(data stored in SCRATCH3701 zone)

EMBL: CP001905

ID   CP001905; SV 1; circular; genomic DNA; STD; PRO; 2744800 BP.
XX
AC   CP001905; ACIU01000000-ACIU01000011;
XX
PR   Project:PRJNA30759;
XX
DT   19-FEB-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Thioalkalivibrio sp. K90mix, complete genome.
XX
KW   .
XX
OS   Thioalkalivibrio sp. K90mix
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Chromatiales;
OC   Ectothiorhodospiraceae; Thioalkalivibrio; unclassified Thioalkalivibrio.
XX
RN   [1]
RP   1-2744800
RX   DOI; 10.4056/sigs.2315092.
RX   PUBMED; 22675584.
RA   Muyzer G., Sorokin D.Y., Mavromatis K., Lapidus A., Foster B., Sun H.,
RA   Ivanova N., Pati A., D'haeseleer P., Woyke T., Kyrpides N.C.;
RT   "Complete genome sequence of Thioalkalivibrio sp. K90mix";
RL   Stand Genomic Sci 5(3):341-355(2011).
XX
RN   [2]
RP   1-2744800
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Foster B., Sun H., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ivanova N., Sorokin D.Y., Muyzer G., Woyke T.;
RT   ;
RL   Submitted (03-FEB-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 1fd36b196346d590d4377ead243a651c.
DR   BioSample; SAMN02598475.
DR   EnsemblGenomes-Gn; EBG00001153673.
DR   EnsemblGenomes-Gn; EBG00001153674.
DR   EnsemblGenomes-Gn; EBG00001153675.
DR   EnsemblGenomes-Gn; EBG00001153676.
DR   EnsemblGenomes-Gn; EBG00001153677.
DR   EnsemblGenomes-Gn; EBG00001153678.
DR   EnsemblGenomes-Gn; EBG00001153679.
DR   EnsemblGenomes-Gn; EBG00001153680.
DR   EnsemblGenomes-Gn; EBG00001153681.
DR   EnsemblGenomes-Gn; EBG00001153682.
DR   EnsemblGenomes-Gn; EBG00001153683.
DR   EnsemblGenomes-Gn; EBG00001153684.
DR   EnsemblGenomes-Gn; EBG00001153685.
DR   EnsemblGenomes-Gn; EBG00001153686.
DR   EnsemblGenomes-Gn; EBG00001153687.
DR   EnsemblGenomes-Gn; EBG00001153688.
DR   EnsemblGenomes-Gn; EBG00001153689.
DR   EnsemblGenomes-Gn; EBG00001153690.
DR   EnsemblGenomes-Gn; EBG00001153691.
DR   EnsemblGenomes-Gn; EBG00001153692.
DR   EnsemblGenomes-Gn; EBG00001153693.
DR   EnsemblGenomes-Gn; EBG00001153694.
DR   EnsemblGenomes-Gn; EBG00001153695.
DR   EnsemblGenomes-Gn; EBG00001153696.
DR   EnsemblGenomes-Gn; EBG00001153697.
DR   EnsemblGenomes-Gn; EBG00001153698.
DR   EnsemblGenomes-Gn; EBG00001153699.
DR   EnsemblGenomes-Gn; EBG00001153700.
DR   EnsemblGenomes-Gn; EBG00001153701.
DR   EnsemblGenomes-Gn; EBG00001153702.
DR   EnsemblGenomes-Gn; EBG00001153703.
DR   EnsemblGenomes-Gn; EBG00001153704.
DR   EnsemblGenomes-Gn; EBG00001153705.
DR   EnsemblGenomes-Gn; EBG00001153706.
DR   EnsemblGenomes-Gn; EBG00001153707.
DR   EnsemblGenomes-Gn; EBG00001153708.
DR   EnsemblGenomes-Gn; EBG00001153709.
DR   EnsemblGenomes-Gn; EBG00001153710.
DR   EnsemblGenomes-Gn; EBG00001153711.
DR   EnsemblGenomes-Gn; EBG00001153712.
DR   EnsemblGenomes-Gn; EBG00001153713.
DR   EnsemblGenomes-Gn; EBG00001153714.
DR   EnsemblGenomes-Gn; EBG00001153715.
DR   EnsemblGenomes-Gn; EBG00001153716.
DR   EnsemblGenomes-Gn; EBG00001153717.
DR   EnsemblGenomes-Gn; EBG00001153718.
DR   EnsemblGenomes-Gn; EBG00001153719.
DR   EnsemblGenomes-Gn; EBG00001153720.
DR   EnsemblGenomes-Gn; EBG00001153721.
DR   EnsemblGenomes-Gn; EBG00001153722.
DR   EnsemblGenomes-Gn; EBG00001153723.
DR   EnsemblGenomes-Gn; EBG00001153724.
DR   EnsemblGenomes-Gn; EBG00001153725.
DR   EnsemblGenomes-Gn; EBG00001153726.
DR   EnsemblGenomes-Gn; EBG00001153727.
DR   EnsemblGenomes-Gn; EBG00001153728.
DR   EnsemblGenomes-Gn; EBG00001153729.
DR   EnsemblGenomes-Gn; EBG00001153730.
DR   EnsemblGenomes-Gn; EBG00001153731.
DR   EnsemblGenomes-Gn; EBG00001153732.
DR   EnsemblGenomes-Gn; EBG00001153733.
DR   EnsemblGenomes-Gn; EBG00001153734.
DR   EnsemblGenomes-Gn; EBG00001153735.
DR   EnsemblGenomes-Gn; EBG00001153736.
DR   EnsemblGenomes-Gn; EBG00001153737.
DR   EnsemblGenomes-Gn; EBG00001153738.
DR   EnsemblGenomes-Gn; EBG00001153739.
DR   EnsemblGenomes-Gn; EBG00001153740.
DR   EnsemblGenomes-Gn; EBG00001153741.
DR   EnsemblGenomes-Gn; EBG00001153742.
DR   EnsemblGenomes-Gn; EBG00001153743.
DR   EnsemblGenomes-Gn; EBG00001153744.
DR   EnsemblGenomes-Gn; EBG00001153745.
DR   EnsemblGenomes-Gn; EBG00001153746.
DR   EnsemblGenomes-Gn; EBG00001153747.
DR   EnsemblGenomes-Gn; EBG00001153748.
DR   EnsemblGenomes-Gn; EBG00001153749.
DR   EnsemblGenomes-Gn; EBG00001153750.
DR   EnsemblGenomes-Gn; EBG00001153751.
DR   EnsemblGenomes-Gn; EBG00001153752.
DR   EnsemblGenomes-Gn; EBG00001153753.
DR   EnsemblGenomes-Gn; EBG00001153754.
DR   EnsemblGenomes-Gn; EBG00001153755.
DR   EnsemblGenomes-Gn; EBG00001153756.
DR   EnsemblGenomes-Gn; EBG00001153757.
DR   EnsemblGenomes-Gn; EBG00001153758.
DR   EnsemblGenomes-Gn; EBG00001153759.
DR   EnsemblGenomes-Gn; EBG00001153760.
DR   EnsemblGenomes-Gn; EBG00001153761.
DR   EnsemblGenomes-Gn; EBG00001153762.
DR   EnsemblGenomes-Gn; EBG00001153763.
DR   EnsemblGenomes-Gn; EBG00001153764.
DR   EnsemblGenomes-Gn; EBG00001153765.
DR   EnsemblGenomes-Gn; EBG00001153766.
DR   EnsemblGenomes-Gn; EBG00001153767.
DR   EnsemblGenomes-Gn; EBG00001153768.
DR   EnsemblGenomes-Gn; EBG00001153769.
DR   EnsemblGenomes-Gn; EBG00001153770.
DR   EnsemblGenomes-Gn; EBG00001153771.
DR   EnsemblGenomes-Gn; EBG00001153772.
DR   EnsemblGenomes-Gn; EBG00001153773.
DR   EnsemblGenomes-Gn; EBG00001153774.
DR   EnsemblGenomes-Gn; EBG00001153775.
DR   EnsemblGenomes-Gn; EBG00001153776.
DR   EnsemblGenomes-Gn; EBG00001153777.
DR   EnsemblGenomes-Gn; EBG00001153778.
DR   EnsemblGenomes-Gn; EBG00001153779.
DR   EnsemblGenomes-Gn; EBG00001153780.
DR   EnsemblGenomes-Gn; EBG00001153781.
DR   EnsemblGenomes-Gn; EBG00001153782.
DR   EnsemblGenomes-Gn; EBG00001153783.
DR   EnsemblGenomes-Gn; EBG00001153784.
DR   EnsemblGenomes-Gn; EBG00001153785.
DR   EnsemblGenomes-Gn; EBG00001153786.
DR   EnsemblGenomes-Gn; EBG00001153787.
DR   EnsemblGenomes-Gn; EBG00001153788.
DR   EnsemblGenomes-Gn; EBG00001153789.
DR   EnsemblGenomes-Gn; EBG00001153790.
DR   EnsemblGenomes-Gn; EBG00001153791.
DR   EnsemblGenomes-Gn; EBG00001153792.
DR   EnsemblGenomes-Gn; EBG00001153793.
DR   EnsemblGenomes-Gn; EBG00001153794.
DR   EnsemblGenomes-Gn; EBG00001153795.
DR   EnsemblGenomes-Gn; EBG00001153796.
DR   EnsemblGenomes-Gn; EBG00001153797.
DR   EnsemblGenomes-Gn; EBG00001153798.
DR   EnsemblGenomes-Gn; EBG00001153799.
DR   EnsemblGenomes-Gn; EBG00001153800.
DR   EnsemblGenomes-Gn; EBG00001153801.
DR   EnsemblGenomes-Gn; EBG00001153802.
DR   EnsemblGenomes-Gn; EBG00001153803.
DR   EnsemblGenomes-Gn; EBG00001153804.
DR   EnsemblGenomes-Gn; EBG00001153805.
DR   EnsemblGenomes-Gn; EBG00001153806.
DR   EnsemblGenomes-Gn; EBG00001153807.
DR   EnsemblGenomes-Gn; TK90_R0001.
DR   EnsemblGenomes-Gn; TK90_R0002.
DR   EnsemblGenomes-Gn; TK90_R0003.
DR   EnsemblGenomes-Gn; TK90_R0004.
DR   EnsemblGenomes-Gn; TK90_R0005.
DR   EnsemblGenomes-Gn; TK90_R0006.
DR   EnsemblGenomes-Gn; TK90_R0007.
DR   EnsemblGenomes-Gn; TK90_R0008.
DR   EnsemblGenomes-Gn; TK90_R0009.
DR   EnsemblGenomes-Gn; TK90_R0010.
DR   EnsemblGenomes-Gn; TK90_R0011.
DR   EnsemblGenomes-Gn; TK90_R0012.
DR   EnsemblGenomes-Gn; TK90_R0013.
DR   EnsemblGenomes-Gn; TK90_R0014.
DR   EnsemblGenomes-Gn; TK90_R0015.
DR   EnsemblGenomes-Gn; TK90_R0016.
DR   EnsemblGenomes-Gn; TK90_R0017.
DR   EnsemblGenomes-Gn; TK90_R0018.
DR   EnsemblGenomes-Gn; TK90_R0019.
DR   EnsemblGenomes-Gn; TK90_R0020.
DR   EnsemblGenomes-Gn; TK90_R0021.
DR   EnsemblGenomes-Gn; TK90_R0022.
DR   EnsemblGenomes-Gn; TK90_R0023.
DR   EnsemblGenomes-Gn; TK90_R0024.
DR   EnsemblGenomes-Gn; TK90_R0025.
DR   EnsemblGenomes-Gn; TK90_R0026.
DR   EnsemblGenomes-Gn; TK90_R0027.
DR   EnsemblGenomes-Gn; TK90_R0028.
DR   EnsemblGenomes-Gn; TK90_R0029.
DR   EnsemblGenomes-Gn; TK90_R0030.
DR   EnsemblGenomes-Gn; TK90_R0031.
DR   EnsemblGenomes-Gn; TK90_R0032.
DR   EnsemblGenomes-Gn; TK90_R0033.
DR   EnsemblGenomes-Gn; TK90_R0034.
DR   EnsemblGenomes-Gn; TK90_R0035.
DR   EnsemblGenomes-Gn; TK90_R0036.
DR   EnsemblGenomes-Gn; TK90_R0037.
DR   EnsemblGenomes-Gn; TK90_R0038.
DR   EnsemblGenomes-Gn; TK90_R0039.
DR   EnsemblGenomes-Gn; TK90_R0040.
DR   EnsemblGenomes-Gn; TK90_R0041.
DR   EnsemblGenomes-Gn; TK90_R0042.
DR   EnsemblGenomes-Gn; TK90_R0043.
DR   EnsemblGenomes-Gn; TK90_R0044.
DR   EnsemblGenomes-Gn; TK90_R0045.
DR   EnsemblGenomes-Gn; TK90_R0046.
DR   EnsemblGenomes-Gn; TK90_R0047.
DR   EnsemblGenomes-Gn; TK90_R0048.
DR   EnsemblGenomes-Gn; TK90_R0049.
DR   EnsemblGenomes-Gn; TK90_R0050.
DR   EnsemblGenomes-Gn; TK90_R0051.
DR   EnsemblGenomes-Gn; TK90_R0052.
DR   EnsemblGenomes-Gn; TK90_R0053.
DR   EnsemblGenomes-Gn; TK90_R0054.
DR   EnsemblGenomes-Gn; TK90_R0055.
DR   EnsemblGenomes-Tr; EBT00001742731.
DR   EnsemblGenomes-Tr; EBT00001742733.
DR   EnsemblGenomes-Tr; EBT00001742734.
DR   EnsemblGenomes-Tr; EBT00001742736.
DR   EnsemblGenomes-Tr; EBT00001742737.
DR   EnsemblGenomes-Tr; EBT00001742738.
DR   EnsemblGenomes-Tr; EBT00001742739.
DR   EnsemblGenomes-Tr; EBT00001742741.
DR   EnsemblGenomes-Tr; EBT00001742743.
DR   EnsemblGenomes-Tr; EBT00001742744.
DR   EnsemblGenomes-Tr; EBT00001742745.
DR   EnsemblGenomes-Tr; EBT00001742746.
DR   EnsemblGenomes-Tr; EBT00001742747.
DR   EnsemblGenomes-Tr; EBT00001742749.
DR   EnsemblGenomes-Tr; EBT00001742751.
DR   EnsemblGenomes-Tr; EBT00001742753.
DR   EnsemblGenomes-Tr; EBT00001742754.
DR   EnsemblGenomes-Tr; EBT00001742756.
DR   EnsemblGenomes-Tr; EBT00001742758.
DR   EnsemblGenomes-Tr; EBT00001742759.
DR   EnsemblGenomes-Tr; EBT00001742761.
DR   EnsemblGenomes-Tr; EBT00001742762.
DR   EnsemblGenomes-Tr; EBT00001742764.
DR   EnsemblGenomes-Tr; EBT00001742765.
DR   EnsemblGenomes-Tr; EBT00001742767.
DR   EnsemblGenomes-Tr; EBT00001742768.
DR   EnsemblGenomes-Tr; EBT00001742769.
DR   EnsemblGenomes-Tr; EBT00001742772.
DR   EnsemblGenomes-Tr; EBT00001742774.
DR   EnsemblGenomes-Tr; EBT00001742776.
DR   EnsemblGenomes-Tr; EBT00001742778.
DR   EnsemblGenomes-Tr; EBT00001742780.
DR   EnsemblGenomes-Tr; EBT00001742781.
DR   EnsemblGenomes-Tr; EBT00001742782.
DR   EnsemblGenomes-Tr; EBT00001742784.
DR   EnsemblGenomes-Tr; EBT00001742786.
DR   EnsemblGenomes-Tr; EBT00001742787.
DR   EnsemblGenomes-Tr; EBT00001742789.
DR   EnsemblGenomes-Tr; EBT00001742790.
DR   EnsemblGenomes-Tr; EBT00001742792.
DR   EnsemblGenomes-Tr; EBT00001742794.
DR   EnsemblGenomes-Tr; EBT00001742795.
DR   EnsemblGenomes-Tr; EBT00001742796.
DR   EnsemblGenomes-Tr; EBT00001742798.
DR   EnsemblGenomes-Tr; EBT00001742800.
DR   EnsemblGenomes-Tr; EBT00001742801.
DR   EnsemblGenomes-Tr; EBT00001742803.
DR   EnsemblGenomes-Tr; EBT00001742805.
DR   EnsemblGenomes-Tr; EBT00001742806.
DR   EnsemblGenomes-Tr; EBT00001742807.
DR   EnsemblGenomes-Tr; EBT00001742809.
DR   EnsemblGenomes-Tr; EBT00001742811.
DR   EnsemblGenomes-Tr; EBT00001742813.
DR   EnsemblGenomes-Tr; EBT00001742814.
DR   EnsemblGenomes-Tr; EBT00001742815.
DR   EnsemblGenomes-Tr; EBT00001742817.
DR   EnsemblGenomes-Tr; EBT00001742818.
DR   EnsemblGenomes-Tr; EBT00001742821.
DR   EnsemblGenomes-Tr; EBT00001742822.
DR   EnsemblGenomes-Tr; EBT00001742823.
DR   EnsemblGenomes-Tr; EBT00001742825.
DR   EnsemblGenomes-Tr; EBT00001742826.
DR   EnsemblGenomes-Tr; EBT00001742827.
DR   EnsemblGenomes-Tr; EBT00001742829.
DR   EnsemblGenomes-Tr; EBT00001742830.
DR   EnsemblGenomes-Tr; EBT00001742833.
DR   EnsemblGenomes-Tr; EBT00001742834.
DR   EnsemblGenomes-Tr; EBT00001742835.
DR   EnsemblGenomes-Tr; EBT00001742836.
DR   EnsemblGenomes-Tr; EBT00001742838.
DR   EnsemblGenomes-Tr; EBT00001742841.
DR   EnsemblGenomes-Tr; EBT00001742842.
DR   EnsemblGenomes-Tr; EBT00001742843.
DR   EnsemblGenomes-Tr; EBT00001742845.
DR   EnsemblGenomes-Tr; EBT00001742847.
DR   EnsemblGenomes-Tr; EBT00001742848.
DR   EnsemblGenomes-Tr; EBT00001742849.
DR   EnsemblGenomes-Tr; EBT00001742851.
DR   EnsemblGenomes-Tr; EBT00001742853.
DR   EnsemblGenomes-Tr; EBT00001742854.
DR   EnsemblGenomes-Tr; EBT00001742855.
DR   EnsemblGenomes-Tr; EBT00001742856.
DR   EnsemblGenomes-Tr; EBT00001742858.
DR   EnsemblGenomes-Tr; EBT00001742859.
DR   EnsemblGenomes-Tr; EBT00001742861.
DR   EnsemblGenomes-Tr; EBT00001742862.
DR   EnsemblGenomes-Tr; EBT00001742863.
DR   EnsemblGenomes-Tr; EBT00001742864.
DR   EnsemblGenomes-Tr; EBT00001742866.
DR   EnsemblGenomes-Tr; EBT00001742867.
DR   EnsemblGenomes-Tr; EBT00001742868.
DR   EnsemblGenomes-Tr; EBT00001742869.
DR   EnsemblGenomes-Tr; EBT00001742870.
DR   EnsemblGenomes-Tr; EBT00001742871.
DR   EnsemblGenomes-Tr; EBT00001742874.
DR   EnsemblGenomes-Tr; EBT00001742875.
DR   EnsemblGenomes-Tr; EBT00001742876.
DR   EnsemblGenomes-Tr; EBT00001742877.
DR   EnsemblGenomes-Tr; EBT00001742879.
DR   EnsemblGenomes-Tr; EBT00001742880.
DR   EnsemblGenomes-Tr; EBT00001742882.
DR   EnsemblGenomes-Tr; EBT00001742884.
DR   EnsemblGenomes-Tr; EBT00001742886.
DR   EnsemblGenomes-Tr; EBT00001742889.
DR   EnsemblGenomes-Tr; EBT00001742890.
DR   EnsemblGenomes-Tr; EBT00001742892.
DR   EnsemblGenomes-Tr; EBT00001742894.
DR   EnsemblGenomes-Tr; EBT00001742896.
DR   EnsemblGenomes-Tr; EBT00001742897.
DR   EnsemblGenomes-Tr; EBT00001742898.
DR   EnsemblGenomes-Tr; EBT00001742900.
DR   EnsemblGenomes-Tr; EBT00001742902.
DR   EnsemblGenomes-Tr; EBT00001742903.
DR   EnsemblGenomes-Tr; EBT00001742904.
DR   EnsemblGenomes-Tr; EBT00001742906.
DR   EnsemblGenomes-Tr; EBT00001742907.
DR   EnsemblGenomes-Tr; EBT00001742908.
DR   EnsemblGenomes-Tr; EBT00001742910.
DR   EnsemblGenomes-Tr; EBT00001742911.
DR   EnsemblGenomes-Tr; EBT00001742913.
DR   EnsemblGenomes-Tr; EBT00001742914.
DR   EnsemblGenomes-Tr; EBT00001742916.
DR   EnsemblGenomes-Tr; EBT00001742918.
DR   EnsemblGenomes-Tr; EBT00001742919.
DR   EnsemblGenomes-Tr; EBT00001742921.
DR   EnsemblGenomes-Tr; EBT00001742923.
DR   EnsemblGenomes-Tr; EBT00001742924.
DR   EnsemblGenomes-Tr; EBT00001742926.
DR   EnsemblGenomes-Tr; EBT00001742927.
DR   EnsemblGenomes-Tr; EBT00001742928.
DR   EnsemblGenomes-Tr; EBT00001742929.
DR   EnsemblGenomes-Tr; EBT00001742930.
DR   EnsemblGenomes-Tr; EBT00001742931.
DR   EnsemblGenomes-Tr; EBT00001742932.
DR   EnsemblGenomes-Tr; EBT00001742933.
DR   EnsemblGenomes-Tr; TK90_R0001-1.
DR   EnsemblGenomes-Tr; TK90_R0002-1.
DR   EnsemblGenomes-Tr; TK90_R0003-1.
DR   EnsemblGenomes-Tr; TK90_R0004-1.
DR   EnsemblGenomes-Tr; TK90_R0005-1.
DR   EnsemblGenomes-Tr; TK90_R0006-1.
DR   EnsemblGenomes-Tr; TK90_R0007-1.
DR   EnsemblGenomes-Tr; TK90_R0008-1.
DR   EnsemblGenomes-Tr; TK90_R0009-1.
DR   EnsemblGenomes-Tr; TK90_R0010-1.
DR   EnsemblGenomes-Tr; TK90_R0011-1.
DR   EnsemblGenomes-Tr; TK90_R0012-1.
DR   EnsemblGenomes-Tr; TK90_R0013-1.
DR   EnsemblGenomes-Tr; TK90_R0014-1.
DR   EnsemblGenomes-Tr; TK90_R0015-1.
DR   EnsemblGenomes-Tr; TK90_R0016-1.
DR   EnsemblGenomes-Tr; TK90_R0017-1.
DR   EnsemblGenomes-Tr; TK90_R0018-1.
DR   EnsemblGenomes-Tr; TK90_R0019-1.
DR   EnsemblGenomes-Tr; TK90_R0020-1.
DR   EnsemblGenomes-Tr; TK90_R0021-1.
DR   EnsemblGenomes-Tr; TK90_R0022-1.
DR   EnsemblGenomes-Tr; TK90_R0023-1.
DR   EnsemblGenomes-Tr; TK90_R0024-1.
DR   EnsemblGenomes-Tr; TK90_R0025-1.
DR   EnsemblGenomes-Tr; TK90_R0026-1.
DR   EnsemblGenomes-Tr; TK90_R0027-1.
DR   EnsemblGenomes-Tr; TK90_R0028-1.
DR   EnsemblGenomes-Tr; TK90_R0029-1.
DR   EnsemblGenomes-Tr; TK90_R0030-1.
DR   EnsemblGenomes-Tr; TK90_R0031-1.
DR   EnsemblGenomes-Tr; TK90_R0032-1.
DR   EnsemblGenomes-Tr; TK90_R0033-1.
DR   EnsemblGenomes-Tr; TK90_R0034-1.
DR   EnsemblGenomes-Tr; TK90_R0035-1.
DR   EnsemblGenomes-Tr; TK90_R0036-1.
DR   EnsemblGenomes-Tr; TK90_R0037-1.
DR   EnsemblGenomes-Tr; TK90_R0038-1.
DR   EnsemblGenomes-Tr; TK90_R0039-1.
DR   EnsemblGenomes-Tr; TK90_R0040-1.
DR   EnsemblGenomes-Tr; TK90_R0041-1.
DR   EnsemblGenomes-Tr; TK90_R0042-1.
DR   EnsemblGenomes-Tr; TK90_R0043-1.
DR   EnsemblGenomes-Tr; TK90_R0044-1.
DR   EnsemblGenomes-Tr; TK90_R0045-1.
DR   EnsemblGenomes-Tr; TK90_R0046-1.
DR   EnsemblGenomes-Tr; TK90_R0047-1.
DR   EnsemblGenomes-Tr; TK90_R0048-1.
DR   EnsemblGenomes-Tr; TK90_R0049-1.
DR   EnsemblGenomes-Tr; TK90_R0050-1.
DR   EnsemblGenomes-Tr; TK90_R0051-1.
DR   EnsemblGenomes-Tr; TK90_R0052-1.
DR   EnsemblGenomes-Tr; TK90_R0053-1.
DR   EnsemblGenomes-Tr; TK90_R0054-1.
DR   EnsemblGenomes-Tr; TK90_R0055-1.
DR   EuropePMC; PMC3746430; 23991253.
DR   EuropePMC; PMC4830845; 27148201.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; CP001905.
