPHKDEMNF
FT                   EQYKELLEGRVNDLNINPYLLSFSVEDKRLVAFKDGRVLVHGTKDISEAKTIYHRYFG"
FT   gene            752523..753335
FT                   /gene="thiD1"
FT                   /locus_tag="BMB171_C0644"
FT   CDS_pept        752523..753335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD1"
FT                   /locus_tag="BMB171_C0644"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05462"
FT                   /protein_id="ADH05462.1"
FT                   /translation="MKVNKALTIAGSDSGGGAGIQADLKTFQELGVYGMTAITAITAQN
FT                   TLGVQGVYPVPLEGITEQLNSIGTDLTPDAVKLGMLFSSEIIQIVAEQIKKFGWNNIVL
FT                   DPVMIAKGGASLLQQEAVHALKEYLLPVATVITPNVPEAEVLTGVEIHNVEDSKEAAKV
FT                   LHELGAKYVLMKGGHAEYQGNEVIDFLFDGEEFIEFRSERIPSKQTHGSGCTFASAVTA
FT                   GLAKGYSIEDAVQEAKRFISIAIEEPLNIGSGHGPTNHFAYKVNRTRV"
FT   gene            754062..754295
FT                   /locus_tag="BMB171_C0645"
FT   CDS_pept        754062..754295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05463"
FT                   /protein_id="ADH05463.1"
FT                   /translation="MMKVLLLGDIANRWAVSVERVQELVQIDPLFPGPYIILPSKDALY
FT                   LEMDITEYEQLHAELTQVYIRGRNLRAFLRGE"
FT   gene            754299..754421
FT                   /locus_tag="BMB171_C0646"
FT   CDS_pept        754299..754421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05464"
FT                   /protein_id="ADH05464.1"
FT                   /translation="MNKKERMLSATSYALHVIRSFYFIFKRSFLRKEKRNKENR"
FT   gene            754765..754902
FT                   /locus_tag="BMB171_C0647"
FT   CDS_pept        754765..754902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05465"
FT                   /protein_id="ADH05465.1"
FT                   /translation="MVNFNKKEGIVMLDVVMVGIFILLVASMASLASWSDKVVKEGKQS
FT                   "
FT   gene            754999..756666
FT                   /gene="kdpA"
FT                   /locus_tag="BMB171_C0648"
FT   CDS_pept        754999..756666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="BMB171_C0648"
FT                   /product="potassium-transporting ATPase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05466"
FT                   /protein_id="ADH05466.1"
FT                   /translation="MIWVAVIITMLLFILVAKPTGIYLEKAFQGSKTLDKVFGPFEKLI
FT                   FKITGVKAYNQTWKQYALSLVLLNGFMIVVVYFIFRLQGVLPLNPAHIEGMEPTLAFNT
FT                   AISFMADTNLQHYSGENGLSYLSQLIGITFLMFAAPATTLALVMAFIRGLAGKELGNFF
FT                   VDFTRALTRVFLPIAFIAALVFVALGVPQTLDGAVTAQTIEGAKQSILRGPVASFVSIK
FT                   ELGNNGGGFFGANSTHPFENPGQMSNILQMMLMMLLPTALPFTYGRMVGNKKQGRILFV
FT                   SLFMVFLLGFITITTSELNGNPALNGMGIEHVQGSTEGKEVRFGTVFSSLYATVTTAAE
FT                   TGAVNTMHDTLTPIGGLVPLVNMMLNTVYGGVGAGFVNIIMYAIIAVFISGLMVGRTPE
FT                   FLGKKIEGKEMKLIAVTILFHPLLILGFSALALSTNLGTDAISHSGFHGLTQVVYEYTS
FT                   SAANNGSGFEGLGDNTPFWNITTGLVMFLGRYFSLITMLAVAASLKEKTVVPETVGTFR
FT                   TDNSLFGGIFIGTIVIVGALTFFPMLVLGPIAEFLTLK"
FT   gene            756677..758770
FT                   /gene="kdpB"
FT                   /locus_tag="BMB171_C0649"
FT   CDS_pept        756677..758770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="BMB171_C0649"
FT                   /product="potassium-transporting ATPase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05467"
FT                   /protein_id="ADH05467.1"
FT                   /translation="MMRPVVVKEKQLNESQIHAVEDEVRQAKTMDRDIVTHAMKQSVAK
FT                   LNPKVMIKNPIMFVVEIGFIITFILSFLPSSSSSIPGWFNITVSLILLFTVLFANFAEA
FT                   LAEGRGKAQADSLKQSKKDVFANVVKENGDIVQVSATDLRKGDVVIVKQGEMIPSDGEV
FT                   IKGLASVDESAITGESAPVIKEAGGDFCSVTGGTMVVSDEITIVITSNPGESFIDKMIS
FT                   LVEGAARQKTPNEIALNTVLTSLTLIFLIVVVTLPIFTNYLGFQIDTAVLVALLVCLIP
FT                   TTIGGLLSAIGIAGMDRVTKFNVLAMSGKAVEAAGDINTIILDKTGTITFGNRMAHTLL
FT                   PVGNETIEQVGKWAAISSVLDETPEGRSVIEYVQGKSISYNRELAEQGEFVPFKAETRM
FT                   SGVDLQDGTKVRKGAVGAVIEWVESQGGTIPKDVNQKADLISKEGGTPLVVAVDNRIYG
FT                   LIYLKDTVKPGMRERFEQLRQMGIKTVMCTGDNPLTAATIAKEAGVDEFVAECKPEDKI
FT                   AVIKAEQDKGKLVAMTGDGTNDAPALAQADVGLAMNSGTTAAKEAANMIDLDSNPTKII
FT                   EVVGIGKQLLMTRGALTTFSIANDIAKYFAIIPAMFTLAIPQMEALNIMKLTSPLSAIL
FT                   SALIFNAVIIPLLIPLAMKGIAYKPMSSNALLSRNLLIYGLGGVIVPFIGIKVIDIIVG
FT                   LFI"
FT   gene            758787..759368
FT                   /gene="kdpC"
FT                   /locus_tag="BMB171_C0650"
FT   CDS_pept        758787..759368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="BMB171_C0650"
FT                   /product="potassium-transporting ATPase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05468"
FT                   /protein_id="ADH05468.1"
FT                   /translation="MEKKQSILSPIIRITFTFLVLCGLVYPLIVTGIAQAVMKDNADGS
FT                   LIYNDKNEVIGSKLIGQNFTDPRYFQGRVSSIEYKAEASGSNNYAPSNPDLEKRVEKSI
FT                   EEWKKQNPSVPVTEVPIDLVTNSGSGLDPDISPKAASVQVDRISKLTNIPKEKLNQLIK
FT                   DQTEGAALGLFGETRVNVLKLNLALQELMK"
FT   gene            759434..760580
FT                   /pseudo
FT                   /gene="kdpD"
FT                   /locus_tag="BMB171_C0651"
FT                   /note="sensor protein kdpD"
FT   gene            complement(760606..761787)
FT                   /locus_tag="BMB171_C0652"
FT   CDS_pept        complement(760606..761787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0652"
FT                   /product="bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05469"
FT                   /protein_id="ADH05469.1"
FT                   /translation="MKKSKLTFILYVVCISALLGSFAQNIYTPILPMIQNSFHTSLYLV
FT                   NVTVSLFTFVLAIMQLVYGPLIDTKGRKSVLIPSLVISTIGSIGCAFSANIYLFLFFRA
FT                   VQAIGIAAIPVVSATIIGDLFEGKERGEAMSLYQMLLALAPAMAPLIGGYLGSINGHLS
FT                   VFLFLSTLGIILLIINISLLPETKPNIIKQSKAQKNYSLILKNKTGFSITLIGFIQFCI
FT                   YFCFLVFLPSILTNSFHLTVNKIGLMFVPMSLSIMLGSFCYKFLQKRLTTKQALFITSF
FT                   FNIICVVLFSFTYSINIPFIIIVTSLYGFSMGLSMPTHTTLLTEEFVQERATAIGMYNF
FT                   IRYLGMGTGPLIGGFLLFNQNYFWIFFLGAIMFLLVILYTMKMLSLHAVQKLK"
FT   gene            761928..762389
FT                   /locus_tag="BMB171_C0653"
FT   CDS_pept        761928..762389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0653"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05470"
FT                   /protein_id="ADH05470.1"
FT                   /translation="MKHATKQMEILSDIRTLLHKKEEHLKRQNEKFLRETGVSSMSLSE
FT                   LHVIECIGKNGLMNVTAITTEMGMTKGAISKICTKLFQKQFVEKMQMLDNQKEIFFSLT
FT                   ESGNEIYKAHEKLHKQAEEKWLLLLDGYTKEEQDFIQRFIKDVSGHLEI"
FT   gene            762518..763372
FT                   /locus_tag="BMB171_C0654"
FT   CDS_pept        762518..763372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0654"
FT                   /product="Serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05471"
FT                   /protein_id="ADH05471.1"
FT                   /translation="MLENTGLVLEGGGMRGVYTGGILEYFMEQDLYFPYVIGVSAGACH
FT                   AASYLSRQRNRNKTVNIDYASHPKYLSYKNLWRKRQLFDMDFIFHEIPEKHVPFDFETY
FT                   FNSPERFLVGTTDCETGQSVYFEKEGTNDDALNLLQASSSLPFIAPVVNYRGKQLLDGG
FT                   ISDPIPVRKAQEDGFKKSVVILTRNHGYAKKKSRFGWIAAKAYKKYPNLVNTMLNRYEV
FT                   YNETLHYIEKEEQAGNLFVIRPEVPLQVDRMEKDTAKLQNLYEQGYEDAKRQFADLQAF
FT                   LQK"
FT   gene            complement(763498..764799)
FT                   /locus_tag="BMB171_C0655"
FT   CDS_pept        complement(763498..764799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0655"
FT                   /product="guanine-hypoxanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05472"
FT                   /protein_id="ADH05472.1"
FT                   /translation="MFNLSKHKTSIKTEIMAGIITFLTMAYIIVVNPVILGDAGVPFEQ
FT                   AFTATIIAAVVGTLFMAIFTNLPIAIAPGMGLNAYFSYSVVKAHEGMTFAIAFSAVFVA
FT                   GMILILLSFTSFRTKLMEAIPENLKHAITAGIGLFIAFIGLRLTGIVTKNDANLVGLGD
FT                   LHSAPVLLALAGLGITIVLMSLNVNGALFIGMLLTGIIAFFTGQLSFSNGVTSMPGLPE
FT                   GIIVSNPITAVSDVINYGLYGVVFSFFLVTLFDTTGTLLGVAQQGGFMKDGKLPKAGRA
FT                   LLSDSFSATIGSMFGTTPSTAYIESSAGVAAGGRTGLTTVTVAVLFALAAFFGPLVSAV
FT                   SGVSAITAPSLIIVGSLMMGSVRHIDWDAFDEAFPAFLVILSMPLTSSIATGIALGFIS
FT                   YPLMKVAKGKFRAVHPLVYVFGILFAYQLIFLPH"
FT   gene            765002..765868
FT                   /locus_tag="BMB171_C0656"
FT   CDS_pept        765002..765868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0656"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05473"
FT                   /protein_id="ADH05473.1"
FT                   /translation="MPQQKNFITMPAQHQNKQPGIESLMSPLPQFEDANYKGSEKLKGK
FT                   NVLITGGDSGIGRAVSIAFAKEGANVAIAYLDEEEDANETKQRVEKEGVKCVLLPGDLS
FT                   NEQHCKDIVEETARQLGSLNILVNNVAQQYPQQGLEYITAEQLEKTFRINIFSYFHVTK
FT                   AALSHLKKGDVIINTASIVAYEGNETLIDYSATKGAIVAFTRSLSQSLVQKGIRVNGVA
FT                   PGPIWTPLIPSSFDEKKVSQFGSNVPMQRPGQPYELAPAYVYLASGDSSYVTGQMIHVN
FT                   GGVIVNG"
FT   gene            766037..766696
FT                   /locus_tag="BMB171_C0657"
FT   CDS_pept        766037..766696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0657"
FT                   /product="protein erfK/srfK precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05474"
FT                   /protein_id="ADH05474.1"
FT                   /translation="MSFFENGNYTKTFPVTTGRDRTPTPEGNFCIITKFKNKEYHRKKI
FT                   PGGAPNNPLGTRWLGLDKNEYAIHGTNREWTIGSRESNGCIRMHDRDIQWLYDRVQLQT
FT                   KVIISRFHTSPEYEANKLGYRVVSWNGRKIEKEQIGVLTLVDRADIYWQEPNGQLTKVK
FT                   TVLPNERYPVYSKRKDGIYYIGNNSYIIDETGEKVRYEQIPSSILSNIYKRKYNVP"
FT   gene            766800..767051
FT                   /locus_tag="BMB171_C0658"
FT   CDS_pept        766800..767051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0658"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05475"
FT                   /protein_id="ADH05475.1"
FT                   /translation="MKSEFAFKVFLVTTCLFIVYLYAFLVFSFYVPYVDLILFFGFIWA
FT                   FVKAREGEKSIYRRITLCGTAVLVILYFFIMHDFWRGM"
FT   gene            complement(767065..768006)
FT                   /locus_tag="BMB171_C0659"
FT   CDS_pept        complement(767065..768006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0659"
FT                   /product="fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05476"
FT                   /protein_id="ADH05476.1"
FT                   /translation="MRNVFCIGELLIDFVCRNTNVSLVNGSDFEKKAGGAPANVAAAIT
FT                   KLGGHATFMGQVGNDPFGEFLEQTLQRAQVDTSMLIKDKQTTLAFVSIDQDGERDFTFM
FT                   RGADGEYQFNSIDLSKIQTNDLIHFGSATALLSSPLKETYFQLLQYAKDKGHFISFDPN
FT                   YRSALITNTEQFSQDCLTFIKHAHFVKVSQEEATMLSKESDLQQAALKLLNYGAKVVAI
FT                   TLGKDGTLLATNEGQTIVSSISIQQVDTTGAGDAFVGAMLYQIAQSEHTLSYHFKDLTA
FT                   FISFANKVGAITCTNYGAIASLPSLTDIKAYD"
FT   gene            complement(768003..769478)
FT                   /locus_tag="BMB171_C0660"
FT   CDS_pept        complement(768003..769478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0660"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05477"
FT                   /protein_id="ADH05477.1"
FT                   /translation="MSKYKTILQSNKDELHSLYEIANQDSWKPIYHIHPPFGLMNDPNG
FT                   VSYYNDEYHVFYQWYPFGPIHGMKHWGHVRSKDLINWERMPVAIIPTESYESHGAYSGS
FT                   AIVKDGLLHLLYTGNIKKPDDSRDAKQCMATMDSQYTMTKYSNNPVIDIIPDGYTKHVR
FT                   DPKVWKHNDIYYMLLGAQRENKTGTLLLYKSQDLYNWHFQGEITTNLKEFGFMWECPDY
FT                   FQLSGKDVLLFSPQGIEKDGENFHNVYNVVYAIGHFDIKNLYFHVDSYYEADKGFDFYA
FT                   PQTLEDSTSRRLLFAWAGSSEITYPSDDYMWAHCLTLPRELTLEDNILKQKPVSELTKL
FT                   RTTKKDISGDITAGLNVLSTLDDEDSYELIVTLKTEDAKRFGLSLFHNEEECFPITFNR
FT                   EQGTISIDRGNFYHQFGGEYGFERCKKIDIQDTIELQIFVDKSIVEIFLYDGSTVFTSR
FT                   VFPRKDMKHHIAIFSDAKLNFTITQYKLKRGIV"
FT   gene            complement(769496..770872)
FT                   /gene="treB"
FT                   /locus_tag="BMB171_C0661"
FT   CDS_pept        complement(769496..770872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="BMB171_C0661"
FT                   /product="PTS system, sucrose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05478"
FT                   /protein_id="ADH05478.1"
FT                   /translation="MDMKQIATQVIQNIGGKENIVRATHCATRLRLILKDDTKINAAEI
FT                   ENIDGVKGAFATTEQYQIIFGTGIVNKVYDEFSKLIGIAELDSTTSNDIPKKKMNPIAR
FT                   LAKTLSNIFVPIIPAIVASGLLMGLLGMLKAFKLVPGDHSLIQLLDMFSSAAFIILPIL
FT                   IGVSAAKEFGGNIFLGAVVGGILTHPSLTNPWTLSNAKPTVLHFLGMDIDMIGYQGTVL
FT                   PILLCVYVMSTIEKELRKRVPNSLDLLVTPFLTIIITGFLSLIIIGPIGYKIGDGITYL
FT                   LNTIYQFAGPVAGLIFGGLYSTIVLTGLHHSFHAIEAGLLANKDIGVNFLLPIWSMANV
FT                   AQGGATLAVYFKTKNKKTKEIAIPAAASAFLGITEPAIFGVNLKLGKPFIAAAIGGAIG
FT                   GAYVVWMQVAANAYGLTGIPMLTIVAPLGMMNMIHYIIGFAIAVITAFVATFILYKESK
FT                   "
FT   gene            complement(771008..771994)
FT                   /locus_tag="BMB171_C0662"
FT   CDS_pept        complement(771008..771994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0662"
FT                   /product="sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05479"
FT                   /protein_id="ADH05479.1"
FT                   /translation="MAKTIADIAKLAGVAKSTVSRYLNGGYVSDKTKLKIEGIIQETNF
FT                   SPNTFAQSLKAKTTNLIGVIIPRLDSFATMKTLIGIDKTLQENNYQMLVANANQTTGTE
FT                   IQAIENFIKQKVAGIILLTKTLTNEHQKIMANSNIPILFVGQEYKDQYCLVHDDYDAAY
FT                   ELGAYVLSQGHRHIAYLGIEKDDISVGINRKNGFQKAIENLEPTCNVSYYETTFRIEDA
FT                   MKQVQHILDNNCPTLIVCATDNIALGAMKVIHSHSLSVPGDISVTGFGGYDISEMVHPS
FT                   LTTIAFDYEYAGKLAATSLSQLVENKTIPKILHSRYTLKIQESVDKI"
FT   gene            complement(772112..772327)
FT                   /locus_tag="BMB171_C0663"
FT   CDS_pept        complement(772112..772327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05480"
FT                   /protein_id="ADH05480.1"
FT                   /translation="MPEVRCSVSNCSFWGQGNFCQASAIIVQPDADETGQTENDSYTAA
FT                   VLTNETLESSVATSVETCCHTFKPRY"
FT   gene            complement(772400..772855)
FT                   /locus_tag="BMB171_C0664"
FT   CDS_pept        complement(772400..772855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0664"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05481"
FT                   /protein_id="ADH05481.1"
FT                   /translation="MKKMLIFGGIIIALFAAIFAVTQMEEKNASTSQKIDNATGSQTDG
FT                   PDYYTNKISLSDLQKNLKEKKEETVYFYQTSCVHCQKLSPVVVPMAKDLNVDMKVMDIE
FT                   KLDAPWDEYKIQGTPTIIHFKDGKEVSRISGEQPKDKLKEWLEQTKK"
FT   gene            complement(772868..773287)
FT                   /locus_tag="BMB171_C0665"
FT   CDS_pept        complement(772868..773287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0665"
FT                   /product="putative disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05482"
FT                   /protein_id="ADH05482.1"
FT                   /translation="MGREKKQEYALLTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRI
FT                   FMYPFVLWLGIAVAKKDYRIASYSLPIATIGACISLYHYAIQKVAAFSAAGAACGRVPC
FT                   TGEYINWFGFVTIPFLALIGFITIAVCSFIVIKNK"
FT   gene            complement(773453..773701)
FT                   /locus_tag="BMB171_C0666"
FT   CDS_pept        complement(773453..773701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05483"
FT                   /protein_id="ADH05483.1"
FT                   /translation="MQTYNDYDKALYYTYCCNWDKLLVLMVQTNDQLFSKRIEHFLHAY
FT                   QYSKELPEVDKQLQLLFQYIDHASQKSHVEEVEQIQM"
FT   gene            complement(773822..774334)
FT                   /locus_tag="BMB171_C0667"
FT   CDS_pept        complement(773822..774334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05484"
FT                   /protein_id="ADH05484.1"
FT                   /translation="MKKYVFSLLAVLSLILAGCGSTSTNDQKSSESKKEEHDHASHTQQ
FT                   ADIQEKTKGVDTLPTFLDKLDPQMKDIYTVAGQNAELLDWIPCYCGCGESVGHKNNKNC
FT                   FIREIKKNGEVVWDSHATTCVNCLEIAVESASMKQKGKSTLEIRNYIDNKYKEGYGKPT
FT                   PTPMPKA"
FT   gene            complement(774389..775489)
FT                   /locus_tag="BMB171_C0668"
FT   CDS_pept        complement(774389..775489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0668"
FT                   /product="GerB family spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05485"
FT                   /protein_id="ADH05485.1"
FT                   /translation="MNTMNKTKTVSPYFAFILLHSLQIGIGILGYQRVILKNAGYDAWI
FT                   SLIIAGIATHIVLFCMLKMLEKDGDLISIHTTTFGKWVGSIFSVIFTLYCLLFCLTVLR
FT                   TYMEVIQVWIFPTIKLWKLTLMFLLVTYYIIKGGFRSVTGICFWGIVLPIFVVFFLIYP
FT                   MKYAHFRNILPIFTHSPFDMLISAKQSALEFLGFETILIFYPFIEKGKSLKRWAHAGIA
FT                   FSTLIYVVLAIVSFMYYSEGQLNRTIWPTLTMLKIIKVPFIQRFEYIIIFVWFLIILPN
FT                   LCLTIWSSCQTMKRSFHISFKFTLPFFIFIIFSASLLFTNRESINTLNTVLSQAGLYIV
FT                   YAYIPILFLFHSLRWYFKNRSKKTSP"
FT   gene            complement(775506..776591)
FT                   /locus_tag="BMB171_C0669"
FT   CDS_pept        complement(775506..776591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0669"
FT                   /product="GerC family spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05486"
FT                   /protein_id="ADH05486.1"
FT                   /translation="MKKLLLHLIIIIFFILQTGCTQTYIVDTQRIIHIAGFDITKNKRF
FT                   QGTILFPEYTHGVKSKPETQSTSARSLETIASRLNAKSPHNVVVGQMRVVLFGKALGER
FT                   GMGEIITNLQRDPNIGRDVQLAIVDGSAEELLNYGKKNGSLYIADLLEQNIRNENIPQT
FT                   ELNIFLYNYYSSVCDAYVPYIKMDDNHSVAVKGLAFLKGDKVVMYTDKRHSVLAKLLIN
FT                   PTKNGRYEAAIKKDKHKGMVVIQNLAGENKYNIDQTGDIPKVKIHLKLNGLIKNSPNWI