DR   SILVA-SSU; CP001905.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024149
CC   Source DNA and bacteria available from Gerard Muyzer
CC   (g.muijzer@tudelft.nl)
CC   Contacts: Gerard Muyzer (g.muijzer@tudelft.nl)
CC        Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Thioalkalivibrio sp. K90mix
CC   GOLD Stamp ID         :: Gi01556
CC   Isolation Site        :: Soda lake sediment
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Salinity              :: Halotolerant
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Phenotypes            :: Alkalophile
CC   Energy Source         :: Chemolithoautotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2744800
FT                   /organism="Thioalkalivibrio sp. K90mix"
FT                   /strain="K90mix"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:396595"
FT   gene            118..1485
FT                   /locus_tag="TK90_0001"
FT   CDS_pept        118..1485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: aeh:Mlg_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70518"
FT                   /db_xref="GOA:D3SBM0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM0"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADC70518.1"
FT                   /translation="MTANTLWTACLDRLQGRVSEQQLNTWLRPLHAEEEAGALRLLAPN
FT                   QFVFEHVRDHLLSSIEEAVSELRPGTEETDRQRVRLGIGGTEWTAAEPEGSAPSRAPAS
FT                   APARRAAVPKGPVSNLNPAFTFDTFVEGKSNQLARAASLQVAENPGVAYNPLFIYGGVG
FT                   LGKTHLMHAIGNSILSRLPEGRIIYLHSERFVADMIKALQHNAIDDFKQHYRTADALLI
FT                   DDIQFFANKERSQEEFFHTFNALLEGQQQIILTSDRYPKEVEGLEERLKSRFGWGLTIA
FT                   IEPPELETRVAILQRKAEQAGIELPTEVAFFMGKRIRSNIRELEGSLRRVIANAHFTGK
FT                   PITLDFAKEALRDLLAVQNKLITLENIQKTVADYYRIKVADLLSTRRSRSVARPRQMAM
FT                   ALAKELTQHSLPEIGQAFGGRDHTTVIHACRKIVELREADASLDEDYANLLRTLSS"
FT   gene            1738..2841
FT                   /locus_tag="TK90_0002"
FT   CDS_pept        1738..2841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aeh:Mlg_0002 DNA polymerase III, beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70519"
FT                   /db_xref="GOA:D3SBM1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADC70519.1"
FT                   /translation="MELSFQREAMTDALQRIVGAAEKRLTMPILGNVRLRPDERGGIRM
FT                   DTTDLELAWQGEAAGTIPGECDVTVSVRKLLDVVKAAPEDSEIRATIDGERMSVGFAGS
FT                   RFSLATLPGADFPDWESKSSEWTLDIPQNRLRRLLEATMFSMAQQDVRYYLQGLLLVAS
FT                   GHSLRAVATDGHRLALAEAELDQAIDGRLEKIVPRKTIAELRRNLSDDDVPVRVGFSED
FT                   QVLFDLGNAVLRSKVIEGRFPDYERVIPADLPATLTVERERLKQALARVSIVASDKYRG
FT                   VRMTLGDEGCQVMTHNADREEAQESVEAEYQGPPMEIGFNLGYLVDVLNAIETDQVRIG
FT                   LRDGNSSILVQAEPPGGARYVVMPMRL"
FT   gene            2865..3938
FT                   /locus_tag="TK90_0003"
FT   CDS_pept        2865..3938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: pfl:PFL_0003 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70520"
FT                   /db_xref="GOA:D3SBM2"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM2"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADC70520.1"
FT                   /translation="MLEGLWWRGVRNLSEQTFEPGEGINRLVGPNGAGKTSVLEACHVL
FT                   AAGRSFRTPQLRRVVRSGEKGLWIGGRVRDLHGGEHRLGVSWEGTRRSRLDGRWMEGHA
FT                   SVAEWLPVRVLHAGSFDLLTGSPEERRRLLDWGCFHSVRGYRWHWQQWRRSHEQRNAAL
FT                   RKGDRRAAREFERPLVDAGENITQARQAYIDRWEINTSEAARVFGFSQRLGDFQVHLRV
FT                   GWDRDRSLSEAIARSRDSDEERGFGQVGPQRADIDLRFDGRVAAEASRGEQKRLITALT
FT                   GGQARMLEREAGRAPVVLLDDVVSELDVAAVEGLMCGLLEFGWQVLVTTVEPHIPGLEG
FT                   GRSTRLFHVEHGVVTPD"
FT   gene            4005..6437
FT                   /locus_tag="TK90_0004"
FT   CDS_pept        4005..6437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: vcj:VCD_001483 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein; DNA gyrase
FT                   subunit B domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70521"
FT                   /db_xref="GOA:D3SBM3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM3"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADC70521.1"
FT                   /translation="MSESEPLDPETYDSSQIRVLKGLDAVRKRPGMYIGDTDDGTGLHH
FT                   MVFEVVDNSIDEALAGHCDTIEVTIHEDNAVSVSDNGRGIPVDIHEEEGKSAAEVILTV
FT                   LHAGGKFDNNSYKVSGGLHGVGVSVVNALSEELRLEIHRAGERHEQVYHLGVPDAPLAV
FT                   AGSTDRTGTRIWFRPSDEIFTDIEFHYEILAKRLRELSFLNSGVRITLRDQRDNREETF
FT                   LFEGGIRAFVEHLNQKKTALHPTVIYANQTREDDYVVEVALQWNDSYQENIFCYTNNIP
FT                   QRDGGTHMAGFRAALTRTVNQYLEKEGLIKKAKVATAGDDMREGLTAVLSVKVPDPKFS
FT                   SQTKDKLVSSEVKPIVESVLSDALTNFLLENPPEAKAITDKVLEAARAREAARKAREVT
FT                   RRKGALDIAGLPGKLADCQEKDPAHSELYLVEGDSAGGSAKQGRDRHFQAILPLKGKIL
FT                   NVERARFDRMLGSAEVGTLITALGCGIGKDEYDPDKLRYHRIIIMTDADVDGSHIRTLL
FT                   LTFFFRQMPELIERGHVYIAQPPLYKIKRGKREQYVRDEAEMGEIVVSLALDGAALHPG
FT                   PDAPPVTGEAFEELVKGYQKAARAVERLGRLYDSRILWAMLEADAIPEPRSVTNPDVQA
FT                   WFSRILESISSDRAGATRYSLGPVTNVDGHAQLSLDRLEHGAALSQYITDDTLASRDFQ
FT                   TILDLSARLNALLESGAYIKRGERVHRIQGFSEAMEWLLQEGRRGLATQRYKGLGEMNP
FT                   EQLWETTMNPETRRLLQVRVEDAIRADEIFTTLMGDQVEPRRDFIESRALSAENVDV"
FT   gene            6444..6974
FT                   /locus_tag="TK90_0005"
FT   CDS_pept        6444..6974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_3325 LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70522"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70522.1"
FT                   /translation="MAIFVIVTIVGLVGLTLTIARLYSHLAVQERQVVGAWDQLERLLV
FT                   QRNGHLQKVCMAAGSGPSAVQHLHRSLQRQETARRRGDLSTVAKAEREIRALWDSLYQQ
FT                   DIDIKKENVEESARRVVALDQAIRDTLIRYNAALQMYRHTCRSPFYAPIAWLGGMGRYT
FT                   PLQPPSSDPDNPA"
FT   gene            7070..9118
FT                   /locus_tag="TK90_0006"
FT   CDS_pept        7070..9118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0006"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: aeh:Mlg_2533 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70523"
FT                   /db_xref="GOA:D3SBM5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM5"
FT                   /inference="protein motif:PRIAM:3.4.24.70"
FT                   /protein_id="ADC70523.1"
FT                   /translation="MTNPLLQTDRLPAFRSIAPEHVLPAIDTVLQENRDGIEALVGQAG
FT                   DQPTWGGLVAPLQHLDARLSQVWAPVGHLNAVMNSSELRQAYNACLPKLSEFGSWVSQH
FT                   QGLYAAFRRLADGPEYARLAPERRKVIDDALRDFHLSGVDLPEDARARLREIDARLSAL
FT                   TARFEENVLDATQSWTWQTDDPDALAGIPAAEQAMLAQNARAHERTGYLVTLDFPSYFA
FT                   VMSHADDRELRRRVYEAFATRASDQGPDAGRFDNSEVMVEILQLREEQARITGFEHYAE
FT                   RSLATKMAETADQVDSFLQDLSRRARPRAEQDLADLRIFARQELGLDSLEAWDMAYAAE
FT                   KMRERRLGLSQEMLKPYFPASQAVEGLFRLVERLFGVRFEADPTVECWHDDVRYYRVFD
FT                   VNGIERAGFYFDLYARKNKRGGAWMDVCRQRFVSDTAQQVPVAFMTCNSTPPVDGKPAL
FT                   FTHDEVITLFHEFGHGLHHMLTRVNEPEIAGINGVEWDAVELPSQFMENWCWEREALDL
FT                   FARHYETGEPMPDELYQRLVDTRHFHAALQLLRQVEFSLFDMRLHAGPAPETAKAILDL
FT                   LETVRDEVAVVRPPAFNRFPHGFAHIFAGGYAAGYYSYKWAEVLSADAFARFEEEGLFS
FT                   PDVGAAYLREILEVGASRPAADSFRAFRGRDPEIDALLRHSGLEDAA"
FT   gene            9115..9882
FT                   /locus_tag="TK90_0007"
FT   CDS_pept        9115..9882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0007"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /note="TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: aeh:Mlg_2782
FT                   exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70524"
FT                   /db_xref="GOA:D3SBM6"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM6"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADC70524.1"
FT                   /translation="MKIASWNVNSLKVRLPQVLDWLGSSRTDILALQETKLTDENFPVS
FT                   AIHEAGYEVVYSGQKTYNGVAILSRTQATDVVTDPPGLEDAQRRILAATIGDIRVVNLY
FT                   VVNGENVGTEKYAYKLDWLARMRSWLAAEIEAHPKLVVLGDFNIAPEDRDVHDPEAWHE
FT                   RILCSTPEREALAALTELGLADTFRAFEQPEEEFSWFDYRAASFRRNRGLRIDLVLASP
FT                   ALLKRLTAAGIDREPRGWERPSDHAPVWAEFSD"
FT   gene            9916..11379
FT                   /locus_tag="TK90_0008"
FT   CDS_pept        9916..11379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0008"
FT                   /product="UbiD family decarboxylase"
FT                   /note="TIGRFAM: UbiD family decarboxylase; PFAM:
FT                   Carboxylyase-related protein; KEGG: pen:PSEEN5330
FT                   3-octaprenyl-4-hydroxybenzoate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70525"
FT                   /db_xref="GOA:D3SBM7"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR023677"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM7"
FT                   /inference="protein motif:TFAM:TIGR00148"
FT                   /protein_id="ADC70525.1"
FT                   /translation="MKYRDLRDFIDGLEARGELKRITTEIDPNLEMTEIADRVLRAGGP
FT                   ALLFENPKGSDIPVLANLFGTPERVAMGMGEDSVGALREVGRLLAFLKQPDPPKGLKAA
FT                   WEQLPVFRKVLDMAPKKTRGAACQRHVIEGDDVDLSTLPVQTCWPGDAGPLITWGLVVT
FT                   RGPEKSRQNLGIYRQQVIGRNRVIMRWLSHRGGALDYREWCQAHPGEPFPIAVALGADP
FT                   ATILGAVTPVPDTLSEYAFAGLLRGSRTEVTRCIGSDLEVPASAEFVLEGHIHPGETAP
FT                   EGPFGDHTGYYNEVDEFPVFTIDRITHRDQPIYHSTYTGRPPDEPAVLGVALNEVFIPI
FT                   LQKQFPEIVDFYLPPEGCSYRMAVVSMRKQYPGHAKRVMMGVWSFLRQFMYTKFVIVVD
FT                   DDVNTRDWNDVIWAITTRMDPARDTTLVENTPIDYLDFASPVSGLGSKMGMDATSKWPG
FT                   ETEREWGRPITMDPAVRERVDALWDELGL"
FT   gene            complement(11409..11981)
FT                   /locus_tag="TK90_0009"
FT   CDS_pept        complement(11409..11981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttu:TERTU_0073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70526"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70526.1"
FT                   /translation="MQGEKWTAALAAVGVMVLGGCAANETRDTTTDAGAEAAAEVTDPE
FT                   VIVAVPERFAYSDDATVSEAIRRECELEERFPGFVQEFGARHDVRVESGADVSPGDAGK
FT                   VLVVEITQARNDGSAWSGHRSLAEAEGTLYENGEAVAKFTSRRVSGGGAFGGFKGSCSV
FT                   MGRTVRAMGADIAAWVRLPEDGAHLGN"
FT   sig_peptide     complement(11913..11981)
FT                   /locus_tag="TK90_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.896) with cleavage site probability 0.474 at
FT                   residue 23"
FT   gene            12140..13168
FT                   /locus_tag="TK90_0010"
FT   CDS_pept        12140..13168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0010"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: tbd:Tbd_2563 CDP-6-deoxy-delta-3,4-glucoseen
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70527"
FT                   /db_xref="GOA:D3SBM9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBM9"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ADC70527.1"
FT                   /translation="MAFDVIIQPSGQQLEVEDDETVLEAALRQGFAFPYGCRNGACGSC
FT                   KGRVLAGEVDHGPKKPPGITEAELADGWALFCQAVPVDDLEIEVREIGAAKDIVVKTLP
FT                   CRVAQLNRLADDVMELRLQLPATERMQFLAGQYLDVLLKGGGRRSYSLANAPHDDEPLV
FT                   LHVRNLEGGRFSKMVFEEMQPKALLRIEGPLGTFFVDEESERPRLFVGGGTGFGPLKGM
FT                   LDHLAVEGFDRPHHLFWGARSAEGIYAPDWLGRMSAEHGEHFRFTPVLSDVPADTAGGF
FT                   PAVAGWPHDAVLAEYPDLSGFDVYMAGPPAMIEAATNAFLAAGLPTEQLYYDSFEPAAP
FT                   HE"
FT   gene            complement(13188..14003)
FT                   /locus_tag="TK90_0011"
FT   CDS_pept        complement(13188..14003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0011"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   nmu:Nmul_A2689 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70528"
FT                   /db_xref="GOA:D3SBN0"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN0"
FT                   /inference="protein motif:PFAM:PF02602"
FT                   /protein_id="ADC70528.1"
FT                   /translation="MAELDIMKPTADGPLNGCGILVTRPAAQAEEFCTLLAGDGAEVIR
FT                   FPVLEILAPSDPTDLRAVLNQLDNFDIAVFISPNAVQRVLNLALADRTWPEGTRIAAIG
FT                   NRTAKELKGFGLNVDIAPPRRFDSEALLEQPAMQDVAGQRVVIFRGDGGREYLGDTLKS
FT                   RGAEVTFAEAYRRGRPEGDTGALMYAFSRDQIDIITITSGEGLRNLYEMVGKLGRMWLR
FT                   KTPLVVGSERIGEIAHELGFKAAVEVAEDPTDAAMQQAVHRLAAQLATS"
FT   gene            complement(14006..14953)
FT                   /locus_tag="TK90_0012"
FT   CDS_pept        complement(14006..14953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0012"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: hch:HCH_00291 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70529"
FT                   /db_xref="GOA:D3SBN1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN1"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADC70529.1"
FT                   /translation="MKPLRIATRKSPLAMWQAEHVAARLRGLHPDLPVELVGMTTQGDR
FT                   VLDSPLARIGGKGLFVKELEVAMLEDRADIAVHSVKDVPMELPADLVLPVILDREDPLD
FT                   AFVSNTYAHVDELPQGARVGSSSLRRQCQLRARRPDLKITDLRGNVNTRLGKLDAGEYD
FT                   AILLAAAGLKRLGFDERIRARLEPAVSLPAVGQGAIAIECRENDPEIAALIAPLNDRDT
FT                   SDRVRAERAFNRRLEGGCQVPLAGHATLDGDRLRLDGLVGAVDGSQLLRRQVEGPRGDA
FT                   EALGVQLAEQLLELGAGELLAAAHAENAASTKGS"
FT   gene            complement(15048..15773)
FT                   /locus_tag="TK90_0013"
FT   CDS_pept        complement(15048..15773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0013"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; SMART: response regulator receiver; LytTr
FT                   DNA-binding region; KEGG: aeh:Mlg_2671 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70530"
FT                   /db_xref="GOA:D3SBN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC70530.1"
FT                   /translation="MSSEALRVLIVDDEPIARQRLAGMVNDAGHQVIGQAAEAISARDA
FT                   ITREAPDLVLLDVEMPGESGMELAAEIGARRPDLMVILVTAHEQFSLDAFEAGVRDYVL
FT                   KPVRGERLTQALERAARHKAGSSAPAPRTVRLTIGRREERVALDRIAYFTAEDGYVIAR
FT                   GEQLEGFVDTRLHELESRFGDALLCVRRGCLVVRTAIRGLETRGPADHRLLFHGQLDPV
FT                   AVSRRQLPQVRAFLRGNLA"
FT   gene            complement(15763..16803)
FT                   /locus_tag="TK90_0014"
FT   CDS_pept        complement(15763..16803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0014"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; KEGG:
FT                   abo:ABO_2324 two-component system sensor protein, alginate
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70531"
FT                   /db_xref="GOA:D3SBN3"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN3"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADC70531.1"
FT                   /translation="MKAPAPDDETTELAKQSPLPDFCSAETLLRVLMVAVLLALAVTLL
FT                   RGGGQDWVPGLALHALFIFWVALTSLLILCAGKRLLVRLPLWGQIVLPPLVPIANTAAV
FT                   FLGAEGLQLADPAWRWPAIAVATILSLVAMHYLYLQAAWQRETQAVSRAREQAMRARLR
FT                   PHFLYNSMNTIAGLCRSEPARAEQITLDLADLFRATFATADRQSLRAELELVRAFLNIE
FT                   QTRFGERLEVEWDCPDQAGLDVSVPTLILQPLAENAIQHGIGPARGPGFVRVRCRLDSG
FT                   TVMLSLTNSVDPEAHSEGTGTASEAVRLRLHHAFGDRCRFETVTREREFEVRIRLPLER
FT                   GNQHVE"
FT   gene            16911..18347
FT                   /locus_tag="TK90_0015"
FT   CDS_pept        16911..18347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0015"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: hna:Hneap_2151 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70532"
FT                   /db_xref="GOA:D3SBN4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN4"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ADC70532.1"
FT                   /translation="MTQDSARDKPQAPAPEGEAKLWGGRFSEPTDAFVERFTASVEFDQ
FT                   RLYREDIQGSQAHARMLAKVGVLTDAEAEQILQGLDAIRDEIAAGKFDWQIGREDVHMN
FT                   IEARLIERIGDVGKKLHTGRSRNDQVATDIRLWLRAAIDDILSLVRAYQRGLVDLAERE
FT                   AETVMPGFTHLQTAQPVTFGHHMLAWYEMLERDAQRLVDCRARVNVLPLGAAALAGTPY
FT                   PLDREYTAELLGFDGVTRNSLDAVSDRDFAIEFTAAAATLMMHLSRQAEELILWTSAQF
FT                   AFIDLPDRYCTGSSIMPQKKNPDVPELVRGKTGRVYGHLMSLLTLMKGQPLAYNKDNQE
FT                   DKEPLFDTVDTLLGSLRAFADMVPNLEVRAENTLAATRKGFATATDLADYLVGRGVAFR
FT                   DAHEVVGRAVRVAQERGVDLAELPLADLQAISDAVGDDVYTVLTPEGSAAARNLTGGTA
FT                   PEQVRRQVAAAREQLASTMG"
FT   gene            complement(18397..18900)
FT                   /locus_tag="TK90_0016"
FT   CDS_pept        complement(18397..18900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_3079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70533"
FT                   /db_xref="GOA:D3SBN5"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70533.1"
FT                   /translation="MTEEQDNKNQGGLKNSERLAWLGFMLFFVIILAIYIARATGLEQD
FT                   VTEAQRELYQTQVQLQEYTRHEIPRPVELGLTNAHIQDLQRRGMARAEERLRADLMEHP
FT                   ELIPHEAEGDEGFAFRPDGIHVLNHRWVLANFEGDGAHGQVLLGYEVVHGNVMWEVIDS
FT                   TLAY"
FT   gene            19040..20542
FT                   /locus_tag="TK90_0017"
FT   CDS_pept        19040..20542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0017"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   mxa:MXAN_0863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70534"
FT                   /db_xref="GOA:D3SBN6"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN6"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ADC70534.1"
FT                   /translation="MSRAEAPAPSTPELQWVNRFASLPEAFYDRPAPAPFPDATCLATS
FT                   PGMCQRLGLAETDLARQPWLGACTEGHPMEGPEPLASVYAGHQFGVFVPQLGDGRVKLL
FT                   GEVRTATGEHWELQVKGAGRTRYSRGADGRAVLRSSIREYLISEAMAALGVPTTRAVAL
FT                   YGSSLQVLRERVEPGAIVLRAAPSFLRFGHFEYFHYSGYSERLRELIDYALAHDYPELA
FT                   DAEDPVAAMLEQVIANTAEMIADWQAVGFCHGVMNTDNMSLLGLTIDYGPFAFLDAYDP
FT                   GYICNHTDQGGRYAFDQQPAIAQWNLIRLAETLVIHFQDTTREAAIERAKALLMDFMPR
FT                   FEQAWLTRMRTKLGLVEEHEGDLELIHDLLARMAEEGVDYTRFFRQLPDLEQPEIREQL
FT                   EAELEDAAAWRAWWSRYQARLEAEARPFEARRAAMNAVNPKYILRNHLAQAAIEQAEAG
FT                   DTSELLRLQAILARPFDEQPEFEAYADLPPAWAAGIQLSCSS"
FT   gene            complement(20558..21046)
FT                   /locus_tag="TK90_0018"
FT   CDS_pept        complement(20558..21046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0018"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dge:Dgeo_0155
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70535"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN7"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ADC70535.1"
FT                   /translation="MLQRVIIAVDFSPASAAALAVARQHCPGAKKRLLYVMKPSDVAGP
FT                   SSAGAFSGAGSSPLNAKDMRHSAEDRVRAQLEAWAEADDEVAVAIGSAPEEISRHAEEW
FT                   GADMIVMGTRGRSQIANMLSGSATEWLVRNARLPVLVVHDVPLSDSMKEKLPPEGAVN"
FT   gene            21280..22824
FT                   /locus_tag="TK90_0019"
FT   CDS_pept        21280..22824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0019"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   ctt:CtCNB1_2514 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70536"
FT                   /db_xref="GOA:D3SBN8"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR018045"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN8"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ADC70536.1"
FT                   /translation="MSASARMGIGEHIVQQTLQDFLARQRKVWFFNVRGDLIAGIVVAL
FT                   ALIPEAIAFSIIAGVDPSVGLYASFTMAVVIAFAGGRPGMISAATGAMALLMVTLIAEH
FT                   GLQYLLAATILTGIIQILFAWAKLARYMMFIPRTVLVGFVNALAILIFLSQVPYLVDGD
FT                   TTMWALVTAGLIILYGLPMIPGYPKLLPPPLVAIVVLSVVVYFMGLPTLEVGDMGELPD
FT                   GLPVFLFPDIPLNWETLQIIFPTAFALAIVGLLESLLTASILDDLTDTPSGKNREAQGQ
FT                   GIANVVTGFFGGMAGCAMIGQSVINIKSGGLGRLSTLSAGIFLLIFIVFLGDLVSIIPM
FT                   AALVAVMIMVSIATFDWGSLTTLHKLPRTDAVVLIVTVAVTVITHDLSMGVFAGVLLAA
FT                   IFFARKMVKAVEVKSDLSEDGKTRIYTVRGQLFFVAVDKFIDSFDYREGIHNVEIDLTR
FT                   ASLWDSSAVAAIDKVVGKFRRNGMEVDVKAPHGESGELHDKLALHDKGADLGPGEH"
FT   gene            23090..23818
FT                   /locus_tag="TK90_0020"
FT   CDS_pept        23090..23818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0020"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG:
FT                   xca:xccb100_4454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70537"
FT                   /db_xref="GOA:D3SBN9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBN9"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ADC70537.1"
FT                   /translation="MMNLRRPAPPTDPRAERERIRRALMWPMLGAGILIAIHALQELTG
FT                   GDWSRLGILPRDAVGVLGIITSPLIHGSWGHLLANVPTLWVLGMLTLYGFPQATRTAVP
FT                   LIWLMGGLGVWLFAREGLHIGASGLTHGLMFFAVVIGIRRRDALSIALAIIILFLYGSM
FT                   LWGVFPSGPKVSFEAHLFGAVVGAVCGGLLYRRDPLPPARRSSWEDDDETDPETLRKIE
FT                   QGRLDEIEPRQPPEEPGRRD"
FT   gene            complement(23930..26047)
FT                   /locus_tag="TK90_0021"
FT   CDS_pept        complement(23930..26047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0021"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: aeh:Mlg_2728 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70538"
FT                   /db_xref="GOA:D3SBP0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP0"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ADC70538.1"
FT                   /translation="MDTSKSTIPRLGGWMLLPLLVVSTASVAEDDPPVLDPVEITVTVP
FT                   RLATPLADLPAAVSRVDQRQATEGRQGLQLDEALNRVPGLFAQNRYNFAQDARISIRGF
FT                   GSRAPFGVRGLRILQDGIPETTPDGQSQVDAIDLLNLRDIEVLRGPSAALYGNASGGVI
FT                   AARTRDGRDPRGFGGGLLMGSYGYRRAEAVAEQDHGTHRYSLTAHDFAIDGYREQSTAE
FT                   KRYLRLHTASELEAGTLNFHLRYLDAPRTDDPGGLTREEMREDRRAAAPLATALDSTQS
FT                   AEQLTTGLQWEQPLAGGELRLGGFWTQRDYAQQLPFPGDSRVAYERDFFGVNAQYERDV
FT                   GATRVLTGIDLEEQRDDRTRRCSAGRLFDRDGGECSADPVDPMSDLALDQRERARSRGV
FT                   FVQTDTALGSDWNLVAGARHDRIRMSIDDHFVERFDDGNDVTDRSGRRTFDETSGMAGL
FT                   IWHFRPEYRAYVNVATNFETPTFTEFANPEGGGGFNPEVDPQRARSIEVGIRRENPQLS
FT                   WEASVYATRVRDELSPYQLEGQGDRTFYTNAGRTARDGVELSADWRLNPQWTLSAAASL
FT                   NRFRFREFEDAEGVRHDGNRMPGLPREQLFVEADWREGPWFVTVDALHVGSRYADNANT
FT                   EKVGPQTTLNLRAGRFWQQGDTRAEAFVAANNLLDADNVDNIRINAAGGRYYEPAPGLT
FT                   LMAGVRMYFGQ"
FT   sig_peptide     complement(25961..26047)
FT                   /locus_tag="TK90_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.689 at
FT                   residue 29"
FT   gene            26288..27316
FT                   /locus_tag="TK90_0022"
FT   CDS_pept        26288..27316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0022"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: cja:CJA_2273
FT                   putative porin"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70539"
FT                   /db_xref="GOA:D3SBP1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP1"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADC70539.1"
FT                   /translation="MNRKHLLTSLIAAGLVVPALATADWTLYGRAHLSADILDDGADYN
FT                   EFNVSSNASRLGFKGEREFREQLIAMFQIEQQVDFDTAADNELSFATRDTFVGLRGDQW
FT                   GMLRIGKFDTPFKRARGPANFFGDQVGDLRNLTRSRAQTGRFDERFNNSIHYQTPSFGG
FT                   LTWNIQYSNETDDATTVDGADNKAYSTSLNLSLGDLTGALAYEKQEDGDVNPDAWRLAV
FT                   GYRITEAFRIGGLYQNSETVNGDEADVYGLGGQFRLSPSMYLNGHVFQLDSDLDDADAT
FT                   MYALGLEYRIDSDLRFYGNIAMVDNDDASALTPWGAARSSGPGGAMGENATAFSLGMRY
FT                   DF"
FT   sig_peptide     26288..26359
FT                   /locus_tag="TK90_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.772 at
FT                   residue 24"
FT   gene            complement(27493..29112)
FT                   /locus_tag="TK90_0023"
FT   CDS_pept        complement(27493..29112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0023"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: hha:Hhal_0237
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70540"
FT                   /db_xref="GOA:D3SBP2"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP2"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ADC70540.1"
FT                   /translation="MSDNAQDPKREIEELEARYETDHEIGEQNINPLGLDLHNPVFAVS
FT                   ALLILAFVILSLMFPEQADEGLGATRAWIGETFDWLFLSAGNLFVLFCLALILLPVGSI
FT                   RIGGQDAKPDFSVLSWFSMLFAAGMGIGLMFWAVAEPVGYFTEWFGTPLGIEGGTEEAK
FT                   HAALGATMYHWGLHPWAIYAVVGLALAFFAFNKGLPLTIRSAFYPIFGERIWGPLGHVI
FT                   DTLAVLATLFGLATSLGLGAQQAASGLESVFGIEAGLNTQVAIIIGVTVIALLSIMRGI
FT                   HGGVRVLSNINLTLAVVLLLFVALFGGFIAFLSNTGITLSAYAQYMWPLSNPVGRDDQT
FT                   FYHEWTIFFWAWWISWSPFVGMFIARVSRGRTVRQFVTAVLLVPTAVTVIWMSAFGGTG
FT                   LDQARDGVGALADGISDSSLALFQMLEHLPLTTITSLLAITLVLVFFITSSDSGSLVID
FT                   SITSGGKTDAPQSQRLFWATVEGVIAGVLLAVGGAAALQALQAGAVSAGLPFVIVLLFM
FT                   CVSLMMGLFHELKLIRLKEATG"
FT   gene            complement(29353..30405)
FT                   /locus_tag="TK90_0024"
FT   CDS_pept        complement(29353..30405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0024"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: abo:ABO_2163
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70541"
FT                   /db_xref="GOA:D3SBP3"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP3"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ADC70541.1"
FT                   /translation="MKNNISWSLTPLAGAVATALLLAPAVSPAEQEGAGGVEFDFYGSL
FT                   RLQYETADPDGEDSYDGFRDAYSRIGFNANYEINESLNAFAQLEIPLDLANGRVQDPFS
FT                   GEDEDVRIGKVGLDGAFGTVAYGRDWLPYYNAIAFPVDMFYSYQSGFATYTTFRESNSL
FT                   MYYSPDFNGFSFAASYSANGGYDDASGSPDDRYQVTGSYAFGDTTLSVGVDDANGEQNT
FT                   RIWGVSAMHSMGPWSMGAKVEYIESDQDAGAFGDDGDVAANIYAAYAVGQHIFHGTYAN
FT                   VDNYGGDVFHLGYAFNWMDGLSLFAEYYYEEEATGAVPASRARDTGRAGADFPEDGSNN
FT                   VFMVGMHYSF"
FT   sig_peptide     complement(30310..30405)
FT                   /locus_tag="TK90_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.456 at
FT                   residue 32"