FT                   DLRKETNINYIKKQIERNVEKDCEDLIKQFQEKEIDPLGIRDEIRSHTRKWNITQIRNM
FT                   YKNVAVDVNLDLNIVQSGIGE"
FT   gene            complement(776588..778105)
FT                   /locus_tag="BMB171_C0670"
FT   CDS_pept        complement(776588..778105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0670"
FT                   /product="GerA family spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05487"
FT                   /protein_id="ADH05487.1"
FT                   /translation="MFGLSSKKSKKTNTKTLCSIPEFIQTMKESSDFVSHNVLENETLC
FT                   LFYYRSVVEALIIKQFILTPLKKESEQIQNISDLCNIVSIEDIIISPSIDDIREKLLGG
FT                   YILIRLKNNSNPDQYALIRAESTVLGTRLYNDTENEYSVIGPKIGFVENLDTNIHLLRR
FT                   NIVTEQLIFKEVTVGSMSKTKVAVAYIEGVTNEQFINTAIQRLEDIDFDVPFDSTMIEQ
FT                   FISDNSNSPFPVLLPTERLDRAVFALINGEVLILTDGSPYALSGPTTLLDFFISPEDYY
FT                   LPWMIGSFFRIIRFFGAIFSLFSSAIYTAALTYHYQMIPADLLGPIIFSRANVPFPPIL
FT                   EALFLEITIELLREAGARLPTKVGQTIGIVGGIVIGQASVEAALTSTILLIAVALSALA
FT                   SFTTPTVKMSSTIRLLRFPLILLAGAFGGLGLIVGFVFILAHLIKLKSLGSPYLLPLYP
FT                   FRGLGTAEGFLRLPFSQTAQRPSFLRPKSKWRYNPNKAKQKRDGENE"
FT   gene            complement(778231..778827)
FT                   /locus_tag="BMB171_C0671"
FT   CDS_pept        complement(778231..778827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0671"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05488"
FT                   /protein_id="ADH05488.1"
FT                   /translation="MYKKIAVSMTMAALLCGAIIFPASAATPKEVTMHHHKPISDEEIQ
FT                   SLEKLGYNKHEIWKAAHIARISNKEIKDVLAYYKQNKSWEKTAEHFGIDPSKLKKHHMN
FT                   KETKQALLQQLATMQKSTPDQLKQKMKEYNIKLRHLTVLTIISQKSNTPLDDVLKMKKD
FT                   GMDIKQIAEKLNVKREDIRAEMMKLVKSIKEQKTN"
FT   gene            779066..779626
FT                   /locus_tag="BMB171_C0672"
FT   CDS_pept        779066..779626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0672"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05489"
FT                   /protein_id="ADH05489.1"
FT                   /translation="MTTYTSIANVIKERRSVRTFTDKAVEKDLLIELLNDATWAPNHKH
FT                   REPWNCKLYIGEGRKKLVDAVLNSFTEEERAKRGKILSDRFLSTPAQIVVYINEDPRQI
FT                   QRDEDYAATCAFMQNFQLLAWERGLGCVWKSGGLNYNPLFIEGIGLTRGQRIVGILHIG
FT                   YFDKAPEGKARTPITEKMEIIEG"
FT   gene            779741..781159
FT                   /gene="spoVR"
FT                   /locus_tag="BMB171_C0673"
FT   CDS_pept        779741..781159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoVR"
FT                   /locus_tag="BMB171_C0673"
FT                   /product="stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05490"
FT                   /protein_id="ADH05490.1"
FT                   /translation="MRASDDKALQYAIAEITEIATGFGLDFYPMRYEICPAEIIYTFGA
FT                   YGMPTRFSHWSFGKQFFRMKLQYDLGLSKIYELVINSDPCYAFLLDTNSLIQNKLIVAH
FT                   VLAHCDFFKNNIRFSNTKRDMVESMAATADRVKAYEHKYGKAEVETFLDAVLAIQEHID
FT                   PSLMRPKLAWSIDDLEDEEVEKKKVSQYDDLWNLDNRNKKQERSNVRKKKKIPPQPEKD
FT                   LLLFIEEYSRELEDWQRDILTMMREEMLYFWPQLETKIMNEGWASYWHQRILREMDLTS
FT                   DEAIEFAKLNAGVVQPSKTSINPYYLGIKIFEDIEERYNNPTEEMKRRGVKPGSGRDKM
FT                   FEVREIEWDVSFLRNYLNKDLVMREDMYLFQRQGKEYKVIDKEWENVRDQLVNMRTNGG
FT                   FPYLVVEDGDYLKNGELYIKHSYEGIELDLKYLEKVLPYLHQLWGRTVHMESIVESKGV
FT                   VFSYDGKMVHRKYV"
FT   gene            781267..782538
FT                   /locus_tag="BMB171_C0674"
FT   CDS_pept        781267..782538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0674"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05491"
FT                   /protein_id="ADH05491.1"
FT                   /translation="MGKVGVGKVDITPPIGIDFVGYHRETGINNIEERIYGTVFVFEKD
FT                   EMKTVFISIDNIGMLIEDTNMIRERVARELHVPFEQITVVYTHTHSGPETVGDNPLVQS
FT                   YKTILVNNVVHGAVTANKNLKRCEVGWGVTTGDIGVNRRERTSDGKAKMGINIEGVVDN
FT                   RIGMLAIRDAETKKLSGILVFCTAHPNVLKENSDELSADYPGMTREILEQIVNCPVIIV
FT                   QGAAGNVNAKYRGSSEALKQMAYLLSGHVLTMLPTVTYSPIVNLRTVSSMLQMKLKDIP
FT                   EIDEIRSMAQLAEKQWGVNTDEWLTIVLEKFEQGIRRLSIDLEVQLFQVNDGIFSGIPM
FT                   EPFSETALEMKEILQNELAFFGGYTNGYIGYLPTKEEFAYGGYEVELSPVVYGPITNLL
FT                   MPPEETTAELIVKKVTSLCNKVNL"
FT   gene            782713..783045
FT                   /locus_tag="BMB171_C0675"
FT   CDS_pept        782713..783045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0675"
FT                   /product="glutamyl endopeptidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05492"
FT                   /protein_id="ADH05492.1"
FT                   /translation="MLDSFISIRCRLALYSFGVLFIFFCIVFLVNQKVYAEDVPWTSVS
FT                   NEGERVLFQEQSLYSNDRRGEDLVSPSFEGRKHGREDWGYLLRDSNFNYPFSYGCNNNS
FT                   YPYSRK"
FT   gene            783162..783464
FT                   /locus_tag="BMB171_C0676"
FT   CDS_pept        783162..783464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0676"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05493"
FT                   /protein_id="ADH05493.1"
FT                   /translation="MSSSIANNEKKFSKVVNFVTFHVENKEKQPIKDFEIILMKDESPQ
FT                   PSKEIGISIGKTDEEGKVIWRNVRTGKYILFFPNNETQMVMINDRGATKKINISL"
FT   gene            783908..785572
FT                   /locus_tag="BMB171_C0677"
FT   CDS_pept        783908..785572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0677"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05494"
FT                   /protein_id="ADH05494.1"
FT                   /translation="MSRKIVVVGGVAGGASVAARLRRLSEEDEIIMVERGEYISFANCG
FT                   LPYYIGGVITERQKLLVQTVERMSKRFNLDIRVLSEVVKINKEEKTITIKNVTTDETYN
FT                   EEYDVLILSPGAKPIVPPIPGIEEAKALFTLRNVPDTDRIKAYIDEKKPRHATVIGGGF
FT                   IGVEMVENLRERGIEVTLVEMANQVMPPIDYEMAAYVHEHMKVHNVELVFEDSVDALEE
FT                   NGTVVRLKSGSVIKTDMIILAVGVQPESSLAKDAGLALGVRGTIKVNEKFQTSDPYVYA
FT                   IGDAIEVKDFVTETETMIPLAWPANRQGRMLADIIHGHTESLYKGTMGTSVAKVFDLTV
FT                   ASTGVNEKILKRLNIPYEVVHVQANSHAGYYPNATPVLIKLIFNKESGKIYGAQALGRD
FT                   GVDKRIDVIATAMKANLTVIDLPDLELSYAPPYSSAKDPVNMVGYAASNIVDGFVETVQ
FT                   WHEIDRIVDNGGYLIDVREPNELKQGMIKGSINIPLDELRDRLDEVPMDKEIYITCQLG
FT                   MRGYVAARMLMEKGYKVKNVDGGFKLYGTVLPERVVY"
FT   gene            785757..786020
FT                   /locus_tag="BMB171_C0678"
FT   CDS_pept        785757..786020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0678"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05495"
FT                   /protein_id="ADH05495.1"
FT                   /translation="MEYNQDMKNRLKRIEGQVRGVLRMMEEGKDCREVITQLTASRSAL
FT                   DRTIGLVVGTNLEQCLREQFESGNGSNEELIKEAVQLLVKSR"
FT   gene            786109..786669
FT                   /locus_tag="BMB171_C0679"
FT   CDS_pept        786109..786669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0679"
FT                   /product="molybdopterin biosynthesis MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05496"
FT                   /protein_id="ADH05496.1"
FT                   /translation="MSIKVDMSLDCKGLACPMPIVKTKKAIEGLAPGQVIEVKATDKGS
FT                   TVDIKSWASKVGHQYIGTKHEGDVLVHYVRKANEHEVNEVVKYPHTITNAELQSILSHG
FT                   EESIVLDVREAAEFAFGHIPSAISVPLGELDSAVLDKMKQIYVICRTGNRSDVACHMLK
FT                   EKGYANVKNVIPGMLEWKGNVEK"
FT   gene            786708..787838
FT                   /locus_tag="BMB171_C0680"
FT   CDS_pept        786708..787838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0680"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05497"
FT                   /protein_id="ADH05497.1"
FT                   /translation="MDIKALQAKDVAEKVLFGELFILDVRNEADYEDWKIEGKQVSSIN
FT                   KPYFDLLDGVDHIVSELPKDKDVLVVCAKEGSSIFVAEQLTEAGLENIYYLAGGMKAWS
FT                   EYVKPVKVGDLKNGGSMYQFNRLGKGCLSYMVISNGEAAVIDAVRTAEAYEEFAKEHGV
FT                   TIKNVMDTHLHADHISGGRKLAEKVGGTYWLPPKDAEEVVFSYEPLVEGSVITVGGTKI
FT                   EIDALYSPGHTIGSTSFIVDDSYLLSGDILFVDSIGRPDLAGKAEDWVSDLRNTLYSRY
FT                   KELSQNLVVLPAHYSKVSEMNESGIVSAKLKDLFANNAGLNIEDEGEFRKVVTENLPPQ
FT                   PNAYEEIRQTNMGKIHPSVDKEREMEIGPNRCAVHE"
FT   gene            787866..788096
FT                   /locus_tag="BMB171_C0681"
FT   CDS_pept        787866..788096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0681"
FT                   /product="molybdopterin biosynthesis MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05498"
FT                   /protein_id="ADH05498.1"
FT                   /translation="MMNIKQVLDAKGLACPMPIVRTKRAMDALQTGEVLEIHVTDKGSV
FT                   KDIPAWANKCGHDIVKLEEEGDVLKFWIRKA"
FT   gene            complement(788198..788326)
FT                   /locus_tag="BMB171_C0682"
FT   CDS_pept        complement(788198..788326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05499"
FT                   /protein_id="ADH05499.1"
FT                   /translation="MKAFHMIPSIFTYCTDINKILPLFPHYTFQFFAIYILNTFHW"
FT   gene            788312..788494
FT                   /locus_tag="BMB171_C0683"
FT   CDS_pept        788312..788494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0683"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05500"
FT                   /protein_id="ADH05500.1"
FT                   /translation="MKGFQNIPLNDLASKANQLDKNKEVIVICQSGMRSKQAAKVLKKL
FT                   GFQQVINVSGGMNGL"
FT   gene            788509..788805
FT                   /locus_tag="BMB171_C0684"
FT   CDS_pept        788509..788805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0684"
FT                   /product="molybdopterin biosynthesis MoeB protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05501"
FT                   /protein_id="ADH05501.1"
FT                   /translation="MKEMTTKELEEKLLRKEAVNIVDVREVEEVAEGKIPEACNIPLGL
FT                   LEFRMHELNKNQEYIIVCRSGGRSARAVQFLESYGFQAINMVGGMLAWEGKVI"
FT   gene            788875..789354
FT                   /locus_tag="BMB171_C0685"
FT   CDS_pept        788875..789354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0685"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05502"
FT                   /protein_id="ADH05502.1"
FT                   /translation="MEQQKKTTIVLFSGDYDKAMAAYIIANGAAAYDQEVTIFHTFWGL
FT                   NALRKDEHVKVKKTFIEKVFGKMMPRGADKMGLSKMNFAGMGPKMIKGIMKKHNAMPLP
FT                   DLIDLAKEQGIKLVACQMTVDLLGLKEKEIMEGVEFAGVGAYLADASDGNVNLFI"
FT   gene            789387..790151
FT                   /locus_tag="BMB171_C0686"
FT   CDS_pept        789387..790151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05503"
FT                   /protein_id="ADH05503.1"
FT                   /translation="MSGVLLLFIIGFIGSFISGMVGIGGAIINYPMILYIPVLLGFTGY
FT                   TSHEVSGITAVQVFFATFAGAWAYRKSTDMNKMLVVYMGASILIGSFIGSFSANLLDEH
FT                   AVNVVYTVLATIAAMMMFVPKKNNSGAVKYNKWLASVLAFIVGGVSGIIGAGGAFLLVP
FT                   IMLVILKLPLRMTIATSIAITFISSVGITTGKVITGQVVIIPALIIAVASIFAAPLGAR
FT                   VGKRINQKVLQYMLSILIVGTAIKMWIDMISK"
FT   gene            complement(790184..790624)
FT                   /locus_tag="BMB171_C0687"
FT   CDS_pept        complement(790184..790624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05504"
FT                   /protein_id="ADH05504.1"
FT                   /translation="MKAAVKHNISDFKDYLKSNDIYMEENIDENDGSVHFSVGLETEAG
FT                   AKIQLIAAFQNEHPTVDIYCFNVAHVPDATSTNDILHVINELNTSYRFAKFTLNKQNAI
FT                   DISTSLAFSEPNFNPALVFEHTRMLYKLANDEYKNLMKVIWA"
FT   gene            complement(790773..791972)
FT                   /locus_tag="BMB171_C0688"
FT   CDS_pept        complement(790773..791972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0688"
FT                   /product="LytR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05505"
FT                   /protein_id="ADH05505.1"
FT                   /translation="MEQNPSLQENTRNKPKKNKKKIKIIISAILFVLLIGGGYTWFLVN
FT                   KASSAVRNAAHDLARGDKSDLRDKAVKPITNNVSVLIMGVDESDVRGKEYGEAIRTDAL
FT                   LLATFNKDSKTVKLLSIPRDTYTYIPIEKKKDKITHAHAFGSAKNGKNGGPQASIDAVE
FT                   KLMNVPVDYFVKFNFKSFIKIVDDLGGVEVDVPVEFTEQDSNDNAEAIHLEKGVQKLNG
FT                   EEALALARTRHIDSDAMRGQRQQLVIEAILKKLTSVGSVTKVGNIIDDINGQFVTNLTF
FT                   DDMLSFYKYGSDSEIEKLQIQGDDCYMAKGDDTCSKSAGGGRTYYYNPDKKELANVTNE
FT                   LRTHLGLPAYTKSDSDSDSKKTKESKSENSSERESSNNEVKNKNKNSSEDTETSSNDNE
FT                   "
FT   gene            792287..793282
FT                   /locus_tag="BMB171_C0689"
FT   CDS_pept        792287..793282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0689"
FT                   /product="alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05506"
FT                   /protein_id="ADH05506.1"
FT                   /translation="MNHTSFRAIVVNETENHQFVRKVVEREVSSLPEGDVFIQVHYSSL
FT                   NYKDALSATGNKGVTRTYPHTPGIDAAGVVVSSEDATIKAGDQVIVTGYDLGMNTSGGF
FT                   GEYIRVPSSWVVPLPEGMSLKESMMYGTAGFTAALSVYKLIGAGVKPSMGDVLVTGATG
FT                   GVGSVAVSILSKLGFNVVGATGKMEEEDMLLRLGAKKVIHRAELNDESGRPMLKGIYAG
FT                   VIDTVGGHMLETALKTVKYGGCVTTCGNVAGQELQTTVYPFILRGISLLGIDSVQCPVD
FT                   VRRDVWTLLAKEWGNKELLSYTEECTLEELEKKFALILQGKLKGRTVVKI"
FT   gene            complement(793320..794900)
FT                   /locus_tag="BMB171_C0690"
FT   CDS_pept        complement(793320..794900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0690"
FT                   /product="Sodium-dependent phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05507"
FT                   /protein_id="ADH05507.1"
FT                   /translation="MGDGLQQAAGDRLRDILDRFTTNPLMGVLAGMLVTVLIQSSSGTT
FT                   ALTVGLVSAGFMTLRQAIGVIMGANIGTTVTAFIIGIKIGEYALPVMAVGAILLFFFKN
FT                   KKVHSVGQVVFGFGMLFFGLELMSAGMKPLRSLESFQELTVSMSDNPILGIVVGTVFTL
FT                   IVQSSSATIGILQELFGQGAIDLQAALPVLFGDNIGTTITAVLAAIGTSIAARRAALVH
FT                   VIFNIIGTIIFTILLIPFTSLIQYFQTSLNLNPEMTIAFAHGTFNVTNTIIQFPFIAVL
FT                   AWIVTKIIRGEDAAIDFKPQHLNPIFIEQSPAIALTEAQKEIIRMAEFSLHGLKEANQF
FT                   LNTQDKKHANMATQLEGAINNLDKKITEYLVLLSEKPLSPTDSEKHSVLAGVVGDIERV
FT                   GDHVENLVELVDFQISNRVSLSDEALAELNEMLELTISTLQDSVEALTNFDTELAQTVI
FT                   AKERKIDQMERVLRKRHVLRLNERSCSGDASIIFVDMVSNLERIGDHAVNIADGVLGEQ
FT                   GKINLKQSL"
FT   gene            complement(795327..796529)
FT                   /locus_tag="BMB171_C0691"
FT   CDS_pept        complement(795327..796529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0691"
FT                   /product="quinolone resistance NorA protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05508"
FT                   /protein_id="ADH05508.1"
FT                   /translation="MGEAILVKREPLWTKEFVALIFANLCMFLGFQMLIPTLPVYVKEI
FT                   GGTSSNIGFVVGMFTVAALFVRPLTGNALQKFNKKIILMIGTAICLLAMGSYLFASTIF
FT                   LLLAVRILHGAGFGITTTTYGTVVSDLIPSARRGEGMGYFGLSGTIAMALGPLIGLWLM
FT                   QTYNFTILFLCALSCTIVSLILTKLLQIQKTKQPPQQSSSTFLDGFIERKALLPSLLIL
FT                   CITLMYGGIGSFITLFATEVGIADISLFFLCNALAIAVTRPFSGKLYDAKGHTFVIIPG
FT                   VIITFTGIILLSYTTTIPSLIIAAACYGSGFGAIQPALQAWMIDRVAPHRRGVATATFF
FT                   SAFDLGIGAGAIIFGFIAHFTNYATVYRYSSLLLIAFLFIYITSIRKQKHGDKNTEKAA
FT                   G"
FT   gene            796849..797937
FT                   /locus_tag="BMB171_C0692"
FT   CDS_pept        796849..797937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0692"
FT                   /product="outer surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05509"
FT                   /protein_id="ADH05509.1"
FT                   /translation="MRRLGISIYPEHSTVEKDKEYLTLASKYGFTRVFTCLLSVDGEKE
FT                   KIIEEFKETISHANALGFQVLVDISPSVFEQLGISYNDLSFFHELGAYGIRLDVGFSGL
FT                   EESIMTYNPYGLKIEINMSNGTKYVDNIMSHRPNRENLIGCHNFYPHRYSGLSYDHFIK
FT                   CSKQFKDYGMRTAAFISSFDATYGPWPVTEGLCTLEQHRELPMTTQAKHLFATELIDDV
FT                   IIANAYASEEELQALGALNKEKQTFDIEIYDTTTELERIIVLNEPHFYRGDVSEYMIRS
FT                   TQSRVKYKKEEFKPHNTREIKRGDLLIDNEQYGQYKGELQIALKDMVNTGKTNVVGRIV
FT                   EEEIFLLDYLQAWDKFGFTLKK"
FT   gene            798074..799954
FT                   /locus_tag="BMB171_C0693"
FT   CDS_pept        798074..799954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0693"
FT                   /product="BigG family transcription antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0693"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05510"
FT                   /protein_id="ADH05510.1"
FT                   /translation="MLNRAFLAGRLHVSTKTIQKDIKLLNDILEENGAKIESQRGTGYE
FT                   LEIIQKKKFEDFCVSLFQKQTEKIPTSYEERIAYILQRVLMTEGYVKLSELAEEMYVSK
FT                   STVNLIMKDVTDICGRYKLQIEKRPYYGIRIVGEEFNIRSCLSQYGLPRYDHTPFHEQF
FT                   EQTETYLSLPHISLIRSIILKYIEGGTIYLSDIEIDNLVIHIAIALKRCQSQHYMKGLH
FT                   AEQSELIIKKEYTIAKQILGDLEKALKFSFPEEEVLYVTMHLLSTAVTTRNRYENIEEL
FT                   LGKDIYAFMQHILFKVAEERNLIFYYDEELLFGFGIHLKTLLNRLKYKLNTRNPLLAEV
FT                   KKNYPYAFEIAVLVGDIIGEYTGESIPESEIGYIAIHFGGAMSRLQEQNQKKRCLLVCA
FT                   TGQGSAQLLKYKILSQFRDKLEIVGITGYYQLKVEDLYKEKIDCIISTIHIPSGLPVPV
FT                   IKVNSIFDDKEIKSIGQRLFTHVNTSVQPYIKEDLIFLNYSASTKEDVIQFLCEKAAEK
FT                   RYVPENFYASVMERENTSPTAVGNSVAIPHPMQLLSEETFLMFCTLEKAVDWGDKKVQV
FT                   IILFSVKRNNNEDLQRLYDFLYDIMSSQTTIEKLTQTEVIEDFQEILLSF"
FT   gene            800066..800386
FT                   /gene="celC1"
FT                   /locus_tag="BMB171_C0694"
FT   CDS_pept        800066..800386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celC1"
FT                   /locus_tag="BMB171_C0694"
FT                   /product="PTS system, diacetylchitobiose-specific IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0694"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05511"
FT                   /protein_id="ADH05511.1"
FT                   /translation="MADMQTPFALILHGGNARSAALEAIAFARQGDFGNAGEKMKLASE
FT                   EISAAHRIQTDLIQEEARGNHAEISLLLVHAQDHLMNAITVKELAEEFIALHKRVEEKV
FT                   TV"
FT   gene            800430..800693
FT                   /gene="celA1"
FT                   /locus_tag="BMB171_C0695"
FT   CDS_pept        800430..800693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celA1"
FT                   /locus_tag="BMB171_C0695"
FT                   /product="PTS system, diacetylchitobiose-specific IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0695"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05512"
FT                   /protein_id="ADH05512.1"
FT                   /translation="MVVRKMQEEAKKQGKNYKIKAVDSELVKLEIKEADVVLIGPQVKY
FT                   LFPAVEFLANSYNIPVAIIDQQDYGMCDGLKVLKQAEQLALA"
FT   gene            800777..802087
FT                   /gene="celB1"
FT                   /locus_tag="BMB171_C0696"
FT   CDS_pept        800777..802087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="celB1"
FT                   /locus_tag="BMB171_C0696"
FT                   /product="PTS system, diacetylchitobiose-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05513"
FT                   /protein_id="ADH05513.1"
FT                   /translation="MNGFMSFMEQKIMPTTQKIAGQRHLLAIRNGVISTLPLTIVGSFF
FT                   VIFLNLPIDAYMEWIAPFRHILDIPFRFTVGLMALYAAFGVGASLANFYQLNQLSAGLL
FT                   SVLAFLLASVEPIQITKAVPGVIDAGRYISVGTLSATSLFGAIVTALIAVEIYHFMIKH
FT                   NISIKLPDSVPPAVSNSFAALIPTLAVILLFWGIRYGLKFDVNTTITYLIAPLKSVLVG
FT                   NNLFGGLLTVFLIVFFWSFGIHGPAILGPIIRPMWDSAILENMEVFTATGNAHQLPNLF
FT                   TEQFIQWFVWIGGSGSTLALVIMFMFSKSKFLKELGRLSFVPGLFNINEPIIFGAPIVM
FT                   NPILIIPFVITPLVTTTVSYFAVVSGMIPLMMAKLPFTMLAPIAAVISTDWTIMAGVLV
FT                   LVNFVISFVIYYPFFKMYEKQQLAGEEKTECSEQLSS"
FT   gene            802331..803416
FT                   /locus_tag="BMB171_C0697"
FT   CDS_pept        802331..803416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0697"
FT                   /product="outer surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0697"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05514"
FT                   /protein_id="ADH05514.1"
FT                   /translation="MERKLGISLYPEHSTKEKDMAYISAAARHGFSRIFTCLLSVNRPK
FT                   EEIVAEFKEIINHAKDNNMEVILDVAPAVFDQLGISYSDLSFFAELGADGIRLDVGFDG
FT                   LTEAKMTNNPYGLKIELNVSNDIAYLENILSHQANKSALIGCHNFYPQKFTGLPYDYFI
FT                   RCSERFKKHGIRSAAFITSHVANIGPWDINDGLCTLEEHRNLPIEVQAKHLWATGLIDD
FT                   VIIGNAYASEEELEKLGNLNRYMLQLKVHFVDEATEVEKRATLQELHVRRGDITEYMVR
FT                   STEVRKKYKDYDFPVRESVLQERGQVVIGNNSFGKYKGELQIILKEMPIDERKNIVGTI
FT                   AEEELFLLDYVGAWTQFTCVE"
FT   gene            complement(803734..805002)
FT                   /locus_tag="BMB171_C0698"
FT   CDS_pept        complement(803734..805002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0698"
FT                   /product="enterotoxin/cell-wall binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05515"
FT                   /protein_id="ADH05515.1"
FT                   /translation="MKKFMGIATAAVFGLGIFTTSAKAETIVTTDVLNVRENPTTESKV
FT                   VGKLLDGYKVNVLHTENGWSKVQLNSGKEAFISADYTKDTYYVTANVLNVRAGANTDSE
FT                   ILGKLKKDDVIETTHQVQNDWIQFEYNGKTAYVHVPYLTGKAPVKVQPVAKVEKTTTVQ
FT                   DTAKVREAAKAQEVAETQAKAKAVEATKAREAAEAQAEVKAQEAAKAREAAKAQEAAKA
FT                   QADAEAQAEVKAQEAAKAREAAKAQADAEAQAAAKAQEAAKAREAAKAQEAAEAREAAK
FT                   AQEAAEAREAAKAQEAAKAQKPATQQPVAKETETSAPSSSRELRVVATAYTADPLENGY
FT                   KAGDQVKSALGHNLTANPNMKLIAVDPSVIPLGSKVWVEGYGVAIAGDTGGAIKGNKID
FT                   VLMPDKGSSSSWGRKTVTVKVLN"
FT   gene            complement(805583..806737)
FT                   /locus_tag="BMB171_C0699"
FT   CDS_pept        complement(805583..806737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0699"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05516"
FT                   /protein_id="ADH05516.1"
FT                   /translation="MALSSIFAHKMRSILTMLGIIIGISAIITIISMGDGTNAKFKKEL
FT                   GQGKDNEVTIYYNNPDYGTDSAKITPDMLNRLQTVPGVKDVYPDVSMKVKASAGSKDVN
FT                   LDLKGGTGAFMTDSKIKLVHGRELNDSELNQAIPAVILNEEAFNKLFSSGWESNQYTDI
FT                   KGKPYKIVGVYETKNDFGMPMPEGYTSLENAPVISGVNEYDSVRLTMTSPTERKSVEKQ
FT                   AVSVLNEMKAPKFEHKFEAQDLGEFTKQLDESIGMMKMVFGGIAAISLLVGGIGVMNIM
FT                   LVSVTERTREIGIRKALGATRGKVLTQFLIESCILTGLGGFIGFMLGIFFAWIVSIFAG
FT                   WPLVVSKELGLLAVGISMLIGIIFGLLPANKAAKLDPIECLRYE"
FT   gene            complement(806764..807438)
FT                   /locus_tag="BMB171_C0700"
FT   CDS_pept        complement(806764..807438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0700"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05517"
FT                   /protein_id="ADH05517.1"
FT                   /translation="MINLKGITKSFQNGAESVQILHGIDVTLNQGEFTSIMGPSGSGKS
FT                   TLMNIIGCLDKPTTGTYELAGQNISNMTETELAHVRNKEIGFVFQNFMLLPRLTALQNV
FT                   ELPLIYAGVDKKERRERSLAALTKVGLADRATHLPNELSGGQKQRVAVARAIVNNPKFI
FT                   LADEPTGALDTKTSTQIMDLFYELNKQGSTIIMITHDREIGEAAARQIVIRDGNIVQDW
FT                   RG"
FT   gene            complement(807435..808538)
FT                   /locus_tag="BMB171_C0701"
FT   CDS_pept        complement(807435..808538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0701"
FT                   /product="periplasmic component of efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05518"
FT                   /protein_id="ADH05518.1"
FT                   /translation="MKKKNKVLITSVVAIGIAAGSYFAFAGGGSDVAMAYSGYKVTEKQ
FT                   IQNAQKFGGEVIPNGIETISFDPTKGTYELAVKKGDEVKKGQLLFKYNDPTAKQGVTEA
FT                   EMQKKIAQKEVTLLQKQIDVAKQKLQKDKNAGLPAEALKASEAEVGQLESQIEMKKFEV
FT                   EKADEMIKAAKEKVNNLSVTSPADGVIDDIVKTADEKTGMSGITLRHAGQFKVKGQISE
FT                   YELASMKVGQEVTVSSKTVAGKTWTGKVTEIGSTPLKSMDENKTVSNYQFTVTLDNSDE
FT                   LQNGFHVYVTSKSGEATGTIVPKSSIVKKGDKNVVFVVKDGKAKEQAVTVEFETDSEAK
FT                   VSGVKKGEEIISKPEKDLKDGMEVVAQ"
FT   gene            808750..809484
FT                   /locus_tag="BMB171_C0702"
FT   CDS_pept        808750..809484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05519"
FT                   /protein_id="ADH05519.1"
FT                   /translation="MEAYFSAPPLKPFIPYSRQHALILFIMLVGIFFLYQYQDVLRQSE
FT                   WNITVRYAIAFLFIGSEIGLHMWEWKAGIFELATSLPFELCTISLLLASIMIVTKSYRI
FT                   YEIVFFTGIIGASQAILTPNLQYAFPHFRFIEYFIAHILLIWAPLFMTWVEGYRPTLQS
FT                   IKRTMIFLNILIPLVSFVNYKTGGNYMFLAHKPETASLLDMLGPHPYYIISLELAALIG
FT                   CFILYMPFAKRERHAHKESLGS"
FT   gene            809586..810452
FT                   /locus_tag="BMB171_C0703"
FT   CDS_pept        809586..810452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0703"
FT                   /product="oligopeptide transport system permease protein
FT                   oppB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05520"
FT                   /protein_id="ADH05520.1"
FT                   /translation="MVKKVFLNGMEVTIQFIISILGIIMLGALPKLFYGFKLDVSKYIQ
FT                   SLKEVFVNLMDISNLQYVKGKFLFPQLFVHYKETIIIFLAAFFISLFVAFCIVYVIMSS
FT                   SPRIQHRIKSFLIFLESIPDILLILVSQILVIWFFKQTGFLPFQIASIGGESIRGLPIL
FT                   CLSIPTTIMFVKMVVLRFENELEKDYVLFAKAKGLGRFHILNRHILRNVLLSTLFFAKT
FT                   NIFFMLSNLYIIEWIFNTGGIFMFLKSYFGIRVEVFIVSVLLIYIPIFILFKLFHYLIP
FT                   AAMKERL"
FT   gene            810454..811458
FT                   /locus_tag="BMB171_C0704"
FT   CDS_pept        810454..811458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0704"
FT                   /product="oligopeptide transport system permease protein
FT                   oppC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05521"
FT                   /protein_id="ADH05521.1"
FT                   /translation="MWTYIKRDKRFWISIGFLLLLVLLSIGNTLWNDGHIRQVTLQYDA
FT                   DENPQVPPFSPSFQFLLGTDRKGYDLLHLVIEGAKWTIGISILIAALRMVIGVFFGVVL
FT                   GTYIKRGFSKIEAFFDSFTVIPTVMIAYFFLQSVNAFGSGEETTTFFERASFQVVLLVM
FT                   LVMPVIALYVAKEVRKLRTEEFVDAARILGGSRRHIVIKHLFPHLYMTFILVFFQQFTQ
FT                   TLTILLHLGLLEIFFGGTVKFLGPIEEIESYTHEWSGLIGVYFRSLTVHPWIPLVPITF
FT                   FGLTIFSGNMIVKSLEEAMLKVRLGGEIKKEVVEEEQSAVQSKEELFTFKHTM"
FT   gene            complement(811500..812816)
FT                   /gene="brnQ2"
FT                   /locus_tag="BMB171_C0705"
FT   CDS_pept        complement(811500..812816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnQ2"
FT                   /locus_tag="BMB171_C0705"
FT                   /product="branched chain amino acid ABC transporter carrier
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05522"
FT                   /protein_id="ADH05522.1"
FT                   /translation="MRTTLKPAQILSISLLLFAVFFGAGNMIFPPLLGLSSGENMWVSI
FT                   TGFIITDVGLSLLAIVAVALAGGSFNTLASRVHPKFAAVFAIIIYLSIGPLFVIPRTGS
FT                   VSYEIGIAPLFPDQWYSMLVFSAIFFTVVYFLSLNPSKLVDHIGKILTPILLVIIAIMA
FT                   TKAILSPGTFAEPIGDYKDIPFFKGFLEGFLTLDAIGALVLSTIVVNAIRQNGIQEKKY
FT                   IAKYTIICGSIAALFLTIVYFLLGYIGASNGNLGQFENGGQLLATVMYQFFGTSGNVLL
FT                   SIAIIFACLTTAIGVVSAFANYFATVLTNVSYKKLVLYVCIFSFVISNLGLSLLIKITL
FT                   PVLIILYPITIILIFVSFIDKYTKRKPSVYIGAMIAAFIISCIHALDNVGMIPSFIANI
FT                   VHTIPFYNLGIGWIVPAIIGGIIGYFIPQTEAEGEVSAK"
FT   gene            complement(813035..813604)
FT                   /gene="cotJC"
FT                   /locus_tag="BMB171_C0706"
FT   CDS_pept        complement(813035..813604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotJC"
FT                   /locus_tag="BMB171_C0706"
FT                   /product="CotJC protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05523"
FT                   /protein_id="ADH05523.1"
FT                   /translation="MWIYEKKLQYPVKVGTCNPALAKLLIEQYGGADGELAAALRYLNQ
FT                   RYTIPDKVIGLLTDIGTEEFAHLEMIATMVYKLTKDATPEQMKAAGLDPHYVDHDSALH
FT                   YHNAAGVPFTATYIQAKGDPIADLYEDIAAEEKARATYQWLINQSDDPDINDSLRFLRE
FT                   REIVHSQRFREAVEILKEERDRKIYF"
FT   gene            814424..814567
FT                   /locus_tag="BMB171_C0707"
FT   CDS_pept        814424..814567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0707"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05524"
FT                   /protein_id="ADH05524.1"
FT                   /translation="MFSISNIENLKKRLVFYKIAYIENKSEKSIVVQDPDGYKIQVIEK
FT                   DE"
FT   gene            814582..815361
FT                   /locus_tag="BMB171_C0708"
FT   CDS_pept        814582..815361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05525"
FT                   /protein_id="ADH05525.1"
FT                   /translation="MERNYEESALFEHQFWLKVLTDHSQFLLDALAPKEKEDIKKATYF
FT                   VETFTNLLNKVRNVNLIAFSKEAERAAKEIRTFKLSIIQKQLEGKITIHFTPTFINHMV
FT                   NEVEEYITVLEFLNKGEVPPVFHELHYHLVWLTDAAGHAGSISGGLDLVEKRLKEKSEE
FT                   FTKHFEQFYLKAVEMTGYLRTELHHFPALKKFTKDVSLELKLFSHFLHEVEELELSNEI
FT                   LSALSARMADHMAREECYYLLKLAQSSGLEMPKCNPL"
FT   gene            complement(815380..816192)
FT                   /locus_tag="BMB171_C0709"
FT   CDS_pept        complement(815380..816192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0709"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05526"
FT                   /protein_id="ADH05526.1"
FT                   /translation="MHTVWKGALSLGLLNIGIKLYSAVEENDIKFLSLHKECLTPIKYK
FT                   KFAPDCTDEEIDDKDIVKAYEYAPHKYIIMDEKELAELQKAHEPRSIRIISFIQNNEID
FT                   SVLYDRSYFIGPTSGHEKSYLLLKEALERTNKLGLIHISIRKKQHLAIIRNFEDGLILQ
FT                   TIHYPNEIRDITNTPNLPSNENYPIQKQELTAAINLIHHLTNPFEKEMYTDEYKEALTE
FT                   LIENKIEQQEKTETISPTPNIINIMETLQASIEQAKIKRENKAEKEAK"
FT   gene            816544..816825
FT                   /locus_tag="BMB171_C0710"
FT   CDS_pept        816544..816825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05527"
FT                   /protein_id="ADH05527.1"
FT                   /translation="MKKLISRLRVVFHVRRFVPFLFDFFTSKEVSIKKKILSIAFLVGY
FT                   VAMPLDLIPDFLPFIGILDDIGIVLFILNRIVKMAPVQLQEKHNVNVG"
FT   gene            816843..817448
FT                   /locus_tag="BMB171_C0711"
FT   CDS_pept        816843..817448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0711"
FT                   /product="alkaline phosphatase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0711"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05528"
FT                   /protein_id="ADH05528.1"
FT                   /translation="MEQIILDIIEFLKQFSYFGVVLALTFEFIPAEVVLPMVGYWVYEG
FT                   DMNFWLAVLAGTLGGTTGPLTLYALGYYGGRPLLIKYGKYFFIKEEQIQKADDFFEKYG
FT                   PVVAFVGRFVPGVRTLISVPCGMAKMNIWKFSIYTFVAMFPLTTLYVYFGMKLGPHWEK
FT                   AADVVGQYMLPILGGVILIVASIFVYKYMKKRNKTESI"
FT   gene            817547..817915
FT                   /locus_tag="BMB171_C0712"
FT   CDS_pept        817547..817915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0712"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05529"
FT                   /protein_id="ADH05529.1"
FT                   /translation="MSCECSGSALTCCPDKNYVQDKVCSPWSATVVATAIDNVLYTNNI
FT                   NQNVIGTGFVKYDVGPGPITVEVLDSAGGTIDTQTLNPGTSIAFTYRRFDSIQVVLPAT
FT                   PAGTYQGEFCITTRYPLS"
FT   gene            817936..818280
FT                   /locus_tag="BMB171_C0713"
FT   CDS_pept        817936..818280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0713"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05530"
FT                   /protein_id="ADH05530.1"
FT                   /translation="MGMRSSSLSCCSNKTLVQDQVCTDWSITGAGTQIVYTNNITQEVY
FT                   GSGYVKYDVGANPITVDFLVGATVVDTITVQPQSSGTFTVRYFTTVRITTTGTTVNQGE
FT                   FCITVRYPIS"
FT   gene            complement(818337..818762)
FT                   /locus_tag="BMB171_C0714"
FT   CDS_pept        complement(818337..818762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0714"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0714"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05531"
FT                   /protein_id="ADH05531.1"
FT                   /translation="MKNKKNIGCFAPLSIICPDPCPPPPPPNPNCERVTNEFAGNFLIT
FT                   NNTISSAKDTSQLMILWQSDGILLISGTVSVYNSTSSNEAITIQIVGTVTNIFTVFPGN
FT                   TISYTGKDLQSINIINITSNPSLYLEGKYCCEFTCCL"
FT   gene            819115..821574
FT                   /locus_tag="BMB171_C0715"
FT   CDS_pept        819115..821574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0715"
FT                   /product="Icc family phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0715"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05532"
FT                   /protein_id="ADH05532.1"
FT                   /translation="MDRNALRKVKGLIGLLMVFVLAFVSFPWSTSVKAEEKKQEKASSE
FT                   KKIVFPVVSDVHIKNSGTDDTFRWKRAIEQLNTLAPKQDAFVIVGDFTDTGSLQQYDRF
FT                   MQVYNENANKDAVRMNSLGNHDYWNGLSVEGAQKRFLEKTGMESIYYHKVVKGYHFLVM
FT                   SPENGTTHGYYSDKQINWLKEEMAKAQKDDPEKPIFVFLHQHIKETVYGSHEWGTQDSA
FT                   KINAVLKEYPQVITFSGHSHYPLDDPRSIHQKDFTSVGTSSISYMEVEGGKVQGNIPPG
FT                   ASTLSQGLLVEVDDEEVTINRRDFHTNSWTGEPWKIKLPAKKDTFTHVEDRDKEKPYFA
FT                   KDAKLAVSNVTENAATVTFPQALDNLLVHSYRVQARDKQTGEIKNKLLAFSEFYRDPVP
FT                   KDLTFTLAGLDGGKTYTLEVVAIDSFGNESVQPLTAEITTKKDDIDPNVKVPKADVFDV
FT                   NFADGTFKDNSPFGTKGDVKGNVTIEYDKALKKNVMKLNGQSNTFGYLPFSAAQKEKVA
FT                   NTFTLETVFSMNQIRGQGILQNTESGGIGFESTGSGYVELWAHIGGSYKRVGVQLEANK
FT                   TYHLTGTYNGSEVAIYVDGKKVNSQPATGKVYHPNVPFVLGADPDSNGNGGIPLNGKIA
FT                   LAKLYSKALSSSEVLAAYNEFSNRTKLEQVNALYEELGKVKEVLAGTYEFGDKPGQYSK
FT                   EAFQELEKSYNNAKQVFENIGSTGEQIVQTYNELKTANVTFVQSKVVEQPKTPKEKLQI
FT                   NIESAKVVVKKAQDANVTDGSVKALSQKITVAEAVVKDVKVKDAQVETMNRTLEYTISL
FT                   VEKSINK"
FT   gene            821870..822040
FT                   /locus_tag="BMB171_C0716"
FT   CDS_pept        821870..822040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0716"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0716"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05533"
FT                   /protein_id="ADH05533.1"
FT                   /translation="MQKWKLIYQVIIFLLLVGIGIVKYATPIGNWAWFTACIGIFFILQ
FT                   SLTKKYNSTEK"
FT   gene            complement(822069..823529)
FT                   /locus_tag="BMB171_C0717"
FT   CDS_pept        complement(822069..823529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0717"
FT                   /product="amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0717"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05534"
FT                   /protein_id="ADH05534.1"
FT                   /translation="MDSYYSRSYGNEKTGGESKVRSLLRKKALSTESPKQLARTLTALD
FT                   LTFLGIGAVIGTGIFVLTGIVAAKHSGPGIMLSFLIAAFTCACVAFCYAEFASSIPVSG
FT                   SVYTYAYMTVGEVVAFIVGWCLMLEYLLAVAAVAVGWSGYLQSLLQGFNIHLPAIIASA
FT                   PGVGKGGLIDLPAVCILLLITGLLSFGIRESARINNIMVLIKLAVIIAFIVAGAKYVKP
FT                   ENWTPFIPFGYDGIITGAATVFFAFLGFDAIATAAEETKKPQRDLPIGIIGSLLICTVL
FT                   YMIVSFVLTGMVPYTQLDVSDPVAFALHFVGEDTIAGLLAVGAMTGMTTVLLVVMYGQV
FT                   RVSYAMSRDGLLPKALARVNKKVKIPLLNTWITGVVAALLAGLLDLHLLANLVNIGTLT
FT                   AFTFVCCAVLILRKTHPDLKRGFRTPFVPVLPVVAILCCLYLMINLSKTTWISFAVWLI
FT                   VGLCFYFFYSRKHSHLAIEKTNDEKKKA"
FT   gene            823731..824858
FT                   /locus_tag="BMB171_C0718"
FT   CDS_pept        823731..824858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0718"