FT   gene            30693..31211
FT                   /locus_tag="TK90_0025"
FT   CDS_pept        30693..31211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0025"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: dps:DP0209 MarR family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70542"
FT                   /db_xref="GOA:D3SBP4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADC70542.1"
FT                   /translation="MSAVSAQNEPHRPATEGEPDLSRSVIRQLRVIIRALQGHSRAVER
FT                   ACGISASQLWALWELQRTPGLNVSDLSRRLSVHASTTSNLLDKLEYSGLVERRRPEKDQ
FT                   RIVRLYVTPKGEALLSDAPAAPQGELNRALHALPPERLADLDEGLTLLVEAMNTTEPRA
FT                   GLQPFEVKT"
FT   gene            31238..31639
FT                   /locus_tag="TK90_0026"
FT   CDS_pept        31238..31639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70543"
FT                   /db_xref="GOA:D3SBP5"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP5"
FT                   /inference="similar to AA sequence:KEGG:Noc_0782"
FT                   /protein_id="ADC70543.1"
FT                   /translation="MRSLLPASLLLLLLPLVVLAEPRFDDPPTDSRDGGLTLEWNAEGP
FT                   VELEQASGPDFDDARVIYRGGDTSSVVSGLPDGEYRFRLRADGADDWADEARIDVAHHS
FT                   LARAFGFFALGGVVFLVLIVAILRGRPRD"
FT   sig_peptide     31238..31300
FT                   /locus_tag="TK90_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            31709..32950
FT                   /locus_tag="TK90_0027"
FT   CDS_pept        31709..32950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0027"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: noc:Noc_0781 allantoate amidohydrolase;
FT                   TIGRFAM: amidase, hydantoinase/carbamoylase family; PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70544"
FT                   /db_xref="GOA:D3SBP6"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP6"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ADC70544.1"
FT                   /translation="MHELKINMQRLQQDITELGQIGRDADRGLHRRAFSEGDRAGREWF
FT                   RGRLEAAGLDVWQDGAANLHGRLDYDGKRPVVAMGSHLDTVPGGGPLDGALGVLIGLEV
FT                   LRTAKEHEVDLQYPLEVIDFTDEEGRFGGMFGSQAMAGKLTPESISHARDLEGITLVEA
FT                   MANWGLNADDALSARRDPHTLHAFIETHIEQGPVLDRRGLSVGVVEAITGLFKWEVRLK
FT                   GQPNHAGTTPMDMRIDAFQGLAEFGGEINRLLEEHGSPNSRATIGRVELSPGAANTVPG
FT                   MATFSFEVRDTDEKVLTALAHAARRTLSSLARRRDLMFEFDVLSEIDPVRCDTGIVQTI
FT                   EATAERMGLEYLTMPSGAAHDTQSMSAITRTGMIFVPSLQGRSHSAAEWTNWEDIETGA
FT                   NLTLQSALALAARS"
FT   gene            32987..33730
FT                   /locus_tag="TK90_0028"
FT   CDS_pept        32987..33730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0028"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: rba:RB13306
FT                   N-carbamoylsarcosine amidase related protein-putative
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70545"
FT                   /db_xref="GOA:D3SBP7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP7"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ADC70545.1"
FT                   /translation="MANNDNVSQLTDYDSLDPLREQYQESLITTPVLRQELREHHVALL
FT                   CIDLQYLDAARGHGVFADSVQSGVPPEAQEYYFNRLEQTVLPNVRRLQDAFREQGLEVI
FT                   HTRIRSLTHDGRDRSPGHKRLNLHAAPGSKDAEFVEQVAPVGDEIVLDKTASGVFNSTN
FT                   LHYILRNLNISALFIVGVYSNECVSTAVRDACDLGFYVTLMDDATATVTPEMQKATITT
FT                   IKDRYARVMTTDEAIREIKKVKEAS"
FT   gene            33727..35193
FT                   /locus_tag="TK90_0029"
FT   CDS_pept        33727..35193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0029"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: noc:Noc_0779
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70546"
FT                   /db_xref="GOA:D3SBP8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP8"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ADC70546.1"
FT                   /translation="MTGLDDPILPSSIAWGLLIAFSILWVALGWWLGRHNKTAEDHMLA
FT                   GRNVGLALATATAMATWVTANTTMTAPQLALQLGVWGMLGYSLGALGLILFAPLARRIR
FT                   ELMPRGFTSGDFIRLRFGTFTWRVFLVVSLIYAFGWLVSMAMAGGVLINALAGIDYRVG
FT                   MTVILTVCVIYTLLGGLRAVIGTDFIQTIIIIAGAAFIAWLTIDKVGFEAIHFNLMEER
FT                   PELLSLLFPAAIMFLFNNLLFGVGEIFHSNVWWSRAFAFGRNVGFRAYLLGGLLWLPIP
FT                   IVAGFLALATPALGINVPAADMVGPLVAAEVLGLTGAIVVFIVVFAALASSLDSLLAAT
FT                   SDLVTRDIYRGHIRPQASEQSQFRATKVIVVLLGLLTWLAASYRGSLPIIGSLAELLYF
FT                   TGAFVASAIWPIVAGLYWRRANPQGAAWSMILGSGIGLASYFLIGFYVAALVGAAVSLA
FT                   VMVLSTWLAPRPFDWGRLSRDAAAEEVRTA"
FT   gene            35190..35312
FT                   /locus_tag="TK90_0030"
FT   CDS_pept        35190..35312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kko:Kkor_2052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70547"
FT                   /db_xref="GOA:D3SBP9"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBP9"
FT                   /inference="similar to AA sequence:KEGG:Kkor_2052"
FT                   /protein_id="ADC70547.1"
FT                   /translation="MMISSTALSVIVVVATLVATLTPILLLALFIRDWKKGCLW"
FT   sig_peptide     35190..35249
FT                   /locus_tag="TK90_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.501 at
FT                   residue 20"
FT   gene            35300..36382
FT                   /locus_tag="TK90_0031"
FT   CDS_pept        35300..36382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0031"
FT                   /product="aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain protein"
FT                   /note="PFAM: aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; aspartate/ornithine
FT                   carbamoyltransferase Asp/Orn-binding region; KEGG:
FT                   noc:Noc_0778 aspartate/ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70548"
FT                   /db_xref="GOA:D3SBQ0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ0"
FT                   /inference="protein motif:PFAM:PF02729"
FT                   /protein_id="ADC70548.1"
FT                   /translation="MPLVNYTEDPLHVLHPKDGAAGTDRPKALLEAVEEDPDPLLKLAA
FT                   AHVVSSQQFSRDELLQLFRLAAQYETTPALMHLPLAGKILISAFYEPSTRTRLSFESAW
FT                   HRLGGAVMSITDPKSTGIAKGESLADIAEMFNNYGDVLVLRSSDGEAAHNMLENLRIPL
FT                   VNAGNGIDEHPTQALADVYTLAKWRPELFTGPVAPEDRIKVGIIGVPSRMRTVRSLLRL
FT                   LSLFPEAIEEVVIISREDENFDPGQREELEEAGLKLRVVHELDPLLPELDVVYINAIAW
FT                   VGDTFESMGEGLKLDRNSPLKKGAVILHPLARGDELSTDLDDTPHNWYFAQARGAVFVR
FT                   MALLTTVVRRISAVMDTPED"
FT   gene            36472..38490
FT                   /locus_tag="TK90_0032"
FT   CDS_pept        36472..38490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0032"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); PFAM: asparagine synthase;
FT                   glutamine amidotransferase class-II; KEGG: noc:Noc_0777
FT                   asparagine synthase, glutamine-hydrolyzing"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70549"
FT                   /db_xref="GOA:D3SBQ1"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ1"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADC70549.1"
FT                   /translation="MCGIAGIFHADPNRKVDPQTLVNMAAIQYHRGPDGFGYKTLDDRG
FT                   VGFSHARLSIIDLDENRGRQPFCMTDGSIMTAVNGELYDYKRIRTDLTSRGVQFRTKSD
FT                   SEMVMHLYRREGLEDAIKHFRGEFAISLYDREHDRLVLIRDRFGIKPLYFTEANGSFVF
FT                   GSELKVLFANPDVPRQFADDGLYHQLMQTMVPGTTAFEGIHQVKPGHMVIVERAHGKLK
FT                   VRQEKYWDMDFPLASERPPEEDADENYWIEGVREQLMEAVQLRLEADVPVACYLSGGID
FT                   SCITLGLASASQQSPVKAFTIGFDNDDYDETAIAREMAESVGADQDILKLNADHLYDNF
FT                   EEALWHAERTIYNTLGVAKLLMSRHVNEAGYKVVVTGEGSDELFGGYPAFRRDMFLHGL
FT                   DTLPEADRAAWQQMLNESNELFSGAMLAEDEVDDPEFTKMMGFTPSCLQPWLAAAEHVP
FT                   GLLAPERRERMQDYQPGKAIANALDDDMLDGRHPLDKAQYVWIKTMLEGQILTWGGDRM
FT                   DMANSMEARPPFLDHHLAEFCAHLPPTLRIKGRTEKYVLRESMKGLLPKVLYEREKFAF
FT                   MAPPAHTDPVKWAAMKALADRYLSPEKVAEAGLLDPEGVRRVFEIHEDENTPAATQVQL
FT                   DAVINHMIGVQVLHEKFVATDIPALARQKADEFGWRP"
FT   gene            complement(38549..39433)
FT                   /locus_tag="TK90_0033"
FT   CDS_pept        complement(38549..39433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0033"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG:
FT                   syp:SYNPCC7002_A0886 PfkB family of carbohydrate kinases;
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70550"
FT                   /db_xref="GOA:D3SBQ2"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ2"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADC70550.1"
FT                   /translation="MIAEPSPQLIFGEVLFDVFPDGQRVLGGAPFNVAWNLHQLGEPVC
FT                   FVGGIGNDPAGAAVQARMDAIGMDARGLYRHPEAPTGEVRVELARGEPSYTIVPDQAYD
FT                   DVPAAWADALPASTPLLYHGTLALRRGNHDLLARLRERAGHRFVDVNLRDPWYTRDTTL
FT                   DLIRDADVVKLNQDELATLVPGAEDDEAEAALLEQAGIRQALVVTAGADGASIRTINGE
FT                   RFAAPAPSVPELRDAVGAGDAFASVVLLGMRQGWDWPATLERALAFAAAVCTLQGATSD
FT                   DPGFYQGARNSWD"
FT   gene            complement(39468..40769)
FT                   /locus_tag="TK90_0034"
FT   CDS_pept        complement(39468..40769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0034"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: hna:Hneap_2165 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70551"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC70551.1"
FT                   /translation="MSASEMRRTIIDLERRLEREQVQQDALRRVALRALAVVSARVPTL
FT                   DGAVQDLSRAVESSPPDSAWMDRLGAQLADAVRSSDHHEDLASAVLEVVRRGLNGFDFL
FT                   DPGLDDLHRATERRDRSEIERTLSQLFRVLHDKCERAMYERDELSDVVGEIWHRLEDVD
FT                   SALSEDEKRSERTRASVATLHDGISDNVRAMKGRMDDLEDIATLRQEISRGLDRVVEHV
FT                   AAFRNQQENDLLEALERNRLLRAKGRTLESQVSALRKRLDQARAEAYRDSLTGLPNRTA
FT                   FERYLDGLREDLGAEQPACLLVWDIDRFKAINDEYGHSAGDKVLKAVAEILAEGVRSED
FT                   FVARYGGEEFVMILTSDPDTCQRRADSIREAVDRLIVRAGKTRLRVTISAGMCPIAAGQ
FT                   STAAIFDAADHALLQAKKLGRDRVERADREPHPS"
FT   gene            complement(40851..41723)
FT                   /locus_tag="TK90_0035"
FT   CDS_pept        complement(40851..41723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0035"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   csa:Csal_3119 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70552"
FT                   /db_xref="GOA:D3SBQ4"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ4"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ADC70552.1"
FT                   /translation="MTATASGKHAEPVRAQPASPEVRGLTYQHDQGAQRLRLLSFNAQV
FT                   GIPSSRLHHYLTNSWKHVLPYKGRIGNLDRVARFISDFDIVGVQELDGGSLRSNFVDLA
FT                   SYLSEKARFPHTYNRINRNLGQFAKHSLALFSRLEPERVEMHRLPGPLPGRGAIEARYA
FT                   MENGEELVLFLLHLALGRRARQAQLDYVAERIQSERHAVVMGDLNCQQDSLEIRRLVAR
FT                   TGLLEPISCPATYPSWDPRLVFDHILLTPDLHVSDMRVYNVALSDHLPVGIEIELPAAQ
FT                   SLHGTRHTA"
FT   gene            complement(41771..43414)
FT                   /locus_tag="TK90_0036"
FT   CDS_pept        complement(41771..43414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0036"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: tcx:Tcr_0051 acetolactate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70553"
FT                   /db_xref="GOA:D3SBQ5"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ5"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ADC70553.1"
FT                   /translation="MSTTVTTAQRLVECLEQEQVERVFGLPGEENMAVLDALADSPIEF
FT                   ITTRHEQGAAFMADVHGRLSGRAGVCLATLGPGATNLITGVADANMDHAPLVAIAGQAS
FT                   THRLHKESHQVLDLKGLFQPITKYSSSVVEPEILPEVVRKAFKWAEGGKPGASFIELPE
FT                   NVAALPCPNPPLPVHAGPEAVPAEASLEAAAKLLNEAQHPLILAGNGVIRSGASGALSQ
FT                   LASALNIPVANTFMAKGVLPFRHPLALGSVGLQSQDFVNFGFHKADVIVCIGYDLVEYP
FT                   PRLWHPTGDRTLIHIDSAPAEVDGHYNVSSEVIGDLNTCLARLTDLVDPREETILRPLR
FT                   QNLIDDMNEHREDTQFPLKPQKLIWDLRTAAELDAVVITDVGAHKLWMARMFRCELPNT
FT                   CLISNGFASMGIALPGAIAAAALYPERQVIAVTGDAGFLMNVQELETAVRLNQSFVVLI
FT                   WNDNAYGLIEWKQVREYGRKAFVDFGNPDFVQLAHSFGASGVRIGPGDSLEAALREALA
FT                   TPGVTIIDCPVDYSENLKLTERLGELVCPF"
FT   gene            complement(43456..44088)
FT                   /locus_tag="TK90_0037"
FT   CDS_pept        complement(43456..44088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0037"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: mmw:Mmwyl1_0748
FT                   DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70554"
FT                   /db_xref="GOA:D3SBQ6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ6"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ADC70554.1"
FT                   /translation="MRRRDFLGAMGGAGLLLATGTSLAREYRDGQNFRTIQPPVETGLE
FT                   DGKIQVVEVFWYGCPHCYSFEPYVQEWQKGLDDDVEFVYLPAPMNDVWALHARVFYTAQ
FT                   KLEVLNEVHQPFYDAIHDQGRELRSESAILRFINQRGLDADEFREVMRSEEIRRKVTEA
FT                   GQDVQEYGVEGVPTLVIDGEAVVSASMTRSHEEMLDVADFLIERARG"
FT   sig_peptide     complement(44014..44088)
FT                   /locus_tag="TK90_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(44089..45261)
FT                   /locus_tag="TK90_0038"
FT   CDS_pept        complement(44089..45261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0038"
FT                   /product="cytochrome c-type biogenesis protein CcsB"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcsB;
FT                   PFAM: cytochrome c assembly protein; KEGG: tbd:Tbd_0185
FT                   putative transmembrane cytochrome c-type biogenesis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70555"
FT                   /db_xref="GOA:D3SBQ7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ7"
FT                   /inference="protein motif:TFAM:TIGR03144"
FT                   /protein_id="ADC70555.1"
FT                   /translation="MSVPHEALDFERPSIFRRIRPLDWAYFALVLAVAVIAHWQYGHLM
FT                   DRYDTGGLILAAGMSAWLGWFWRPWQLFSIIVAALSLFGVWLYGDDLARGSTNFWLNYI
FT                   GSGQAGVMWMSVMLYMATATYILGLFSKSDFPSRLGAAFAWIGSGAGMMALMVRWREIY
FT                   LTDPSWGYIPVSNLYEVFILLAVMTTLMYLYYEQRTGQRTMGAFVMLVIAASVTFLLWY
FT                   MWDRQAHEIEPLVPALNSWWMKIHVPTNFVGYGGFAIAAMLGVAYLIKHRFERTRPDAA
FT                   ITHRLPSKDALDSVMYKAIAIGFAFFTIATVLGAMWAAEAWGGYWTWDPKETWSLILWL
FT                   TYASWLHMRFTKGWRGPVMAWWAIIGLFVTTFTFLGVNMFLSGLHSYGEL"
FT   gene            complement(45309..47345)
FT                   /locus_tag="TK90_0039"
FT   CDS_pept        complement(45309..47345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0039"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: aeh:Mlg_2852 ResB
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70556"
FT                   /db_xref="GOA:D3SBQ8"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ8"
FT                   /inference="protein motif:PFAM:PF05140"
FT                   /protein_id="ADC70556.1"
FT                   /translation="MSNNEQVAGSAPATGARSKSARAPRRSRILVEFMGSMSLAITLLV
FT                   ALAIASVIGTVLVQNQPYTDYLIDYGPFWHEIFAGMGLYQVYSATWFLLIVTFLVVSTS
FT                   FCVYRQSPGILKDLRRYNLQVKEKSLRSFHSSATGELDQSQQEFIDHARRVLKAQGFKA
FT                   REKESEGQTVIAAMKGRWNRLGYLLTHVGIVVICVGALADGSTLLKAKEWLGIIEIETR
FT                   GVPVSEVPRSAWVPVSNPSFRGMVEIPEGSSADVVFLPMREGYFVQQLPFRIELEEFRI
FT                   ERFSTGAESSYESDLVIHDPNRDEPLRHTISVNHPLIYNGYAIYQASFADGGTRLDIEA
FT                   IPLGGEALRSLEVPGRVFQEQEIPTPQGDTRIIEFIDFKDQNVVPLLNEEGQRENRQLG
FT                   PSFDFRLMDRTGHGLYYRNYMRPALQEGAMYFLSGVRESPSDEFVYLFLPADADDSLDR
FT                   FRTYLAMLHNAEVRNTIAREVAADDPSGTAIAQTTSELMRLFAEGGYGAVHAEIDRRVP
FT                   EEQREQVGQLLMRVLHAGLQGLYMEVLEDEGVVSIQEEEQRWLEDAVSAINAISLYESP
FT                   FYFHLSDFEHREASGLQIARAPGQSTVYTGSVMLIIGIFLMFYVSYQRLWIIARRREDG
FT                   SGTQVTMAGTSNRHKVEFENRFAHLKRWIIDQKPANGSGDGQK"
FT   gene            complement(47611..48234)
FT                   /locus_tag="TK90_0040"
FT   CDS_pept        complement(47611..48234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0040"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: aeh:Mlg_2853
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70557"
FT                   /db_xref="GOA:D3SBQ9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBQ9"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADC70557.1"
FT                   /translation="MNHKLSALFAALSVSLLLPLSAAQAGDPQRGQEISQSCAACHQAD
FT                   GNSTNPEWPKLAGQHPKYTVKQLRDFKEGETRYDSLMAGEVADLDEQDMRDLAAYFAEQ
FT                   SITTETADEDVVERGERIYRGGIPSQNVAACIACHGPNGQGNPEAMFPKVAGQHATYSA
FT                   DQLYKFRDGERSNDAGRMMRNVVQRMSDEDIEAVSQYMAGLSSD"
FT   sig_peptide     complement(48157..48234)
FT                   /locus_tag="TK90_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 26"
FT   gene            48682..49293
FT                   /locus_tag="TK90_0041"
FT   CDS_pept        48682..49293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0041"
FT                   /product="ribosome biogenesis GTP-binding protein YsxC"
FT                   /note="TIGRFAM: ribosome biogenesis GTP-binding protein
FT                   YsxC; PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   dno:DNO_0391 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70558"
FT                   /db_xref="GOA:D3SBR0"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR0"
FT                   /inference="protein motif:TFAM:TIGR03598"
FT                   /protein_id="ADC70558.1"
FT                   /translation="MEPRFRETAFIKGVAQVEQLPEDDGIEIAFAGRSNAGKSSALNAL
FT                   CGRKALARVGRTPGRTQEINLFALPPDEAWRLVDLPGYGYAKVSAGQRQHWDRLLGDYL
FT                   QSRECLAGLVLIMDIRRPLTELDRQLLEWVPLERCQLHCLLTKADKLSRQAADKQLHAT
FT                   QRELEGLGIEATLQTFSSLKNQGVDDLRGLLTEWLQPVED"
FT   gene            complement(49537..50184)
FT                   /locus_tag="TK90_0042"
FT   CDS_pept        complement(49537..50184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0042"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   aeh:Mlg_1815 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70559"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR1"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADC70559.1"
FT                   /translation="MNRIPVSSLFWAFAVVAAGALLVYVTLEPGEPPPRDLAGHAQLPI
FT                   ADEVQGGPIELPIATHAERFDLGDYTDQYVWLYFGYTSCPDACPTSLGWIGGALNRLPE
FT                   ELQGQVNGVFISVDPERDTEDRLADYVAHFHADIHAATGSEEDLKPAAKRYGVFYERRA
FT                   TDSAMGDIIDHSSSTYLIGPEGDLLEIHPHGTSAADLVETLRAHAQSQGTDD"
FT   sig_peptide     complement(50131..50184)
FT                   /locus_tag="TK90_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.439 at
FT                   residue 18"
FT   gene            complement(50195..50689)
FT                   /locus_tag="TK90_0043"
FT   CDS_pept        complement(50195..50689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70560"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70560.1"
FT                   /translation="MLAHRFNRIAAWLVALLLLASAWMLAERYLDSGAAEVPIVQPQAC
FT                   DLNAGPCSTALAQGGEVRLEITPRPVPMLRELTLDLQLDAAAKTALNNPEALDLDLAGV
FT                   EMYMGYQRPRLEHTGDGRYRGTTTLPICTTESMTWAATAMPAGKSEAAFVQFRFVTARD
FT                   H"
FT   sig_peptide     complement(50621..50689)
FT                   /locus_tag="TK90_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.776) with cleavage site probability 0.648 at
FT                   residue 23"
FT   gene            complement(50695..53430)
FT                   /locus_tag="TK90_0044"
FT   CDS_pept        complement(50695..53430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0044"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mca:MCA2573 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease, SAM-fold domain; 3'-5' exonuclease; 5'-3'
FT                   exonuclease, N-terminal resolvase-like domain; SMART: 5'-3'
FT                   exonuclease; DNA-directed DNA polymerase; 3'-5'
FT                   exonuclease; Helix-hairpin-helix domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70561"
FT                   /db_xref="GOA:D3SBR3"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR3"
FT                   /inference="protein motif:TFAM:TIGR00593"
FT                   /protein_id="ADC70561.1"
FT                   /translation="MARTFRTDTALMSQAPLVLVDGSSYLFRAFHALPPLTAPDGAPTG
FT                   AMIGVANMLRKLRADYGPEHMAVVFDAKGKTFRDDIYPEYKATRPPMPDELAAQIEPLH
FT                   ELVRAMGLPLLCVEGVEADDVIATLADQAAAAGHDVVISTGDKDLAQLVNDRITLVNTM
FT                   SGVTLDREGVQEKFGVAPEQIVDYLALMGDSVDNIPGVDKVGPKTAAKWIAKYGDLDTI
FT                   LEQADDIGGKIGENLRAAAERLPTSRELITVKRDVELDAGPNDLNIREPDHERLLEMVR
FT                   RYGFTRWRAELEGSEDEAADGNPGPSQAKGDYRTLREEAELAELLERLDKADRVAFDTE
FT                   TTSLDAMRAEIVGMSFAFEPGTAWYLPLAHTGPDADPQLPRAETLERLKPWLESERHGK
FT                   LGHHLKYDRNVLGNHGITLRGIVDDTLLESFCLDAGANRHDLDSLAERHLDYKTTHYED
FT                   VAGKGVKQIPFAEVDIGIATDYAGEDADICLQLDAVFQPRLQAAEGPAFVYREIEMPLV
FT                   PVLADIERVGVKVDPDRLGEQSQELLAEMERIEREAFEEAGGEFNLGSPKQIQEILFER
FT                   LGLPVLRRTPKGQPSTAEDVLEQMADDYALPRLILEHRGLSKLRSTYTETLPRRIHPET
FT                   GRVHTSYHQAGAATGRLSSSEPNLQNIPVRTEAGRRIRRAFIAEEGHQLLAADYSQIEL
FT                   RIMAHLSQDAGLLKAFAEGQDIHRATAAEVFGLDPEQVSGDQRRAAKAINFGLIYGMSA
FT                   WGLARNLGIEQGEAREYIDRYFSRYPGVHDYMERARASGRENGYVETLFGRRLYLPEIN
FT                   SRNGARRQQSERVAINAPMQGTAADIIKRAMVRVAHDLEDTGIDARMIMQVHDELVFEV
FT                   ADAAVEDLTTLVRKAMSGAADLDVELVVDVGVGANWDDAH"
FT   gene            53516..54241
FT                   /locus_tag="TK90_0045"
FT   CDS_pept        53516..54241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   aeh:Mlg_2861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70562"
FT                   /db_xref="GOA:D3SBR4"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR4"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ADC70562.1"
FT                   /translation="MNDRERAEHPGLRPIDDSALTRESWKIFQIMAEFVEGFERLAHIK
FT                   PSVSIFGSARFPPGHPHYQLGEEVARQLSDAGFAVVSGGGPGIMEAANKGAFAGRSPSI
FT                   GLNIQLPHEQSANPYQDISLGFRHFFSRKVMFVKYASAYVVLPGGFGTLDELAEILTLV
FT                   QTGKTRRIPIVLVGSEFWKGLLHWFDDTLVSEGTIDAEDLKLYSLVDAPEDVVDVIFEH
FT                   YEARSFEPSAEEKKRMMEL"
FT   gene            54244..54642
FT                   /locus_tag="TK90_0046"
FT   CDS_pept        54244..54642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70563"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR5"
FT                   /inference="similar to AA sequence:KEGG:Daro_0165"
FT                   /protein_id="ADC70563.1"
FT                   /translation="MAAKCTHYPAALLVGLLLAPALAIAQQEREWDDAPPPPEMPDEAE
FT                   ADPAPPVLDERAREQRGLEEADIVIIERDGETRREYRMGGQLVMVEVIPAAGPSYYLID
FT                   STGDGLLDRRQRELEPDFVPPSWVIFQW"
FT   sig_peptide     54244..54321
FT                   /locus_tag="TK90_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.892 at
FT                   residue 26"
FT   gene            54642..55478
FT                   /locus_tag="TK90_0047"
FT   CDS_pept        54642..55478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0047"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csa:Csal_0546 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70564"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70564.1"
FT                   /translation="MNEHDCQACAEACGVSIEFREGEALLAGQPVQCLRLSADAASGIE
FT                   AALKGAGISPLATADADGTRILFLDQGQALREPLSAEGPGSLNALGERAASWQALHPAS
FT                   AMPEATGYRRGVLQQLLRERADALGQTLLAGERETLDAELHHQSLYRFEDLPLAGSYWH
FT                   SVRVYSEGAGLADLVMPPAPVPAFWQLARIALAIAVDEAGEIRADAYRALLAGYHARRP
FT                   LAAIERGAAPTLLRLAALDDWIGRRESGATGEAERQRLVALQGHAARVQGMWVRAA"
FT   gene            55513..56166
FT                   /locus_tag="TK90_0048"
FT   CDS_pept        55513..56166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0048"
FT                   /product="PKD domain containing protein"
FT                   /note="SMART: PKD domain containing protein; KEGG:
FT                   noc:Noc_2650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70565"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR7"
FT                   /inference="protein motif:SMART:SM00089"
FT                   /protein_id="ADC70565.1"
FT                   /translation="MNKVWVLFLVAMCLPALTQAEVYRWTDDQGNVHFGDRPPEGSASE
FT                   SVDVREPMRGVPLEGAREILERPVRPQQEEADASGYERVAITQPEDGAGVRANDGNVTA
FT                   EVALEPALDTEAGHRVVWLLNGEEAGDSTGSSITFEGLNRGEYSLQARVEDDAGQELAS
FT                   SDTIQFNVLRIAIPREQQQQQRPQQFPQGGAPQAPRAPQAPRAPQPQVQQIPQN"
FT   sig_peptide     55513..55575
FT                   /locus_tag="TK90_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.866 at
FT                   residue 21"
FT   gene            56343..57440
FT                   /locus_tag="TK90_0049"
FT   CDS_pept        56343..57440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0049"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein;
FT                   KEGG: pap:PSPA7_5858 two-component sensor NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70566"
FT                   /db_xref="GOA:D3SBR8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC70566.1"
FT                   /translation="MNNPVAKPAPAPWPWWDDLSTAVLVTDGELRLVSLNSAAEVLLGL
FT                   SRERIVGHGLGQCLRLDRSLSNRLRSVLSLDQPITLRARQMEPLRAEPFLADITITPLR
FT                   GDDGREPQLLFELNAIDRHERISREEQLQKQQAITRAVTRGLAHEIKNPLGGLRGAAQL
FT                   LASELDDDGLKEYTGIIIREADRLRSLVDRMLGPNNLPRLEAVNLHEVLEHVRGLVSVQ
FT                   LPLGLKIRGDYDPSIPDVQADRDMLVQAILNLVQNAVQALSEGGEITLVSRVLRQYTIS
FT                   GHRHRLVARLSVRDNGPGIPEEIRERIFFPMVTGRAAGTGLGLPIAQSLIQLHNGLIEC
FT                   RSRPGSTSFDILLPIEPQNAKEAGN"
FT   gene            57440..58876
FT                   /locus_tag="TK90_0050"
FT   CDS_pept        57440..58876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0050"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: aeh:Mlg_0016 nitrogen metabolism
FT                   transcriptional regulator NtrC; TIGRFAM: nitrogen