FT                   /product="Na+/H+ antiporter NapA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0718"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05535"
FT                   /protein_id="ADH05535.1"
FT                   /translation="MLFYFELVVILLCTKLAGDISVRLGQPSVLGKLIVGIIIGPAVLG
FT                   IINSSELIDELSEIGVLLLMFMAGLETDLEELNRNLKSSFAVAAGGIIFPFIGGYVTGL
FT                   LFGLIQSHAIFLGLLLCATSVSITVQTLRDLGKMNTRESTTILGAAVFDDVIVVILLAF
FT                   VMSFLGTQDVNITLVIVKKIIFFVSIVFIAWKVVPWIMKMLVPLRVTEALISAALIICF
FT                   SFSYYSEMMGIAGIIGAFAAGIAISQTEYKHEVEHKIEPIAYAIFVPVFFVSIGMEITF
FT                   QGIGSQLWFIIIMTLVAIFTKLIGSGLGARLTGFNRQSSISIGAGMVSRGEVALIIAAN
FT                   GLTANLLAKENFTAIVIVVILTTIITPPLLKKYFV"
FT   gene            824983..825297
FT                   /locus_tag="BMB171_C0719"
FT   CDS_pept        824983..825297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0719"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0719"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05536"
FT                   /protein_id="ADH05536.1"
FT                   /translation="MKITKEKVIGVIVLIAVCIPFTAWKESKVKDFPVSIFSEEADGEY
FT                   GQKLKYTAFLPDVAIWMNGWEKKWTEGERTVYQKGNRIVNVFHPPGDDGYYLLEARENK
FT                   "
FT   gene            825402..826190
FT                   /locus_tag="BMB171_C0720"
FT   CDS_pept        825402..826190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0720"
FT                   /product="RpiR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0720"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05537"
FT                   /protein_id="ADH05537.1"
FT                   /translation="MYIMENAEIVPNLTTKEVSTNAGASEASVVRFCKSIGIGSFKAFK
FT                   IALVRELTIADYNINDFSVMNTEDGPYDLFNKVTYVNKAAIEASVTAIDKKELEKAADR
FT                   IVNAGKIIFYGVGGSATPAMDGAYKFTRLGFTAMMLSDFHMMLPLVTNLKEGDIFVAIS
FT                   TSGRTRDVLEMAQYAKRQGATVIGITKLDQSSPLYKEADIRLCMPDVEQDHRIASIASR
FT                   MTQLNMIDALYVITFNRIGNKVLDQFMETREEALRLRKLK"
FT   gene            826346..827230
FT                   /gene="murQ"
FT                   /locus_tag="BMB171_C0721"
FT   CDS_pept        826346..827230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /locus_tag="BMB171_C0721"
FT                   /product="N-acetylmuramic acid-6-phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0721"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05538"
FT                   /protein_id="ADH05538.1"
FT                   /translation="MLENLSTEHRNEKTMNLDEMSIKEVLQSMNEEDRTVALAVEKEIE
FT                   QIEKVVQTVIKSFEEEGRLIYIGAGTSGRLGILDAVECPPTFGTDDKMVQGFIAGGLKA
FT                   FTKAVEGAEDREELAEEDLKSIGLNEKDTVIGIAASGRTPYVIGGLKYAQSVGASTASI
FT                   SCNKNAEISKYANLNVEVETGAEILTGSTRLKAGTAQKLVLNMISTASMIGVGKVYKNL
FT                   MVDVQSTNEKLVERSKRIIVGATGASYEVAAEYYEKAERNVKAAIVMVLLQCEYGEALE
FT                   KLKYAKGFVKKAL"
FT   gene            827255..828619
FT                   /locus_tag="BMB171_C0722"
FT   CDS_pept        827255..828619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0722"
FT                   /product="PTS system, sucrose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0722"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05539"
FT                   /protein_id="ADH05539.1"
FT                   /translation="MKKEERMAKEISEQLGGIKNIRSIAHCMTRLRLTLHDESKVNMDL
FT                   LKKVEGVMGVIEDETLQVVVGPGTVNKVAAEMEGLTGLRIGEVADHHLEDIGQEMKSEI
FT                   KKKNNTPVKNFLRKIGSIFIPLIPGLVASGIINGVANFAKNAGADPNVTWLQMLLLIGG
FT                   GIFTFLGILVGWNTAKEFGGTPVLGAIAGILIFNPAMANVKLFGEALVPGRGGLFAVIF
FT                   AAWLMVVVERQVRKAVPNAVDIIVTPLITVLVVSIVTMLAIQPLAGFLSDGITSGINAI
FT                   LNIGGAFAGAVLAGTFLPLVMVGLHHGLTPIHMEFINQTHVTPLLPVLAMAGAGQVGAA
FT                   IAIYVKTKNKRLRNVIKGGLPVGFLGIGEPLLYGVTLPLGKPFITACLGAAVGGAFQAV
FT                   MQTASLGIGVSGLSLIPLIADNKYLLYFLGLVIAYAFGFIFTYFFGFKEEMAENI"
FT   gene            828668..829741
FT                   /locus_tag="BMB171_C0723"
FT   CDS_pept        828668..829741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0723"
FT                   /product="outer surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05540"
FT                   /protein_id="ADH05540.1"
FT                   /translation="MIGVSIYLSKERVEKQEEWLKVAKENGFTSIFTSLHIPEDDPNTY
FT                   KELIQILGKQALAHEMELMVDVSPKSLHHLGLTYENVEELLDWGITGLRMDYGIAPKEI
FT                   ASVSHKMKVALNASTITKPFWKELLAEHIRVENVEAWHNFYPRPETGLAKSFLQKQNQY
FT                   LQECGIKTMAFIPGDAEKRGPLYEGLPTLEKHRNMRPLEAYLELVQDCGVDKVLIGDIS
FT                   ASLESMQEVASASRGIIPLRYKSFITDKEVLKVVEQVHTNRLDPARDVIRSVESREGNR
FT                   VVLQPMHTIVRKKGSITIDNELYGRYAGEMQVATHDLPVDEKVNVVGIVVEEDVSLLPY
FT                   IGAGKMFQLFLCDRIKA"
FT   gene            829894..830298
FT                   /locus_tag="BMB171_C0724"
FT   CDS_pept        829894..830298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0724"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05541"
FT                   /protein_id="ADH05541.1"
FT                   /translation="MNQYIGNLIIRIVLGVTFFAHGLAKFQSGIDNVAGWFTSIGLPGG
FT                   LAYGVATVELVGGILLIIGLGVRYVGLLFALILAGAIVKVNGAAGLLGDGKNPGYELDL
FT                   ALLSMGAYLFVVKAEGYVDRFLKEKVMKTK"
FT   gene            830453..830854
FT                   /locus_tag="BMB171_C0725"
FT   CDS_pept        830453..830854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0725"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05542"
FT                   /protein_id="ADH05542.1"
FT                   /translation="MPKSNLEIIQSTYEGSASSNAKHLAEALSEKVEWTEAEGFPYGGT
FT                   YTGVEAIMENVFSRLGSEWDDYKARVNTYHEVNGKDAIIAEGMYSGVYKETGKSFEAEF
FT                   VHVWQLENGKIVKFKQYVDSHIVREAMKR"
FT   gene            830929..831339
FT                   /locus_tag="BMB171_C0726"
FT   CDS_pept        830929..831339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0726"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0726"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05543"
FT                   /protein_id="ADH05543.1"
FT                   /translation="MLAYVEKENENIQTERAANEKEKKAAEEAPQISEGEIISTMHKMV
FT                   HQKVKSSEKWGFVEMTKKEISNVKRDIENSTGFQYKMKLFSIINRWEKGDFSQTVEEHN
FT                   FLWSLQGGDTGKATERLSPEEEKQYIKEMKRK"
FT   gene            complement(831374..832285)
FT                   /locus_tag="BMB171_C0727"
FT   CDS_pept        complement(831374..832285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0727"
FT                   /product="drug/metabolite exporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0727"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05544"
FT                   /protein_id="ADH05544.1"
FT                   /translation="MPYFYVFLLLLTSLLWGGNFVVGKSLVDHASPMTLTNLRWMIAIV
FT                   CLLPMVWFKEKKILPPRTAILPLILMGISGVALFNIFQFLALEKTSATNVGLISTLNAI
FT                   SIALFSVLFLKEKVNTLQILSMILSFFGVILVLLKGNFSLLFSLHFNSGDLWMIAAVCI
FT                   WGIYSVCSKWATKTTTPLMATLYSGIFGVILLLPFNIGSFTVSNINTSFITSLLYTGLI
FT                   STVLCMVFWNIGVQKLGATTSGIFLNFNPIFTAILAFIFLGEELTWIQILGTIVVVTGC
FT                   YLFSHFKTVAVQPVRPLMRKHS"
FT   gene            832491..832985
FT                   /locus_tag="BMB171_C0728"
FT   CDS_pept        832491..832985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0728"
FT                   /product="AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0728"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05545"
FT                   /protein_id="ADH05545.1"
FT                   /translation="MESSVIKVLDDLDVQILDILQKESQVSNAELARRVNLSPAAMHAR
FT                   IKRLDGEGFIDKQVAILNQEKLGFDLLCFIFMSTNIHQFDKLEVLEKELESMPEVLECH
FT                   CLTGEYDYLLKVANRDRKELEQFIRKLNKLGITKIQTSLALREIKYSTVLPIRNEEPSI
FT                   D"
FT   gene            833114..833569
FT                   /locus_tag="BMB171_C0729"
FT   CDS_pept        833114..833569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0729"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05546"
FT                   /protein_id="ADH05546.1"
FT                   /translation="MKICNAVTSDVKEIYSLIEVYAKEGVVLPRSLLSLYQYLQCLYVM
FT                   KEEGEIVGVAGLHVLGEDLAEVRSLVVSHTYAGKGIGRMLVNHVINEAAKIKVSRVISL
FT                   TYETEFFQKCGFDFVNRDALPEKVWIDCRHCPKVDYCDEVAMIRYVG"
FT   gene            833932..834276
FT                   /locus_tag="BMB171_C0730"
FT   CDS_pept        833932..834276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0730"
FT                   /product="quaternary ammonium"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0730"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05547"
FT                   /protein_id="ADH05547.1"
FT                   /translation="MKNRAWLYVILTCIFEIFWVFGFNTANTWWHWIIILGVIAVDFHF
FT                   LSKACEHLATGTVYAVFAGAGTVGTFLMDVFLFGGSFSVGKLFFIVMVVAGVIGLKLAD
FT                   NKEETVEGAA"
FT   gene            834279..834593
FT                   /locus_tag="BMB171_C0731"
FT   CDS_pept        834279..834593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0731"
FT                   /product="quaternary ammonium"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0731"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05548"
FT                   /protein_id="ADH05548.1"
FT                   /translation="MGWFFVFCAAISEIVGVIGLKMYSKDKTLANGAIYIGGFATSFAF
FT                   LYTSFLFLQVSVAYAVWIGIGTAGAVLLNMFLFGESKSKARIISVFLIVCGVTGLKALS
FT                   "
FT   gene            834745..835323
FT                   /locus_tag="BMB171_C0732"
FT   CDS_pept        834745..835323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0732"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0732"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05549"
FT                   /protein_id="ADH05549.1"
FT                   /translation="MMNKKEKIVYAAIEVFQEKGVEKTKISDIVKLAGIAQGTFYLYFP
FT                   SKLSVMPAIAEVMVEKMILAVKEKVQKDVPFSNKVAQVIDAVFHFIEEYREIQALMYAG
FT                   LASTEHIKEWEAVYEPLYMWLSEFLSEAKEAGEIRDSVHAERTAKLFIALVESAAEQVY
FT                   LYDHKDDEQVDLQKAEVLDFLTHALHIKK"
FT   gene            835563..836738
FT                   /gene="blT"
FT                   /locus_tag="BMB171_C0733"
FT   CDS_pept        835563..836738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blT"
FT                   /locus_tag="BMB171_C0733"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0733"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05550"
FT                   /protein_id="ADH05550.1"
FT                   /translation="MVLVILLSNIFIAFLGIGLIIPVMPSFMNDMHLTGKTMGYLVAVF
FT                   AMAQLITSPITGRWVDLYGRKKMIIIGLFIFGVSELLFGLGKDVWMLYVARVLGGISAA
FT                   FIMPGVTAYVADITSIQERPKAMGYLSAAISTGFIIGPGIGGFIAEYGIRVPFFVAAAI
FT                   AFIACVISIFILKEPLTKEELAEISSNTKESSFIGDLKKSLHPMYAIAFIIVFVLAFGL
FT                   SAYETVFSLFSDHKFGFSPKDIAAIITISSIFGVVVQVFMFGKLVDMFGEKVLIQICLI
FT                   VGAVLAFVSTVVFNYWIVLLVTCFIFLAFDLLRPALTTFLSKAAGKEQGFVAGMNSTYT
FT                   SLGNIAGPAMGGILFDMNIHYPYAFSGVVLIVGLAITFMWREKQLAESFAK"
FT   gene            complement(836772..837110)
FT                   /locus_tag="BMB171_C0734"
FT   CDS_pept        complement(836772..837110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0734"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0734"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05551"
FT                   /protein_id="ADH05551.1"
FT                   /translation="MNNIDPVELTKGLPGIPCPIAKTLDVISTKWTFLIIRDLLIEGTL
FT                   RFSDLQKSMDGISPKTLSLRLKELESQGIITRKVYPEVPPRVEYTLTDKGKQLEGIFIE
FT                   LKRFGLSL"
FT   gene            837280..837819
FT                   /locus_tag="BMB171_C0735"
FT   CDS_pept        837280..837819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05552"
FT                   /protein_id="ADH05552.1"
FT                   /translation="MGIKKLFGFLSLFVICIVLVACGVEQKTEVQLLKEMPRPKAMTID
FT                   PSLSKKEATEMVHAAQRFYAFWDTGKEELIPQTVTEKFFDNTLPKGRPQGIEGLKFAAQ
FT                   NFRKVVPDIHCEIEDLLVVGDKVTARLSFTGTHNGKKINFFAIDILHVKDGKITEDWHL
FT                   EDNLTLQQQLGLIAEG"
FT   gene            837843..838391
FT                   /locus_tag="BMB171_C0736"
FT   CDS_pept        837843..838391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0736"
FT                   /product="modulator of drug activity B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05553"
FT                   /protein_id="ADH05553.1"
FT                   /translation="MKNIFIINGHEKYGTKEGRLNRTLVDYMVTVLGENHHVKTTTIQD
FT                   GYNIKEEQDKFLWADVVIYQTPIYWFSVPGLFKTYMDEVYEYGLFFKGADEYGTGGLLK
FT                   EKEYMFSTTWNAPEKAFGDKTKFFEGESLESALSHLHRVQKFLGMSPLKSFACYDVVKN
FT                   PDIEQYLLNLKDHLDEVIK"
FT   gene            complement(838464..840203)
FT                   /locus_tag="BMB171_C0737"
FT   CDS_pept        complement(838464..840203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0737"
FT                   /product="oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05554"
FT                   /protein_id="ADH05554.1"
FT                   /translation="MKIMDYYIRLRLHAQDQKHIQNSLQELADVLYCSTKNVKILLKKM
FT                   SEEQLISWTPGRGRGNKTEILFIHNFVEAIESYTDELLAQEKLKDVFLLLKEPLPLALQ
FT                   KKIENKLHHHFGYEPSNDMYDVLKIPISRKIFPLDPAFVAVTTESHLTSQIFDTLVVYN
FT                   DVTEKMEPHIAHTWELSEDGLTWTFYLRKDIYFHNETILTSKDVQFSFERLKQVQSPFE
FT                   WLTEEIIQIETPSPLQIRFHLAKPNLFFLHYVSSMQLAILPRDTSIQNHHYIGTGPFKL
FT                   AHYSEDNIVLEAFTHYFKERALLDRIEFWGIPDHVQIDADYELPNEEENERHDIQIEEI
FT                   GCIYASFNFKKPGPHHDIYFRKAWRELYDVEMILRNIEGRRTIAASSFFPDRSRLATRR
FT                   SYSLEKAKEYLKKSTYNGETIHIYFFAFKDSANDAYFLKERCESLGIQVALHPFPVSDY
FT                   MDRSIDKHADIIFMGEVFAANHEIAFLNVFKNKSCFVNRFIDPHYEKQINCLLDTFLLE
FT                   ENKEKRYELMYEIEEFLQAEYIILFNYHVLKRKTYPSSLKNVTIDSFGWANFAKLWIQP
FT                   STH"
FT   gene            840310..841572
FT                   /locus_tag="BMB171_C0738"
FT   CDS_pept        840310..841572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0738"
FT                   /product="multidrug resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0738"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05555"
FT                   /protein_id="ADH05555.1"
FT                   /translation="MGFWSMHRNIKIRIITSFLTRTVSTMIFPFMAIYFSIKLGSAIAG
FT                   ALLLINVIASLVIGLYGGYVGDRLGRKKVMIIGQSIQVISIACMGVANSDYVDSPWLTF
FT                   IFMLVNSLGSGLMNPATEAMLIDVSTPENRKVMYSINYWAINLSIAIGAIFGGLLFENY
FT                   RLQLFIVLTLVAIITLYVMTVYMEEVYVVRKTVEKKNVLKGMADSYKVVMKDKAFLIFC
FT                   AASICTLSLEFQINNYLGVRLQKEFETVHFLFGNGITFDLTGIRMLSWISAENTILVVL
FT                   CSALLIKMLKSFNDLKILYVGLFIYTTGFIILGTSNSLWILLIAGLFQTVGEMMYVPVR
FT                   QSIMADMVPNEARGSYMAINGMVFQVAKMNGALGVMLGSFIASWGMSALYFIVGMSSIL
FT                   LFMKAIGKEKYEDERNVSQIG"
FT   gene            complement(841625..841828)
FT                   /locus_tag="BMB171_C0739"
FT   CDS_pept        complement(841625..841828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0739"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05556"
FT                   /protein_id="ADH05556.1"
FT                   /translation="MNNNPPSTPPNPTETNNNEVSLQTLRVIGLIVLISGYILVTLSEV
FT                   GTLKNLLLQPSTTPNLAEVDPF"
FT   gene            complement(842140..842655)
FT                   /locus_tag="BMB171_C0740"
FT   CDS_pept        complement(842140..842655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0740"
FT                   /product="protease I"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0740"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05557"
FT                   /protein_id="ADH05557.1"
FT                   /translation="MSKKIAILITDYFEDTEYTEPVGAFKQKGYELTTIEMEKGKTVHG
FT                   KQGKSEVVIDKSIDDVSPENFDALFIPGGFSPDILRADERFVRFSKAFMDADKPVFAIC
FT                   HGPQLLITAQTLEGRDVTGYKSIEVDLKNAGGNFHDKEVVVCQNQLVTSRQPEDIPAFI
FT                   EESLRILG"
FT   gene            complement(842704..844701)
FT                   /locus_tag="BMB171_C0741"
FT   CDS_pept        complement(842704..844701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0741"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0741"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05558"
FT                   /protein_id="ADH05558.1"
FT                   /translation="MNKKMEQLKHHVTDNQRKHALTTNQGVKIAEDEFSLKMGLRGPTL
FT                   MEDFHFREKMTHFDHERIPERIVHARGVGAHGYFQLYESLEAYTKADFLTNPSKKTPVF
FT                   VRFSTVQGSKGSNDTVRDVRGFATKFYTDEGNYDLVGNNMPVFFIQDAIKFPDFVHAVK
FT                   PEPHNDIPQGASAHDTFWDFVAHNPESTHMVMWQMSDRAIPRSLRMMEGFGVHTFRLIN
FT                   TAGKAHFVKFHWKPTLGVHSLVWDEAQRIAGKNPDFHRQDLYEAIEKGDYPEWELGLQL
FT                   IPEEDEHKFDFDILDPTKLWPEEEVPVKLVGKMTLNKNVDNFFAETEQVAFHPGHVVPG
FT                   IDFSNDPLLQGRLFSYTDTQLSRLGGPNFHQIPINQPVCPFHNNQRDGMHQMQIHRGQT
FT                   SYHPNGLNNNQPATVQAEQGGYEHYQEKIDGHKIRGRSKSFLNFYSQAKLFYNSMSPIE
FT                   KQHIKEAFCFEVGKCKSDIVKANVIALLNHVDRQLAQEVANIIGAPLPKENHEVNSDAK
FT                   SPALSMSNTIFKSDSKNVAILLNGDPSVSLLSEWIQAFAQHRINYSIIDNKIYQFNASI
FT                   KVTDTYTTTDSSLFDAVLVFSSESVIHPPVLEFTETTFKHFKPIAHVLSNPHALDNSKI
FT                   KLDGAGVYNLTNTSIESFIEGIAQGRFWNR"
FT   gene            complement(844976..846175)
FT                   /locus_tag="BMB171_C0742"
FT   CDS_pept        complement(844976..846175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0742"
FT                   /product="protein ecsB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0742"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05559"
FT                   /protein_id="ADH05559.1"
FT                   /translation="MSIESLWSSRFQQHIQNIITYFARMINGLLYSFIFISCVGAYYYA
FT                   QFLKASPSKGISLIIITIVLTFIITRCPIRTFIQKPDAVYLLALEEKLTSYFKKSLLYN
FT                   YIIQLFPLLFTFLILVPLAMESLQLTVPFLCTIFIVLMITKAWNMYIHWMWRDSHDKNI
FT                   WLIIRITCNALIIYMLFYSANVLILGGLLLLLAFLLLYTKKQPTKRIPWDYIIEQEEKM
FT                   NVRFYQFASIFTDVPQLNKQVNKRKWLTNWIEPLLHKKRATFFYLHTLAFLRGNDYFGI
FT                   YIRLGLIGAFALYFIPNIYVKGSITYIVLYMISMQLRSLWKYFSGNIIVALYPIHTEER
FT                   MKQFLSLIFILLSIQLIVFSIVILIATGQFLHSLIIMIIGLIWIKFIIVPKTKQRISAF
FT                   "
FT   gene            complement(846236..847660)
FT                   /locus_tag="BMB171_C0743"
FT   CDS_pept        complement(846236..847660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0743"
FT                   /product="arginine/ornithine antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0743"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05560"
FT                   /protein_id="ADH05560.1"
FT                   /translation="MQQKKWGFWVLTAFVVGNMVGAGIFMVPSTLAQTASPLGVTLAWL
FT                   TTGFGVLMLALVFGNLAIRRPDLTTGPQSHAYALFSTPKKKKMAGFSMVWGYWVANWAS
FT                   NVAIITSFAGYLSLFFPIMKDTRLLFSIGSFNVEVGKLITFTICSILLWGTHIILTNGV
FT                   SGAGKLNFLATTTKVTGFLLFIVVTLFAFEASKFGQWYTPMIDKSGASHGLLSQVNLAA
FT                   LTTLWAFIGIESAVLLSNRAVSPKTVKRATVAGLLITVAIYLGITILTMGVLHVDKLQA
FT                   SERPLADALNAAMGHGGGKLMALLALTSLFGSILGWILLSSEVPYQAAKEGFFPSFFTK
FT                   TNKKGSPIYSLRLTNIMSQVFLLSTLSGTIAEAYTFVITVSTLAYLIPYLVSPIFQLKL
FT                   VATGETYKNEMRARITDGIVAVIALCYALWVIKTGASDIKTFLLGIGLFVIGFAFYPLM
FT                   NRDQKKNNEKKNGQVA"
FT   gene            848191..849021
FT                   /gene="racE2"
FT                   /locus_tag="BMB171_C0744"
FT   CDS_pept        848191..849021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="racE2"
FT                   /locus_tag="BMB171_C0744"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0744"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05561"
FT                   /protein_id="ADH05561.1"
FT                   /translation="MSVCHKHSVIGVLDSGVGGLTVASEIIRQLPKESIYYIGDNKRCP
FT                   YGPRSVEEVQSFVFEMVEFLKQFPLKALVVACNTAAAAALTELQEALSIPVIGVIHPGA
FT                   RAAIKVTKKEKIGVIGTVGTIKSNMYEKALHELDTYLEVHSHACPNLATVVENRLEDIA
FT                   YVTQQVKQALLPLTKEDIDTLILGCTHYPLLESYIKKELGEDVTIISSAEETAIELSTI
FT                   LQHKGILSDNLNPKHRFFTTGSVLSFEHIAERWLGYQISVECVHLPMKNACMHN"
FT   gene            849132..850217
FT                   /locus_tag="BMB171_C0745"
FT   CDS_pept        849132..850217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0745"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05562"
FT                   /protein_id="ADH05562.1"
FT                   /translation="MELSRSQLFALEYISKYAENEKREAKATINHILKMSNITDEIFEE
FT                   AVANLKSHARIALHFHPDRLDSSKKSVAEALFEQGVYKSQFETLLSNGSVSAYPGGERD
FT                   LWEKRIFGGAYQLEGVTNDQRPKYGALNLMLHPDGPAPRFGSCYFLLSPKVSSRSTYTY
FT                   LDSHQDPKEKGTYEEFDMILAALLEETFVRDFAIGEGNLTPTILINHLLANLKRPFIDV
FT                   VSKEPARNLNHYIEAQIHGEISLKEDVEALVADPSFKGTDVGRVLEEICLKYAIDLYWH
FT                   IGFVLAVDEVPMDFRGSKMPSLARRIARKHCIDANIIGSAVVDLKRNPLSWSDRGTYEE
FT                   VLQELKLLWHVLVRFGKPNRK"
FT   gene            complement(850296..851735)
FT                   /gene="gapN"
FT                   /locus_tag="BMB171_C0746"
FT   CDS_pept        complement(850296..851735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gapN"
FT                   /locus_tag="BMB171_C0746"
FT                   /product="NADP-dependent glyceraldehyde-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0746"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05563"
FT                   /protein_id="ADH05563.1"
FT                   /translation="MTTSNTYKFYLNGEWRESSSGETIEIPSPYLHEVIGQVQAITRGE
FT                   VDEAIASAKEAQKSWAEASLQDRAKYLYKWADELVNMQDEIADIIMKEVGKGYKDAKKE
FT                   VVRTADFIRYTIEEALHMHGESMMGDSFPGGTKSKLAIIQRAPLGVVLAIAPFNYPVNL
FT                   SAAKLAPALIMGNAVIFKPATQGAISGIKMVEALHKAGLPKGLVNVATGRGSVIGDYLV
FT                   EHEGINMVSFTGGTNTGKHLAKKASMIPLVLELGGKDPGIVREDADLQDAANHIVSGAF
FT                   SYSGQRCTAIKRVLVHENVADKLVSLLKAQVAELSVGSPEQDSTIVPLIDDKSADFVQG
FT                   LVDDAVEKGATIVIGNKRERNLIYPTLIDHVTEEMKVAWEEPFGPILPIIRVSSDEQAI
FT                   EIANKSEFGLQASVFTKDINKAFAIANKIETGSVQINGRTERGPDHFPFIGVKGSGMGA
FT                   QGIRKSLESMTREKVTVLNLV"
FT   gene            852641..854092
FT                   /locus_tag="BMB171_C0747"
FT   CDS_pept        852641..854092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0747"
FT                   /product="multidrug ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0747"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05564"
FT                   /protein_id="ADH05564.1"
FT                   /translation="MTPTFYQKNRTGDLMARATNDLKAIAMTAGFGILTLVDSSLYMLT
FT                   IVFMMGFTISWELTFAALIPLPIMAYAMNIYGKKLHERFTVAQDAFGDMNDKVLESIAG
FT                   VRVIRAYVQENADEERFHHLGDDVYEKNMKVAKIDALFQPTVKMLVGLSYLIGLVYGAY
FT                   LVFQSKVTLGELVSFNVYLGMMIWPMFAIGELINVMQRGNASLDRVNETLAYEPDVKNP
FT                   KHPKLVQEPDYIQFDDVSFSYPSSTEENLKKVSFTLKQGETLGVVGKTGSGKTTLVRQL
FT                   LRQYPLGDGDIAVSDVTLDKMTNENVLGWIGYVPQEHILFSKTARENILFGNREATEEE
FT                   LEKAIEIAAFKKDLEFLPEGLETLVGEKGVSLSGGQKQRISIARAVIQNPEILILDDSL
FT                   SAVDARTEAAIIENIRTERSGKTTIITTHRLSAVQHADWILVMDEGAVIEEGTHDQLIQ
FT                   KGGWYAEQFERQQGESESADSGVKI"
FT   gene            854089..856089
FT                   /locus_tag="BMB171_C0748"
FT   CDS_pept        854089..856089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0748"
FT                   /product="multidrug ABC transporter permease/ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05565"
FT                   /protein_id="ADH05565.1"
FT                   /translation="MSVSKRLFQYAMKVKGTIFAAMLMLFIFVIAELAGPFVAKTMIDD
FT                   HIVGIEKPWYETEQSEDAVSYNGAFYKRSDRFEQGETKGKEVRVMQAGFQYYFVPNKVN
FT                   AEGSRTVKGDMITVQNGKAVQVYKAQALTKEEVFAFYKPEINRLLLLGGGYFALLVVVS
FT                   LFAYGKQFFLQKAANKIIQIMREDVFSHIQTLPIRYFDHLPAGKIVSRVTNDTEAIRDL
FT                   YVTVLATFVSSIIYIIGIFAALFLLDVKLASLCLLIIPILIVWAILYRKYASVYNHKMR
FT                   SRLSDINGTVNESIQGMPIIQAFRQERETKKEFEELNGDYFKYQNKILNLNAATSHNLV
FT                   AVLRNIAFTGVIWYFGGASLSATGIISLGVLYAFVDYLTRLFSPITNMVNQLANLEQAR
FT                   VASERVFELLEEKGEPVEEERMPRLKGNVKFDNVSFSYNGKDEVLKNISFEAKQGETVA
FT                   LVGHTGSGKSSIMNVLFQFYEFEKGKLTIDGHDVKEMPKQATREHMGIVLQDPFLFSGT
FT                   VASNVSLENEKISKERIVKALRDVGAERFANNINEEITEKGSTLSTGERQLISFARALA
FT                   FDPAILILDEATSSIDTETEAMIQQALEVVKKGRTTFIIAHRLSTIKSADQIIVLDRGT
FT                   ILEKGSHDELMKKRGRYYDMYKTQMEGNQSA"
FT   gene            856184..856351
FT                   /locus_tag="BMB171_C0749"
FT   CDS_pept        856184..856351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0749"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05566"
FT                   /protein_id="ADH05566.1"
FT                   /translation="MFYLFLHKCYIKKCYLFFVCSVIFPFCLIMKKKDKLNKNIFIEKL
FT                   FKIAYNQYSF"
FT   gene            856384..857181
FT                   /locus_tag="BMB171_C0750"
FT   CDS_pept        856384..857181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0750"
FT                   /product="cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0750"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05567"
FT                   /protein_id="ADH05567.1"
FT                   /translation="MKKLFSVLAVTTLAIGIVAGCGKEEKKDTASQDALQKIKQSGELV
FT                   IGTEGTYPPFTFHDSSNKLTGFDVELAEEVAKRLGVKPVFKETQWDSLLAGLDAKRFDM
FT                   VANEVGIREDRQKKYDFSKPYISSSAALVIAKDKDKPATFADVKGLKGAQSLTSNYADI
FT                   AKKNGAEIEGVEGFSQAAELLASGRVDFTINDKLSVLNYLETKKDAKIKIVDTEKEASQ
FT                   SGFLFRKGSDKLVQEVDKALEDMKKDGTYDKITKKWFGENVSK"
FT   gene            857168..857866
FT                   /locus_tag="BMB171_C0751"
FT   CDS_pept        857168..857866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0751"
FT                   /product="cystine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0751"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05568"
FT                   /protein_id="ADH05568.1"
FT                   /translation="MYLSSALVSDRLSTWIDIMQTSFMPMLKEAVFTTIPLTLITFIIG
FT                   LILATLTALARISGSRILQWIARIYVSIIRGTPLLVQLFIIFYGLPTLNIEVEPYTAAV
FT                   VGFSLNVGAYASEIIRASILSIPKGQWEAAYTIGMTYPQALKRVILPQATRVSIPPLSN
FT                   TFISLVKDTSLASLILVTEMFRKAQEIAAMNYEFLIVYFEAGLIYWVICFLLSIVQQML
FT                   EKRSERYTLK"
FT   gene            857895..858629
FT                   /locus_tag="BMB171_C0752"
FT   CDS_pept        857895..858629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0752"
FT                   /product="cystine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0752"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05569"
FT                   /protein_id="ADH05569.1"
FT                   /translation="MISIQHLQKSFGDNTVLKHIDLTVEKGEVVVIIGPSGSGKTTFLR
FT                   CLNVLETPNAGNIRIGNKELNFSQKVTKKDIVNLRTQTGMVFQHHNLFPHLTALQNVME
FT                   GLVTVKKMGKEEAKKKANYFLEKVGLADKVDLYPFQLSGGQQQRVGIARALAMEPEVLL
FT                   FDEPTSALDPELVQEVLKVMKELAKEGMTMVIVTHEMRFAHQIANRVIFMDGGVVVEQG
FT                   TPEEVFTNPKEERTKKFLQMLQ"
FT   gene            complement(858681..858884)
FT                   /gene="sasP1"
FT                   /locus_tag="BMB171_C0753"
FT   CDS_pept        complement(858681..858884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sasP1"
FT                   /locus_tag="BMB171_C0753"
FT                   /product="small acid-soluble spore protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0753"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05570"
FT                   /protein_id="ADH05570.1"
FT                   /translation="MANQNSSNQLVVPGATAAIDQMKYEIAQEFGVQLGADSTARANGS
FT                   VGGEITKRLVAMAEQSLGGFHK"
FT   gene            859463..859588
FT                   /locus_tag="BMB171_C0754"
FT   CDS_pept        859463..859588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0754"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05571"
FT                   /protein_id="ADH05571.1"
FT                   /translation="MDQELLSAVDGLTHNNSNEYCNHIFYCRVCNVETEVVVKLV"
FT   gene            complement(859608..861065)
FT                   /locus_tag="BMB171_C0755"
FT   CDS_pept        complement(859608..861065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0755"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05572"
FT                   /protein_id="ADH05572.1"
FT                   /translation="MKEHIYTLNISDDHPNSITLPYVFSITPPITSLSFGIRHIASEEV
FT                   KIHYSFTREIIIGKHIAEKLLLPQSTTIHAFTQNQTIIFGPLIGIFTTGFNDDSSNPLG
FT                   NRSIALSELLTPPFSLRPFVFVFGVQHIHWEEETIEGYFFQEKQWIKKKVPLPNVIYDR
FT                   LPNRQAENYKPIVRAKRKLEQDYCIPWFNPGFFNKWEVHQLLTKDESIKPLLPNTEAFQ
FT                   HFEQVERFLGTYKSVYMKPIHGSFGRNIHQIFYSQTENCYYCRYRENEENKLRKYQSLE
FT                   TLLNHVLKGHDLKKFIVQQGISLLRFDGQPVDFRIHTNKNHFGNWIVSAIVAKIAGKGS
FT                   LTTHVNSGGDTKLLQELFPDSTKQVQIENKLKHTALQISYALDEQVTGNIGEIGFDIGL
FT                   DTKENPWLFEANSKPGRTVFQDKKLKEQSELTRQLFYEYAVYLTEHSLRDTKEKMSQIK
FT                   SGASSNTEHIPSPMIHSQIQKQKLPPR"
FT   gene            complement(861086..862138)
FT                   /locus_tag="BMB171_C0756"
FT   CDS_pept        complement(861086..862138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0756"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05573"
FT                   /protein_id="ADH05573.1"
FT                   /translation="MVLGLLTSKLHYEQTYYTEIAKRARLYHNVVAQFTPFCIDSKTDL
FT                   VSGLIYDTDTGKWKEQTFPIPSYIYDRYSFHEETDFEKAKSIIHSLHNRPSTTFLNNTL
FT                   INLSELHDLFLTNKKLSPYIPKFEVATIQNIFKLLLKSKDIIIRPTNIHSKDNLYRVAY
FT                   KNKTFHIDTVNEKYHTSLSIKRTDEFISWCKSNIRSSRYIVHTMLQPPNQLTYPLHIRT
FT                   ILQKNKEQTWNVIGQFIQKSSFPNQLLPSATDDDSLHSFSKIKYVLSSTGVQLLQDALH
FT                   DIINEVFQTLDQSYSSLFELELSTIMDQKGAIWLMYVNTIPPYEQYIRHSDSLAEKIFH
FT                   GPLKFSRFTP"
FT   gene            862286..863404
FT                   /locus_tag="BMB171_C0757"
FT   CDS_pept        862286..863404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0757"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05574"
FT                   /protein_id="ADH05574.1"
FT                   /translation="MLTTTGLGAIIGGYTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIP
FT                   KRRDELAVQLGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRHML
FT                   EKWNVAHVEEEATRKIEHVITEKIHAFLAEYYTYTWEQALPHSVNEKVENAIPNVSAFI
FT                   LERGISFFESEEGKARLSKMIDDFFASRGTLLNLVGMFLGNVSVVDRVQPEVIKFLGQD
FT                   ATKQLLTDVLQKEWEKLKGRDVKELEAFVEKEMIVSSVLSAVKVEETVSKFLNQSVQQV
FT                   CEPVRETIIEKVVPSAVAKGLKWGTENVESILNNLHLAEIVQQEVSTFSTERLEDLVLS
FT                   ITKNELKMITYLGALLGGMIGLVQGLLLLFLR"
FT   gene            863547..863903
FT                   /locus_tag="BMB171_C0758"
FT   CDS_pept        863547..863903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0758"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0758"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05575"
FT                   /protein_id="ADH05575.1"
FT                   /translation="MTKNIHDVAYELQKAIAENEDFKTLKESYAAVQADTASKNLFDEF
FT                   RTMQLSLQQKMMQGQEITEEDNQQAQEVVARIQQDAKITKLMETEQRLNVVIGDVNKII
FT                   MKPLEELYSAQQQA"
FT   gene            864450..866753
FT                   /locus_tag="BMB171_C0759"
FT   CDS_pept        864450..866753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0759"
FT                   /product="sensor protein comP"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0759"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05576"
FT                   /protein_id="ADH05576.1"
FT                   /translation="MIRVFKYEYQLIVTLLSLSLFSYFAIEIMLYPRVGIEIEHQENHL
FT                   VINNIVKNSWAAEQDLAVEDIIEKIDGILPDDNSNISLYGATERVKKITIKKGGTIEEY
FT                   KVEYNPYDKQLVYHLFLPTVFYLTCFFVATYILIRAPYLNAGTKDLIYFLHCLGMSYIS
FT                   IMAGLRKDSIAYIVVAISLTYSVVFFIKFMDMFTKNLKIRFITKTKLIYINIIAFILVC
FT                   LTIFIYLKYNDLSTSYIILLSSVLFLLTVYVLFRFYFKSRKSYYFKFIRVIIMSTIISA
FT                   MPFIFLFLIPNLINYKEIISVETTAIFFLLVPICIFYMIIEGKIFDYNFVIHRVQYYAL
FT                   LSICLTGFIVILGILIFHNTSDNILDVIRFAGILFVSLMLSCFIKDYLDFKLRKKLYHS
FT                   QKNYQFSLHRFLHQAKNEYKFSNLIVSIKREINDVLRREEICCIEVSKGDNSLQIIGDG
FT                   YVSEDVLKQLNGYQLETYTVGSIIQLEDHFVFVLSISAKTMIILLCKSNNRRGLNIQEI
FT                   GWLETLCSYADLLLECSYQVEELVNQLQTINEPKQPPIWLSKLLFNLSEKERTNLASDI
FT                   HDGVLQDQIRLSRKLEEYHKDIPDVDMKKIINEVYEDVLDHIYVIRETCNNLRPPFLYE
FT                   LGLKKALLDLFKQVNLKATFFFYYEIQDNIILPNVEYEQAIYRIIQELLNNALKHSKAS
FT                   KVTIRLYEQNGYLNLTYDDDGIGMGIDLDELNHSYSSLGLSGIVARIHSLGGEMSIDSK
FT                   VNNGLKIKVSMKID"
FT   gene            866789..867445
FT                   /locus_tag="BMB171_C0760"
FT   CDS_pept        866789..867445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0760"
FT                   /product="two-component response regulator comA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0760"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05577"
FT                   /protein_id="ADH05577.1"
FT                   /translation="MISVLVVDDHVAVGLGTKALIERYDDIEADVFHDSEEIREVMHNK
FT                   QYDVYLIDLQMPKINGLELSKYILSVQPEAAILIFTGFDVLAHYNLLIDNGVLGVLSKT
FT                   SSEKEVVNAIRHAVKKEVVLSHQLVRQLRIVENASNINVEGEMKNIISLNDEEKMILVE
FT                   VGKGKTNRELAEILNLSQRSVEYKLTDIFHKLQVSSRMEAVQKAKELWFIPTINF"
FT   gene            868224..869912
FT                   /gene="alsS"
FT                   /locus_tag="BMB171_C0761"
FT   CDS_pept        868224..869912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsS"
FT                   /locus_tag="BMB171_C0761"
FT                   /product="acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0761"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05578"
FT                   /protein_id="ADH05578.1"
FT                   /translation="MSTGVKANDVNTKTKGADLVVDCLIKQGVTHVFGIPGAKIDSVFD
FT                   VLQERGPELIVCRHEQNAAFMAAAIGRLTGKPGVCLVTSGPGTSNLATGLVTANAESDP
FT                   VVALAGAVPRTDRLKRTHQSMDNAALFEPITKYSVEVEHPDNVPEALSNAFRSATSTNP
FT                   GATLVSLPQDVMTAETTVESIGALSKPQLGIAPTHDITYVVEKIKAAKLPVILLGMRAS
FT                   TNEVTKAVRKLIADTELPVVETYQAAGAISRELEDHFFGRVGLFRNQPGDILLEEADLV
FT                   ISIGYDPIEYDPKFWNKLGDRTIIHLDDHQADIDHDYQPERELIGDIALTVNSIAEKLP
FT                   KLVLSTKSEAVLERLRAKLSEQAEVPNRPSEGVTHPLQVIRTLRSLISDDTTVTCDIGS
FT                   HSIWMARCFRSYEPRRLLFSNGMQTLGVALPWAIAATLVEPGKKVVSVSGDGGFLFSAM
FT                   ELETAVRLNSPIVHLVWRDGTYDMVAFQQMMKYGRTSATEFGDVDLVKYAESFGALGLR
FT                   VNTPDELEGVLKSALAADGPVIIDIPIDYRDNIKLSEKLLPNQLN"
FT   gene            869929..870687
FT                   /gene="alsD"
FT                   /locus_tag="BMB171_C0762"
FT   CDS_pept        869929..870687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alsD"
FT                   /locus_tag="BMB171_C0762"
FT                   /product="Alpha-acetolactate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0762"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05579"
FT                   /protein_id="ADH05579.1"
FT                   /translation="MTVAQLIDIDAKKTKTSNEVYQTSTMLALLDGIYDGVISFEDLKK
FT                   HGDFGIGTFDQLDGEMIAFDNEFYHLRSDGSAEKVEPEETTPFATVTFFEKEMSYTVER
FT                   PMNREEVEALLHELMPSKNLFYGIRMDGTFREVRTRTVPRQEKPYTPLVEVTKSQPIFS
FT                   FENTEGTLAGFWTPDYAQGIGVAGFHLHYIDDERSGGGHVFDYVIENCTIQICQKAHMH
FT                   LALPETADFMAAELSRENLEDNIATAEGAE"
FT   gene            complement(870909..871526)
FT                   /locus_tag="BMB171_C0763"