FT                   regulation protein NR(I); PFAM: sigma-54 factor interaction
FT                   domain-containing protein; response regulator receiver;
FT                   helix-turn-helix Fis-type; SMART: response regulator
FT                   receiver; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70567"
FT                   /db_xref="GOA:D3SBR9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBR9"
FT                   /inference="protein motif:TFAM:TIGR01818"
FT                   /protein_id="ADC70567.1"
FT                   /translation="MDPIVWIIDDDDSIRWVLDRALQRAGINVRGFETADAAWAALETD
FT                   EAPDTVVADIRMPGLNGLDFLARMQTRPDPPPVIIMTAFSDLESAVGAYQTGAFEYLPK
FT                   PFDVDEAVALVQRALEARATAQQNAEGGARIEDTPIIGEAPAMQEMFRAIGRLSRSNIT
FT                   VLINGESGTGKELVARALHQHSPRADQPLIALNTAAIPKDLLESELFGHERGAFTGASQ
FT                   SRKGRFEQADGGTLFLDEIGDMPFDLQTRLLRVLADGTFYRVGGHTPIRVDVRIIAATH
FT                   QDLEERVRAGLFREDLFHRLNVIRIHVPSLRERPEDIPLLVQHFMAEVACELGVEAKTM
FT                   RPEVVRELQRLPWPGNVRQLENTCRWLTVMASGREVHLDDLPAELHQDAPPMETHGGLS
FT                   DAQMATPRDWTSELAQVARQHWQQGERDLLGRVLPQLERTVIREALNVTGGHRQQAAAL
FT                   LGWGRNTLTRKIQELGIDDE"
FT   gene            complement(58883..59875)
FT                   /locus_tag="TK90_0051"
FT   CDS_pept        complement(58883..59875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0051"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /note="TIGRFAM: dihydroorotate dehydrogenase family
FT                   protein; PFAM: dihydroorotate oxidase; KEGG: noc:Noc_2822
FT                   dihydroorotate dehydrogenase 1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70568"
FT                   /db_xref="GOA:D3SBS0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024920"
FT                   /db_xref="InterPro:IPR033888"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBS0"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ADC70568.1"
FT                   /translation="MSDSRTDPRLAVDFCGLHLNTPLVLLSGCVGFGEEYTRVAGFSNR
FT                   DAGAICLKGTTGQARLGNPPHRVYETPDGMLNAIGLQNPGVDRVVDEILPALDFEETRF
FT                   FANVSGSTIEEYIEVTRRFDDSPIDAIEINISCPNVKEGGVAFGNDPEMSARVVEACRS
FT                   VTSKPLITKLSPNQTDIAENGRRCIDAGTDGFAVINTLMGMAVDVENRRAVIGNNQGGL
FT                   SGPAIKPIALLKVQQVYQVAAPHNVPIIGQGGVMNARDALEFLIAGASTVGVGTGLFYD
FT                   PLCLPKILDGIRDYMDRHGIQQVSELTGSLQLNSAISACAAPAPEDPTT"
FT   gene            59874..60338
FT                   /locus_tag="TK90_0052"
FT   CDS_pept        59874..60338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0052"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   kpe:KPK_0145 putative tRNA/rRNA methyltransferase YibK"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70569"
FT                   /db_xref="GOA:D3SBS1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBS1"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ADC70569.1"
FT                   /translation="MLHIVLYEPEIPPNTGNIIRLAANTGAALHLIHPLGFELDSARAR
FT                   RAGLDYHELARVQEYDSLERWRESIRPQREFALTTRGQARYDQAGFQSGDALLFGPETR
FT                   GLPQAVLDALPPEQRLRLPMQPDSRSLNLSNAVAVVVYEAWRQLGFPGGV"
FT   gene            60457..61329
FT                   /locus_tag="TK90_0053"
FT   CDS_pept        60457..61329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0053"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: tbd:Tbd_2269
FT                   putative dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70570"
FT                   /db_xref="GOA:D3SBS2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBS2"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ADC70570.1"
FT                   /translation="MVSAFRSFCLLAATSLLVSPLAADEPTGSDNWWWDDDWWEDGVLY
FT                   SDLENHEVEIERFEYERDGVDIPALVARPADGEAYPAILWAHGRRGLDDLAILHVKRLA
FT                   ARGFVVMAPDMYTGRFMESHPLDHDYELEGDLNKGLDVLLERDDIVGDRACLVSITRGG
FT                   YKTLKVAVTFERQVEDVACWAGYYPHLQDPNLGEPHQVYRYANEVNQLEIPMMILIGDE
FT                   EQYQRHRTAKMAADGLESRGGDVTWIEYPGVGRGFDFRNGSNRTFADDLASRDAMIRVT
FT                   RFVNQHLRD"
FT   sig_peptide     60457..60528
FT                   /locus_tag="TK90_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 24"
FT   gene            61567..62775
FT                   /locus_tag="TK90_0054"
FT   CDS_pept        61567..62775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0054"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: rfr:Rfer_0362
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70571"
FT                   /db_xref="GOA:D3SBS3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBS3"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ADC70571.1"
FT                   /translation="MAKVLIAQGGGPTAVINQSMVGAVLEARKFTDVELVYGAFHGVRG
FT                   IIDEEFLDLTQETTHNLEMVARTPSSALGSTRDKPDLDYCKEIFKVLKAHEITYFFYIG
FT                   GNDSSDTVRIVSEEARKANYPMRCVHIPKTIDNDLVENDHTPGFPSAARFVAQAFVGAN
FT                   LDNYALPGIYLAVVMGRHAGFLTAASALGKKFPDDGPHLIYVPERVFEVDRFLSDVKAT
FT                   MDRYGRCVIAVSEGIHDADGEPIATKLAKDVEKDAHGNVQLSGTGALADMLCGEIRDKL
FT                   GVKRVRGDTFGYLQRAFIGCVSDVDQREAREVGEKAVQFAMWQGRDGSVAIKRTGFYSV
FT                   DYEYVPLEAVAGKTKVMPDEFIDASGTDVTDAFRMYLRPLLGSGMPDAYRLRQNKVTKV
FT                   LGR"
FT   gene            complement(62879..63535)
FT                   /locus_tag="TK90_0055"
FT   CDS_pept        complement(62879..63535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0055"
FT                   /product="adenylate kinase"
FT                   /note="TIGRFAM: adenylate kinase; PFAM: adenylate kinase;
FT                   adenylate kinase lid domain protein; KEGG: abo:ABO_0840
FT                   adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70572"
FT                   /db_xref="GOA:D3SBS4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D3SBS4"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADC70572.1"
FT                   /translation="MRLILLGAPGAGKGTQAQYICEKYNIPQISTGDMLRAAVKAGTPL
FT                   GLKAKEVMDAGGLVSDDIILGLVKERVEQPDCCDTGFLFDGFPRTIPQAEALKEQNVPL
FT                   DFVVEVDVPDEEVIRRMSGRRVHPGSGRTYHVEFNPPKVEGKDDVTGEDLIQREDDNEE
FT                   TVRKRLEAYHSQTRPLVDFYSKWADSGEPDAPQYVHIKGTGSVEDIRDQIFKALG"
FT   gene            63687..64853
FT                   /locus_tag="TK90_0056"
FT   CDS_pept        63687..64853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC100272996"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70573"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70573.1"
FT                   /translation="MQAGPREITTPFRPIPLDIPEGMKPNEFFNSTENLADLVNNNGLL
FT                   VNPENLLLYRKALGHSNEFDCSIIYNTSQTILDPMGRPVRRTQVPEPVRHVWNRMNGVI
FT                   IEYMLEQYPDPAEALVLAGEASLDATWPLTAPGVPSIRMLHNHFIVFPMATLAEAPLAD
FT                   PGNPNLTDGGQHSLFQAYMRDVYRAFFTRALDLQILRPAPDHQARLALTGYPHGLPSWE
FT                   IQGGVEALKDIRFWREYDAVLQGFLDFYRTFFSQVSTRNAPMPEGVHFPDAVEEVLLFN
FT                   NDFLKTAKKVRDRCFTDAKYAHAIRWQPAFKQLIYRNDEGRLIVTISQNSIGNAITELL
FT                   GVVVNRVPDAEAYEHVEPALVEKLLEVRRRLVELDLGEGITTEAWSAV"
FT   gene            complement(64925..65908)
FT                   /locus_tag="TK90_0057"
FT   CDS_pept        complement(64925..65908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0057"
FT                   /product="DMSO reductase anchor subunit (DmsC)"
FT                   /note="PFAM: DMSO reductase anchor subunit (DmsC); KEGG:
FT                   har:HEAR3344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70574"
FT                   /db_xref="GOA:D3SC55"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC55"
FT                   /inference="protein motif:PFAM:PF04976"
FT                   /protein_id="ADC70574.1"
FT                   /translation="MHPAFSVIFLTTLIGAGQGLFLGLFGAEALSLLGVLPPPGSDFLA
FT                   LGSALALAFLVLGLIASFFHLGRPERAWRTATKWRTSWLSREVIVLPAFMGVVFLYGAA
FT                   HAFGFNPALGTLAGDVPVLLTVVLGAIGALLAIVLYVTTAMIYACIKFLQEWHSPLTVV
FT                   NYTVLGAANGFTLAAAYAAWAGVPLVAFLATVAIVLTLLGLGTRSASLVRNSRIKSKST
FT                   LQTAIGVKHPKIQQKSQGFMGGSFNTREFFHHMSAAFLRGMKWIFLLGAFVVPAILLLV
FT                   VLVARIDPVNLLIAAFVIQYLGMVAERWFFFAQANHPQNIYYQSVA"
FT   gene            complement(65926..66657)
FT                   /locus_tag="TK90_0058"
FT   CDS_pept        complement(65926..66657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0058"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: har:HEAR3343 putative iron-sulfur
FT                   cluster-binding protein (partial)"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70575"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC56"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC70575.1"
FT                   /translation="MTQLALVIDLNVCVGCHACVTSCKEWNTSGDAGPLVDQNPYDADP
FT                   TGTFFNRVQSFEVGEYPNTETVHFPKSCLHCEEPPCVPVCPTGASYKRESDGIVLVDYD
FT                   KCIGCKYCSWACPYGVREVDAERKVMTKCTLCVDRIYNEELPEWDRKPACVRACPTNAR
FT                   LYGDIHDPESVVSKAIREAGGYQLMPEWGSKPANHYLPRRKTQLTIREDEVERADNPLK
FT                   IDSQLPKPGQDEPSLDDVTSW"
FT   gene            complement(66942..69803)
FT                   /locus_tag="TK90_0059"
FT   CDS_pept        complement(66942..69803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0059"
FT                   /product="molybdopterin oxidoreductase Fe4S4 region"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   molydopterin dinucleotide-binding region; molybdopterin
FT                   oxidoreductase; KEGG: har:HEAR3342 putative molybdopterin
FT                   oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70576"
FT                   /db_xref="GOA:D3SC57"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC57"
FT                   /inference="protein motif:PFAM:PF04879"
FT                   /protein_id="ADC70576.1"
FT                   /translation="MAQTPSHEIKNTTCYMCACRCGIRVHLRDGEVRYIDGNPEHPINE
FT                   GVICAKGASGIMKQHSPARLTQPLRRKPGAERGDGEFEPISWEETFEILAERLGHIRET
FT                   DPKRFALFTGRDQMQALTGLFAKQFGTPNYAAHGGFCSVNMAAGMIYTIGGSFWEFGGP
FT                   DLERSKLFVMIGTAEDHHSNPLKVAISKFKRQGGRFISINPVRTGYSAIADEWVPIRPG
FT                   TDGALLLALIHEIINKGLYDRDFLVRYSNAGQLVNMDEDQDEFGMFLRTEDPPEEGCYD
FT                   AQNQLWWDRKTGRPVATHTPGADPYLLGEFTLDDGTRAKPSFQLLQDRVAEYTPEWAER
FT                   VTGIAAKDIRRLAHEMGVTARDQRIELPIAWTDSWGVEHESVTGNPVSFHAMRGLAAHS
FT                   NGFHTIRSLSILMSLLGTIDRPGGFRHKAPFPRPIPPCARTPKGPEGVQPGKPLDGMVL
FT                   GWPASPDDLFVDDKGEPVRLDKAFSWEYPLAVHGMMHNAITNAWRGDPYPIDTLLIFMA
FT                   NMAWNSTMNTEEVRKMLNDKDDNGEYKIPFLVVADAFQSEMTAFADLVLPDTTYLERHD
FT                   VMSMLDRPISEFTGPVDSVRIPVVPPKGECKPFQDVLIELGSRLKLPAFVNEKGDRKFR
FT                   DYPDFVVNYETEPGSGIGFLAGWRGKGGEKSLRGEPNPNQWEMYAKNNCVFQYELPRSY
FT                   QYMRNWNKGYLEWSQRNRITRYGEPVLIHLYSEVLMKFRAAAQGKGPTRKAPAHLAKRV
FT                   ETFFDPLPFYYDPLEHQSTDKHTYPLAAVTQRPMAMYHSWDSQNAWLRQIHAHNLLYVN
FT                   ARTARAAGIEDEDWIWAESPWGRVRCMAKYSEAVEPGTVWTWNAIGKAAGAWNLTPGAN
FT                   ESRKGFLLNHLISEELPGQSGPISNSDPVTGQAAWYDVRVRIYKAEEGEPQETSPQFKP
FT                   LKPYPGQSTRARVLNFFAGLGKR"
FT   gene            70029..70565
FT                   /locus_tag="TK90_0060"
FT   CDS_pept        70029..70565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0060"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: tbd:Tbd_1651 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70577"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC58"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ADC70577.1"
FT                   /translation="MKVCIVSDSHDRGPMLARAIEAGIVEGAEAVIHCGDVIGGNTLRA
FT                   SLKLGVPIHAVHGNNLGDPVAISRIAHQSNGLLHYYGLDATITLGGRRIFVTHYPHYAH
FT                   AMACTGDYDLVCCGHSHETEIRQQPHVQDGSTWVVNPGTVAGLGAPEATWALGDLDRMS
FT                   FEIRPTPEEAAAGIE"
FT   gene            70692..71297
FT                   /locus_tag="TK90_0061"
FT   CDS_pept        70692..71297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0061"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: lch:Lcho_2957 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70578"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC59"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ADC70578.1"
FT                   /translation="MTAEFPHKPLPSSKAAPGTGLQQVTDEEPRVTLASSALCVLTDFR
FT                   RVPVATIGPDATLGQATEQMIARGVRLLIVVDDARQVRGLITARDTQGERPIQMVNERG
FT                   LRHEDLRVRDLMAPLDDVDLLDMQRVMQADVGDIIATLKDWGRQHALVGQTDPATGETR
FT                   IRGMFSATQIGRQLGVSVQTFDVARTFAEIQAALSKTY"
FT   gene            complement(71367..72557)
FT                   /locus_tag="TK90_0062"
FT   CDS_pept        complement(71367..72557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0062"
FT                   /product="sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: abo:ABO_0730 sulfate adenylyltransferase;
FT                   TIGRFAM: sulfate adenylyltransferase; PFAM:
FT                   ATP-sulfurylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70579"
FT                   /db_xref="GOA:D3SC60"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC60"
FT                   /inference="protein motif:TFAM:TIGR00339"
FT                   /protein_id="ADC70579.1"
FT                   /translation="MIKPHGADTLKPLFVYDPEQHHALLKEAESLPSVVISSAAAGNAV
FT                   MMGGGYFTPLTGFMNVADAMNCAENMRTTSGLFFPVPVVNLLENADAIRGAKRIALRDP
FT                   NMEGNPVLAIQEVEAIEEFTPEQMETMTQKVYGTTDMEHPGVAAFNSEGRVCVSGPIQV
FT                   LHFSYFQDDFPDTFRTAVEIRNEIAERGWNKVVAFQTRNPMHRAHEELCRMALDQLGAD
FT                   GLVIHMLLGKLKPGDIPAPVRDAAIRKMAEIYFPPNTVMITGYGFDMLYAGPREAVLHA
FT                   LFRQNMGATHFIIGRDHAGVGDYYGPFDAQTIFDTEVPSDALEIEIFRADHTAFSKKLG
FT                   RVVMMCDAPDHTKEDFVLLSGTKVREMLGRGEAPPPEFSRPEVAEILMDYYQSINQ"
FT   gene            73072..73902
FT                   /locus_tag="TK90_0063"
FT   CDS_pept        73072..73902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70580"
FT                   /db_xref="GOA:D3SC61"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC61"
FT                   /inference="similar to AA sequence:KEGG:Tbd_2284"
FT                   /protein_id="ADC70580.1"
FT                   /translation="MITSNPFAELAAFIPPAAMQAYVVLMVILVAAGTILDMMHKRSAK
FT                   YFFENAKKAEKNATRSVSGGEKFSLAMQTIGKEVITSGEFKNPTRRASHLFTMWGFIVF
FT                   VVSSAVLIFGYAAEPAAGVWPLLWHLGALSLAFGGYWFWFFIRVDVNSEGRRWYQLVRA
FT                   DLFIVSLLAMSTFAILWSLTQGAGALGWVFFALFLAATTTLFATVYWSKFAHMFFKPAA
FT                   AYQKRLTRADGSAENLPTLTRDDPEQQQRHSMELLRDAPMEMGKGIQREAPNHY"
FT   gene            73942..74421
FT                   /locus_tag="TK90_0064"
FT   CDS_pept        73942..74421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0064"
FT                   /product="adenylylsulfate reductase, beta subunit"
FT                   /note="TIGRFAM: adenylylsulfate reductase, beta subunit;
FT                   PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   KEGG: tbd:Tbd_2283 adenylylsulfate reductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70581"
FT                   /db_xref="InterPro:IPR011802"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022738"
FT                   /db_xref="InterPro:IPR038465"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC62"
FT                   /inference="protein motif:TFAM:TIGR02060"
FT                   /protein_id="ADC70581.1"
FT                   /translation="MPTFVYMTRCDGCGYCVDICPSDIMHIDETTRRAYNIEPNMCWEC
FT                   YSCVKACPHHAIDVRGYADFAPLGHSVRVDRDEERGTIAWKIKFRDGREKNFLSPITTK
FT                   PWGKHIPQLADVPAPDQSMRDSQLLFNEPKYIRMDEGDLHTLEAAGLKLKEGVYY"
FT   gene            74421..76319
FT                   /locus_tag="TK90_0065"
FT   CDS_pept        74421..76319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0065"
FT                   /product="adenylylsulfate reductase, alpha subunit"
FT                   /note="TIGRFAM: adenylylsulfate reductase, alpha subunit;
FT                   PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: tbd:Tbd_2282
FT                   adenylylsulfate reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70582"
FT                   /db_xref="GOA:D3SC63"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011803"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC63"
FT                   /inference="protein motif:TFAM:TIGR02061"
FT                   /protein_id="ADC70582.1"
FT                   /translation="MAYKTIVEDNIDILVCGAGLGGTGAAWEARFWGQDKKVVIAEKAN
FT                   IDRSGAVAQGLYAINCYMGTRWGENNPEDHVRYARIDLMGMVREDLLFDMARHVDSTVH
FT                   QFEEWGLPLMRDPKTGAYQREGRWQIMIHGESYKPIVAEAAKKSADTIYNRICVTHLLM
FT                   DESKENRVAGAVGFNVRTGNYHVFKSKTVIVAAGGASMIFKPRSVGEGAGRVWYAPWSS
FT                   GSAYGLLINAGAKMTQMENRIVLARFKDGYGPVGAYFLHLKTRTQNCNGEEYESKWWPQ
FT                   LQEMVGKEYLDPEASHRTHRPIPTCLRNHAFLNEVNAGRGPIHMVTMEAFQDPHLEEVG
FT                   WENFLGMTVGQAVLWAATDVDPKNENPELTTSEPYVMGSHATGCGAWCSGPEDVSPPEY
FT                   FWGYNRMTSVEGLFGAGDAVGGTPHAFSSGSFTEGRLAAKAACKYIDDGKADGIRVSDS
FT                   QINKRKEEIYKPLEHYKIYRNEVVAGSVNPNYINPRQGLDRLQKLMDEYCGGVTVSYMT
FT                   NEKLLNIGLKKMHILEEDLDKLAAEDIHELLRAWELKHRVRTAESVFHHTLFRKETRWP
FT                   GYYYRGDYMKLDDKNWHHLTVSRRDPKTGEYTMEKAPCYHLVDKDEAPAEPEKAEA"
FT   gene            76477..76827
FT                   /locus_tag="TK90_0066"
FT   CDS_pept        76477..76827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70583"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC64"
FT                   /inference="similar to AA sequence:KEGG:Tbd_2281"
FT                   /protein_id="ADC70583.1"
FT                   /translation="MNIIDHSDEEILEIAHPMWNDLIKYSNKGQYGKFVRRFSYHLLFG
FT                   LNEVEVGKQFAQSELTRNLKEDWDFLGIIRRGEHVTVLYRVRSTKKEGEWLGRMVLGYE
FT                   EGEVRIFGASIF"
FT   gene            76844..77356
FT                   /locus_tag="TK90_0067"
FT   CDS_pept        76844..77356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0067"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase"
FT                   /note="KEGG: tbd:Tbd_2280 putative peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70584"
FT                   /db_xref="GOA:D3SC65"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC65"
FT                   /inference="similar to AA sequence:KEGG:Tbd_2280"
FT                   /protein_id="ADC70584.1"
FT                   /translation="MTDVIKDNKYVELNYQVIDEKSGQVLTEVEFPLGYVHGVNEVLSP
FT                   KVMGELEGKAQGETIEVPIDCNALYGPRDESLVITEAIENVPEEYRKLGTAILMENDRG
FT                   QTKSFLVTRLDDKTITIDGNNPLCGRQVIFKLNVLLVRDATADEIEHGGKVESGPEIDS
FT                   GRAVPIE"
FT   gene            77449..77613
FT                   /locus_tag="TK90_0068"
FT   CDS_pept        77449..77613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70585"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC66"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70585.1"
FT                   /translation="MSQDTEKKHPQVPDGKSRYLVTRQMPPNEKGFVGYETIWESFQKE
FT                   AEYTTPKRP"
FT   gene            complement(77764..79191)
FT                   /locus_tag="TK90_0069"
FT   CDS_pept        complement(77764..79191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0069"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aeh:Mlg_2679 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70586"
FT                   /db_xref="GOA:D3SC67"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC67"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADC70586.1"
FT                   /translation="MSTAAESQNRPNRDWREALSVYRHPRVVGMLFLGFAAGLPLLLTG
FT                   GTFTAWLRDLGVELASIGFLSWVGMAYSIKVLWAPIVDRMRLPLLTRIFGRRRAWMLAA
FT                   QATIMLGLFGIAFTDPTEQLWLVAVWAVLTAFGAATQDIAIDAYRIEAVSQERQGAMAA
FT                   AYVFGYRVALLTAGAGALHIAAAGSWSLSYMAMAALMLVGVVCTLIVREPEVAPRDAKT
FT                   AQLEERVVHYINNTSDTGLWRDFKAWFIGAVVCPFVDFWQRFGRIALVVIAFIAIFRIS
FT                   DIFMGVMANPFYLDLGFTKDEIANIAAAFGLAMTLTGAALGGLLVVRFGIMRMLIATAI
FT                   LAPATNLTFSWLATLGPEIYGLVFAIMADNLSGGMAISVFIAYLSSLTNSAYTATQYAL
FT                   FSSIMTLPGQFLAGFTGVFAEHLGWFWFFVSSALIGIPTILLALALMRWANPDRMAQPG
FT                   RPPELQEPPEGPERAPS"
FT   gene            complement(79213..79986)
FT                   /locus_tag="TK90_0070"
FT   CDS_pept        complement(79213..79986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0070"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: exodeoxyribonuclease III ; K01142
FT                   exodeoxyribonuclease III; TIGRFAM: exodeoxyribonuclease III
FT                   Xth; exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70587"
FT                   /db_xref="GOA:D3SC68"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC68"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ADC70587.1"
FT                   /translation="MRILSMNANGIRAAARKGFFDWLPKTEADVVCIQETKAQIHQIQG
FT                   EPFHPPGYHSAYVDAVKPGYSGVALYSRRQPDEVITRIGFEEADNEGRYVEMRFGDLSV
FT                   VSLYLPSGSSGDHRQDSKWRFLDFFRPWLAERMQDGREWVICGDWNIAHKEIDLRNWKS
FT                   NQKNSGFLPEERAWLDHLFDEIGMVDVFRRLDDRPEQYTWWSNRGQAWAKNVGWRIDYQ
FT                   IATPGIAETARDPYIHTDDRYSDHAPFWIDYDYTP"
FT   gene            80090..80725
FT                   /locus_tag="TK90_0071"
FT   CDS_pept        80090..80725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0071"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: vex:VEA_001826 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70588"
FT                   /db_xref="GOA:D3SC69"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC69"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ADC70588.1"
FT                   /translation="MTAHAFLDYALERDVLRFGEFTLKSGRTSPYFFNAGLFNRGSDLV
FT                   RLGEFYAQAIVDSGVAFDLVFGPAYKGIPLAAAVTEALYRDHDMDRPWAFNRKEAKDHG
FT                   EGGNIVGAPLAGRVLIVDDVITAGTAIRESVELIRAAGATPVAVAIALDREERGRGARS
FT                   AIQEVEDELGLEVVRVARLGDLVQMLEQTGRAPEHLEALRAYRSEYGV"
FT   gene            complement(80731..81735)
FT                   /locus_tag="TK90_0072"
FT   CDS_pept        complement(80731..81735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0072"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /note="PFAM: Peptidoglycan-binding lysin domain;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: azo:azo0897 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70589"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC70"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ADC70589.1"
FT                   /translation="MRLVVGTVLPLVALLTGCAMLGVNGKEPLTEASEESAAEGPAPAE
FT                   DLTIAEIIEALQEGDTEHADRALDRFLEGEPEHRVARSLRAQLDADPVEELGEASFEHT
FT                   VESGETLGQLARRYLGDANRFLILARYNDIERPSRLLAGQRLRIPETAPREASTADRET
FT                   LDEQLAALGGQDDEDAYLRAIEADLEAGRYAEAREGLQHAREQSGNGRWGRRLAALEHE
FT                   VEGRYWEQRGNQARDADDTGAALTAYDRALEADSGRDAARDAREELREQRKEELHSAAI
FT                   RRYRNQDLEEAIALWDEALELDPEFEAARGYRLRALELQRRLERLGHSEDGAS"
FT   sig_peptide     complement(81658..81735)
FT                   /locus_tag="TK90_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.718 at
FT                   residue 26"
FT   gene            complement(81741..82571)
FT                   /locus_tag="TK90_0073"
FT   CDS_pept        complement(81741..82571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0073"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: azo:azo0896 putative phosphoprotein
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70590"
FT                   /db_xref="GOA:D3SC71"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC71"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADC70590.1"
FT                   /translation="METAVAQEIGGRREQQDAAGVWACPGARCALLVVADGMGGHADGA
FT                   QAARMAIATAERLWNECDGRPEDPAALLERLFRETQAALYNPGAAAGDQPGTTLVALYV
FT                   GPERAWWAHCGDSRLYHFEGGRLVTRTRDHTRVQALLDAGEIREEDMATHPEQNQLLQA
FT                   LGVVDPVRVDHGETPLTPDSRFLLCSDGYWEQLSPEESARWMGQPGFQAACTKAAALAA
FT                   QRGGGHGDNVAIAAWRAQGVDTPDRHHLLAAIRPTLLGALLLLAVLAILFWPLD"
FT   gene            complement(82647..83597)
FT                   /locus_tag="TK90_0074"
FT   CDS_pept        complement(82647..83597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70591"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC72"
FT                   /inference="similar to AA sequence:KEGG:Tbd_2013"
FT                   /protein_id="ADC70591.1"
FT                   /translation="MTELKKAIEHQREYLEARLQEPLAEIAARISTAWPRREALDSILE
FT                   EAIRQIPEATFVYALNTEGIQLSDNISRSGVLPEHFGRDRSQRPYMKEAVPAAGFLLSE
FT                   AYISLLGRRPSLTALQLVRDENGTALGFLGADFDLRNLPDLSEDLYEEPNEWRQIKGDP
FT                   SIRGTLFLQSRTESLMDQHIDTALAILEELFTERGVFQGVFHFSSSRATLWTTEDPYRY
FT                   RILTHESLADPDVCLAFPHEPYPEEALIPKEAMGRVLEGLKALRFADETIYLRSASVNL
FT                   FNGMVSLTFSCDGSHYMTWDDFLGRSIDFWIGATG"
FT   gene            83886..84206
FT                   /locus_tag="TK90_0075"
FT   CDS_pept        83886..84206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70592"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC73"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_0294"
FT                   /protein_id="ADC70592.1"
FT                   /translation="MHIHLDTTDLMTRVRLESRWRSAGATVTSGDGAERPDLVVIDLAA
FT                   RDVDTVATWRERCPDAAILAFGPHVEGAMLKAARQAGADEVVVRGKVADRVSRRIEGSA
FT                   AP"
FT   gene            complement(84774..85739)
FT                   /locus_tag="TK90_0076"
FT   CDS_pept        complement(84774..85739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0076"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   rso:RSp1179 TIS1021 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70593"
FT                   /db_xref="GOA:D3S9B6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D3S9B6"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADC70593.1"
FT                   /translation="MSQRSFSDLEYSAKRKQTRRDRFLGEIDAITPWAALVEAIEPHYP
FT                   KGKRGRPPIGLERMLRMYVAQQCFNLSDEGIEDAVYDSQAIRSFVGIDLSREDAPDATT
FT                   LLQFRRLLEQHNLTQVIFDRINAHLQQRGLMLREGTVVDATLIAAPPSTKNREKARDPE
FT                   MHQARKGNQWYFGMKAHIGADVVTGLVHTVKGTAANVSDVSQVPELLHGEEASLHGDAG