FT   CDS_pept        complement(870909..871526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0763"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0763"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05580"
FT                   /protein_id="ADH05580.1"
FT                   /translation="MQAPPSFYEGDTLEVAKKLLGQKLVHIVDGIKRSGIIVEVEAYKG
FT                   PDDKAAHSYGGRRTDRTEVMFGAPGHAYVYLIYGMYHCFNVITAPVGTPQGVLIRALEP
FT                   VDGIEEIKLARYNKTEITKAQYKNLTNGPGKLCRALGITLKERGVSLQSDTLHIELVPK
FT                   EEHISSQYKITAGPRINIDYAEEAVHYPWRFYYEGHPFVSKK"
FT   gene            871661..872533
FT                   /locus_tag="BMB171_C0764"
FT   CDS_pept        871661..872533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0764"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0764"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05581"
FT                   /protein_id="ADH05581.1"
FT                   /translation="MIYRLLALNIDGTLLYNNGKIAKGLRETIEFVKRKDVYVTLFTSR
FT                   NFQSAHKVAKALKLDSILVTHGGAFVSATLDKPYVQRRLSEEKTFNIVQVLEHFDCNVR
FT                   ISHERFSIGNRERNTPNLIARTVLSSADPLFYPVQFVDSLGDALRDHPVAAPKIDVLFQ
FT                   TKGEKERGLNTLRKAFQDVEYVECDSKRIEILPQNVSKLRGLQLLGEHLNISLNEMVAI
FT                   GDSMEDLEVIENVGLGVAMGNSPVELKQAADWITRSNSENGVEYMIKEHFRKQFPLPFL
FT                   KNHKNTPKR"
FT   gene            872996..876850
FT                   /locus_tag="BMB171_C0765"
FT   CDS_pept        872996..876850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0765"
FT                   /product="collagen adhesion protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0765"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05582"
FT                   /protein_id="ADH05582.1"
FT                   /translation="MNFLIHLPFKAEAATTELKGLGDVSYYNAIIFGDHSATSADIEGA
FT                   MAVQKNMNASSYTVVAAATGANNLAGATWIDEGYPSLLLGGQFTKAGAGQVIIQDGTVA
FT                   MTKDGDPDGAMKTSYDRISYKEQAEIDAKFKEFRKDVDGVIGDASKLHTDKPKPNMSFG
FT                   IGEDVNNPNIYVSSGQTGKKAFDVKDVFLPNVENKDFIVIYSDAEEVSFGGGAILYDTR
FT                   NTGMATDLINTSQAYDPNSSFTELASKVIWVFPNATKITTKGYGVVGSVFAPNAVVETK
FT                   GGSINGQAYVGGLHQRDGFEVHNFKFNWPKWNKPAAEKGHLQIKKVDENDGNIVLKDAK
FT                   FDVIDKDNNVVATVTTNEKGIAEVKDLPLGDYFVKEINAPEGYIKVDTPVKVTIDNTNV
FT                   IELVMKNTKKVENGQFKLLKKDSESGQLLPGAKFDVIDKDGKVVETIVTDDKGEALSKR
FT                   LPVGSYTLKEVEAPKGYELSSSSVSVDVEANKVLTVDVVNKKIPEKVTGQFEIVKVDAE
FT                   DKTKVLSDAEFEVYKEGKKVDTLRTDKTGKVVSQKLEPGKYTLKETKAPQGYKLLKEEI
FT                   EVVVEADKVVEVQIENAKELGSLQVIKKDAESGKVLAGAEFKLKNEAGQVVGEAKTTNK
FT                   DGVVKFESLVPGRYTLEETKAPEGYKALEVTVEVNVVANEVVKQEVMNEKVTGQFEIVK
FT                   VDAEDKTRLLSGAEFEVYKDGKKVAELKTDESGKVMSPKLPLGEYTVKETKAPAGYKLS
FT                   NKEWKVTIQNEKEVVKVEAENEKILGSLQIIKMDDKDQTKRLAGAEFTLKDAKGNVVKE
FT                   GITTDKSGTVKVDGLVPGEYTLEETKAPEGYELTKQIIHVTVDGEKVIDVKVTNGKSLG
FT                   QFEIVKVDAQDKTKVLSDAEFEVYKDGKKVDTLRTDKTGKVVSQKLEPGKYTLKETKAP
FT                   QGYKLLKEEIEVVVEADKVVEVQVENAKELGSLQVTKKDAESGKVLAGAEFKLKNEAGQ
FT                   VVGEAKTTNKDGVVKFENLVPGKYTLEETKAPEGYKALEVTVEVNVVANEVVKQEVMNE
FT                   KVKEEITGQLEITKVDANNTNKTLAGAVFEIWKDGIKIDTLTTNKSGKATSKKLEPGDY
FT                   TLKEIQAPEGYTLSNKEMKFTISNEKIEVVKLQITNKKDTDKDPEKPGEGTGKPGEGTG
FT                   KPGEGTGKPGEGTGKPGEGTGKPGEGTGKPGEGTGKPGEGTEKPDEGTGKPGEGTGKPG
FT                   EGTEKPGEGVEKPNLPEKGQGSSNNQQLPATGHNTNYVPFIGFMLLLLGIRLRFMAKNS
FT                   "
FT   gene            complement(876945..878648)
FT                   /locus_tag="BMB171_C0766"
FT   CDS_pept        complement(876945..878648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0766"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0766"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05583"
FT                   /protein_id="ADH05583.1"
FT                   /translation="MKKKFYSVLTLSLALQTVLAPTYSFAESAEKSAEVYTEDQVFKSI
FT                   KEHVNEHSTHEEDIEVTGQFLLYTSKKHSLYTANDLKNKSNIEITEQVVTATKKKGNAY
FT                   YITTPTGAGWIDNNDNSLEVQEIHKLSNQKLIVKEEASIHALPFQSFKEEGKLEPQVIT
FT                   PTEQAGNWFKVQINETAKWIYAPSATFEGTKASLLKNSRTAKNSLLRSPEALQTNTIYG
FT                   VTFKEMIVPKGNDDIRPGYPMVPKYITIHETANTAKGANALNHAKFLDNQARGTADRAA
FT                   SWHFTVDDKEIYQHLPVNEVGWHAGNKTGNYESIGIEIAVNQDGNYEKAVENARKLAAY
FT                   LMNDLNISLDKVQKHQFWSGKNCPAFMIQRGQWDAFLKGTETYYKENQKNPVTDDITGG
FT                   WYEQDIRQLAARGIMQGEGNGKYFPERLVTRAEFATLITRALQLPSGNANFTDLEQVHP
FT                   SLRDGINRAASAGIIRGRGDNTFDPNTTITREEAVIMIDRSLKHAGIFAKQVELPFVDQ
FT                   NLIYAKEEVQRVYGYGIVKGNEFNQFVPKGPSQRAHAAAFINRMLSVIEA"
FT   gene            878900..880390
FT                   /locus_tag="BMB171_C0767"
FT   CDS_pept        878900..880390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0767"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0767"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05584"
FT                   /protein_id="ADH05584.1"
FT                   /translation="MLLISIKTLQDDRFLRPLQNIGGLFFEESTIGFEQEEANLIVDIH
FT                   IEENVKASARLTDVATGNVYEETFAKDLSAFTDEKERMKQVKHVVSYVYLSVLQQLTGI
FT                   EQSWGILTGVRPTKLLHKMLQNGMSKEEAHQELRESYLIHEEKIELLQRIVDCQLAVVP
FT                   DLYRLKEEVSIYIGIPFCPTKCAYCTFPAYAINGRQGSVDSFLGGLHYEVREIGKFLKE
FT                   KGVKVTTIYYGGGTPTSITAEEMDMLYEEMYEAFPDVKNVREVTVEAGRPDTITPAKLE
FT                   VLNKWNIDRISINPQSYHQETLKAIGRHHTVEETIEKYHLAREMGMNNINMDLIIGLPG
FT                   EGLDIFKHTLDETEKLMPESLTVHTLSFKRASEMTQNKRKYKVAGREEITAMMHEAEEW
FT                   TQKHNYVPYYLYRQKNILGNLENVGYAMPTQESIYNIVIMEEVQSIIGLGCGASSKFVH
FT                   PKTGAITHFANPKDPKSYNDGFVKYTEDKLKILEELFA"
FT   gene            880707..882263
FT                   /locus_tag="BMB171_C0768"
FT   CDS_pept        880707..882263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0768"
FT                   /product="acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0768"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05585"
FT                   /protein_id="ADH05585.1"
FT                   /translation="MYMTIGRIFDLSVGKYPNKEALVEPEKNIRWTYKQWDEQINKTAH
FT                   ALLEEGVRKGDTVSVYLYNCHEFVNVYLACAKIGAIFNPINFRLKAKEVSYILQDASSK
FT                   VVVFEKAVESTVAIIERDFPNTSFWSIENDKPSYASSYHEKVNEASSEKVNIEIDEMDY
FT                   CSMLYTSGTTGHPKGVLHRHREMAEHSMICTYFLKYNRDSVGLVVAPLYHCGELNAGII
FT                   PRIQVGGKNVILHHFDTETVLHTIQEEKITTFFAAPTMWNMLLQKDLAQYDLTSMKIGI
FT                   YGGAAMAPALVKECKERLYIDLVQIYGMTEMGPVVAFLVEEDQITKAGSAGTPCFSHEV
FT                   RIVKPNEDAPAEPDDVLPPYEVGEIILRGPTMMAGYHNREEANKKSMYKGWYHSGDLGY
FT                   FDKDGYLFVADRVDDMVISGGVNIYPREIEDFLHSHPGILDVAVLGEPDELWGERVVAV
FT                   IVKKDETITEADLETYCKESDELADYKRPRHYLFVDELPRNASGKLQKFVLRESLKGAK
FT                   K"
FT   gene            complement(883147..883611)
FT                   /locus_tag="BMB171_C0769"
FT   CDS_pept        complement(883147..883611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0769"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0769"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05586"
FT                   /protein_id="ADH05586.1"
FT                   /translation="MLTFEEKLSIIESFPELERKNVSLKRVNFHFEESRLDKKNVVFHL
FT                   HPNGNGFVYASGIKGYKTDDKGMVNIREFSAEELRSVIEKSIDLLSQEEVVAPVEPAKE
FT                   EEWQNEDGHILTLISEDDMWNVYAGVNLDGTFNSYPEAAEYLDEEGFSRK"
FT   gene            883800..885269
FT                   /locus_tag="BMB171_C0770"
FT   CDS_pept        883800..885269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0770"
FT                   /product="Sulfate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0770"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05587"
FT                   /protein_id="ADH05587.1"
FT                   /translation="MFQKIAKECLAGFTVAIVALPLAIAFGIAATGTSEGALVGLYGAI
FT                   FAGLFAALFGGTPGQVTGPTGPITVIATGVIATHGLEASFIAFMMAGLFQILFGVCKLG
FT                   SYVRYIPYPVVSGFMNGIALIIILGEIKHVQNSFLLVVLTIIVMIVSGKWIKAIPSSLV
FT                   ALVGVTALLPLFSSLLEGLTVKLPIIGNLSLNKVIEKIGTIPEAMPTLHIPSLSGTGIA
FT                   ALILPALSIALLGSIDSLLTSVVMDNVTGTRHKSNKELVGQGIGNMMSGLFGGLAGAGA
FT                   TVRSIVNIRSGGKTALSACMHSVILFIFIMGLGSVVQYIPLAVLSGILILTGIGMFDWG
FT                   SMKKMHVAPKGDVVVMLVTMIVTVKFDLMIAVAFGIILSFIIYMVKCKERKTSIVKEKE
FT                   ETYTIQGPLSFLSVDRIFSTLQDVKSPVILRMKDVRYMDVSGAMALLNFVEQSNKVGAS
FT                   VKLEQVHPSIEKTIAVMASDEQKEQLKILSV"
FT   gene            885605..887125
FT                   /locus_tag="BMB171_C0771"
FT   CDS_pept        885605..887125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0771"
FT                   /product="polysaccharides export protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0771"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05588"
FT                   /protein_id="ADH05588.1"
FT                   /translation="MNKTFVKGAAILTITTFLSKLLGSFFQIPLQNIAGDEVLGIFRLV
FT                   FPVYMIALTLSVAGVPLAISKLIAELNEKNKQKEIAKLFKSASIIGIAFGVFGCLVIVL
FT                   FSIEIANMLGGQETRMPLLITSLALLIAPYMAVYRGYFQGFGDMKPTGVSQVIEQFVRV
FT                   FFMLIIAYILVSWDKSNTVITSGAMVGSFLGVISSLIYLRIKYNRSPYYNKSNSYSLRD
FT                   LRENGKKILRVSIPIAIGALSMPLLNLVDSLTIPHVLQGSSTEIQEQFGIYSRGFAFTQ
FT                   IIVIFASAIVFPLIPLLTSALAKRDINLAKITIQNTNRLAHVLTAPLTIWLMALTVPLN
FT                   VGLFTDVKGSSMLTVMIGSSYFTAVMVLSIGVLQGINRSAQAAWIVIAASCVKVVLNIM
FT                   FVQKFGIDGAAYSTFITYVLVCIVNHLYIRSYIAYSIHLKSFFGVLAIACILGLGLYEL
FT                   CNVINITSSRIMTLLFSGIALSITTILYGVCALKLKWISINKIPFLKR"
FT   gene            887269..888357
FT                   /gene="csaB"
FT                   /locus_tag="BMB171_C0772"
FT   CDS_pept        887269..888357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csaB"
FT                   /locus_tag="BMB171_C0772"
FT                   /product="putative pyruvyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0772"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05589"
FT                   /protein_id="ADH05589.1"
FT                   /translation="MRLVLSGYYGFYNVGDEAILQSIIESLSKENPDIELVVLSNDSKY
FT                   TKEMYGVESVDRWDIKAVYHAIKNSDGVISGGGSLLQDQTSTKSILYYTGIMGLARLLK
FT                   KPYYIYSQGIGPITKGYNRLLVKWNLSKASYVSVRDEDSFLYLKELGIKNDIEIVPDPV
FT                   LTWKRTKQSDWLQKHSIHGKVIAVSVRYWNAKEDYIKKLAAALKKLKQEGYQILFVPMH
FT                   EPFDQKASREVVDLMGEKTYMLPYKMDIDEKIFILSQCSLLIGMRLHALVFSAVAKTPM
FT                   VGISYDPKIDSFLSQVNQPVIGSVDGEWSAEYLYEIAKKQLMQQGTVQQELQLTIDELR
FT                   LQGKQATKKLIDHMEKGTLLKK"
FT   gene            888504..890366
FT                   /locus_tag="BMB171_C0773"
FT   CDS_pept        888504..890366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0773"
FT                   /product="S-layer protein/peptidoglycan"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05590"
FT                   /protein_id="ADH05590.1"
FT                   /translation="MKTFSKGITAVALTGSLLLTPISSYAANDDITGHMFETNMRSLIT
FT                   KGVLMGYGDNVYAPDKLVTRAEFATFIARALNLPKADSNFEDVPKTYGLYDGVSRAYGA
FT                   KIINGRTNETFSPNDVITREEMSIMVKRALDYKNIKVAVSPLTFTDKDSINYKEHVQVM
FT                   VATQIIKGYPEDNTFRPHLSATRGMASAMLDRMLQTIEKNGNTNPVETKKYVVTNVREN
FT                   GTEQEVERYNTYKEAVTAAQNKGMNAVKYENEFLWIKDGFASAKRITGQNIINIYDENL
FT                   STVYTYIQYGTELKVLEVGEDRVKVQLSGLTGYVKKNEITLIPTNEMKQSSYYVKSDGY
FT                   LYHKYYTYNTSSPGYTEFRYGVAPSFMKQGQQMYSVDGKTFGDETFYQYFNYLSLRSKT
FT                   DYTAEQLDSYVKSIKPDSPLIGLGKKFKEVESKYNVNALFLYSLAIHESYYGTSALAKD
FT                   KNNLFGLKATDDSPYGNGEAFNSKEDCIEHAAKLYMNEGYLNPGHWRYTATYTGDKAAG
FT                   LNAKYASDANWGKKVAGHMNRFDSYLGKKEYNKYKLARVMNNVEVKKNPSISNERLYRL
FT                   NTNVVVTVTGEEIINGKAWVKVISDNPTVTEAYIAKESLEYVKH"
FT   gene            complement(890413..891807)
FT                   /locus_tag="BMB171_C0774"
FT   CDS_pept        complement(890413..891807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0774"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05591"
FT                   /protein_id="ADH05591.1"
FT                   /translation="MVNKLKQTDNYFPHFLLLFIVFQPILDLLTSFSIYILHMSATVGV
FT                   VVRFAFMLLALGYLLLHHKQQDAKKYILYLCLLGIALAIGLVNNMMVKSPVSFGEEVKF
FT                   ILKSVYPIVLLFGYIIAFKELKNKEYVFHKIITYFLYATLILSITMIVAMQTGTDFPSY
FT                   PHSKIGSRGWFFAGNDLSSLFAIMFPIIVLYSIHKTTSFSKIYYWIPTILAMYASIMVG
FT                   TKVGYGAIVITLGVALFFSFIEYMINRKKEGKGFTHIVNTVVAAVILGGLIVLTPHTPI
FT                   AKNMGIHMQIYEYKKSVQEEKDRKEGKVIKEDPEDAKKHAKGELTDSEVKSLIYSDRDK
FT                   FLKTYKQYYKDAPLSQKLFGMGYAGNYTDKIKLIEMDFHDLFFAFGIVGFLIYLIPLLY
FT                   FGITLFIRMITNFKKIMTVKYMLLASTLILSLGIGFMSGHVLTAPAVSIFFVVILAYII
FT                   VDFKIE"
FT   gene            892133..892921
FT                   /locus_tag="BMB171_C0775"
FT   CDS_pept        892133..892921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0775"
FT                   /product="enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05592"
FT                   /protein_id="ADH05592.1"
FT                   /translation="MEITSKTESVVVKYEGHVATVMVNRPEVLNALDEPTLKELLQKLK
FT                   EVAESSAHIVVLCGNGRGFSAGGDIKSMLSSNDESKFDGIMNTISEVVVTLYTMPKLVI
FT                   SAIHGPTAGLGLSIALTADYVMADISSVIAMNFIGIALIPDGGGHFFLQKRVGENMTKQ
FT                   IIWEGKKLSATEALDIGLIDEVIGEDFQTAVKQKINEWSQKPIKAMIQTKQILCEVNRS
FT                   NLEQTLQLEKRGQYAMRQTADHKEGIAAFLEKRLPAFKGE"
FT   gene            893030..893347
FT                   /locus_tag="BMB171_C0776"
FT   CDS_pept        893030..893347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0776"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0776"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05593"
FT                   /protein_id="ADH05593.1"
FT                   /translation="MKKMIGVITIILLTYSALHSTPSLAVRTALFFEGHPSVAFSDGVT
FT                   KEKDVKKEAIPDEYQTLYGKDEDLEHYFFPHVRAHGSGIDMLSACVKKKWFFYKAELGC
FT                   Y"
FT   gene            893365..893691
FT                   /locus_tag="BMB171_C0777"
FT   CDS_pept        893365..893691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0777"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0777"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05594"
FT                   /protein_id="ADH05594.1"
FT                   /translation="MSAYNKLVRDRVPEKILMSGKTYTAQKLTGQAYIQALAKIGTEEI
FT                   REFASMKEREHALDSLADALEVIISLARAEGASIEDVERLRKQKEIERGGFERGIYLLD
FT                   VSEE"
FT   gene            complement(893713..893892)
FT                   /locus_tag="BMB171_C0778"
FT   CDS_pept        complement(893713..893892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0778"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05595"
FT                   /protein_id="ADH05595.1"
FT                   /translation="MNISKKYIHIALIWFLASLFCLQISYAIHTTTSITIGWILTAIFF
FT                   IISFIATKKHSVTH"
FT   gene            894019..895068
FT                   /locus_tag="BMB171_C0779"
FT   CDS_pept        894019..895068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0779"
FT                   /product="deblocking aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05596"
FT                   /protein_id="ADH05596.1"
FT                   /translation="MAHHTKETMELIKELVSIPSPSGNTAKIINFIENYVSEWNVETKR
FT                   NNKGALILTVKGKNDAQHRLLTAHVDTLGAMVKEIKPDGRLSLSMIGGFRWNSVEGEYC
FT                   EIETASGKTYTGTILMHQTSVHVYKDAGEAKRDEKNIEVRIDERVFSADEVRELGIEVG
FT                   DFVSFDPRVQITESGYIKSRHLDDKVSVAILLKLIKRLQDENVTLPYTTHFLISNNEEI
FT                   GYGGNSNIPEETVEYLAVDMGALGDGQASDEYTVSICAKDSSGPYHYALRKNLVELAKT
FT                   NHIEYKVDIYPYYGSDASAAIRAGFDVKHALIGAGIDSSHAFERTHESSIAHTEALVYA
FT                   YVMSNLIEE"
FT   gene            895460..897052
FT                   /locus_tag="BMB171_C0780"
FT   CDS_pept        895460..897052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0780"
FT                   /product="S-layer protein/N-acetylmuramoyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0780"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05597"
FT                   /protein_id="ADH05597.1"
FT                   /translation="MKYKAIAAGLLAANLLAHPISSLAETKKFPDVSDSAWSKDAIYYL
FT                   VERNVINGMPDGNFMPYGNLTRAQAAKIIATAIGAKVDPNAKPSYDDAKNSWAASFIAA
FT                   MEKENIIKGREPGVFDPEGKVTRAEMAAMLVRAYNLKSKVTGPVPTKFADLENHWGKEE
FT                   VNILVELKLSLGTENGWKPNDSITREQAAQLTAQTDKFSKNSDRPVETKKMYIDRKFIT
FT                   YHAPSLSSGISANQHNPQTVEIKEERDGWIKIATSNGDKWTPLVEKTEVINEGFTTYAE
FT                   ASSSSKVMGTHNAQQVTVIEENGSWIRIRMGAGFQWVNKNQLNPVKQGNFLEGKAIIID
FT                   PGHGGVDPGHSGVKMDESAIVLDTSLRVQKLFEQKTPFTVLLTRNDDTRPGNTPGESLK
FT                   KRVEFAQENKGDIFVSIHANGFNEQVEGTETFYYRSATNPNSEESRVLAEKVQKRLVQA
FT                   LQSNDRGVKTENFYVVKYNTMPAILAELGFIDAKGEGEKLATEEWRQRAAEAIYQGILD
FT                   YYEEMGNNVSSFR"
FT   gene            897206..898159
FT                   /locus_tag="BMB171_C0781"
FT   CDS_pept        897206..898159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0781"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0781"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05598"
FT                   /protein_id="ADH05598.1"
FT                   /translation="MNNHSKTPACIYTYAFREEERALCYLEMRSFFGMESHVNILKSDV
FT                   KIDPSRSAFMKERVEVMYEGDDLESILKQVEQIDLAGASFKVIFVKINDLVGENKIEYG
FT                   ERRLIERDLGMHIEGEADVRNPERVFGIVPLGGRWYFGHYVESEPVWYHHIKKPHSYST
FT                   SLSTRVARSVANIAVPNPEGVRAIDPCCGIGTVVVEALSMGINIVGRDINPLVVLGTRK
FT                   NIAHFGFEGTVTKGPIEEITENYDVAIIDMPYDLFTHATPEDQLSILSSARRIAKKVVV
FT                   VTMETMDDMIHEAGFEITDRCITRKGSFTRQILVCE"
FT   gene            complement(898303..898449)
FT                   /locus_tag="BMB171_C0782"
FT   CDS_pept        complement(898303..898449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0782"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0782"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05599"
FT                   /protein_id="ADH05599.1"
FT                   /translation="MYYGTKGWYVAELKKLGVRYHEGRKLESYRGHVLRNLLIAQQEKL
FT                   KEQ"
FT   gene            complement(898661..898816)
FT                   /locus_tag="BMB171_C0783"
FT   CDS_pept        complement(898661..898816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0783"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0783"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05600"
FT                   /protein_id="ADH05600.1"
FT                   /translation="MFHTVGASFQLRFSFYFWHSARNNSKRLPSYVCINRCIYFTNLHF
FT                   YLSPIR"
FT   gene            898868..899689
FT                   /locus_tag="BMB171_C0784"
FT   CDS_pept        898868..899689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0784"
FT                   /product="proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0784"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05601"
FT                   /protein_id="ADH05601.1"
FT                   /translation="MYGCIITPPASAHADFGVLFMHNEGWSTMCGHGIIAVITVGIETG
FT                   MLEVKGEKQKFIIDSPAGEVIAYATYNGSEVESVSFENVPSFVYKKDVPIKIDSYEFQV
FT                   DITFGGAFYAVVDSKEFGLKVDFKDLSAIQMWGGKIKHYIESKMEVKHPLEEGLKGIYG
FT                   VIFSDDPKEKDATLRNVTIFADGQVDRSPCGTGTSARIATLFGKDALQKGEIFVHECIT
FT                   DGKFEGEVLSVTAVDTYEAVVPKVTGNAFITGFHQFVVDPRDDLNRGFLLG"
FT   gene            899709..900686
FT                   /locus_tag="BMB171_C0785"
FT   CDS_pept        899709..900686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0785"
FT                   /product="ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0785"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05602"
FT                   /protein_id="ADH05602.1"
FT                   /translation="MLVISANEQRNLVNMNEVIEYAALALKEFSAERTITPIRGSLPFA
FT                   NEQNTALIMPSVAEGLEALGVKIVTVVPQNKQIGKKTINGIVMLSDFQTGEPLALLEGS
FT                   YLTMIRTGALSGVATKYLARHNAKTLCIIGTGEQAKGIAEAIFAVRDIEKVILYNRTEE
FT                   KAYAFAQYIQEKFGKPAYVYKDPNEAVREADIIVTTTNATTPVFSEILQKGVHVNAVGS
FT                   FRPSMQELPSHAIAKANKVVVESKEAALDETGDLQVPIKEGLFKANAIHAELGQIISGE
FT                   KAGRENDEEITIFKSVGLAVVDIIVAKYLYERALEQGVGNKIEF"
FT   gene            complement(900852..901190)
FT                   /locus_tag="BMB171_C0786"
FT   CDS_pept        complement(900852..901190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0786"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0786"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05603"
FT                   /protein_id="ADH05603.1"
FT                   /translation="MTFDELKKNKPTTSWVESDEDGEFFTEENISTTNTVLDTYINNLQ
FT                   RLGENPTEVEVMQVVKEVVIKLNELNIEHDHFIETMEREDLYEFIDTAARIAGLEPEED
FT                   ITEEWREW"
FT   gene            901508..903097
FT                   /locus_tag="BMB171_C0787"
FT   CDS_pept        901508..903097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0787"
FT                   /product="oligopeptide-binding protein oppA"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0787"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05604"
FT                   /protein_id="ADH05604.1"
FT                   /translation="MKQKLFALPFVLILLIALAACSGEKDSSKQAGTSKSGTPKDGGTL
FT                   TIGVSDNPDTMNPLYANDRVSLTVQQALYAPLYHMENGKKKFVLAESFTPSEDQLTWTL
FT                   KLKDNLKWHDGKKITSDDIAFTFQSILDEKQNSSSRENFIFKGKPLEVKKVDELTTQFV
FT                   LPQVSASFEGVMNDFFPIPKHVFEGEADLAKSKKNLQPVGSGPFKFKEYKSDEYVALDR
FT                   FDDYVGGKAKLDSIVYRVVKDRNTANVSLQNGQINMKMIEPQDFKKLDSTGNFSMVTFP
FT                   EGRLFYLSYNMNTELMKKKEVRQAIAHALDKKEMINSAFVSGEFAEPANSILTPDAMYY
FT                   AKDIKDYKYDKKEAKDLLAKAGVKDKEKVRVMYVTNNKIMESLALYTQQKLKEVGLEVE
FT                   LNALDASAASEKGLDKENKEYDITFGGYIMGPEPDSYKSLFLSNAEYNYARYKNADFDK
FT                   LWEEAAVETDKTKRAELYHKIQETAREDVPYLPIAYPKAVIAVDKKFDGLKEAKAIPVT
FT                   MFEDLSKIYEVK"
FT   gene            903153..904103
FT                   /locus_tag="BMB171_C0788"
FT   CDS_pept        903153..904103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0788"
FT                   /product="oligopeptide transport system permease protein
FT                   oppB"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05605"
FT                   /protein_id="ADH05605.1"
FT                   /translation="MYKVIAKRLLNAIPLLFVISIISFLLIKLAPGDPVRNFVTPNMSP
FT                   IDVERIRKSLGLDQPIYVQYFLWLKNILTGNFGYSLQNHRPVLELITERLPATIGLMGS
FT                   SLLVSFVIAIPLGLFTGVKKNSFFDRIVNFISYVGISMPVFWFALLLVYLFSLKLNLLP
FT                   SMGMRTVGKDSVWDIVQHGILPCMVLAFQNVSVYMRYIRSSTIQQLEEEYVQIQYAYGA
FT                   SKKTVLFNHVLRNVLIPIITIFGLSIPSLVGGAFITETVFSWPGLGSLGVNAIFRFDYP
FT                   IIMAITLLSSFMLILGNLIADILYGVVDPRIRMRG"
FT   gene            904110..904961
FT                   /locus_tag="BMB171_C0789"
FT   CDS_pept        904110..904961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0789"
FT                   /product="oligopeptide transport system permease protein
FT                   oppC"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0789"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05606"
FT                   /protein_id="ADH05606.1"
FT                   /translation="MNNRRFQTIKHSFTKNKFVAMGVIILAILTVASIFAFVSPYDPSK
FT                   MSIPDRLQEPSMSHPFGTDDYGRDYLTRALYGGRVSLAVGFLAMVVSITIGTAVGTISG
FT                   YFGGKLDNFLMRVVEVLMSIPSFFLMLLLNAYLKPGITTLVLIIGLLTWMDTARIVRAE
FT                   TLSVKEREYVLYAKVSGQKSLMIIVRHIIPNILSTIIIAATLTIATSILMESSLSFLGL
FT                   GIREPDSSWGSMLNNAQGYIGEAWYLTLFPGFLILLTVLSFNVIGEALKKAFAPKGAGH
FT                   EN"
FT   gene            904988..905980
FT                   /locus_tag="BMB171_C0790"
FT   CDS_pept        904988..905980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0790"
FT                   /product="oligopeptide transport ATP-binding protein oppD"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0790"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05607"
FT                   /protein_id="ADH05607.1"
FT                   /translation="MSEKLLEVKNLKTSFFIESGEVEAVRGVTFRLNKGEVVGIVGESG
FT                   SGKSVMAKSVMSLVMSPGKVKEGEILFHNENILSKSEKELRSIRGNQISLISQDPMSAL
FT                   NPVVKIGKQMMEVIIRHQKVKKKEAEQIAINLLKQVGLSSPEERVKQYPHELSGGMKQR
FT                   VMIAMAMSCNPDLLIADEPTTALDVTIQAQILDLMKNLKNETNMALLLITHDLGIVAQN
FT                   CTRVIVMYGGLIMEEGPVLDIFQAPNHPYTKGLLNSLPKISNGVKERLAPIQGVTPNLL
FT                   NPPQGCPFAERCPHAMDICEKERPPYFEIGDGRRSMCWLNDRAVGDSHA"
FT   gene            905964..906944
FT                   /locus_tag="BMB171_C0791"
FT   CDS_pept        905964..906944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0791"
FT                   /product="oligopeptide transport ATP-binding protein oppF"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0791"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05608"
FT                   /protein_id="ADH05608.1"
FT                   /translation="MIPMHEENLIEVRNLKKYFPIKKGLFGRKTEQLKAVDDLSFTIKK
FT                   GETFGLVGESGCGKSTTGRSIIRLHDVTSGNVLFDGKDIASLKESELKEYRKRMQIIFQ
FT                   DPYASLNPAMNVFQIISEPMNIHGSYEKEEQKEIILDLLKKVGLKEEHLYRYPHEFSGG
FT                   QRQRISIARALSVKPDFILCDEPISALDVSVQAQVVNMLQDIQAETGVTYLFIAHDLSM
FT                   VRHISDRIGVMYLGNIVEIADSEDLYTKPAHPYTQALLSSMPEPDPTNIGKERIILEGE
FT                   VPSPLNSPSGCKFRTRCKFATEKCAQEVPKMVEIAKGHQVACHLF"
FT   gene            907552..908172
FT                   /locus_tag="BMB171_C0792"
FT   CDS_pept        907552..908172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0792"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0792"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05609"
FT                   /protein_id="ADH05609.1"
FT                   /translation="METKQDNLIYVWDAYCGWCYGFSESIKGFYKNHTEVPLTVLCGGL
FT                   FLDNLPMKNFSYIEEGNKRINQLTGAEFGPSYQKLVEEGTFKMNSKDAAIGFSALRSLA
FT                   PDRLLEFTSAMQKAFYYEGQSLSDPETYRKIAIEHGLDPEQVLERLNAQETIIDVQNDF
FT                   NKVRQLGVNSYPSLLLQKDNQIIPIGGGVMTPDKIEARFKNLY"
FT   gene            908499..909320
FT                   /locus_tag="BMB171_C0793"
FT   CDS_pept        908499..909320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0793"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0793"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05610"
FT                   /protein_id="ADH05610.1"
FT                   /translation="MFKTIDTNQQDVKLTVFSSDEKSFMVTATLVEKAGHAFLINSKFT
FT                   QSDSKEIVEYLKKNNLSLDKIFIIHGDPDYYFGLESIKAVYPEAIAYATESTVEHIVHS
FT                   VLGKLKVWKDALGENAPSNVVLPQVFKEKAIDFQGLTFELVGLDHYRTSLFNKELKVLI
FT                   GGIDVFNEIHVFLADTSSKAAMEAWIENLKVLQALHADIIVPSHGSIEKSLNNQALTAT
FT                   MDYLRTAVQASEESGTSKDFVTKLEAAYPDYANKGVLELSAKVVTKEMPWG"
FT   gene            909325..909717
FT                   /locus_tag="BMB171_C0794"
FT   CDS_pept        909325..909717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0794"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0794"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05611"
FT                   /protein_id="ADH05611.1"
FT                   /translation="MNKYQKLLHETYVLTGEGKLDAFKTYLSKNVSWTEAAGFPYAGTY
FT                   IGPDEVVKNVHERLGTEWDDYSAKDEIYAFNNNTVIVYGKYSGTYKATGKSFIADFCHL
FT                   YKFDENDKVKKFIQIVDSATVNEVLS"
FT   gene            909869..910393
FT                   /locus_tag="BMB171_C0795"
FT   CDS_pept        909869..910393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0795"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0795"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05612"
FT                   /protein_id="ADH05612.1"
FT                   /translation="MKLEKSLIITIISVFILGVVSTLVYQASADNNKGNSIKSENVASA
FT                   SKEVKENEKNKKMVVDFYNEVFNKHNIDIIPKYVSEDYKQHNPFVADGRKAFMDFFKED
FT                   FVKNPNSSAEIKRVVAEGDTVALHVHSRTNSQDKGVAIVDIFRIKDGKIVEHWDVIQEI
FT                   PSEAANDNTMF"
FT   gene            complement(911594..913024)
FT                   /locus_tag="BMB171_C0796"
FT   CDS_pept        complement(911594..913024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0796"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0796"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05613"
FT                   /protein_id="ADH05613.1"
FT                   /translation="MSISVSDELQLFAQEVQSFLSPNILRNLARDVGFVQRTSKYQAKD
FT                   LVALCVWMSQNVAKTSLTQLCSCLEASTEVLISPEGLNQRFNATAVQFLQQLLAELLNQ
FT                   KLSSTKLISSPYTSIFKRIRILDSTAFQLPDVFSSVYPGAGGCSHTAGVKIQLEYDLLS
FT                   GQFLHIHTGSGKQHDRTYGSLCAPTVAANDLCIRDLGYFHLKDLQYIQDKKAYYISRIK
FT                   SNTRIYQKNSTPDYFQDGRIKKGTEYIQIDMEVLMNSLQPGQTCEIFDAFVGMTDKVPT
FT                   RVIVHRLTKEQQQKRLQDQTVREKKKGMKYSPRSKRLSGINVYMTNTPTDIVPMGQVHD
FT                   WYSLRWQIEILFKTWKSFFHIHHCKKIKRERLECHLYGQLIAILLCSSIMFQMRKLLLT
FT                   KKKQELSEYKAIYMIKDYFSLLFRSIQKDTQELSKILLRLFNLLQRNGRKSHRYEKKTV
FT                   FDILGVVYNCTLSANLAA"
FT   gene            913253..913450
FT                   /locus_tag="BMB171_C0797"
FT   CDS_pept        913253..913450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0797"
FT                   /product="PbsX family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0797"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05614"
FT                   /protein_id="ADH05614.1"
FT                   /translation="MSVSKIKIARTEKGLTQQELAVLVNVTRQTIGLIELNKYNPSLKL
FT                   CIDIAKSLDKTLDELFWEEK"
FT   gene            913452..913925
FT                   /locus_tag="BMB171_C0798"
FT   CDS_pept        913452..913925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0798"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05615"
FT                   /protein_id="ADH05615.1"
FT                   /translation="MEKLKNLFSLSTHSDERIQQIEMKIWAQSGIVVLLLAFIDLIIRG
FT                   VYLQRPFLEWATALGIIICYMVFFFIRSILAGVYEPEIDNKEKLKQKLKDKLSYTLILS
FT                   FSGVAYTTYHNQLPQDIVGWILVCIKFILLVTILFGIQYFITILAWNKSNKIQ"
FT   gene            914154..914300
FT                   /locus_tag="BMB171_C0799"
FT   CDS_pept        914154..914300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0799"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0799"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05616"
FT                   /protein_id="ADH05616.1"
FT                   /translation="MCDYIGCFYPEGYINPEYTFVFNHEDIEGIIFVGFIDEEEEAFVG
FT                   LLN"
FT   gene            914696..914992
FT                   /locus_tag="BMB171_C0800"
FT   CDS_pept        914696..914992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0800"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05617"
FT                   /protein_id="ADH05617.1"
FT                   /translation="MAGQIRMSPEELKSKAAQYGQGANQIEDILSQLQNLQNELRGEWE
FT                   GRAFEGFDQQFNQLKPKVQNFAQLLQEINMQLNKTAEAVASHDEELSRNFGLK"
FT   gene            915338..915454
FT                   /locus_tag="BMB171_C0801"
FT   CDS_pept        915338..915454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0801"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0801"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05618"
FT                   /protein_id="ADH05618.1"
FT                   /translation="MLDFTKQFSTAFQQAVDNIHSVAQEFERMDNELHNTFR"
FT   gene            915496..915858
FT                   /locus_tag="BMB171_C0802"
FT   CDS_pept        915496..915858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0802"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05619"
FT                   /protein_id="ADH05619.1"
FT                   /translation="MSQDIEKQINQVNQKLRSVFEEQDRNQSAIHIQEQAEADFYEWRG
FT                   RNHRLFDRILGTWYGDREMSQFFMNTYQEAQHIERKVTFELENQKETLLKERRNLNDLE
FT                   NDLSYQQQQLAREVNA"
FT   gene            915855..917492
FT                   /locus_tag="BMB171_C0803"
FT   CDS_pept        915855..917492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0803"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0803"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05620"
FT                   /protein_id="ADH05620.1"
FT                   /translation="MSLNMYLGEVQGQTQSMNAVCNATIQGMEQVIQSIDAFAIDTVLQ
FT                   GQTYSSAKSFFVQTFRPLAQGIIYLCEELIRQNDAFPSQFQSQVASTDVIEQEILEQIR
FT                   EIDRMKASMEAISQAMPIPGMDAMANLFTVMRKKLQEKLDHLYQFNQTASNNYSTALQL
FT                   AASIAAGLAEVQSGKGFSPASGTFSTQGWNMEWTTSIQAITEERARQAANLIEEGEMCG
FT                   KLPEKSTGEKIWDGIVEGTGQAVSDTIDGIKALGDWETWENMGNAALHPIDTLSTMYNT
FT                   LSDSFINDVINGDAESRAKWGSYALTQVGLGLIGDKGLSKASKLGQAGKVTKLAKNKIP
FT                   QAVSHITSNLQMGDRFAFAGGNSLRFRFDTPDFKKAEEKLSTYQFARGESNSGGSNFVN
FT                   ENHRSSLSNREIISNLQHTEKFRPNTLKHILEGEINWRGDAMGYHTEVLENTPGKIISG
FT                   TEEILNDQGIYKARVEVNGTPKTGNRGFSTFFPKDWSPQKIVDNINEAYNNRTYEFGNT
FT                   YSGIGSEGIRISMYIDGNGKIISAFPAE"
FT   gene            917526..917879
FT                   /locus_tag="BMB171_C0804"
FT   CDS_pept        917526..917879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0804"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0804"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05621"
FT                   /protein_id="ADH05621.1"
FT                   /translation="MKYPYSFEVLTNGKLVMRLPQEIKLMETFLGVEVSAFGDWILEEI
FT                   HSVLNGKENYVVVNGNICGLEIRKDTTTVLDNLAEDGKGDFCEIETIELVDLIHIWQDK
FT                   QKEFKKGKNKELK"
FT   gene            complement(917975..918478)
FT                   /locus_tag="BMB171_C0805"
FT   CDS_pept        complement(917975..918478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05622"
FT                   /protein_id="ADH05622.1"
FT                   /translation="MVLIPFYLASNHLNCCLSLANHISSGNSSDLIIKPAFLKSGYCVP
FT                   NFIGTSGIKPFSIATCLIIAFWGAVNFSPPLIYLHFHGLLEFTTAALYSNSKSRYFPST
FT                   ASSKIFIYSSTSYKFSIKSDTIAISSCKRILNPLNGSHQNSCELSLHPSSYLNTFRFFC
FT                   NDYC"
FT   gene            918574..919044
FT                   /locus_tag="BMB171_C0806"
FT   CDS_pept        918574..919044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0806"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05623"
FT                   /protein_id="ADH05623.1"
FT                   /translation="MKIKNGSELQSPNDELIESFEEYCEIKLPNDFIDFLKKYNGSIPI
FT                   TNVFSHEKNELLIERFLCLLEDPEDDDENGWYDIEVVLSDIDTRLTDDEDLTGINIIPF
FT                   AVLFAGDFLCLDFREKEIPSVVVWYHEESEELNPVTSEVADNFSEFLSMLKE"
FT   gene            919600..919713
FT                   /locus_tag="BMB171_C0807"
FT   CDS_pept        919600..919713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0807"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0807"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05624"
FT                   /protein_id="ADH05624.1"
FT                   /translation="MCVYSMLSFMLFHFIMELHRYYYLRKHIEDGGKDSDK"
FT   gene            920419..920616
FT                   /locus_tag="BMB171_C0808"
FT   CDS_pept        920419..920616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0808"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0808"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05625"
FT                   /protein_id="ADH05625.1"
FT                   /translation="MTRELTYEVKGQKIIIQDHSEGHKFGEGGIGDQPPHHNIRPEYNT
FT                   RTGQVDGMEDHYYFEKRNNK"
FT   gene            920628..921020
FT                   /locus_tag="BMB171_C0809"
FT   CDS_pept        920628..921020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0809"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0809"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05626"