FT                   YIGAEKRLEGHRPETHIARKRGTVRAMPEGPERDQVRAAERHKAQLRSIVEHPFHVVKN
FT                   LFGYRKVRYRGLKKNTAQLHSLFALANLYRARQWGLLPQG"
FT   gene            85851..86546
FT                   /locus_tag="TK90_0077"
FT   CDS_pept        85851..86546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0077"
FT                   /product="D-Ala-D-Ala dipeptidase"
FT                   /EC_number="3.4.13.22"
FT                   /note="PFAM: peptidase M15D vanX D-ala-D-ala dipeptidase;
FT                   KEGG: sfu:Sfum_0509 peptidase M15D, VanX D-ala-D-ala
FT                   dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70594"
FT                   /db_xref="GOA:D3SC75"
FT                   /db_xref="InterPro:IPR000755"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC75"
FT                   /inference="protein motif:PRIAM:3.4.13.22"
FT                   /protein_id="ADC70594.1"
FT                   /translation="MRLMSLWLAGLVLVWPIVASADEAWPPGFVAARDVVPGLVEEIRY
FT                   FGEDNFVGEPIDGYEAPVCILTVPAAEALAGVQERLKPFGLGIKVFDCYRPQQAVDHFV
FT                   RWAADPDATEMQERYYPNVPKDELFERGYIAEQSTHSRGSTVDVTLVDRETGSELDMGT
FT                   DFDRFSPRSWPDAADATPQQRANRVLLQRLMVEAGFEPYAQEWWHFTLANEPFPETSFD
FT                   FPVAHPPRD"
FT   sig_peptide     85851..85916
FT                   /locus_tag="TK90_0077"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 22"
FT   gene            86699..87604
FT                   /locus_tag="TK90_0078"
FT   CDS_pept        86699..87604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0078"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: aeh:Mlg_1916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70595"
FT                   /db_xref="GOA:D3SC76"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC76"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADC70595.1"
FT                   /translation="MGLGVGLVVLAAFFWGLSGGIGGILMAEGWDAFVVSFYRGAIGLL
FT                   FVLIWLAWRPGGSGLGSGKMWFWSAVAGLGVAGNFAFYFLSIAHGSVAVAATLMYCAPV
FT                   FVYIISFALRLESPTTLKLVAIAMVMVGIVLLTQIYDTGAGGVTLIGAGAGLLAGLSYA
FT                   IFIFGFKYAGQHGSPQAILAIAFGVLVILLMLPGDNTQMASVLTTTDWPLFLALGIFGA
FT                   GLSFAFYINGLRTTAPAVASIVAMIEPVTATLFGVAILNESLTLIQIIGMALILVTVTA
FT                   LSVSSRATPPPVPERSRDDN"
FT   gene            87666..88661
FT                   /locus_tag="TK90_0079"
FT   CDS_pept        87666..88661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0079"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: pfl:PFL_4452 D-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70596"
FT                   /db_xref="GOA:D3SC77"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC77"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADC70596.1"
FT                   /translation="MKVAVFSIQQHDHEHLVPGLTAAGMEPVVYAERLTEETIHLAAGV
FT                   DAVCVFTNDDLKRGVIDGLADQGIQVIALRCSGYDNLDVGRARERGVRVGRVPAYSPNA
FT                   VAEHAVALLLTLNRSVHRAWDRTRRGDFRLDHLTGFDLVGRTVGVVGTGRIGQVFARIM
FT                   LGFGCRVLAHDPYPNAELQAVGVEYRDLDTLLAESSVVSLSCPMTPENRHMINADTLAR
FT                   MPRGAFLINTARGALVDTDAAEIALDSGQLGGFALDVYEAEAGLFFRDWSLAGLPDRRL
FT                   ARLMQRDDVLVTGHQAFLTHEALTNIADTTVSNLTTLHQDPDAQPEGRVV"
FT   gene            complement(88722..89681)
FT                   /locus_tag="TK90_0080"
FT   CDS_pept        complement(88722..89681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0080"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   sil:SPO2822 SoxH protein,-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70597"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC78"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADC70597.1"
FT                   /translation="MLKNARNRAQLVLALAAFVLSPMLAAKEAPILPEPEAVSDHAHAW
FT                   IGPYGGPDTENQGFRMNLGYVVGEDAVAVIDSGHTPEMAQEMLEHIRATTDKPVRYVIN
FT                   TNSQPHRFMGNDVFREAGADILAAPEAVDRMQGNASMFAMQLENALDRPEGSTEHPEPP
FT                   NVTVEDREELDLGGVTLTVRHVGSAHTHGSLIAVVEPDNVVFAGDVLYSGRLLAILPDG
FT                   SMEGWLQAYELLRDEYADAKFIPGHGKPGALSTFDHATHDYLRALWDHMFEAADMGTDM
FT                   QSAIRSFDASPWQDLADFDDLAPRNANMAYQEAESALF"
FT   sig_peptide     complement(89601..89681)
FT                   /locus_tag="TK90_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 27"
FT   gene            complement(89693..91045)
FT                   /locus_tag="TK90_0081"
FT   CDS_pept        complement(89693..91045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0081"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   mpt:Mpe_A2526 CHR transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70598"
FT                   /db_xref="GOA:D3SC79"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC79"
FT                   /inference="protein motif:TFAM:TIGR00937"
FT                   /protein_id="ADC70598.1"
FT                   /translation="MTDPEHTATQRPDAPTRAEAFRYWLKLGFISFGGAAGQIGMMHDE
FT                   LVERRRWVSEKRFLHALNYTMVLPGPEAQQLATYLGWLLHGTFGGLMAGLLFILPSLFL
FT                   MIGLSWAYLAFGDVPAVEAVFYGIKPAVVAIIVYAGWRIGGRVLNNGLLWLMAIAAFLA
FT                   IFALNIPFPYIIVAAGILGWLGSRVWPERFQSGESHGAGSVESRGPAVVDDDTPPAPWM
FT                   QFRWSRVIRFLVVGLGLWAIVFGALLAVFGWDATLTRMGQFFTQTALVTFGGAYAVLPY
FT                   VYQGGVETYGWLSPTQMIDGLALGESTPGPLIMVVTFVGFIGGWTQAFLGPDQIVLAAL
FT                   LGALVATFFTFLPSFLFILVGAPLVERTRGDLHFTGPLTGITAAVVGVIVNLAVFFTWH
FT                   VLWPDGFEGAFEWFSALLGIAAFIALARFRVGIIPLITVCAVLGAGYQLLF"
FT   gene            complement(91042..92013)
FT                   /locus_tag="TK90_0082"
FT   CDS_pept        complement(91042..92013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0082"
FT                   /product="Chromate resistance exported protein"
FT                   /note="PFAM: Chromate resistance exported protein; KEGG:
FT                   rpf:Rpic12D_3250 putative chromate resistance signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70599"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC80"
FT                   /inference="protein motif:PFAM:PF09828"
FT                   /protein_id="ADC70599.1"
FT                   /translation="MDSPDTDWQLLILAFQGGQDSTRVRLWRALKALGAATLRDGVYLL
FT                   PNRSDLRDALLELAESARAAGNQAYHLPVAASAEEQVHYRSLFDREAEYRTLQTSAETL
FT                   LGQLPGLGEAELLKRLRQIHREAEQLRRTDYFPGPGRGPLEALLSRLESAAQSTLSPDE
FT                   PSPAPDSGIPRLDPADYRGRLWATRAAMWVDRVASAWLIREFIDPEARFVWLPTPADCP
FT                   AEALGFDFDGAAFTHVGDRVTFEVLLAAFGLERDSGLAGLAEMVHFLDVGGRPIPEAAG
FT                   FESILTGAKQQCADDDALLARVTPVLHDLRQAYEQQSGRDPR"
FT   gene            92161..93381
FT                   /locus_tag="TK90_0083"
FT   CDS_pept        92161..93381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0083"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: bcm:Bcenmc03_6812 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70600"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D3S9U4"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ADC70600.1"
FT                   /translation="MLDKKTLQKLGGWEGYRLERAVWPDEAGGTLELHLKPTRQWMHCE
FT                   RCGHRTRQVHETTLRRVRDLPLFEYRVVLVVPRRRVWCEHCGGPQLERLSWLGRYQRLT
FT                   NRLADACSQLLRSASIQAVAAFYGLGWHTVKTVDRHRLAASLLEPDWASIRYLAMDEFA
FT                   LHKGHRYATVVIEPIRRQVLWVGEGRSRETARAFFEQLPEGVRERIEAVAIDMTTAFEL
FT                   EIRAQCPRAEIVYDLFHVVAKYGREVIDRVRVDEAKRLGEDRRARRVIKSSRWLLLRNR
FT                   ASLNAGQAVHLDELLQANQALLTVYLLRDELKRLWFQRRPEQTWQAWRHWVQQAQESGI
FT                   HALQRFARLLEPYLPGIVSRCRHRLNTSVVEGINNTIKVIKRRAYGYRDQDYFFLKIRA
FT                   AFPGNAR"
FT   gene            complement(93440..94453)
FT                   /locus_tag="TK90_0084"
FT   CDS_pept        complement(93440..94453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0084"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: hha:Hhal_2319
FT                   inositol phosphatase/fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70601"
FT                   /db_xref="GOA:D3SC82"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC82"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ADC70601.1"
FT                   /translation="MHIGTTLTNCIIETQRGIQGATGEFTGLLNDISVACKKISNLVDK
FT                   GDLVGVLGSAGSENVQGETQKKLDIITNEVFIESLSHNGHAAGLASEEMEEICEMPADA
FT                   PRGHYLVLFDPLDGSSNIDVNVSVGTIFSILKAPEGVTDPKTEDFLQPGTKQVAAGYCL
FT                   YGPSTMMVMATGQGVKMFTLDKDFGEFLLTKDTVQIPEDTQEFAVNMSNSRFWEAPIKR
FT                   YIDECLAGKEGPRGKDFNMRWVASMVAEVHRILCRGGVFMYPMDTKMQAKGTTGKLRLM
FT                   YEANPMSFIVEQAGGAATTGRERIMDISPEGIHQRVPVVLGAKNEVERITGYHNEG"
FT   gene            94674..95939
FT                   /locus_tag="TK90_0085"
FT   CDS_pept        94674..95939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0085"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: hha:Hhal_2318
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70602"
FT                   /db_xref="GOA:D3SC83"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC83"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ADC70602.1"
FT                   /translation="MPQNALYAQSGGVTAVINASAWGVIEAVRAHPAHFGKIYAARDGI
FT                   LGVLREEIIDLDHEDPLTLAALRHTPGGAFGSCRFDLGDPDKDPEQYERLVEVFRAHDI
FT                   GTFFYNGGGGSMDTALKIAKMGERMGFPIRAIGVPKTIDNDLAVTDSSPGFGSAAKFIA
FT                   TVVREASLDVESMHTSSTKVFVMEVMGRHAGWLAAAAALAQEFDGQPPMLILFAEVPFD
FT                   QNDFLDHLNRTIERHGYCVVVVSEGLKNPDGGLFSVAQSHDVYAYTQLGGAAPRLAELI
FT                   REKTGHKLHWAVVDYIQRAARHIASKVDVEQAYACGRAAVEGVVAGEDAFMPIIRRDSN
FT                   KPYRWSIGFTHLETVADIEQGMPRNYITPDGYGITQAARDYLRPLIQGEDAPPFEQGLP
FT                   CYPRIRGELLPKRCTPFEVRSD"
FT   gene            complement(95949..96188)
FT                   /locus_tag="TK90_0086"
FT   CDS_pept        complement(95949..96188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmj:BMULJ_00966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70603"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC84"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00966"
FT                   /protein_id="ADC70603.1"
FT                   /translation="MNEIVLDSMLTCPECGHQKTETMPTDACQWFYECTGCGTLLRPLP
FT                   GDCCVFCSYGTAPCPPIQQEGPGGCCTPAKPAAE"
FT   gene            96357..96782
FT                   /locus_tag="TK90_0087"
FT   CDS_pept        96357..96782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcg:BCG9842_B3332 putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70604"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70604.1"
FT                   /translation="MKKQTLNRALAGFAAVALMGAFAAPGTVAAQGAYWLSADGSPDDI
FT                   KVEYRLRDHGCDNVRGEWRVVNDSDDYVDVTVTKTAYTCPGELDDDVRTTVRRFGTIAP
FT                   GDMRERTRDDSVCGGAWARSVEVLEYEIEKVDPPEES"
FT   sig_peptide     96357..96449
FT                   /locus_tag="TK90_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.547 at
FT                   residue 31"
FT   gene            96952..97371
FT                   /locus_tag="TK90_0088"
FT   CDS_pept        96952..97371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70605"
FT                   /db_xref="GOA:D3SC86"
FT                   /db_xref="InterPro:IPR016924"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC86"
FT                   /inference="similar to AA sequence:KEGG:Maqu_2156"
FT                   /protein_id="ADC70605.1"
FT                   /translation="MSHAPHRRWLSAPAAFLIALALALLPATPAFAGVGMLDTGSMIQQ
FT                   ASADDTRAQLLKQLDDQAVREKLVEMGVDPDRAQERVARLTPEELAQLEARMETDPAGA
FT                   AGVVGVVAIVFIVLVILDAVGVTDIFSFVGPARER"
FT   sig_peptide     96952..97050
FT                   /locus_tag="TK90_0088"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            97379..98407
FT                   /locus_tag="TK90_0089"
FT   CDS_pept        97379..98407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_1974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70606"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR039563"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC87"
FT                   /inference="similar to AA sequence:KEGG:Pmen_1974"
FT                   /protein_id="ADC70606.1"
FT                   /translation="MASVYWRRAPGLAALVCGLFAVLWLSGCATAPQSAQLSSEAPENL
FT                   PVRVELEDTPFFPQEDYQCGPAALATVLGARGIDASLEELIHEVYIPAREGSLQAEMRA
FT                   AARARDLVAYRVEPQLESILREVAEGNPVVVFQNLGVAMFPEWHFAVVMGYDLEEREVY
FT                   LRSGPIERHVNSFARFERTWARGDRWAFLVIEPDQLPATAEPLRWLRAVNELEQVGRLG
FT                   PAATGYQTAMERWPEHPIGYVGRANVAFAQGDLPTAEDALRQLIERDPQRHEGWNNLAH
FT                   VLIARQCGEQAREAASCAGELAGPGSYAPTLGAAAGAPDDGAQCRALPPCPAALEARAP
FT                   QE"
FT   sig_peptide     97379..97486
FT                   /locus_tag="TK90_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.408 at
FT                   residue 36"
FT   gene            complement(98419..98646)
FT                   /locus_tag="TK90_0090"
FT   CDS_pept        complement(98419..98646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lsa:LSA0035 putative iron-sulfur
FT                   cluster-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70607"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70607.1"
FT                   /translation="MTDDYRPPLADYWDQLEARYGGGFNFHQISRDELAQLVEHLRHAV
FT                   KEDPQVTDVEKQNLGLVLKHAEQTLDKRKA"
FT   gene            98789..99280
FT                   /locus_tag="TK90_0091"
FT   CDS_pept        98789..99280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0091"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: noc:Noc_1930 coenzyme A biosynthesis protein;
FT                   TIGRFAM: pantetheine-phosphate adenylyltransferase;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70608"
FT                   /db_xref="GOA:D3SC89"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC89"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ADC70608.1"
FT                   /translation="MPQVTAIYPGTFDPITHGHTDIVRRAARLFDRVVIAVAANPNKGP
FT                   AFPLETRVALAEEAVRGIEGVEVQGFNVLLAKFVHAQGANVILRGLRAVSDFEHEFQLA
FT                   AMNRQLAPEVETLFLTPAEEYSFVSSSLVREIARLGGDVSKFVSPGVARMLAEQNGLER
FT                   "
FT   gene            99314..99562
FT                   /locus_tag="TK90_0092"
FT   CDS_pept        99314..99562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0092"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tmz:Tmz1t_3621 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70609"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC90"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC70609.1"
FT                   /translation="MALMITDECINCDVCEPECPNEAIYPGDEIYEIDPERCTECVGHY
FT                   DEPQCQDVCPVDCIPLDPDRKETREQLQAKYEKLMGA"
FT   gene            99565..101268
FT                   /locus_tag="TK90_0093"
FT   CDS_pept        99565..101268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0093"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: noc:Noc_0769 gamma-glutamyltransferase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70610"
FT                   /db_xref="GOA:D3SC91"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC91"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ADC70610.1"
FT                   /translation="MLARLLPVALAAALLAAPVQAEGPGQGAVASAHPEATAAGERILA
FT                   AGGNAFDAAVAVTAALGVAEPYGSGLGGGGFFLLYDAENDRSVMLDARETAPGEAHRDM
FT                   YLDDDGEVVEGLSLDGVLAAGIPGMPAGIDHLSRHYGNLPLGDTLEPAIRLAEDGVEVG
FT                   SRYNQMASFRHQALRDGADAAQIFLDNGDVPDAGMRLVQPDLADTLRRLADEGRDGFYT
FT                   GELAERLVEGVREAGGIWALEDLENYEVVERDPIHIEYRGARITTASPPSSGGVALGQI
FT                   LNILSFYDLDELAPDLRAHLTIEAMRRAYRDRAEYLGDPDHVDMPLERLLSRDYAAGLR
FT                   ATIHPDEATPSRYLPLSVDPQADVPDPAQAAESPETTHFSVIDADGNRVAATLTLNYPF
FT                   GSGYVVPGTGVLLNNEMDDFSAKPGEPNAYGLIGFEANAIAPYRRPLSSMSPTFVETDD
FT                   RVAILGTPGGSRIITMVLHGILGVVEGLDAETIVEQPRYHHQYLPDRVEHETSAFDMET
FT                   RGQLVSRGHRLVPQVRPFGDMQVILWERGEGRLEAASDPRGEGGARVLSE"
FT   sig_peptide     99565..99630
FT                   /locus_tag="TK90_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(101410..101679)
FT                   /locus_tag="TK90_0094"
FT   CDS_pept        complement(101410..101679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0094"
FT                   /product="ribosomal protein S20"
FT                   /note="TIGRFAM: ribosomal protein S20; PFAM: ribosomal
FT                   protein S20; KEGG: mca:MCA2250 ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70611"
FT                   /db_xref="GOA:D3SC92"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC92"
FT                   /inference="protein motif:TFAM:TIGR00029"
FT                   /protein_id="ADC70611.1"
FT                   /translation="MANIASARKRARQAVKNRAHNMALRSRFRTAMKAVLKPLQQGDAQ
FT                   AASEAYKKAVPVIDATVSKGLIHRNKAARHKSRLNARIRDLAQG"
FT   gene            101836..102366
FT                   /locus_tag="TK90_0095"
FT   CDS_pept        101836..102366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0095"
FT                   /product="Domain of unknown function DUF1791"
FT                   /note="PFAM: Domain of unknown function DUF1791; KEGG:
FT                   tcx:Tcr_2005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70612"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC93"
FT                   /inference="protein motif:PFAM:PF08754"
FT                   /protein_id="ADC70612.1"
FT                   /translation="MFPLSRAVRMARLPGFAMALMLTGLLFAALAFTPRAEAMEPEAKV
FT                   VYHADFADPRRFSAMLTSINNMMTYYQDEFMDVDVRIVFVAHGIRFLTDDDLADTPFEA
FT                   DEELKEERDTLRGRLMSLASTHGVKLELCEITRSQIGLDQDEVYDHVEFVPSGVVRIAE
FT                   LQNEKGFAYIKIE"
FT   sig_peptide     101836..101952
FT                   /locus_tag="TK90_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.764 at
FT                   residue 39"
FT   gene            complement(102693..104900)
FT                   /locus_tag="TK90_0096"
FT   CDS_pept        complement(102693..104900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0096"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: eic:NT01EI_0118 DNA
FT                   helicase II, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70613"
FT                   /db_xref="GOA:D3SC94"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC94"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ADC70613.1"
FT                   /translation="MDVSPLLDSLNPAQREAVAAPPQPLLVLAGAGSGKTRVLVHRIAW
FT                   LIGVEGVAPHSLLAVTFTNKAAAEMRGRIEALLGHPATGLWVGTFHGLAHRLLRQHWQD
FT                   ARLPQGFQILDSDDQLRMVKRVLRGLELDEARWPPKQAQWYINARKDEGARPEHLPDTG
FT                   DPVARQWVRIYTTYQQACERAGVVDFAELMLRSLELLRDNKALLEHYRTRFRHVLVDEF
FT                   QDTNDIQYAWLRLLAGDSPVFAVGDDDQSIYGWRGARIENIQHFQQDYPGTQVVRLEQN
FT                   YRSSANILNAANALIRHNAGRLGKELWTEDKEGAPVRLYTALNEQEEARFIAETIARHV
FT                   DEGGLYRECAVLYRSNAQSRVLEETFIARRMPYRVYGGLRFFERQEIRDALAYLRLAGN
FT                   GDDDAAFLRVVNQPPRGIGEKTLEGLRQAAQAADTSLLQAATHAVDADALPGRARNAVA
FT                   GFVQLVRTLQQELPRQPLADQVEQAIERAQLREHYKKEKGERGEARLENLDELVGAARA
FT                   FDMESTAESEEGEGNRLTEFLAHAALEAGEGAADPHEDAVQMMTLHSAKGLEFPLVFLT
FT                   GMEEGLFPNARSLEEPGRLEEERRLAYVGMTRAEKELYLIHAETRRLYGRESYNVASRF
FT                   INEIPEDALEVLRPQASPFGAGRFAAARQKTAGFGSMDVQAAEASAAGLAIGARVHHAK
FT                   FGEGLITQFEGSGNSARVQVNFAHAGSKWLVLGFAKLEVLS"
FT   gene            105078..107879
FT                   /locus_tag="TK90_0097"
FT   CDS_pept        105078..107879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0097"
FT                   /product="2-oxoglutarate dehydrogenase, E1 subunit"
FT                   /EC_number="1.2.4.2"
FT                   /note="KEGG: csa:Csal_1217 2-oxoglutarate dehydrogenase E1
FT                   component; TIGRFAM: 2-oxoglutarate dehydrogenase, E1
FT                   subunit; PFAM: Transketolase central region; dehydrogenase
FT                   E1 component; SMART: Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70614"
FT                   /db_xref="GOA:D3SC95"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC95"
FT                   /inference="protein motif:TFAM:TIGR00239"
FT                   /protein_id="ADC70614.1"
FT                   /translation="MNDMPSLHRLDTPVSGQELHPDNLLFAETLLERYREDPESVPPAW
FT                   ADYFRSLESAPRRERRRRSSDRPDLAHEQLQIRVLQFINSYRYLGHFGARLDPLERAAP
FT                   EPPVELSREYHGLDRVGPEILFDPGSLFIEGPVSLDTIERVLRETYCASIGAEYMHIAA
FT                   TEEKRWLQERLESVHGHFGFGDETRLAILERLTAAEGLERYLHRRYVGQKRFSLEGAES
FT                   LIPLLNALVQRGGARGLQEVVLGMAHRGRLNVLVNLFGKAPADLAGEFEGRPRDDRGTG
FT                   DVKYHMGFSSNVETPGGPIHLALAFNPSHLEIVTPVVEGSVRARQVRIGDRKGSRVMPV
FT                   VIHGDAAFAGQGVVMETLNMSQTRGFSTKGTVHVVVNNQIGFTTSTLKDARSTHYATDV
FT                   AKMVNAPILHVNGDDPEAVVFVTQVALDYRMRFGKDVVIDLVCYRRQGHNEADEPAATQ
FT                   PHMYRRIRDLPTTRELYARTLIEAGLTEEKTQDEAFEAYRARLDAGEPVALSLHDDGHG
FT                   TTTNWAPYVNQTWDQDVETGVESARLSRMLGQLSTPPEGFQVHPRVQKILDARCAMAAG
FT                   EQPLDWGAAETLAYGTLIQDGYRIRLSGQDSGRGTFFHRHAVLHDQETGKALVPLRRLD
FT                   PDHPRFLVIDSLLSEEGVLAFEYGYSTAAPEALVVWEAQFGDFVNGAQVVIDQFISSGE
FT                   QKWGRLCGLTLLLPHGYEGQGPEHSSARPERFLQLAAQENMQVCVPTTPAQIFHLLRRQ
FT                   MVRPYRKPLVVMTPKSLLRHQDAVSDLAALAHGQYQTVIDDARIEDPQAVKRVLLTSGR
FT                   IYYDLASSQSEGQHWDVAILRLEQCYPFPEERLTELLGRYPHAEEFVWVQDEPENQGYL
FT                   GFLAPRINPLLTVRGQTLHAVARPPAAAPAVGYPEVHKAQLKDLLERAFGPISSRDTPH
FT                   PTP"
FT   gene            107908..109221
FT                   /locus_tag="TK90_0098"
FT   CDS_pept        107908..109221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0098"
FT                   /product="2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase"
FT                   /note="TIGRFAM: 2-oxoglutarate dehydrogenase, E2 subunit,
FT                   dihydrolipoamide succinyltransferase; PFAM: catalytic
FT                   domain of components of various dehydrogenase complexes; E3
FT                   binding domain protein; biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: hha:Hhal_1085
FT                   2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide
FT                   succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70615"
FT                   /db_xref="GOA:D3SC96"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC96"
FT                   /inference="protein motif:TFAM:TIGR01347"
FT                   /protein_id="ADC70615.1"
FT                   /translation="MASDPTPIQVPELPESVADATVVALHKKAGDAVKRDELIAELETD
FT                   KVVLEVSAPSAGTLTALEVSEGDVVKTDAVIGYLSAADEAAADDVDAEEEASTPAQDPR
FT                   ESTDTKAESSWSEKDDRAQAAAKATPDRASGSAPPTPSPAVRRLLQEAGLKPEDVEGTG
FT                   EDGRILREDVERAQAARSSAGQASSPAPKAERSPAREPAPTAGGIERVPMTRLRARIAE
FT                   RLLEAKQSTAMLTTFNEIDMSAAMDLRARYKETFEKRHSIKLGFMGLFVAAASRALERF
FT                   PIINAALDGEEIVYHHYSDIGIAVSSPRGLVVPVLRDTGNASISEIERRIRDFAERARD
FT                   GKLDIDELRGGTFTITNGGVFGSLFSTPIVNPPQSAILGMHAIKERPVAVDGQVVIRPM
FT                   MYVALSYDHRLVDGADAVRFLVAIKDAIEDPARLLLDV"
FT   gene            complement(109365..110201)
FT                   /locus_tag="TK90_0099"
FT   CDS_pept        complement(109365..110201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0099"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: mgm:Mmc1_3535
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70616"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC97"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ADC70616.1"
FT                   /translation="MNRTGWLGALLAGLLALPMGAAGEMDEEEGELIFGSVAMDIPARM
FT                   LSRLEPVTDYLSAELGMEVGLRLSPNMPDAIREVAEGRSDIAYLTPVAYIRARDRGQVE
FT                   PLVRTVTKGEEAFRLMLVVREDSPLETPQGLVGKRFAFGDEAALLQRATVVNAGVTLDE
FT                   LGEYHFLGHYDNIVRGVINGDFDAGILKDTTAYEWEGNGIRILHESPLLPPYVIAARDG
FT                   LDPALRERIREVLLAARADDPASGPALRALDESYDGFAPVSDADYDVIRELIAPFD"
FT   sig_peptide     complement(110130..110201)
FT                   /locus_tag="TK90_0099"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.510 at
FT                   residue 24"
FT   gene            complement(110198..111538)
FT                   /locus_tag="TK90_0100"
FT   CDS_pept        complement(110198..111538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0100"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: azo:azo1879 putative signaling protein;
FT                   TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain containing
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: GGDEF domain containing protein; histidine kinase
FT                   HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70617"
FT                   /db_xref="GOA:D3SC98"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC98"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC70617.1"
FT                   /translation="MTNGRRQLFRLGIRQKVVLILLTVLLTALSISGYLVLRDVERNVL
FT                   DETDRRGAETADYLARSLAYPVVGYDYHTLQLLLEQVVEAGGVVHVRVISDRGNTMAEM
FT                   QHPQREELERVAFERPIMLDDRDVGYLEMELSIEPILAQLQQQKRALIQREVAVIALIA
FT                   AAEFIALSWIIIGPLTRVSRSLESNVDENGVILRDIPVGSRDEIGELARRFNQMRAQLN
FT                   TANEQLRGRVEAADRELKEAYDQLLRQQSELEASNMELEQLTLTDPLTGLGNRRAFQEA
FT                   IEKDVALFRRHGDPASLLILDLDAFKQINDTHGHEGGDRILRRFAELLQDRVRTTDLVC
FT                   RLGGEEFAVFLRRAEPEDALAIAEALREAVAAMEVALDDGARASITVSIGVAWLSLEDD
FT                   LTTTRALCRAADQAMYASKRRGRNRVTDYTTLAAEDPLGQDQSGDKG"
FT   gene            complement(111699..113384)
FT                   /locus_tag="TK90_0101"
FT   CDS_pept        complement(111699..113384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0101"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: aeh:Mlg_0071 2-octaprenylphenol
FT                   hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70618"
FT                   /db_xref="GOA:D3SC99"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3SC99"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ADC70618.1"
FT                   /translation="MRRALYRGLRLWTIARVLVRYRLDVILFTLKPLRPLSFLLYLAPW
FT                   NWFRRTEGTRGERIRRALEDLGPIFIKFGQMLSTRRDLLPDDIAVELARLQDRVPPFPF