FT                   /protein_id="ADH05626.1"
FT                   /translation="MIDQFKFLNPQALISIFGKIPKLKESELLDVRLKRDGPTLVIQLM
FT                   TKENVENKPKRWNKWDVIYVEISFFTIHNLTIKGLGTENIIDYFEINTIEEEGLLKIKC
FT                   KNQMLVECSFEWAKVEGVTPGLIGLP"
FT   gene            921528..922199
FT                   /locus_tag="BMB171_C0810"
FT   CDS_pept        921528..922199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0810"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05627"
FT                   /protein_id="ADH05627.1"
FT                   /translation="MKKSIDFNKKAFAHYMALYPVNEIRVQVIVLVLLGADVFVLLPAF
FT                   ANPFQLLYVYIVTPPVIFLNLWAIWIAINPRKRQLQYTLFRGVYGTICSVGLLVITQKY
FT                   AYEVLQLQTPIYCILSFGLYSFALYHFYKNHIEKLQEPRKKSKSSKGTGGVKVAAIAAG
FT                   LGQLIANIILSIATQQMGVIVFMCACTVFSFALFYMIIELHKYYYLRKHIEDGGKIRIG
FT                   F"
FT   gene            922200..922355
FT                   /locus_tag="BMB171_C0811"
FT   CDS_pept        922200..922355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0811"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0811"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05628"
FT                   /protein_id="ADH05628.1"
FT                   /translation="MEKKSSFSNGDELSTKAIAGKLDVNIPYDWKSLKEDVFVSKVIGV
FT                   KGAAGI"
FT   gene            922542..922730
FT                   /locus_tag="BMB171_C0812"
FT   CDS_pept        922542..922730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0812"
FT                   /product="Hypothetical Cytosolic Protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0812"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05629"
FT                   /protein_id="ADH05629.1"
FT                   /translation="MLHFSEYFPIIGDKDLKIKGDLGLGAIGLKGSFGKETGITVLALE
FT                   GFTVGSSLKFEKAEEKK"
FT   gene            923261..923698
FT                   /locus_tag="BMB171_C0813"
FT   CDS_pept        923261..923698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0813"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0813"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05630"
FT                   /protein_id="ADH05630.1"
FT                   /translation="MVKILLGVEGVMIVKIFENTILFVLCLVILSGCFTREGTIVGGKV
FT                   HGSSDSVSGSISGDYRKFTGSATQDRKVKKGENWIFSFDDKTKQGTIIAYVVDSNDNTI
FT                   LEFNSGEGEKNIKVPKDDTYKVKIKTEEHGGEFRISWKKEK"
FT   gene            924194..924385
FT                   /locus_tag="BMB171_C0814"
FT   CDS_pept        924194..924385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0814"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0814"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05631"
FT                   /protein_id="ADH05631.1"
FT                   /translation="MQAFKVGKLVTFVAIIILLVVAILSPYNLFKKIYFIIGVLIIGAI
FT                   SLGANKFFELIHSKFNKK"
FT   gene            924575..924931
FT                   /locus_tag="BMB171_C0815"
FT   CDS_pept        924575..924931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0815"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0815"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05632"
FT                   /protein_id="ADH05632.1"
FT                   /translation="MKHGGKDAGIEPPPYSNAAHHLTPWNDKRAIEAQELLKEFGIHHD
FT                   SAANGVFLPYKVNEYVTTEVLHIGNHGTDYMKEVTKVLKEVKEYGGTQADAVAALHDIR
FT                   IRLLDGSLKLNSPK"
FT   gene            complement(925542..925997)
FT                   /locus_tag="BMB171_C0816"
FT   CDS_pept        complement(925542..925997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0816"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0816"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05633"
FT                   /protein_id="ADH05633.1"
FT                   /translation="MSQWLSNDKIADHDFGGCILKFLLGMSIIFILILYPIYWLFFQEN
FT                   EKPLVKNTSSNQANQIEITGISYGHLSDDKYIKMYFKEKNKLVEKTKVRVANFNIINSS
FT                   DLYEISWKDNTKVVIVMKFEYETKTLEYDFETGTIGGYINSTNNNLL"
FT   gene            complement(926577..927899)
FT                   /locus_tag="BMB171_C0817"
FT   CDS_pept        complement(926577..927899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0817"
FT                   /product="citrate-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0817"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05634"
FT                   /protein_id="ADH05634.1"
FT                   /translation="MAQAKSNRVAGNIFKGSVGNLIEWYDWYVYSAFAVYFSAEFFPKG
FT                   DPTSQLLNTAAIFAVGFLMRPIGSLLMGRYADRHGRRAALTLSITVMAGGSLIIACTPS
FT                   YESIGIMAPIILVLARLLQGLSLGGEYGTSATYLSEMASSGRRGFYSSFQYVTLVAGQM
FT                   VALGVQIVLQQLLSEPDMKAWGWRIPFIIGAMGAVAVLWLRRTMDESEQFSNIKSQKRE
FT                   SAGTISALMKHPKAVLTVVGLTLGGTVAFYTYTTYLQKFMVNTVGLPKEVVSWINFVAL
FT                   LIFVVLQPIAGLLSDKIGRRPLLMAFGILGTLLTAPIFFFMEKTTEPIVAFLLMMVGLI
FT                   IVTGYTSINAIVKAELFPTEIRALGVGLPYALTVAIFGGTAEFIALWLKSIGMESLFYF
FT                   YVAGCIAISFITYWRMDESSKTSQIEAELGGGDKLVNNKSS"
FT   gene            928125..929714
FT                   /locus_tag="BMB171_C0818"
FT   CDS_pept        928125..929714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0818"
FT                   /product="two-component sensor kinase citS"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0818"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05635"
FT                   /protein_id="ADH05635.1"
FT                   /translation="MKKSRKVSLQTKIVSLIITLILFVVLLLAGIFVYIQSVDTKHQVE
FT                   QLALQTAKSLSFMPAIKEAFQNNEHKSTIQSIAEQVREQAGADYVIVEDRYGVMYSHSN
FT                   SELIGTKSNNPYNYEALTFGGYYTLEGNGVSGPALMAKAPIIVQNGDYDQVVGVVTVEF
FT                   LIKGIESNILSRTKEIILFSVAVLLAGIVGGILLARSIRKDTLGLEPNEIAALYRERSA
FT                   ILLSIKEGIIAIDQNGFITMMNTSAEEMLHVNDDYMQQHISKVLPNFNMERVLETDQEI
FT                   AFQDKVFILNMTPILENNNTVGVVCSFRDKTELQNLVNTISEVRKYSEDLRAQTHEFTN
FT                   KLFVLSGLLQLGHYKEAIEFIQQESNIHQSQNHILFHQIHDAKVQAILLGKIGTASEKK
FT                   IDFHIEGDSALHPLPDHIKVSHLITILGNIIDNAFDAVSEREEKSVSFFVTDIGHDIVF
FT                   EVIDSGIGIPTEKITTIFQKGFSTKGNNRGYGLANVKEMVGLLEGTIEIQNEKNGGAIF
FT                   TIYLPKTLKEST"
FT   gene            929734..930411
FT                   /locus_tag="BMB171_C0819"
FT   CDS_pept        929734..930411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0819"
FT                   /product="two-component response regulator citT"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0819"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05636"
FT                   /protein_id="ADH05636.1"
FT                   /translation="MLKVAIAEDDFRVAQIQEEFLLKIKDVKVIGKALNAKETMELLQK
FT                   EEIDLLLLDNYLPDGIGTDLLPQIHADFPNVDVIMVTAANENYMLEKAIRNGVSNYLIK
FT                   PVTLEKFVRTIEDYKRKKQLLHSNNEINQALIDHFFGTSQTQDIKNLPTGVDPLTLQKV
FT                   KGIIKGFEEGITIEEMGEQMGASRTTARRYLEYLVATNECTVEYTYGIIGRPERKYRIG
FT                   RGL"
FT   gene            930408..931388
FT                   /locus_tag="BMB171_C0820"
FT   CDS_pept        930408..931388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0820"
FT                   /product="tricarboxylate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0820"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05637"
FT                   /protein_id="ADH05637.1"
FT                   /translation="MKKRLLLCIWIMTGVIAGCSSEKSHTNKVNIDKVEIVAPNVQGAG
FT                   WDLTARAMQKTLAEEKIFTKPITVTNKVGGSGDVGWKYTKQKGGHVLAINSSLLITNNL
FT                   LGHSKLTYKDFTPLATLASDWEVVVVSKDSTIDNANELMEQLKQDKKNFKIGVAPGLGN
FT                   DDHLSFVQVSKAFGINPVELQFFAYENKEKIINALTNKQINAATMTLSEAEKQYKASKI
FT                   KILAVSVSKRLDRLPEIPTWKEQGINVIFQHWKGIMGPKDMTEEEVAYWDDVIKRMVES
FT                   DSWKGILRERGWESFYKGSGETRGFLEEKVRDMRGEGGLKNVGDT"
FT   gene            931647..933455
FT                   /locus_tag="BMB171_C0821"
FT   CDS_pept        931647..933455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0821"
FT                   /product="Type II restriction-modification system
FT                   methylation subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0821"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05638"
FT                   /protein_id="ADH05638.1"
FT                   /translation="MYVLERYECKVKNNIDENLEKKYKIIDLFAGAGGLSNGFEQTGRF
FT                   EIVGAVEINKEAVETYICNHQNNKEIIIKPKNSEISDISSIDFNEFIMQKGIDPSETVV
FT                   IGGPPCQGFSNANRQKNYLISGNNQLVKEYARAIDTVRPVAFLMENVKTMSSPTHKFFV
FT                   TEYVEDSICMYSSEQHLSDISGDEEPFWQEDELILLETDKVEYENLLNQILNVTCVQPF
FT                   ITSEMELSRIRSVVRKLKKKKLYNPIGPKEKKELKEIQKIIKSLSEYKFGELEDEEHLV
FT                   NIVNETVESFKKLTQGNNKSNEETLASLQGFVEINQLLRYLRELEEERIVKLGDPLVLV
FT                   DQTLKVIVKVKSYNIVVYLEKFFKHLGYKVEKGTVHSNDYFVPQKRQRFMILGIKSSAT
FT                   QYKEIKFPERYTEIDFTVRDAIADLEGITPAKSTESHKIDYNIELNKTVMQHYYRSGMN
FT                   HNVIYNHINTDSEPLSQQRFEEIKRTDGKNFHSLSSELKDVSYADASRTQNTVYLRLNY
FT                   DTPSPTVINVRKSMWQHPTKAMALSIREAARLQSFKDNYIFKGSKDRQYQQIGNAVPPL
FT                   MARAIAEKMLHYLGEEPNQYLKDDFE"
FT   gene            933548..935032
FT                   /locus_tag="BMB171_C0822"
FT   CDS_pept        933548..935032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0822"
FT                   /product="Type II restriction-modification system
FT                   methylation subunit"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0822"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05639"
FT                   /protein_id="ADH05639.1"
FT                   /translation="MDTIYTEPSATPVIQALRSIGYNARTAIADIVDNSIDAKATYVHL
FT                   EFEYDMGNGYIRIEDNGIGMTDEELQKAMTIGSKDPRDKRGKEELGRFGMGLKTASFSL
FT                   GKRLCIITKKDGIVSERCWDLDYVSDENEWLLFKSIPAEVKDKVGHIKEENGTVIFIDR
FT                   LDRFCGFGTHKILKKESYYSKIKRIHKYLEMVFHIKLEQGLLITINGNSLYPWNPFLEG
FT                   NQRRIEGEEQVIRVNKKLVKITPYVLPHPSTFNQVDYKYAGGVKGWRDQQGFYIYRENR
FT                   LVSFGDWFGMFSKEVPSELVRIKVEFSNEADDDWKIDVKKSVVSIPDEAKEDLMAIAKY
FT                   YRQLSKEIMLYRTKATRTGEKIKGTLNTWELASDDVNSVYILNRTHPVLTDILKTVNDD
FT                   VRRKLNVYLKLIELGSPNNLLKTANMVKKEVQQIDEKSKKLIIDYAEILFSTGIQLDAE
FT                   KVAETISMMAGFEGIEIYTIRTIIEKEVDIDVSSNT"
FT   gene            935013..937706
FT                   /locus_tag="BMB171_C0823"
FT   CDS_pept        935013..937706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0823"
FT                   /product="endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0823"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05640"
FT                   /protein_id="ADH05640.1"
FT                   /translation="MYQVIRDEYLGIVENLYIAFKNTGIDRPLELAMETARKKIIKSYM
FT                   GLDADMLESISLEVYSKYASINVQKASVMRSKDNHPWFKEAHPNYSYFWPRYERYLKEI
FT                   KEWSQDTVETIDSTTNDILKSLGNPKGKEDFDKRGLVLGYVQSGKTANFTGLINKAFDV
FT                   GYKLVIVLAGMHNDLRSQTQLRLEREVVGTVDTITGEKKGVAVIRNDGTQIETWTTVQD
FT                   DISTNNAIGIKNLDKPILLVVKKQKDVLPKLIELLQRSINHSGMKPPVLIVDDEADQAS
FT                   VDASGNKVDDPSKINQLIRQLLSLFNKKSYVGYTATPFANLLIKADADHAEVGKDLYPK
FT                   DFAIGLPKPEAYCGPAEYFNTTGYTDDNKPMFIRHLSLDDISILDKLRTKEDAGFFTEV
FT                   PKSMQESMLAFLLSTAIRNLRGQRGNHNSMLIHTSRLTDVQNSMCGVIKDFYKKLSNDL
FT                   IYNSKSEYINKIKYLYENDFLEIQNNFECYNEFQVFTWGEIYKEIKDVARKIEVMEING
FT                   ESEEVLEYDKYKENGLYVIAIGGNKLSRGLTLEGLTISYYYRGSSMYDTLMQMGRWFGF
FT                   RNGYMDLCRIYTSNEIAKNFEYLARVMRELREEFEKLAKDGATPEEYAIKMLKHKTMKV
FT                   TSPAKMGTAESLIDYTGTMQQTRSFEKNKEFYMNNMEATFQFINNIEQDFKIYRKDTKY
FT                   HIAKDVPSQFIISFLKNYKTISSARIVNSKKIADYIGKMNKEKLLEKFNVAVVDVTEAT
FT                   LRSQKTIDYGITPWKVNLGKISIESAVIRSVNYAKSKGIGTVDLGAIVAANQEFIDIEH
FT                   KTIDKKKNRKLRENENPLILIYPLHPQVKSFKTLNIDFNENLVPIGLAFSFPDVVSVTG
FT                   IKSGERVGEKGDYIYNNTIGKGASND"
FT   gene            937699..938709
FT                   /locus_tag="BMB171_C0824"
FT   CDS_pept        937699..938709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0824"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0824"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05641"
FT                   /protein_id="ADH05641.1"
FT                   /translation="MINISERFKLLIEQLKNEESDDVYRLEPIYFQKPFILIGIDLLNL
FT                   QRRIYVDITNENWDEEQLQSFPKWRGIDIGQEYFSQIGPLKEKNFLVISQIVEEGEEIF
FT                   ERVLQNLVDHILIEEELPLYTVVYEVLDRWHNFFKRKWDSKLTLEEEMGLFGELYYINK
FT                   WLENFPQEPPLIIKDWKGPLKNRIDFVSKNSGVEIKTVAPRIRDEIKISNEKQLELNPV
FT                   TDRLFLYVLKVEVNESVGKSLQNIIEAIEKQLIERAPSLAVKFNDLLLEVGVMSEDYDE
FT                   NYFFVHEELAYNANASFPKLTSENLPIGITNVSYSIDLSHCNNFKVSLEDVFNLK"
FT   gene            938722..940569
FT                   /locus_tag="BMB171_C0825"
FT   CDS_pept        938722..940569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0825"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0825"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05642"
FT                   /protein_id="ADH05642.1"
FT                   /translation="MNETKRKLDFFYEFIDTIEQKGRVLGSRHNPFLQEMLPFINIEDE
FT                   PAIMYFSKKESKIQLNGYLYQEDINTLNLYVVEYEPFFEESELPIANMTFLKEYANKAK
FT                   RFYTSAEQILQLADRSMEYYDVTKMIVDKKGEIEEINIYVITSKFYLSNKPIDLTIPNI
FT                   ETVNVHVWDMDRVFKLSEAEQGIREFDIHFESEYGSALQMMHIPNENENGLIDCYIGVI
FT                   PAKLLAELYDEWGPKLVERNVRSFLQARGGTNKGIRDTLKDARQRELFIAYNNGISSVA
FT                   KAGDIERIGDSNLFSIKTLTSWQIVNGGQTTASIHQAYKNDIDLEGVYVQTKLTIINVP
FT                   QEIENNDVQMDRHVFEDEMISKISEYANTQNKINKSDLLANTRFMSDIEKFSRNIWIPT
FT                   QDNRKEESKWYFERARGQYMVDIGRRSKGKEQTAFKKMYPKENVITKVEMAKYFMSWEG
FT                   FPYVSSKGGEEAFKRFMDLNSLYWKQSSITNDEGEVIKSILSIDNEYYKKLIARKVINA
FT                   FVTEIVESMKLKGYRANVIYYTVAMLNYLYGKEIDLIEVWQHQALSNKWEDVVRTIANN
FT                   ALNYLRESAGDQNVTQWAKKEDCWKGFIKESAVVLSSLI"
FT   gene            940739..941569
FT                   /locus_tag="BMB171_C0826"
FT   CDS_pept        940739..941569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0826"
FT                   /product="HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0826"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05643"
FT                   /protein_id="ADH05643.1"
FT                   /translation="MDTRRGLSDINALEILGGYEKSEIINRIQFFYLVNNEKVVVKYSK
FT                   ISNDGKKYWFGITPNAIKLYKSEKISHIIFILGYEGIVKLPIEILYKYIKEANVTRKES
FT                   GEIKRHHININFSNDLCLYNSVDSFILDDYYFYNEEIVESELDEKKRDIILEEAKNFID
FT                   YKEQYVKIGDKAKRRKESSAQKKRIAILEDHTCQVCGFKEEYIKANNKKGWIIEVDHII
FT                   EKSKGGGESFDNLWVLCPNCHAKKTRGVIIIDPIEKIVREKGKVITIQDNHLDW"
FT   gene            943355..944362
FT                   /locus_tag="BMB171_C0827"
FT   CDS_pept        943355..944362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0827"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0827"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05644"
FT                   /protein_id="ADH05644.1"
FT                   /translation="MPRKYVRFNYFEVQLVPAPVVLRDELNEGYQEIELLGEEEHAASW
FT                   DMSGFLDYLMTHLDFNTNVAVGDEYAEIEIDSYTFDEVRNIYGFQLSKLRDKNIPSKKR
FT                   FGEIKEEILLDQDQFIGEFVSVLFDQSYGSIALQSNLYGLSAKQTENVLTQLRFRYLDQ
FT                   IGQTEEVPLVVRLAPIIDRSKIERVIRADYFKKIRVKGSNVMLDANLGEDSLLSDARRL
FT                   LNEVAGINIDITISLGRAERTASLDDDSIRQLIDAYNELPEDQRPQIEITALENEEAEI
FT                   ETINLLEPRMTDRISIVVEARTTVGHEFLFNTFLETYDTRRPDIRRVLVPLDLE"
FT   gene            944368..944859
FT                   /locus_tag="BMB171_C0828"
FT   CDS_pept        944368..944859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0828"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05645"
FT                   /protein_id="ADH05645.1"
FT                   /translation="MAEKLYDRLEIIWEKHSFAISFIICVFVGILYFNGLVTNIRMVTG
FT                   NVVMFASMVVAVNGVFLTLIITLQESPAFIRLKGIFPDFQKKLYLSLRDQIHFGILVVA
FT                   MSILINILPPSPNKYLSSIGVGVWFFFFILMGLGSFFSVKLVTDIIVKNFKTPTRSRRQ
FT                   "
FT   gene            945619..947385
FT                   /locus_tag="BMB171_C0829"
FT   CDS_pept        945619..947385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0829"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0829"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05646"
FT                   /protein_id="ADH05646.1"
FT                   /translation="MSKVLLLEAILDDFADQLDMTKSSERDSVFELFVAEQLLKDKDLD
FT                   SDELENGIIGGSFDNGIDGMFIFANDELIQSIEQVSNFKSIKNIEVHFHQYKNNERISE
FT                   DVVHKFNTATSNILNLSQELSPTSWNIDLIEKVKLLRNLTIRSAVAHPEYKFIYRHISK
FT                   GNRDNIYNEDRPNESYLDKVATLKNTVEKSDYSNVLFVFDYIGVNELISLNRNEKQFSI
FT                   ALKLNENPIALDFSDDGKRGYIASVNIKDYFKFITEESGELRKYLFDSNIRDYQNNTEV
FT                   NTQISGTIKNDKDLDFWWLNNGVTIIADKGSLTGKTLHLDNVQIVNGLQTSHSIYYSYN
FT                   KEVDDENRSLLLKIIITDDKVTADKIIKSTNSQNKVPTSLLRATDRVQRDIEEYFLTKD
FT                   YYYDRRKNYYKNLKKPTKKIISINFLAQCLTSLLIQEKNPSKARSNPTVLTKKDEDYAK
FT                   LFPENRHLDTYLKSIIVVKNVEIHLKQLLNGDELAEQIKKYFLFHVSRVSMSVLFQQPN
FT                   YGEEQFRNVNLDLVNEDLVAKSVEWLKRIISKYLEETEYKDVVNISKQSEFSQYITDKL
FT                   IELIAEARQVSV"
FT   gene            948392..949252
FT                   /locus_tag="BMB171_C0830"
FT   CDS_pept        948392..949252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BMB171_C0830"
FT                   /product="Phage replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:BMB171_C0830"
FT                   /db_xref="EnsemblGenomes-Tr:ADH05647"
FT                   /protein_id="ADH05647.1"
FT                   /translation="MAVYRTVQVNFWQDDFVLDLTPEERYFYVYLLTCSKTTQCGIFPF
FT                   PKRLAEMETGYNRETVDKLVQRFVDYGKILYDADTRELFVLNWLRYNPVTNTNVEKCVL
FT                   RELKGVKNKEFVHMFLQKCVEEELN