FT                   EQARALIESELERPIEIAFARFEDTPIASASIAQVHAATLQDGREVVVKVVRPGILKTI
FT                   RADLEVMHLIADLADRYWSEAKRLRPREVVDEYEKTVTDELDLIREGANAAAIHRNFED
FT                   SHLLYIPEIIWDYTRRSVLVMERIGGIPVADIAALRERNVDLKLLAERGVEIFFTQVFR
FT                   HNFFHADMHPGNIFVDATHPDDPTYLAVDFGIVGSLLDSDQRYLAENFHAFFNRDYRRV
FT                   AELHVESGWVPKDTRVDEFEAAIRTVCEPIFQRPLEEISFGQVLLRLFQTARRFNMEVQ
FT                   PQLVLLQKTLLNIEGLGRQLYPQLDLWTTAKPFIEDWMHERMGVRAFIRNAQQHLPRLL
FT                   AQLPEMPMHLEKALTVEEQRADRDAALRQQIRDLEEGLRRQNRRRHEAWGGAGLLALAG
FT                   LATQLDVSTWLGLAWPAWPLGLLGAAMLLFGLRPGPYRRPVDRN"
FT   gene            complement(113384..114019)
FT                   /locus_tag="TK90_0102"
FT   CDS_pept        complement(113384..114019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0102"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   mca:MCA2018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70619"
FT                   /db_xref="GOA:D3SCA0"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA0"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ADC70619.1"
FT                   /translation="MAEPFALPSPFTALIEAALNEHLASAPEKDRARLAGRAIAVVIEP
FT                   PGIALSLIGAADRLQVVGGVEEPVDVQLAGSPLSLAAAMARDDRSGLTITGDATVLSDL
FT                   QHALRDSGVDWEGLFERFAGAGAAGPLRDLLDQARDSLRHLGRRSAEDTADYLRDELEW
FT                   LPAGGAFEAFADDVAALRDDVARLDARLRQLGRHSPEANASAPDDRQA"
FT   gene            complement(114304..115053)
FT                   /locus_tag="TK90_0103"
FT   CDS_pept        complement(114304..115053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0103"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase; KEGG:
FT                   kko:Kkor_2259 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70620"
FT                   /db_xref="GOA:D3SCA1"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA1"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ADC70620.1"
FT                   /translation="MKEEPGKTHFGYQTVPESEKASRVGEVFHSVASRYDVMNDLMSLG
FT                   VHRIWKRYTLERTGVRPGMKILDLAGGTGDLAGAFAPRVGPKGQIVVCDINASMLEAGR
FT                   DRMLDEGHVGNLDFVQADAEQLPYPDDYFDRVTIAFGLRNVTRKERALAEMRRVIKPGG
FT                   RVLVLEFSQPMAPLRPIYDIYSFKMLPLMGKLVANDADSYRYLAESIRMHPDQETLAGM
FT                   MRDAGLERVEYDNLTGGIVALHRGTKF"
FT   gene            complement(115067..115432)
FT                   /locus_tag="TK90_0104"
FT   CDS_pept        complement(115067..115432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0104"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   mei:Msip34_1997 protein of unknown function DUF971"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70621"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA2"
FT                   /inference="protein motif:PFAM:PF06155"
FT                   /protein_id="ADC70621.1"
FT                   /translation="MSSTHRPTDIQLHQKSRILELTYSDGSHFELPCEFLRVYSPSAEV
FT                   RGHGKGQEVLQVGKEDVNITEIEPVGNYAVKLVFSDGHDTGIYDWDYLHELGTDQERLW
FT                   QDYLDRLKEAGHERKTH"
FT   gene            complement(115651..115784)
FT                   /pseudo
FT                   /locus_tag="TK90_0105"
FT                   /note="hypothetical protein"
FT   gene            116278..117177
FT                   /locus_tag="TK90_0106"
FT   CDS_pept        116278..117177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0106"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hma:rrnAC1370 cytochrome c-type biogenesis
FT                   protein CcmF"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70622"
FT                   /db_xref="GOA:D3SCA3"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70622.1"
FT                   /translation="MLWLIAYVIALIAAAGILSERSRAPVRARVLFALAVLAVPFVLET
FT                   FGWMLLGDEPHDLIAAQLGLLSYVIGPILVAWYFLYRYPLPASARHAPKLKSFRLAVGA
FT                   WHRHILFLGFMAFVVVGIGATYNPLTQWAYDRVGQHNLENEVVRAKLADQHFDIPMRYF
FT                   VIDAYVPRGYWPKAKNRRVDVGALSVYVMLPDLRPFYPEEEHLWNLEGGGRGDRVRMTI
FT                   REDDFSEPNVKTLRARAAESGEPLAPETAKTYGVDLHDVDVDAFLYARSLRLFPRDESE
FT                   AWFITCTSPEDVPSPSVL"
FT   gene            complement(117174..118262)
FT                   /locus_tag="TK90_0107"
FT   CDS_pept        complement(117174..118262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0107"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   maq:Maqu_3320 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70623"
FT                   /db_xref="GOA:D3S9Z6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D3S9Z6"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADC70623.1"
FT                   /translation="MGRPIKTLTISEAERDELESWLRRRQMPAAEQQRARMILLSTRGL
FT                   KASEIGARVGVSAETVSKWRKRFEQARIGGLTDAPRSGRPRTIDDDKVTEVINKTLQSK
FT                   PDNATHWSTTLMAKETGLNAMAISRIWRAFGLKPHRLETFKLSTDPHFVAKVHDIVGLY
FT                   MHPPDRALVLCVDEKSQIQALNRSQPALPLSFGHPETRTHDYLRHGTTTLFAALDVATG
FT                   EVIGKLHRRHRAKEFLAFLNEIDRQVPDDLDVHLILDNYGTHKTEKVRAWFAARPRYHV
FT                   HFTPTSASWINLVERFFALISQRWIKRQSHRSTRELEDSIREYLKTYNDEPRPFIWRKT
FT                   ADQIIASIARLTDRLDKNTNFC"
FT   gene            118351..118485
FT                   /locus_tag="TK90_0108"
FT   CDS_pept        118351..118485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0108"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70624"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70624.1"
FT                   /translation="MKTAFRPGIALEKTFGLEHLPDWRRIGTKSEQLVDSLAVEGANP"
FT   gene            118589..119641
FT                   /locus_tag="TK90_0109"
FT   CDS_pept        118589..119641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rlg:Rleg_2058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70625"
FT                   /db_xref="GOA:D3SCA6"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70625.1"
FT                   /translation="MSVVDLLGSVLIALIPMAVAIVAAIGVLIAVRRASAAVRIGYALL
FT                   VLALPVAVMLGFTRLLEEYAREMSAGLPVALFAFIGIPLMVVWWFRRRHPVRLETGAPA
FT                   APTVHSFRLTFRYWRLELALVVLLVLVVFTENPVSRMINDYAGRIHLKVATAHFDLSGH
FT                   KFDVPVRFFYFVHEELGHWPRPGEGRHEPATLQLSTLLPDLRPYHHEDRDRWTRGDDAL
FT                   GDRVEIMLLNEPPPGFIGPMGRLARENPQDGRTSDDGLVMFETDPQETDPKGPGSSSFF
FT                   VPEDASNDLVIRCAPPGEPPAPECIAMTAFRDDLALTYRFTLEHLPDWNRIDREVRQLL
FT                   DSLSVEGDAP"
FT   gene            119638..119742
FT                   /locus_tag="TK90_0110"
FT   CDS_pept        119638..119742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70626"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70626.1"
FT                   /translation="MSPSTRLPIPDEWLSRFTLDSVCVIRAQNGGRDS"
FT   gene            119739..120353
FT                   /locus_tag="TK90_0111"
FT   CDS_pept        119739..120353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0111"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kpn:KPN_01957 major facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70627"
FT                   /db_xref="GOA:D3SCA8"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70627.1"
FT                   /translation="MTRQAKPPKPFFDAGKLGAFGLVFWVPLVVTVLVSQVALAGETGI
FT                   ATAVWWLSEGVAGRLPMIDTIAESRRDTAGIRAALVAAIGFQPFLFVYLLFKMSRSVRP
FT                   ERPTGLALLKLIGSLTWFIAFFAFVVFAQLYAVLPAAGPELSGRMIETYDPLFEIPAVA
FT                   ATSFFFVLYISTTLASAWLWMLGTLASDSFSARGQNRGRGA"
FT   gene            120350..121294
FT                   /locus_tag="TK90_0112"
FT   CDS_pept        120350..121294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B2314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70628"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70628.1"
FT                   /translation="MSGAGRLALIVAVLAAIWLAGSALWSGIARPLLIEHGVPEAWRQL
FT                   YGEPPPLVEERPVPIRKANINGVPIAIPSNYLALVGIEYKDQSTWAPRDPDTPKPDERT
FT                   FEDEAHAFTLAVRWPDLKPRSPETDQSYWGRGDPDGDPWLQIGLGAYSNPDAIGRDLGW
FT                   APLVRGRIERIKERTHTRRLPPRNPTERWGGTEEVRIHYEMRGTDPETGLEWAEPMGPG
FT                   TERFHAWNLTLHWKGDLDGYVSDMIECYNGQMPRPESRPVCRHRFTLPEWGAWVDFGYP
FT                   RALLPQWREIRSAVRDLILDFEADPLENAEEGP"
FT   gene            121291..121926
FT                   /locus_tag="TK90_0113"
FT   CDS_pept        121291..121926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70629"
FT                   /db_xref="GOA:D3SCB0"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70629.1"
FT                   /translation="MSIRQSLIDLLAKYPGPTEAEARRWRYALMAMGAFALLAEGVLVY
FT                   ILYYMDPAAPPFWLAAPAGWLWEHVPAARGFTNSSYGLRAQMPYVFVVFFLLVIATAAL
FT                   VACCNRRGSIFGMAVNFLQEGIFRQGVILVAVPIVYYAVAFFVFSSDLEAVSSPSERSY
FT                   RHYGLFFETEMGVATAWVPLALFCGSFIGVHLSMIAEIPRLLRAARIG"
FT   gene            121963..122259
FT                   /locus_tag="TK90_0114"
FT   CDS_pept        121963..122259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70630"
FT                   /db_xref="GOA:D3SCB1"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB1"
FT                   /inference="similar to AA sequence:KEGG:PAE0435"
FT                   /protein_id="ADC70630.1"
FT                   /translation="MYTLAYFSLWLSFLFVWAALFSLIILGSRRRAVLGARMSYAGLTL
FT                   LAPFAVLFLGALSVWYAPEGVPGWLEMTLVFYLPLVTPYLVRTLFVLRWPVHA"
FT   sig_peptide     121963..122019
FT                   /locus_tag="TK90_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.773 at
FT                   residue 19"
FT   gene            complement(122438..123772)
FT                   /locus_tag="TK90_0115"
FT   CDS_pept        complement(122438..123772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0115"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: aeh:Mlg_0067 ATP-dependent protease
FT                   ATP-binding subunit HslU; TIGRFAM: heat shock protein
FT                   HslVU, ATPase subunit HslU; PFAM: ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70631"
FT                   /db_xref="GOA:D3SCB2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB2"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ADC70631.1"
FT                   /translation="MTDMTPREIVQELDRYIIGQDEAKRSVAVALRNRWRRRQLPPELQ
FT                   PEVTPKNILMIGPTGVGKTEIARRLAKLARAPFIKIEATKFTEVGYVGRDVESIIRDLA
FT                   EAAVKQLRDEAIKENRVKAEDAAEERILDALLPRPRNAGFTESAQDDSNSETRQKLRKR
FT                   LREGDLDEREIDIEVQQNPHGVEIMTPPGMEEMASQLQSMFQNLGGQKTRSRRLQIAEA
FT                   RKLLIEEEAARLINDEELKERAIERVEQSGIVFLDEIDKVAKGSDKGSSGEVSREGVQR
FT                   DLLPLIEGTTVSTKLGMVRTDHILFIASGAFHLSKPSDLVPELQGRLPIRVELDALSAD
FT                   AFVRILTEPTASLTEQYVELMKTEGVELRFEEDGVRRLAEIAFDVNARTENIGARRLHT
FT                   VLERLLQDVAYRAPDVDGAVIVDRAFVDERLADLVENEDLSRYIL"
FT   gene            complement(123814..124356)
FT                   /locus_tag="TK90_0116"
FT   CDS_pept        complement(123814..124356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0116"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   hch:HCH_05979 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70632"
FT                   /db_xref="GOA:D3SCB3"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB3"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ADC70632.1"
FT                   /translation="MEQFRGTTIVCVRKDGAVTLGGDGQVSLGNTVMKGNARKVRRVYH
FT                   DRILAGFAGGTADAFTLFERFEGMLEKHSGNITRAAVELAKDWRTDRALRRLEALLAVS
FT                   DRDNSFVISGNGDVIEPENALIAIGSGGPYAQASAQALLQNTDLSARDVVEKSLNIAAD
FT                   ICVYTNHNITLESLDAE"
FT   gene            complement(124535..125485)
FT                   /locus_tag="TK90_0117"
FT   CDS_pept        complement(124535..125485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0117"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: avn:Avin_47730 tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70633"
FT                   /db_xref="GOA:D3SCB4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB4"
FT                   /inference="protein motif:TFAM:TIGR02224"
FT                   /protein_id="ADC70633.1"
FT                   /translation="MSSGPNPPPEAAAETTAHDADIAAFLAHLRDVRGHSPHTIKAYQR
FT                   DLAHLRRLHSGPWDQLKAADMRRIAGQLARQGHHPRSIQRFLSAARGFFAHQVEHRRMP
FT                   ANPAAGLRGPRAGRALPRDLDVDQTQQALTPAEDLDPILAARDQAMLELLYSSGLRLSE
FT                   LTGLDLTDLDLDAGLVRVLGKGRRERSVPVGRMARDALRNWLKCRGDWAAPDAHAVFVS
FT                   RRGQRIGNRAVQRRVAEAGRRAGLDVRLHPHRLRHAFASHLLESSGDLRAIQELLGHAN
FT                   LETTQIYTHLDYQHLAQVYDAAHPRARRDRSPGKR"
FT   gene            complement(125457..126194)
FT                   /locus_tag="TK90_0118"
FT   CDS_pept        complement(125457..126194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0118"
FT                   /product="putative phytochrome sensor protein"
FT                   /note="PFAM: protein of unknown function DUF484; SMART: GAF
FT                   domain protein; KEGG: abo:ABO_2333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70634"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB5"
FT                   /inference="protein motif:PFAM:PF04340"
FT                   /protein_id="ADC70634.1"
FT                   /translation="MTGQSSNASAAKPAKNRAPENNNHQGISAGDVEAYLRDHPDFFQD
FT                   HLPLLDILRLPHPAGGAVSLLERQVTLLREKHRAMEQHMGELVERARDNERMGQHLHEL
FT                   AKTLMRAENLDAVLALTQDALRNELGAERVSIRLADREVDDLHALESSELSTFDPLFAR
FT                   GKAQCGRVPGEMLDVLFDSADGIGSAILMPLGDESDRIGVLGLASDSVDRFQPDMGTYF
FT                   VTHIGDLLAESIRCHVERTQSAA"
FT   gene            complement(126191..127027)
FT                   /locus_tag="TK90_0119"
FT   CDS_pept        complement(126191..127027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0119"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: cja:CJA_3290 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70635"
FT                   /db_xref="GOA:D3SCB6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB6"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ADC70635.1"
FT                   /translation="MRLEFTKMHGLGNDFVVIDGTRQDVRLDEATLRQLADRHFGIGCD
FT                   QILLVEPPGDPTQALFRYRIFNADGSEVEQCGNGARCFARFVREQGLTEAREIPVETLG
FT                   GRIVLHVEDDEHVRVNMGQPVFTPEQIPLVAEHEADAYTLDVQGHAITLGAVSMGNPHA
FT                   VLLVDDVASAPVTEVGPLIERHECFPRRVNVGFAALRDRTHVDLRVFERGVGETLACGS
FT                   GAAAAMAILRRRNLVDDEVEVSLPGGTLVLSWNAQAEAPVWLTGPATTVFNGWIDL"
FT   gene            complement(127027..127701)
FT                   /locus_tag="TK90_0120"
FT   CDS_pept        complement(127027..127701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0120"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: mca:MCA2592
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70636"
FT                   /db_xref="GOA:D3SCB7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB7"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADC70636.1"
FT                   /translation="MIPRRPEPELMLEPEQARAYADADFAAPHEGFVDAFAEAFPGPVT
FT                   GPVLDLGCGPGDVSLRFAAHYPACEVDGLDGAPAMLAAGDALMAGHPAAPRVHLAEGCL
FT                   PEARGPRAPYATIISNSLLHHLHEPAVLWQTIVRDGAAGAAVFVMDLRRPDSEQTVKAL
FT                   VAEYAADDPDVLRRDFEHSLRAAFTPDEVRAQLADAGLDDFAVRATSDRHMIIFGHLPE
FT                   AT"
FT   gene            complement(127698..129002)
FT                   /locus_tag="TK90_0121"
FT   CDS_pept        complement(127698..129002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0121"
FT                   /product="diaminopimelate decarboxylase"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: pag:PLES_56721
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70637"
FT                   /db_xref="GOA:D3SCB8"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB8"
FT                   /inference="protein motif:TFAM:TIGR01048"
FT                   /protein_id="ADC70637.1"
FT                   /translation="MDYFDYHGNTLHAEGVALDHLAQLVGTPAYVYSRATLERHYRAFS
FT                   EALIGTPHQVCFAVKANSALGVLNVLARLGAGFDIVSGGELERVLRAGGDPAKVVFSGV
FT                   GKTAAEMRRALKVGIHCFNVESAPELERLESIAAEMGVTAPVSIRVNPDVDAETHPYIA
FT                   TGLRENKFGVAIEEAPALYARVRDSQHLEATGVDFHIGSQLTRIDPFTDALKRVLTLVD
FT                   QLAADGIELEHIDVGGGLGVRYRDETPPEPDAWASALRKVMGERSLKVLLEPGRAIAAN
FT                   AGVFLTRVEYLKHTEAHDFAIVDGAMNDLLRPALYGAWQEIIPVVQRRETAARTYDIVG
FT                   PVCETGDFLGRERELALAAGDVLAVRSAGAYGYVMAGNYNSRPRPPEIMVDGDHFQIIN
FT                   RREQVDHLMMRESMLPRDPEDADPDDENPPGSVDP"
FT   gene            complement(129003..129137)
FT                   /locus_tag="TK90_0122"
FT   CDS_pept        complement(129003..129137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70638"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70638.1"
FT                   /translation="MRSCKAQWLLIAVVVVLGTMQMLASCGQKGDLYLPDDDETEERR"
FT   sig_peptide     complement(129054..129137)
FT                   /locus_tag="TK90_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.843) with cleavage site probability 0.596 at
FT                   residue 28"
FT   gene            129450..129923
FT                   /locus_tag="TK90_0123"
FT   CDS_pept        129450..129923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0123"
FT                   /product="transmembrane proetin, twin-arginine
FT                   translocation pathway signal"
FT                   /note="KEGG: hha:Hhal_1941 transmembrane proetin,
FT                   twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70639"
FT                   /db_xref="GOA:D3SCC0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC0"
FT                   /inference="similar to AA sequence:KEGG:Hhal_1941"
FT                   /protein_id="ADC70639.1"
FT                   /translation="MISTKRRVFLKGTLAAGTVGVAVGAGLLAPSKLLAAWPSSTFEAE
FT                   GLDAAMEAALGSTDIPDSDDIDLSAPEIAENGAVVPVSIETSLDDVTEIALFAEENDFA
FT                   ATAHYILASGTKPKVSSRIRLGESSNVVAAVKSGDSWYKTVREVKVTVGGCGG"
FT   sig_peptide     129450..129557
FT                   /locus_tag="TK90_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 36"
FT   gene            129970..130254
FT                   /locus_tag="TK90_0124"
FT   CDS_pept        129970..130254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0124"
FT                   /product="Sulphur oxidation protein SoxZ"
FT                   /note="PFAM: Sulphur oxidation protein SoxZ; KEGG:
FT                   hha:Hhal_1942 sulfur oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70640"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC1"
FT                   /inference="protein motif:PFAM:PF08770"
FT                   /protein_id="ADC70640.1"
FT                   /translation="MSIRVRAQESNGVVNVRALMSHDMLVPDDDGGPHFIETVEIKRNG
FT                   EDAITAYWNFTVSRNPFLQVEFDGSAGDTVSVSWTDNKGESDSTEVEVG"
FT   gene            130405..130998
FT                   /locus_tag="TK90_0125"
FT   CDS_pept        130405..130998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0125"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   hch:HCH_01342 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70641"
FT                   /db_xref="GOA:D3SCC2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC2"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ADC70641.1"
FT                   /translation="MTERTASIRRDTLETQITVELNLDGKGTSQLETGVPFLDHMLDQV
FT                   ARHGMVDLSVRAQGDLHIDAHHTVEDVGITLGQALAKALGDKKGIRRYGHAYVPLDEAL
FT                   ARVVIDFSGRPGLEMHADFRRSHIGEFDVDLFHEFFQGLVNHAWMTLHIDSLRGDNAHH
FT                   VAETIFKAFGRALRMAAEADPRAEGITPSTKGSL"
FT   gene            131025..131681
FT                   /locus_tag="TK90_0126"
FT   CDS_pept        131025..131681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0126"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; KEGG: avn:Avin_04600 imidazole
FT                   glycerol phosphate synthase, glutamine amidotransferase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70642"
FT                   /db_xref="GOA:D3SCC3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC3"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ADC70642.1"
FT                   /translation="METVAVIDYGMGNLHSVVRALEHESGADQRILLTDDPDTLREADR
FT                   LVFPGQGAAGDAMRALASRGLDRLLPELTADRPFLGLCLGQQILMQHSEESGGVDLLGI
FT                   LPGRVARFPECDGPDGRRLKIPHMGWNRVLPTGEHPLWHGLPETPWFYFVHSYRVLPEN
FT                   ETDIAGRTDYGETFASALARGSLFTMQCHPEKSAACGLRLLHNFLRWDGEGPGAA"
FT   gene            131692..132423
FT                   /locus_tag="TK90_0127"
FT   CDS_pept        131692..132423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0127"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="KEGG: mca:MCA2803 1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase; TIGRFAM:
FT                   phosphoribosylformimino-5-aminoimidazole carboxamide
FT                   ribotide isomerase; PFAM: histidine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70643"
FT                   /db_xref="GOA:D3SCC4"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC4"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ADC70643.1"
FT                   /translation="MLVIPAIDLKEGKCVRLRQGKMEDSTVFGEDPVEMAKRWVDAGAE
FT                   RLHIVDLDGAFAGHPRNAEAVHAIAEAFPDLPIQIGGGIRDEDTVQAYLDAGVEFVIIG
FT                   TRAVSAPHFVNDLCLEFPGRIIVGLDAKDGKLAVDGWSKLSHHDVIDLAQHFEADGVVA
FT                   FVYTDIARDGMMKGPNVEATARLASNVRVPVIASGGISSLDDLRQLAENEEEGITGAIV
FT                   GRALYEGAFTLEEARKAASGG"
FT   gene            132425..133216
FT                   /locus_tag="TK90_0128"
FT   CDS_pept        132425..133216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0128"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: bpr:GBP346_A3845 imidazoleglycerol phosphate
FT                   synthase, cyclase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70644"
FT                   /db_xref="GOA:D3SCC5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC5"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ADC70644.1"
FT                   /translation="MLAKRIIPCLDVDAGRVVKGVNFVGIRDAGDPVEIARRYNAQGAD
FT                   EITFLDITASSDDRDTILHVVEEVAREVFIPLTVGGGVRAVEDIRRLLNAGADKVSINT
FT                   AAVHRPELVREAADWVGSQCIVVAIDAKRVSAEGESPRWEVFTHGGRRETDLEVVEWAQ
FT                   RMESLGAGEILLTSMDRDGTRIGFDLELTRAVSDAVGIPVIASGGVGELQHLVEGVTEG
FT                   HADAVLAASIFHFGQHTVGEAKDAMAAAGVPVRPNDAGVAA"
FT   gene            133216..133593
FT                   /locus_tag="TK90_0129"
FT   CDS_pept        133216..133593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0129"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-ATP pyrophosphohydrolase; KEGG:
FT                   mei:Msip34_0274 phosphoribosyl-ATP diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70645"
FT                   /db_xref="GOA:D3SCC6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC6"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ADC70645.1"
FT                   /translation="MAGRASDARAGAELLSALAEVIEQRRQADPEQSYVAKLHARGLDE
FT                   MLKKLGEESAETIIAGKNDDSDALVSEMADLWFHSLIVLAARGRHPDDVLDELARRFGL
FT                   SGIAEKAARRASGQRSDKNDK"
FT   gene            133667..133969
FT                   /locus_tag="TK90_0130"
FT   CDS_pept        133667..133969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0130"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: vsp:VS_0101 twin arginine translocase
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70646"
FT                   /db_xref="GOA:D3SCC7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC7"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ADC70646.1"
FT                   /translation="MGIGGISIWQLLIILLIVVLLFGTKKLRNMGGDVGSALKNFRQAV
FT                   KDPDGQNKQDDNAEGQDGETPEVEDQTGDKGRVVDGEVKNSSEQETETSQSDKKS"
FT   gene            134014..134718
FT                   /locus_tag="TK90_0131"
FT   CDS_pept        134014..134718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0131"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: bpt:Bpet0128 sec-independent protein
FT                   translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70647"
FT                   /db_xref="GOA:D3SCC8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC8"
FT                   /inference="protein motif:TFAM:TIGR01410"
FT                   /protein_id="ADC70647.1"
FT                   /translation="MFDIGFWEIIIIVLVALLVVGPERLPGLAREIGRWVGKTRRFVHS
FT                   VRSDFEQELQTDELRKMLQSQEREIRQLKGTMEETEKDLREDIEETEKDLREDIEGKPA
FT                   ARKGLTQDHLKALDDKRAATDKQTKKPAVRERRPADADDAQDEADPEQAEVRRVPTRSG
FT                   IDGNLMTDDPALEAERKARAGEADRPKRKKPAVRPRRTAKSDTPESVDRQDAAPDQSSD
FT                   STHDDQAPDKHS"
FT   gene            134715..135911
FT                   /locus_tag="TK90_0132"
FT   CDS_pept        134715..135911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0132"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: aha:AHA_0089 twin arginine-targeting
FT                   protein translocase TatC"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70648"
FT                   /db_xref="GOA:D3SCC9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCC9"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ADC70648.1"
FT                   /translation="MSKTKPEVEPSPEATETLLTHLIELRDRVLRMFIAILVVFLVLFP
FT                   FANPIYTWLADPLMQHLPEGTSMIAIDVAAPFLIPFKLVLLLAVVISIPYLLYQVWSFV
FT                   APGLYSHEKNMALPLVASSTILFYLGMAFAYFVVFPLIFAFFTATAPEGVSVMTDISRY
FT                   LSFVIMLFIAFGIAFEVPVATILLVSLGATTPDKLAKKRPYVIVGVFLIGMVLTPPDII
FT                   SQTLLALPMWLLFEIGLILSRIMERKKAEKRRAQGGDEPDDLSDDSGDGPDDPDGGPGG
FT                   GGKGASGTSSRKAAAATATAGAASSSSSAGARETPASARAGYTPMTDEEMDAELDRIEA
FT                   EQAELQRQKEARKSSESQTDETPGTDLSQDDTPQEPARDDARADEGPSQEDYDEGRFR"
FT   gene            136050..137600
FT                   /locus_tag="TK90_0133"
FT   CDS_pept        136050..137600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0133"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.-"
FT                   /note="KEGG: hna:Hneap_0120 phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: BPG-independent
FT                   PGAM domain protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70649"
FT                   /db_xref="GOA:D3SCD0"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD0"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ADC70649.1"
FT                   /translation="MADPRPTPRRPVLLIVMDGVGVNPSKVNNAYAEANTPRLDEYLST
FT                   HAHTTLDACGRAVGLPDGQMGNSEVGHLTLGAGTVINQDLVRIDDSIADGSFYENDALV
FT                   SAARAAANNDLPLHLIGLVSDGGVHSHIRHLRALVEICQREGARPMVHMITDGRDTAPR
FT                   SALNYLDPLEEELASAGGAIATVCGRYYAMDRDKRWSRTEKAFRAIAYAEGEPARSARE
FT                   AIEAAYAAGEDDEFINPRIINGGAPLGQDAVCVLFNFRNDRPRQLTAALGLDDFDGFDR
FT                   GEFRPVAETCLTEYDPRFLSPIAFPPERPSTTLGSTIASAGIPQFHCAETEKYAHVTFF
FT                   FNGGKEEPYAGEQRVMVPSPPVDTYDEQPEMSAVEVADETIKAMEGGRYGFILVNFANG
FT                   DMVGHTAKREALLQAVEVLDREVGRVLDAAKDAGYSVIVTADHGNCDEYIDPVTGDPHT
FT                   QHTIYPVMCMITDSQRWRLRTGGGLADVAPTVLELMGVPKPAAMGGCSLLLEEVPEPA"
FT   gene            137609..137965
FT                   /locus_tag="TK90_0134"
FT   CDS_pept        137609..137965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0134"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   mac:MA3617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70650"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD1"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ADC70650.1"
FT                   /translation="MYTRYDDIPAYDTKDGSEIRELMHPDSHGNAAQSLAEAVVAPGAT
FT                   THLHRHAQTEELYHITRGRGEMRLGEETFEVTVGDTVCIHPGTPHNIRNTGTEPLHILC
FT                   SCAPPYSHGDTELL"
FT   gene            complement(137982..139670)
FT                   /locus_tag="TK90_0135"
FT   CDS_pept        complement(137982..139670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0135"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   serine/threonine protein kinase; Tyrosine-protein kinase,
FT                   subgroup, catalytic domain; histidine kinase HAMP region
FT                   domain protein; KEGG: azo:azo0898 putative serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70651"
FT                   /db_xref="GOA:D3SCD2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD2"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADC70651.1"
FT                   /translation="MQRIGRYGVGEEIGRGAMAVIYRGFDPEIRRELAIKCLQDDYARR
FT                   PEYRRRFLVEARAAGTLTHPGIVTIFDVGESGDRPFIAMELLDGITLAAFAEQFRPLLL
FT                   RNVLKIAIQLTEALDYAHRNGVVHRDIKPENIIVTSATVNIKVMDFGIAQTLNDPAWRA
FT                   DSDGYVAGSPHYMAPEQIRGLSTDARADLYSVGVVLYELLTGSTPFRGHEVEGLLTRVV
FT                   RDPPPPLRPIVRDCPPELIELVERLLEKQPDQRYQSAGELLVELQRIDEERMERERAGA
FT                   GRRIIPLRWRWPAILGATVAITLAAAGALVQKKQNEVITDLAFDYGSTLAQIISVESAE
FT                   DLLLEDTIAVQGRLQDMQDNREIALLSVADHQGRVVASSDRASLGSPFESPPEEHLLTR
FT                   RGGQAIWSLEDPDGREMFLFEAPVRFQEIEIGRLQVGLSTRSLRAANQTTLLALTLLAL
FT                   VTLLAVSLGAYVLARRLQAPLDTLRGALDQIGQGRLDTRIRARRRDDFERVYAAYNAMA
FT                   DSLEARMKQRPAPQQQAPQAESDSERTLILEEDTEADRPERTPPA"
FT   gene            complement(139685..140218)
FT                   /locus_tag="TK90_0136"
FT   CDS_pept        complement(139685..140218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0136"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: azo:azo0899 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70652"
FT                   /db_xref="GOA:D3SCD3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD3"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADC70652.1"
FT                   /translation="MSDQGRDSERERSGPQGTMLFQGATLPETEATAEQSRTPPGGHPV
FT                   LVGVAEPFRQQRLTLKPGKQSVGRQGDNDIVLQEGSVSSQHAWLVNDGGACRVVNLLST
FT                   NGTWVNERKVHEATLNDGDHVRFGRAEFIFRRRDDGSEAVPVGGVRRSSWRWIGVAVAI
FT                   LVLAAVARILLENT"
FT   gene            140350..140730
FT                   /locus_tag="TK90_0137"
FT   CDS_pept        140350..140730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kko:Kkor_0847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70653"
FT                   /db_xref="GOA:D3SCD4"
FT                   /db_xref="InterPro:IPR035287"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD4"
FT                   /inference="similar to AA sequence:KEGG:Kkor_0847"
FT                   /protein_id="ADC70653.1"
FT                   /translation="MEAESTGNPQLRELIEPLVRGKFWMQLIGIMLVISGVLTALSIVG
FT                   ILIAWIPIWAGVVLMQAAGASQRAFDSADPLEIKYALSRLRIYFTIFGVLLLIYLALMI
FT                   VGMLFGIGAGMMGLGAMGEHMQ"
FT   gene            140842..141909
FT                   /locus_tag="TK90_0138"
FT   CDS_pept        140842..141909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0138"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: pmy:Pmen_3540 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70654"
FT                   /db_xref="GOA:D3SCD5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC70654.1"
FT                   /translation="MDPLYAEGEDTRRGFAAWLRATRIPQVRYIAFLTAALYLLYAAIE
FT                   QTVAVDASGQRLLAHGLLVPGMLLAVAAMTFRASLQRPMWALLIIAPVVANAANLYLNA
FT                   GSPQFLVFAPEIYLSIMWTFAISGLALRQAALAATGIVVLVVAASLLQTLETGLLQLHL
FT                   LWVLAAFSFGCLSAFVLERALKLTFLQQRELAHSAQVDELTSLSNRAHIEQLFEEECAR
FT                   TERYGQPFSVILIDIDYFKAVNDTWGHRTGDTVLKQFAELLRQNLRKVDAIGRIGGEEF
FT                   FVLLPQTDAEQAQAAARDLQARINAFDFDAVGRRTASFGVTEYRPGERRVDTFDRADQA
FT                   LYAAKKNGRNRIEVR"
FT   gene            complement(141969..142631)
FT                   /locus_tag="TK90_0139"
FT   CDS_pept        complement(141969..142631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dba:Dbac_2253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70655"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70655.1"
FT                   /translation="MLYCARHKYRQEDHGIATASRYRSASALAALLAACQIGAATARDD
FT                   GAAVQQRPDISVFAYGARWTDTRFVEILQFQTAMQDSHLAAAGISRRLHRFSDHLHLEG
FT                   EISVARHWGQQDHFELNAAANLRWTRFPWDQLVDTSAAWGIGPSRAFGDPVIEDRRPSR
FT                   TQAFMMAEVTFAPSASRDSSWEAFLRIHHRSGVFGVVSDASGSNFIGTGVRFHFGPR"
FT   gene            complement(142782..144671)
FT                   /locus_tag="TK90_0140"
FT   CDS_pept        complement(142782..144671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0140"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: hna:Hneap_0500
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70656"
FT                   /db_xref="GOA:D3SCD7"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD7"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ADC70656.1"
FT                   /translation="MSAIPESFARKTAEVSAEVTRPFPNSEKRYVEGSRADIRVPYREV
FT                   AQTPTMTSGTPEENPPIPVYDTSGPYTDPDASIDLHRGLADLRGPWIDERADTEWLDGP
FT                   SSEYGRARAADPELASLRFGHIRPPRRAQAGANVSQMHYARKGIITPEMEYVAIRENNR
FT                   LQELRADPRYQKLLRQHAGESFGASIPDEITPEFVRDEIARGRAIIPANINHPELEPMI
FT                   IGRNFRVKVNTNIGNSAVTSSIEEEVEKLVWSARWGGDTLMDLSTGKNIHETREWILRN
FT                   SPVPIGTVPIYQALEKVDGKPEDLTWELFRDTLIEQAEQGVDYFTIHAGVRLQYVPLTA
FT                   DRVTGIVSRGGSIMAKWCLAHHQENFLYTHFDEICEIMKAFDVSFSLGDGLRPGCLADA
FT                   NDAAQFGELETLGELTQKAWAHDVQVMIEGPGHVPLQKVKENVDKELEDCFEAPFYTLG
FT                   PLVTDIAPAYDHITSGIGAANIGWYGTAMLCYVTPKEHLGLPNKQDVRDGIITYKIAAH
FT                   AADLAKGFPGAQLQDNALSKARFEFRWEDQFNLALDPERAREFHDETLPKEAHKVAHFC
FT                   SMCGPNFCSMKITQDVRDYAAAQGISADEALQKGMQEKAVEFVEKGAEIYRKT"
FT   misc_binding    complement(144749..144847)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 68.57"
FT   gene            144948..145628
FT                   /locus_tag="TK90_0141"
FT   CDS_pept        144948..145628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0141"
FT                   /product="Putitive phosphate transport regulator"
FT                   /note="PFAM: Putitive phosphate transport regulator; KEGG:
FT                   pmy:Pmen_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70657"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD8"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ADC70657.1"
FT                   /translation="MSPKNFVFELFGRSPVRPLQAHMEKVRACIAELPPFIEAMARDDW
FT                   DTARVQQKKIVKLEHEADRLKKDLRLHLPKGMMLAMSRRDVLDTLLIQDRIANMAKDIA
FT                   GLMLGRQMQFPANMQGPLQRFLDRSVDAVNQAGRAVNELDELVEAGFRGHEVEVVNDIL
FT                   TELDQIEHESDEAQREVREILFAQEAELPPVNVIFMYRVIDSIGELADLAQRVGSRLQL
FT                   MLAK"
FT   gene            145656..146912
FT                   /locus_tag="TK90_0142"
FT   CDS_pept        145656..146912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0142"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: csa:Csal_0712
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70658"
FT                   /db_xref="GOA:D3SCD9"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCD9"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ADC70658.1"
FT                   /translation="MEYGTLLLGLAVIFGLFMAWGIGANDVANAMGTSVGSRALNIRQA
FT                   VFVAAVFVFAGAWLAGGEVTQTIRSGMVDSALLADSPSLLVYGMLAALAAAGTWLLTAS
FT                   YFGWPVSTTHSIIGAIIGFAVVGLGFEVVRWERVGTIAISWVLSPMIGGMIAFALFRSI
FT                   QLLILDTVDPLKNAKRWAPLYIFLTAFVTALVTMFKGLTHVGLDLTTAQAYSFAVLISV
FT                   AVVVVGLFAIRRLRFEEASLQAHGSHFSDVEKVFGVMMVVTGCAMAFALGSNDVANAVG
FT                   PLAAVVDVIQTGEVDPETVVPMWVLLLGGFGIVFGLFTYGHKVIATVGTGITQLTPSRG
FT                   YAATAAAAATVVLASGTGLPISTTHTLVGAILGVGMARGIAAIDLRLVRMIFMSWIVTL
FT                   PAGAILAIVFFFILRGLLG"
FT   gene            complement(147015..148019)
FT                   /locus_tag="TK90_0143"
FT   CDS_pept        complement(147015..148019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0143"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: hna:Hneap_0591 molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: molybdenum cofactor synthesis
FT                   domain protein; Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70659"
FT                   /db_xref="GOA:D3SCE0"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE0"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ADC70659.1"
FT                   /translation="MQHALKDENALVDAFGRRIEYVRLSVTDRCDLRCFYCMPKGFRDF
FT                   EEPEHWLSFEEIERVMGAFGRLGTRRVRLTGGEPLVRKNLPDLAARLNALPGIDDISLS
FT                   TNATRMARHAQELKDAGVARINVSLDSLKPEVFKEITGGKLEKVLDGLMASKAAGLDPI
FT                   KINMVVMGGINEPEVEDMVDFCIEHGFTLRFIETMPMGDTGREAKEGHYVNLQDVRARL
FT                   EQRYNLVPGVMPGGGPARYMQIPDTDVRIGFITPISQHFCDTCNRVRLSVDGTIYTCLG
FT                   NEHSLNLRPYLREGCSDSELEDLVIQAINLKPERHEFSERPEKVMRFMSMTGG"
FT   gene            148249..151155
FT                   /locus_tag="TK90_0144"
FT   CDS_pept        148249..151155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0144"
FT                   /product="Nitrate reductase"
FT                   /EC_number="1.7.99.4"
FT                   /note="PFAM: molybdopterin oxidoreductase Fe4S4 region;
FT                   molydopterin dinucleotide-binding region; molybdopterin
FT                   oxidoreductase; KEGG: aeh:Mlg_1675 molybdopterin
FT                   oxidoreductase Fe4s4 region"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70660"
FT                   /db_xref="GOA:D3SCE1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE1"
FT                   /inference="protein motif:PRIAM:1.7.99.4"
FT                   /protein_id="ADC70660.1"
FT                   /translation="MSALPEFENHSEQEIKYTTCYMCACRCGIKVTVQNNKVRYIQGNR
FT                   HHPINKGVLCAKGNAGIMKQQSPARLHQPMRRKPGTERGAGEFEPISWDEALDMLSTRL
FT                   QKIRETDPRKLAFFTGRDQMQALTGLWATQFGTYNWAAHGGFCSVNMATGGLYTTGFAF
FT                   WEFGDPDWDRTKYHMLWGVAEDHASNPIKIGLEKLKRRGGKFVAINPVRTGYQAIADEW
FT                   VGIKPGTDGLFALSMLHVLLKNDQFDWDFLVRYTNATQLVVQTPGQKGDGLILRDEAGN
FT                   PLVWELEQEAFVDGTQVDIKPALFGEYTAPDGRPVKTVMTLLAERYLSEEYSPENTAKI
FT                   TGVPADQTERLALEMAHVAFKETIELDIEWTDSWGRKHDKVFGRPVSMHAMRGISAHSN
FT                   GFQTCRAIHLLQIMLGSVDCPGGHLAKPPYPKHVPPGIKPAKECAPNTPLKSPPLGFPT
FT                   APEDLVIDDDGNPLRIDKAFSWDAPISNHGLMHMVVTNAVNGDPYPIDTLIFFMANMSW
FT                   NSSMNTAEVMDMLRAKDDSGEYKIPFLVVADAFHSETVNFADLVLPDTTYLERYDTISM
FT                   LDRPISEPAAAADSIRHPILEVDRDVRPWQEVMVELAGRLKFPAFTNDDGSRKFDDYKD
FT                   FIVNFEKEPGIGFLSGYRGKDGKSHLRGEPNPKQWEAYIENQGFFVHHLAPNQQFYRYA
FT                   NKEYLELAKHAGWVGKTDPITIELYSETQQRFKLAGQGLYDGPQPTKQEHKDRLTQFFD
FT                   PLPIWHKPLEQTRIDEDEYPFYAVNQRPMFMYHSWDSQNAWLRQICAQNYLYMNRGKAE
FT                   SMGIEDLSWVWMESHNGKVRVQVKLIEGCEPSTVWTWNAIGKQKGAWGLKPDANESNKG
FT                   FLMNHLISELLPKKGDPVDNITNSDPVTGQAAWYDLKVKITPADPEEASTWPDFDTVKP
FT                   APGMSEAPDQLRYAAHKPVHLNRSIRDVLTRGSLDEDR"
FT   gene            151223..151918
FT                   /locus_tag="TK90_0145"
FT   CDS_pept        151223..151918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0145"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tbd:Tbd_0571 DMSO reductase chain B"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70661"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE2"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADC70661.1"
FT                   /translation="MRLGLVIDMDTCVGCHACAVACKQWNTSGTTGALTDYRPYGEDPS
FT                   GVWFNRVRHYEVGDYPNNKTVNIPMSCMHCQYADCVNVCPTGASYKRPEDGIVLVDQDK
FT                   CMGCNYCAWACPYGARELDREDGVMKKCTLCVDRIYDEALPPEERQPACVITCPAHARF
FT                   FGDFDDDNSEVSRLVRERGGVKQMPELGYKPVNTYLPPRITRPIPIDDVRANRLVSSVK
FT                   DWVNKMVAR"
FT   gene            151944..152993
FT                   /locus_tag="TK90_0146"
FT   CDS_pept        151944..152993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0146"
FT                   /product="DMSO reductase anchor subunit (DmsC)"
FT                   /note="PFAM: DMSO reductase anchor subunit (DmsC); KEGG:
FT                   tbd:Tbd_0572 DMSO reductase chain C"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70662"
FT                   /db_xref="GOA:D3SCE3"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE3"
FT                   /inference="protein motif:PFAM:PF04976"
FT                   /protein_id="ADC70662.1"
FT                   /translation="MHPAFSVILFTVISGAGYGLFILLAAFHLAGIGPAMSHGELLAHG
FT                   AVSLGMITLGLMLSTGHLANKKNAWRSFMRFKTSWLSREAVFAVLFYPFAGIYGLGVLL
FT                   QGAAIGPLPALAGVIAAVLAVITLFSTGMIYGCLKTIRQWNTALTPANYIMLGIATGTT
FT                   LFAAIATVFGNATAMHAGVAMVALVAAAVLKAIYYFWISRVNGPTINTATTFNRATVRL
FT                   LDTGHTAGTFLTDEFGYDPRKDTIDNVKMGVFLLGFVAPVLVFASILSGAPAGIAWLAA
FT                   VSSLIGIGMERWLFFAEAKHVVRLYHGAQTCTNSLAEPARGRTSVAPVTDPTDARRWEL
FT                   GDTPGGSGS"
FT   gene            complement(153127..153261)
FT                   /locus_tag="TK90_0147"
FT   CDS_pept        complement(153127..153261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_1283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70663"
FT                   /db_xref="GOA:D3SCE4"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE4"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_1283"
FT                   /protein_id="ADC70663.1"
FT                   /translation="MLTEIMFQSPIGILTILTLVGIVAFFVYVGYFILHGMHEDDKAK"
FT   gene            complement(153355..153978)
FT                   /locus_tag="TK90_0148"
FT   CDS_pept        complement(153355..153978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0148"
FT                   /product="proteophosphoglycan ppg4"
FT                   /note="KEGG: proteophosphoglycan ppg4"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70664"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE5"
FT                   /inference="similar to AA sequence:KEGG:LbrM34_V2.0540"
FT                   /protein_id="ADC70664.1"
FT                   /translation="MRTSVRAEARAAGRRAVPPQAVPARRAKRPQVAQPSSRARRLNAL
FT                   GANPANLRSNRGPHRGPTSRHRQPAVPVRRTEPPKAAKPSSRARSTNTQEASPMPPFEP
FT                   RPAQRADARYRRRRCQPEGPSDRRSRSHPLGRAARTPPSPTPRPRRIKACAAARHRKSP
FT                   PRRQPRGVRRREAVLRETPAHPLGRNISSASNMSWPDQRGDPAS"
FT   gene            complement(154042..154118)
FT                   /locus_tag="TK90_R0001"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(154042..154118)
FT                   /locus_tag="TK90_R0001"
FT                   /product="tRNA-Arg"
FT   gene            154309..155172
FT                   /locus_tag="TK90_0149"
FT   CDS_pept        154309..155172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0149"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: ngk:NGK_1553
FT                   cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70665"
FT                   /db_xref="GOA:D3SCE6"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE6"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ADC70665.1"
FT                   /translation="MANQPIKMDTGNKVLMFIASVALLATVIYLLIQLANFMGGLQLGE
FT                   PSEAERDRIVERIQPIGRVASGPVDMEEETADLSPGDIYSNVCAACHDTGASDAPIKGD
FT                   SDAWAARLDERSLDEVFDNSINGIGAMPARGGDSSLSDEEVKLVVVYMLDEAGIDHGWE
FT                   PEDANGDENGNGDENGNGEAVTEDDDAAVEDDEALEGIALDTGDVSRGESLYSTCIACH
FT                   GAQGQGSPAFPKIAGQTAEYTADKLVRYRAGETVGDRTALMAPNAARLSDQDIADLAVY
FT                   VATFED"
FT   gene            complement(155237..156742)
FT                   /locus_tag="TK90_0150"
FT   CDS_pept        complement(155237..156742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0150"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: app:CAP2UW1_0748 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70666"
FT                   /db_xref="GOA:D3SCE7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE7"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ADC70666.1"
FT                   /translation="MPIAISHARAVAGIQAPLVTIETHLANGLPSFQIVGLPEAAVRES
FT                   RDRVRAAIQTSGFDFPRRRITVNLAPADLPKDGGRFDLGIALGILAASQQIPGSALEGR
FT                   EFLGELGLDGTLRPVGGTLAAALAAANEARELIVNPEDGAEAALASAARVRTADHLIAV
FT                   CAGLQGQGELDEGRPVEAEPDRYPDLADVRGQHQARRALEIAAAGGHHLLMVGPPGSGK
FT                   SMLAARIPGILPPMSEAEALETAAIHSLRDTGHLQRDWRARPFRSPHHTASGVALVGGG
FT                   STPRPGEISLAHHGVLFLDELTEFQRSVLDVLREPLETGTIHIARAARQAEFPARFQLV
FT                   AAMNPCPQGFDCDLGARCQCSPEQMARHRRRLSAPLLDRIDLAIEVPRIPPPELASHGE
FT                   PGEDSRTVAQRVALAQERQRQRQGSLNRELAGQMLDQHATLEAGDRALLDRAAERFRLS
FT                   ARAYHRILRLARTIADLEPSDPITTGHLTEALSYRALDHWRTQ"
FT   gene            complement(156802..157056)
FT                   /locus_tag="TK90_0151"
FT   CDS_pept        complement(156802..157056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0151"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   aeh:Mlg_0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70667"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE8"
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /protein_id="ADC70667.1"
FT                   /translation="MIDPKRFDDLARRITESLPESVRHMQEDVQRQVRSSLQHGFERMD
FT                   LVTREDFDVQVALLERTRERLAELEARVEALEAERKTAE"
FT   gene            complement(157115..157876)
FT                   /locus_tag="TK90_0152"
FT   CDS_pept        complement(157115..157876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0152"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   neu:NE1165 pteridine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70668"
FT                   /db_xref="GOA:D3SCE9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCE9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADC70668.1"
FT                   /translation="MTEHTQGERSETGVVLVTGSARRVGATIVRWLHGEGLRVLIHYRG
FT                   SRDDAAALADSLNARREDSARILQADLLNLNDIQRLAREAEEAWGRLDYLVNNASTFYA
FT                   TPVGAIDTQAWDDLVGSNLKAPTFLTQACAPALARTRGAVVNIVDIHALRPLKGYPVYS
FT                   AAKAGLWALTQAYARELGPDVRVNGVAPGAILSPEDPNNAGTHEAMVERTALKREGHPD
FT                   DIARTVRFLLLDAPYITGQVIPVDGGRSASQ"
FT   gene            157908..159104
FT                   /locus_tag="TK90_0153"
FT   CDS_pept        157908..159104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0153"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   aeh:Mlg_2524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70669"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF0"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ADC70669.1"
FT                   /translation="MLPPKPSTPTPDDPAAAIARQMHDSLQQSIAAHGGFLPFVDYMHQ
FT                   ALYAPGLGYYVNGARKLGAGGDFVTAPELSSLFGETLASWLAPLLRDELAGGGQLLEFG
FT                   AGSGRLAGDVLVTLRELGVGWQCYKIIEVSPDLRAVQQEHLAERLEPEEYARVEWLDAL
FT                   PEEPIRGVVLANEVLDALPVELFRWREGQPWQMGVTVDGDGRLVLAEQSAPEPLADVVR
FT                   ELQAVHGPWPDGYTSEWRPAQAAWVASVAACLEQGVALLVDYGFPRAAYYAAERHQGTL
FT                   VGYYRQQMMLDPLAQPGLMDLTASVDFTAVAEAADAAGLDVLGYAAQGEFLLGAGLAQR
FT                   FEARVGSGEDARKTMQAAQAVRMLTLPGEMGERFQVMTLGRACTALDFTAIPDRRGRL"
FT   gene            159175..160185
FT                   /locus_tag="TK90_0154"
FT   CDS_pept        159175..160185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0154"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mca:MCA2990 O-sialoglycoprotein endopeptidase;
FT                   TIGRFAM: metalloendopeptidase, glycoprotease family; PFAM:
FT                   peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70670"
FT                   /db_xref="GOA:D3SCF1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF1"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADC70670.1"
FT                   /translation="MKVLGIETSCDETGVALIDDQRGLLAHRLYSQTDLHAVYGGVVPE
FT                   LASRDHIRRLLPLLRAVLDEAGVKGPELDAIAYTGGPGLLGALLTGASVARSLAWGWGV
FT                   PAMPVHHLEGHLLAPFLEDAGLDFPFLVLLVSGGHTQLIHARSLGDYELLGESIDDAAG
FT                   EAFDKTAKLLGLGYPGGPALSRLAEQGASDALRLPRPMLDRPGLDMSFSGLKTAVLTAL
FT                   NKQEYRPQDVARAFEEAVSETLVEKTRRALEQSQAPALVVAGGVAANTRLRAGLQAMAA
FT                   QQGVPVYFPRIEFCTDNGAMIALAGLRRLQAGWTPDDQAPAITARARWPLAELSA"
FT   gene            complement(160195..160821)
FT                   /locus_tag="TK90_0155"
FT   CDS_pept        complement(160195..160821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0155"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   hna:Hneap_1883 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70671"
FT                   /db_xref="GOA:D3SCF2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF2"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ADC70671.1"
FT                   /translation="MDIVLGIVIAYLLGSLSTAIVVSKLLRLPDPRHTGSGNPGATNVL
FT                   RYGGKKAAIITLIGDVGKGWLPVFVAAQLGIFPTWALGLIGLAAFLGHVFPVYYRFGGG
FT                   KGVATALGVLLALNPLVGGLTLLTWLVVAAIWRYSSLSALVAATLAPVYFVFLEPDFWV
FT                   ALIVAGMAVVLFIRHDTNIRRLMRGEEGKIGYKKDEAEAEEPPRD"
FT   gene            160927..161673
FT                   /locus_tag="TK90_0156"
FT   CDS_pept        160927..161673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0156"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: noc:Noc_2099
FT                   biotin biosynthesis protein, BioH"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70672"
FT                   /db_xref="GOA:D3SCF3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF3"
FT                   /inference="protein motif:PRIAM:3.1.1.1"
FT                   /protein_id="ADC70672.1"
FT                   /translation="MTRPTLVLLHGWGFSPAVWAPLRAALPGFEIHAPALPGHGELAGG
FT                   EALGDPVATCEAIRAQLPRPLSRPIWLGWSLGGLVALELARQMPDTRGLILLNSTPRFA
FT                   AAPDWGHALPAAELADFQLALEGPRRRLHRRLAMLCARGSPEAASLAADLTSELEGTPA
FT                   TDQGLAAGLACLMGRDQRACWQSSPVPVAACLAEGDALVPSTVADGLRGLRPDARLAVR
FT                   PGGHAQWWQDPAPVAAFINEFVAALE"
FT   gene            161684..162556
FT                   /locus_tag="TK90_0157"
FT   CDS_pept        161684..162556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0157"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="TIGRFAM: biotin biosynthesis protein BioC; PFAM:
FT                   Methyltransferase type 11; KEGG: aeh:Mlg_2433 biotin
FT                   biosynthesis protein BioC"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70673"
FT                   /db_xref="GOA:D3SCF4"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF4"
FT                   /inference="protein motif:TFAM:TIGR02072"
FT                   /protein_id="ADC70673.1"
FT                   /translation="MTEADEYALDKARVREAFGRAAAGYEAHAVLQREVQGRLLERLDL
FT                   VKLQPVRVLDLGCGTGEALDLLARRYRKAELTGVDFAPGMVAAVQRRGRWWRRPLAVCA
FT                   DIEALPLPEAHYDLAISSAALQWCASLDQTFAEVRRVLAPGALWTFSTFGPDTLRELRA
FT                   AFAEVDGGGAQHVNAFVDMHDIGDALVRAGFADPVMDQETLTLTYGDFQTLLRDLRGVG
FT                   VRNALAGRGRGLLGPRRLQAVAEAYARAFAVEDRLPATWEIVYGHAWVPEAPPPSKPQG
FT                   RVIPVRPVS"
FT   gene            162763..164250
FT                   /locus_tag="TK90_0158"
FT   CDS_pept        162763..164250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0158"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: mfa:Mfla_0629 cytochrome c oxidase, cbb3-type,
FT                   subunit I; TIGRFAM: cytochrome c oxidase, cbb3-type,
FT                   subunit I; PFAM: cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70674"
FT                   /db_xref="GOA:D3SCF5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF5"
FT                   /inference="protein motif:TFAM:TIGR00780"
FT                   /protein_id="ADC70674.1"
FT                   /translation="MSQAATTAGSVPATSVASTEQYNYAIVKRFAIAAVLWGVFGMAAG
FT                   VWIASQLAFPFLNFDIAQITFGRFRPVHTTAVIFGFGGNALFATSYYVVQRTCQTRLYG
FT                   DSLASFTFYGWNLALILGVITYTMGITQGREYAEFNWQIDIIILVVWVAYFWIYLQTLL
FT                   RRNQPHIYVANWFFMSFILATALLHIFNNLEVPVGIFHTDSYPLFSGVQDAMRQWWYGH
FT                   NAVGFFLTAAFLGMMYYFVPKQAGRPIYSYKLSIIHFWALVFLYMWVGAHHLHWTALPD
FT                   WVSTLAATFSILLLLPSWGGMINGIMTLSGAWDKLRTDPIMLFLITALSFYGMSTFEGP
FT                   MMSLKSVNALSHYTDWTVGHVHSGALGWVAMITFGSLYHLIPRLWGVNLYSLKLVYVHF
FT                   FLATIGIVLYITAMWVAGIGQGLMLRAFDQYGNLAYTFTESVVFLHRPYVVRAIGGGFF
FT                   LAGMLIMAWNIAMTVRMGIKSEAREREEARAAEARTA"
FT   gene            164269..165003
FT                   /locus_tag="TK90_0159"
FT   CDS_pept        164269..165003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0159"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   II; PFAM: cytochrome C oxidase mono-heme subunit/FixO;
FT                   KEGG: mfa:Mfla_0630 cytochrome c oxidase, cbb3-type,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70675"
FT                   /db_xref="GOA:D3SCF6"
FT                   /db_xref="InterPro:IPR003468"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF6"
FT                   /inference="protein motif:TFAM:TIGR00781"
FT                   /protein_id="ADC70675.1"
FT                   /translation="MKHESVETNAGLLIILTLAVISVGGLVEIVPLFYIDDTIEEVDGV
FT                   RPYTPLEQRGRDIFVREGCYTCHSQMVRPFRDEMLRYGHYSLAAESKYDHPFQWGSKRT
FT                   GPDLARVGGKYSNEWQVQHLIDPQSLVPESIMPGYPWLATTPLDYSDIAARMRALKRVG
FT                   VPYSITEEEYEANVEKFGEQHARMFDINNAEEMLIEQAQAENFDGDSSFISEMDAMVAY
FT                   LQVLGTMVDFSEYDDGHFAEFR"
FT   gene            165033..165251
FT                   /locus_tag="TK90_0160"
FT   CDS_pept        165033..165251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70676"
FT                   /db_xref="GOA:D3SCF7"
FT                   /db_xref="InterPro:IPR008621"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70676.1"
FT                   /translation="MAAAWEWITDLGNSKMFALVLFMSTFIGIVIYLFAKPSRARKFET
FT                   YRYIPLEEDDSHLEPTARRDKTESEKQ"
FT   gene            165248..166171
FT                   /locus_tag="TK90_0161"
FT   CDS_pept        165248..166171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0161"
FT                   /product="cytochrome c oxidase, cbb3-type, subunit III"
FT                   /note="TIGRFAM: cytochrome c oxidase, cbb3-type, subunit
FT                   III; PFAM: cytochrome c class I; KEGG: hna:Hneap_1877
FT                   cytochrome c oxidase, cbb3-type, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70677"
FT                   /db_xref="GOA:D3SCF8"
FT                   /db_xref="InterPro:IPR004678"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR032858"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR038414"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF8"
FT                   /inference="protein motif:TFAM:TIGR00782"
FT                   /protein_id="ADC70677.1"
FT                   /translation="MSTQDNRDKNQVETTGHVWDGDLQEYNNPLPRWWLWGFYATVVFA
FT                   LVYWLIYPAWPIGDSFTKGFATITYEVNGEERTTHWNTRALLARDMQTGEYAVRQREML
FT                   EQVASQDYETILADADSMSFVNAYAQGSFGTWCAACHQVGGAGVIGQYPNLRNDHWKWG
FT                   GTVEQIEHTIREGRLGYMPGYRDTLTGDQMNEVAAYVLSLNDYDVDSDLADAGERIFTG
FT                   MEGGCFQCHGEDGQGLASQGAPNLTNNIWGLIDVQGADSDSERLRLVANFVRDGIQREM
FT                   PAFADRLSDDEIKMLTAYVHSLGGGQ"
FT   gene            166332..167732
FT                   /locus_tag="TK90_0162"
FT   CDS_pept        166332..167732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0162"
FT                   /product="cytochrome c oxidase accessory protein CcoG"
FT                   /note="TIGRFAM: cytochrome c oxidase accessory protein
FT                   CcoG; KEGG: hna:Hneap_1876 cytochrome c oxidase accessory
FT                   protein CcoG"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70678"
FT                   /db_xref="GOA:D3SCF9"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCF9"
FT                   /inference="protein motif:TFAM:TIGR02745"
FT                   /protein_id="ADC70678.1"
FT                   /translation="MAQGQPIYEARIPIHPRSVKGRFRNLKTGILLLAYGVFFGLPWLR
FT                   WDRDYGPSQAVLFDIPNRQFFLFDLVVYAQDIFWLAGFLVLAALLLFFVTGVLGRVFCG
FT                   YFCFQTLWTDVFMYLERKIQGERPARIRLSKQPWNFEKVWKLGATHLSWLLVAFATGLG
FT                   FVLYWADAPTLVRDFFTGDARFASYVTAGLLTATTYTFAGLAREQVCTFICPYARFQSV
FT                   MFDRDTLIVSYDQNRGEGTAGRAKVKAGLKTREERQAAGVGDCIDCGYCVQVCPTGIDI
FT                   RDGLQVSCIHCALCIDACDTIMDKQGWPRGLIAYSSERELEGGKTRWLKGKTLGYGAAV
FT                   LVVIGALVFSILERPPVDVNVNQVRQPLFVQMSDGRVQNSYELRLNNVSDQELDFTLDI
FT                   DGLEGATLDLGQVEQIRLEPGQRLTVLARVRHDVEAGADSPIRFYFVISDREGRIDPVE
FT                   ADARFSHR"
FT   gene            168004..168831
FT                   /locus_tag="TK90_0163"
FT   CDS_pept        168004..168831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0163"
FT                   /product="FixH family protein"
FT                   /note="PFAM: FixH family protein; KEGG: hna:Hneap_1875 FixH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70679"
FT                   /db_xref="GOA:D3SCG0"
FT                   /db_xref="InterPro:IPR008620"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG0"
FT                   /inference="protein motif:PFAM:PF05751"
FT                   /protein_id="ADC70679.1"
FT                   /translation="MSNLVISLGLGSAALALLFALIYKFTRLRAYNTAAVVVAIMLFVF
FT                   IPTSILTWQGADVFAIHLALYIIVPYGLGIILTQKEAEAEDGQKGSFSLHWAPLVIVGF
FT                   FTIIASVQAVLITLAHNGMPERFIGTLLPEPENPAERVTSAFPGTVGGIQERDEALAVH
FT                   RMTRLQEQRELGWQVRQGWVETPVEGETATFQVEVLDAEGRPISDADIRGTFMWVADER
FT                   RDQAFDMQPIGEGLYQVELTLPSPGRWDLRFHVEHDGQLVEQQARTRVRGQSS"
FT   gene            168868..171408
FT                   /locus_tag="TK90_0164"
FT   CDS_pept        168868..171408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0164"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: tbd:Tbd_2044 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70680"
FT                   /db_xref="GOA:D3SCG1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR021993"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG1"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ADC70680.1"
FT                   /translation="MESTGTPADADGGCFHCGLPIPGGANYPVQFEGRERPTCCPGCQA
FT                   VAGAIIERGLGAYYHHRPAPPGQAGEPLVPDELRELELFDTEAVQRSFVTPASDAATTG
FT                   GSRLEAALILEGITCAACVWLNERHVQSLPGVIAFSINYSTHRARLVWDPERIALSAIL
FT                   KAIRDIGYHAHPYDPGTREKAIARERGLALRRIGVAALGMMQVMMLALAIWLGEDDAQH
FT                   ADLMQFMRWVAAALTTPVVFYSAIPFYQSAWRDLRQRRLGMDVPVSLAIIVTYVASLYA
FT                   VLLGTGEHVYFESVVMFVFFLLTSRYLELIARQHASQAIDRLDRLVPALAHRLDAGGQE
FT                   EPVALGDLSPGDRVRVRPGESVPADGFVVQGRSTINRALLTGEPDPAPVAAGDEVVGGT
FT                   INVDGPLIVEVRHVGAETTLAAIQRLLDRAQSEKPRIARIAETGTGWFVGAVLLLTALA
FT                   GLVWYAWIDPSRALWVMVAMLVATCPCALALATPVALTATTGTLSRLGLLVTRGRTLEA
FT                   LARVDTVCLDKTGTLTEGRPRLVAQQDHVAPPPGQDWRTWAAALEAHSEHPLSRAFRAA
FT                   VPAPGVAAQAVHNEPGSGLVGQIDGREVAIGGRAMLSQTEPPAVEVPADSPLASPVWLV
FT                   VDGQPVATFWLADTPRPEAAETVATLRARGLEVILLTGDRPEAGQRFAEHLGIDRFHGG
FT                   LTPEDKLRHVRDLQAAGRTVLMAGEGINDAPVLAGADVSLAMGGGTRLAQTQADLVLTS
FT                   DRLDRLPEALDQARRTTRIVRQNIAWAIGYNVVALPIAAAGLLTPWLAALGMSMSSLLV
FT                   VGNALRLRPGRDRVAAPREHASRAPAEASVSPPG"
FT   gene            171440..171661
FT                   /locus_tag="TK90_0165"
FT   CDS_pept        171440..171661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0165"
FT                   /product="cytochrome oxidase maturation protein, cbb3-type"
FT                   /note="TIGRFAM: cytochrome oxidase maturation protein,
FT                   cbb3-type; PFAM: cytochrome oxidase maturation protein
FT                   cbb3-type; KEGG: hch:HCH_02268 cytochrome oxidase
FT                   maturation protein, cbb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70681"
FT                   /db_xref="GOA:D3SCG2"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG2"
FT                   /inference="protein motif:TFAM:TIGR00847"
FT                   /protein_id="ADC70681.1"
FT                   /translation="MSILYLLIPLAMLFALVVGMVLLWAIRSGQYDDLEGPAHRILMDD
FT                   DDPRIPTTEDDEKDQTSGETQRPEDRPR"
FT   sig_peptide     171440..171517
FT                   /locus_tag="TK90_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.645 at
FT                   residue 26"
FT   gene            171740..171844
FT                   /locus_tag="TK90_0166"
FT   CDS_pept        171740..171844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mei:Msip34_1994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70682"
FT                   /db_xref="GOA:D3SCG3"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG3"
FT                   /inference="similar to AA sequence:KEGG:Msip34_1994"
FT                   /protein_id="ADC70682.1"
FT                   /translation="MREWFTFANFPLTFTAALIIWSWISFFSVILFGG"
FT   gene            complement(171951..172820)
FT                   /locus_tag="TK90_0167"
FT   CDS_pept        complement(171951..172820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0167"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: hha:Hhal_2302 RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70683"
FT                   /db_xref="GOA:D3SCG4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG4"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ADC70683.1"
FT                   /translation="MSSKALATVHADLPVPVGNLDHYMQAVSRIEVLDPEHERELARSL
FT                   HERNDLDAARQLILHNLRFVVHVARGYQGYGLPLGDLIQEGNVGLMKAVRRFDPNQGVR
FT                   LVSFAVHWIRAEIHEFILRNWRIVKVATTKAQRKLFFNLRSAKQRLGWMSNDEVSAVAR
FT                   DLGVSENDVWEMERRLSSQDASFDPAPDSDDEHTYLAPAQRLSIEDMSDDPAQVAEDED
FT                   WDRHYQERLASTLGELDERSRDILARRYMSEPKATLHELAAEYGVSAERIRQIENNAIK
FT                   RIRTAFAD"
FT   gene            complement(172924..173853)
FT                   /locus_tag="TK90_0168"
FT   CDS_pept        complement(172924..173853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0168"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ttu:TERTU_0250 putative cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70684"
FT                   /db_xref="GOA:D3SCG5"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG5"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADC70684.1"
FT                   /translation="MRPGRRLLDALPAWLDSHRDAARRSLGRRLQAPILSLITIAVLGF
FT                   ILALPAYLWVLLDNARALSAHVDHDPRIALYLDQVDEETADRLQDALDDDERVARWERI
FT                   DADTALSAYRDSLPDPELLDWLEDNPLPDVIDVVPASTQPATVAALRDDLRALAPEAGV
FT                   VADDEWVRQLNSLHELGLRILSVVAALLGLGAVLILALATASELRERQEEIAISRISGA
FT                   THRFLRRPSLYGGVLTGFGGGIFSVILLLVGVALSREPLTEAAAAFDLEFTLRLPHAGD
FT                   LLGLILVGLILGWLGARLGSGHALRDAP"
FT   gene            complement(173850..174521)
FT                   /locus_tag="TK90_0169"
FT   CDS_pept        complement(173850..174521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0169"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="KEGG: csa:Csal_2988 cell division ATP-binding
FT                   protein FtsE; TIGRFAM: cell division ATP-binding protein
FT                   FtsE; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70685"
FT                   /db_xref="GOA:D3SCG6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG6"
FT                   /inference="protein motif:TFAM:TIGR02673"
FT                   /protein_id="ADC70685.1"
FT                   /translation="MIQLQRVTKRFGSAADALSNVSLRVDAGAMAFVTGPSGAGKSTLL
FT                   RLIAGLERPTRGRIRVNGHELDRLSARAIPRFRRSIGLVFQDHRLLFDRPVFDNVALPL
FT                   EILAYRRPEMRKRVRAALDKVGLLHKETVNPRTLSAGEQQRVGIARAIVHRPVLLLADE
FT                   PTGNLDPALSEEILALFDDFNRVGMTALIASHDQELIGRMGKPVLHLEDGRIEARGGAR
FT                   A"
FT   gene            complement(174527..175570)
FT                   /locus_tag="TK90_0170"
FT   CDS_pept        complement(174527..175570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0170"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: aeh:Mlg_2659 signal recognition
FT                   particle-docking protein FtsY; TIGRFAM: signal recognition
FT                   particle-docking protein FtsY; PFAM: GTP-binding signal
FT                   recognition particle SRP54 G- domain; GTP-binding signal
FT                   recognition particle SRP54 helical bundle; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70686"
FT                   /db_xref="GOA:D3SCG7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG7"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ADC70686.1"
FT                   /translation="MFGFRKKKSEDSATPSPETTPEAPPETAAAPEPEPDAQPARGGWF
FT                   QRLRQGLAKTGQALGGDLKSLFRRKIDDELFEELEERLLLADVGLDATQRIMDRITREV
FT                   KRRELDNADALMDALETAMVEILEPVSRPLDIPQAERPFSILVVGINGAGKTTTIGKLA
FT                   HRFKDEGRSVLLAAGDTFRAAAVEQLQTWGERNGVPVIAQGTGADSASVVYDGLQAAQA
FT                   RKTDILIADTAGRLHTQTNLMDEVRKVKRVMGRLDEHAPDEVLLVVDGGTGQNALSQAR
FT                   QFHEALGLTGIVVTKLDGTAKGGVLFALAEQLGVPVRFIGVGEKAEDLQRFDARAFVRA
FT                   LLGREEN"
FT   gene            175660..177048
FT                   /locus_tag="TK90_0171"
FT   CDS_pept        175660..177048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0171"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   noc:Noc_1933 peptidase M16-like"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70687"
FT                   /db_xref="GOA:D3SCG8"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG8"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADC70687.1"
FT                   /translation="MAVWLISASVVAGELEIESDVVEATLDNGLTVLVLEDRRAPVVAN
FT                   MVWYRVGSADEHSGITGISHMLEHMMFRGSEKYEPGEFSRIVARMGGRENAFTGRDYTG
FT                   YHQVIGSDHWETVMAMEAERMQHLKLQEDEFRPELRVVQEERRLRVEDQPNSLLREQLM
FT                   ATAFFNHPYGQPVIGWMTDIESYTLEDLQDWYDRYYHPSNAVVVVVGDVDADEVIAAAE
FT                   KHFGAIPSGNVPEAKPRRETPQAGERRITVQAPAQVPFLMMGWKTPVLNTLDSHEDAYA
FT                   LLVAAGILDSGEASRFARELVRGQELASATSARYSPFARLDDLFMVAAVPTLDTDIESL
FT                   EQALLDEIDRLAEEPVDGRELERVQARVIASEVFERDSVRAQAFQLGMLETVGVGWREN
FT                   DRFLERVREVTAEDVQRVVREYLVPERRTVGVLDPQPVDDEEAPAPGPYGAPDLDGGYP
FT                   EEGH"
FT   gene            177048..178373
FT                   /locus_tag="TK90_0172"
FT   CDS_pept        177048..178373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0172"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   aeh:Mlg_2657 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70688"
FT                   /db_xref="GOA:D3SCG9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCG9"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ADC70688.1"
FT                   /translation="MLHAIKKLSRHSLFAGLVLALLAIPVQAVEIERWETDEGLRVLYV
FT                   EAPDLPMVDLRLTFDGGAARDGDLPGLAMMTSRSLRHGTEEMDASELAERFESVGARFG
FT                   TSSLRDMAIVSLRTLTEPDWMETAVGTLTDVLSAPAFPEGDFERSRRQALQSLQRERQE
FT                   PSSVGTRRFYELMYEDHPYGSWPGGEVDTLEAMTRDDARDFFERHYAAGNGALAITGGV
FT                   SREQAEELAARISAALPRGDAVDPLPPVPMREEPVEERIAFPSEQAHIFMGAPALRRGD
FT                   EAHFALTLANHALGGGGFTSRLFQEVRSARGLAYSVHSRFQPMAVEGPFVINMQTGVDQ
FT                   TDDAVAVLREQVLRWHAEGVDPEEMEASRENVINSFPLSLASNSDIVSLLGMIGFYGLS
FT                   DDYLERYVERMQAVELETMNTQLADRLNPEALVTVIVGGQED"
FT   sig_peptide     177048..177134
FT                   /locus_tag="TK90_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 29"
FT   gene            178357..178968
FT                   /locus_tag="TK90_0173"
FT   CDS_pept        178357..178968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0173"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: hha:Hhal_2308 putative methyltransferase;
FT                   TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70689"
FT                   /db_xref="GOA:D3SCH0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH0"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ADC70689.1"
FT                   /translation="MARKTRRGPPGRSARIRIIGGAWRRQWLPVPSVGGLRPTADAQRE
FT                   TLFNWLQPQLPGARVLDLYAGTGALGFEAASRGAREVWLVERDARAAAQLEANRERLGA
FT                   TQVHIRRDDVARLLGQLPEGDPFDVVFLDPPFGQGRVAPALAALAVQGWLSPGARVYAE
FT                   LESEADPSFVQEDGWAIERERVCGQARGLLLARSPAEDDS"
FT   gene            179151..180776
FT                   /locus_tag="TK90_0174"
FT   CDS_pept        179151..180776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0174"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: pla:Plav_0421
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70690"
FT                   /db_xref="GOA:D3SCH1"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH1"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ADC70690.1"
FT                   /translation="MEEPSSSPGLNQTRIAGFGIICSPVFWISSAVIAAFVLFGAVFPD
FT                   TAEEIFEKLQTGISEYLGWYYMLVVTVFLIFSLYLMFSRYGGIRLGDQFEAPRFSYAAW
FT                   FAMLFSAGMGIGLLFWSIAEPMYHYLDPPHADGETSEAATEAMRYTFFHWGLHAWAIYI
FT                   VVGLSLAYYAYRHNLPLLIRSSLYPFIGDRIYGPWGHLIDILALFGTMFGVATSLGLGV
FT                   MQINSGLNYVFGIEESTAMQIILVAIITLIAVGSVALGIDKGIKRLSNFNIGLAVILLA
FT                   LLLIMGPTLFILRVLVESTGVYVQHLPEMSLWADTIDETGWATVWTIFYWGWWISWAPY
FT                   VGMFIARVSRGRTIREFVAGVLLAPTAAAFVWLAVFGGTAMGYELGGVANISGAVEESV
FT                   STALFATIEAMPLWDWLAVLAMAAATVLIVTFFVTSSDSGSLVIDTLASGDVRNPTVTQ
FT                   RVYWAILEGIVASILLLAGGLAALQAAAISVGLPFSVVMLVMVFGLWKSLHSTEAVTPT
FT                   KYQKEAPPPHTLLGYTEDLDDKIK"
FT   gene            180786..181667
FT                   /locus_tag="TK90_0175"
FT   CDS_pept        180786..181667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0175"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: syp:SYNPCC7002_A2814 3-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70691"
FT                   /db_xref="GOA:D3SCH2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH2"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ADC70691.1"
FT                   /translation="MAASRVALLGCGLMGQPMGLRLLRAGFSVEAYNRTQERASDLASE
FT                   GVTVHTVPAAAVAGADTLVLMLSDAAAIQAVLRTLPEGALSGRCVIQMATILPAESRQL
FT                   AEHLRRSGACYVEAPVLGSIPEAREGRLLVMAGADTEADFERASPVLAALGENPRHVGP
FT                   VGQGAALKLAFNQLIASLTAAFSLSLGLVRREGAEVDTFMEILRESALYAPTFDKKLDK
FT                   MLSGDFGTANFPVKHLLKDVRLAERAAEDAQLIGPWLPLLAQLLEQAQDRGLADADYSA
FT                   IYSAIAPEPSAH"
FT   gene            complement(181672..184158)
FT                   /locus_tag="TK90_0176"
FT   CDS_pept        complement(181672..184158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0176"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: mfa:Mfla_1023 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70692"
FT                   /db_xref="GOA:D3SCH3"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH3"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ADC70692.1"
FT                   /translation="MAAPEVTHLPHLPNDVEGLRQSIRDAVVRVVGEDPRKATHRDWLE
FT                   ALAFAIRERMVERRLLTRRQFAEEDVKRVYYLSMEYLIGRMLEANLRNMGILDEARQAM
FT                   SDLGVDLDQIVDLEDDAALGNGGLGRLAACILESLATQGYPGYGYGIRYEYGMFRQEFE
FT                   PYRQVEHPDNWLRYGNPWEFPRSDRKYSIHFYGYVVEHHHPNGETRYTWEDGEEVLAMA
FT                   YDYPTAGYGRRNVNNLRLWAAKATRDFDLRYFNEGDYIRAVADKNESETISMVLYPNDA
FT                   TAIGKELRLKQEYFFVSASLQDALERHLGLGYPLDALPDKAAIQLNDTHPAIAVAELMR
FT                   LLVDHHEVPWDRAWDLTRRTFAYTNHTLMPEALETWSVPLMQHVLPRHMGIIYQINHEF
FT                   LEEVRHRYPGDNDRLARLSIIDEEGERRVRMAHLAVVGSHHINGVAALHTRLLQETLFE
FT                   EFFELWPERFVNVTNGVTPRLWMIQSNPALTELLGRRIGNDWQYDLERLRALEPYATDP
FT                   ELQREFMAVKRANKARLADLVRERTGVELNPDVLFDVQVKRIHEYKRQLLKLLHVVDLY
FT                   RRIRAGEDIPPRVVLFGGKAAPGYARAKAIIQVINEVADIVNHDPAVGDRLKCVFFPNY
FT                   EVSSASIIIPAADISEQISTAGFEASGTGNMKLALNGALTIGTLDGANIEIRDAVGDEN
FT                   VFIFGMTAEEVVEHRARGERPSAILERTPDLAAAVDMIESGFFTCNDPDTHRELGRYLR
FT                   EDDPFFVLADYSAYAEACERADALYADPSAWAEAAIHNVARMGFFSIDRTVRDYASQIW
FT                   DVTPEPVAPSKTNGAA"
FT   gene            complement(184485..185774)
FT                   /locus_tag="TK90_0177"
FT   CDS_pept        complement(184485..185774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0177"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: kko:Kkor_0247 phosphoribosylamine/glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70693"
FT                   /db_xref="GOA:D3SCH4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH4"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADC70693.1"
FT                   /translation="MNVLVIGNGGREHALAWKLAQSPRVQRVLVAPGNAGTARTAKCEN
FT                   VEIGVTDIDGLLALAEREDIAFTVVGPEAPLVAGVVDAFRAAGRRCFGPSAKAAQLEGS
FT                   KSFAKDFMQRHGIPTAAYGSFEDESAALDFIRAHGAPIVVKADGLAAGKGVILAQTEDE
FT                   ACAAVRDMLAGNAFGEAGHRVVIEEFLRGEEASFICMVDGEHVLPLASSQDHKARDDGD
FT                   QGPNTGGMGAYSPAPVVTDALHARILREVIEPTVRGMAADGERYTGFLYAGVMIDAEGN
FT                   PKVLEFNCRFGDPETQPILSRLESDLADLVEAALDERLDQIEARWDARVALGVVLAAGG
FT                   YPGAYRKGDVITGLESVENNPEAYVFHAGTATREDGAVVTAGGRVLCVVGLGRDVKSAQ
FT                   KKAYEAVHRIHFEDIYCRTDIGYRAVAREG"
FT   gene            complement(185788..187353)
FT                   /locus_tag="TK90_0178"
FT   CDS_pept        complement(185788..187353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0178"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: csa:Csal_2289 IMP cyclohydrolase /
FT                   phosphoribosylaminoimidazolecarboxamide formyltransferase;
FT                   TIGRFAM: phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; SMART: AICARFT/IMPCHase bienzyme formylation
FT                   region; MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70694"
FT                   /db_xref="GOA:D3SCH5"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH5"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ADC70694.1"
FT                   /translation="MTPSRPLQRALLSVSEKTGVVELARALHEHGVELLSTGGTARLLA
FT                   ENNLPVIEVSAHTGFPEIMDGRVKTLHPRIHGGLLGRRDIDADVMAEQDIPPIDLLVVN
FT                   LYPFEATVARPGCSLEEAIENIDIGGPAMLRAAAKNYRDVAVATSPDQYSELLAAIGEA
FT                   GEVPQSLRFRLAVAAFDHVARYDAAISNYLSALTEDGEAEPFPGQLNATFQRVESLRYG
FT                   ENPHQRAAFYRDPQPAPGSLASYRQHQGKALSYNNLADADAAWECVRQFEQNACVIVKH
FT                   ANPCGVAAAPTQLMAYERAFQTDPTSAFGGIIAFNRPLDGDTAHAIVSRQFVEVVIAPE
FT                   ITPGALRALAAKKNVRVLEIPPAGSAPGLDYKRIGGGLLVQDADRGSLADVELKTVTAR
FT                   APSEQELKDLRFAWQVAKYVKSNAIVYARDEQTIGVGAGQMSRVYSARIAGIKAADEGL
FT                   QVAGSVMASDAFFPFRDGIDAAAEAGITAVIQPGGSMRDDEVITAADEHGIAMLFTGMR
FT                   HFRH"
FT   gene            187831..188649
FT                   /locus_tag="TK90_0179"
FT   CDS_pept        187831..188649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0179"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: hha:Hhal_1678
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70695"
FT                   /db_xref="GOA:D3SCH6"
FT                   /db_xref="InterPro:IPR014369"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH6"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADC70695.1"
FT                   /translation="MSANIKNDQDFGEKPTERRDTENYRNEYTTGFVDKWDDLIDWDNR
FT                   AKSEGTFFIEELKKRGAKRVLDVAAGTGFHSVQLREAGFDVVTADGSPEMLAKAFENGR
FT                   KRGHILRTVQADWRMLNRDIYGRYDAVVCLGNSFTHLFNEHDRRKALAEFYSALNHDGV
FT                   LILDQRNYDTIMDHGYSSKHTYYYCGDDVQVQPAHVDEGLARFQYRFPDGSEYFLNMFP
FT                   LRKAYVRRLMREVGFQQIETYGDFQETYRETDPDFFIHVADKRYIEDENR"
FT   gene            188646..189494
FT                   /locus_tag="TK90_0180"
FT   CDS_pept        188646..189494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0180"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cts:Ctha_2187
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70696"
FT                   /db_xref="GOA:D3SCH7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADC70696.1"
FT                   /translation="MSNQYSDVVETARDYYNSEDADTFYKLVWGGEDLHIGMYEYQGEP
FT                   IGDASRRTVAHMSDLLGEPQPEWRVLDMGAGYGGVARYLVENYGCDVTALNLSEKENER
FT                   DREINKARHLDHKITVVDGSFEKVDEPDASYDVVWSEDSFLHSQNDKKKDVIKEAARVL
FT                   KPGGWLIFTDPMQTDNCPDGVLDPILARIHLDSLASPSLYREAAKEAGLYEVGFEEHSS
FT                   QIATHYGRVKQELESREEELRGYISQDYIDRMKQGLQHWVDGGQSGYLTWGIFRFRKPA
FT                   E"
FT   gene            complement(189534..190274)
FT                   /locus_tag="TK90_0181"
FT   CDS_pept        complement(189534..190274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0181"
FT                   /product="Arginyltransferase"
FT                   /EC_number="2.3.2.8"
FT                   /note="PFAM: Arginine-tRNA-protein transferase domain
FT                   protein; KEGG: azo:azo2209 arginyl-tRNA-protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70697"
FT                   /db_xref="GOA:D3SCH8"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017138"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH8"
FT                   /inference="protein motif:PRIAM:2.3.2.8"
FT                   /protein_id="ADC70697.1"
FT                   /translation="MQEHPIRWFVTAPQACPYLDDREMQSLLVDPAVSLGGARYGQLLA
FT                   EGFRRSGQFVYRHHCPTCSACVPVRIPVTDFAPSRSQRRCLKRNHDLAVTITRPPDQPG
FT                   HTPCADLDEHMPLFSRYLAHRHTGGGMERMGRDDYAGMLSHRNGPVDILEFRRDHTLVA
FT                   VALTDRTPQGLSAMYSFFDPETPDRGLGTLAVLTQIAHARRLRLPHVYLGYWIDQAPKM
FT                   AYKTRFRPIEGRVSGVWKRLTSRP"
FT   gene            190432..194223
FT                   /locus_tag="TK90_0182"
FT   CDS_pept        190432..194223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0182"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: homocysteine
FT                   S-methyltransferase; dihydropteroate synthase DHPS;
FT                   Methionine synthase B12-binding module cap domain protein;
FT                   cobalamin B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region; KEGG: noc:Noc_1206
FT                   B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70698"
FT                   /db_xref="GOA:D3SCH9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCH9"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ADC70698.1"
FT                   /translation="MTATRNDIEKALKERILILDGGMGTTIQLYKLEEADYRGERFKDW
FT                   ESDLKGNNDLLSLTRPDIIEQIHNDYLEAGADIIEANTFNGTRIAMADYHMEDLVPELN
FT                   RESAKLARKAADAWTEKTPDKPRYVAGILGPTNRTASISPDVNDPGARNVDFDTLVESY
FT                   KEAAEALVEGGVDILLIETVFDTLNAKAAIFAVKTLEDELGKELPIMISGTITDASGRT
FT                   LSGQTTEAFWNSVRHANPVSIGLNCALGAKEMRQYVEELSRIADTHVSAHPNAGLPNEF
FT                   GDYDESPEQMAADVGPWAEQGLLNIIGGCCGTLPEHIRAMREAVEKFPPRKVPEIAPAC
FT                   RLSGLEPCNITDDSLFVNVGERTNVTGSRKFLRLIQNEEYDVALEVALNQVEGGAQIID
FT                   INMDEGMLESQDAMVRFLNLLAGEPDIARVPVMIDSSKFEIIEAGLKCVQGKAVVNSIS
FT                   MKEGEENFIKQAQLCRRYGAAIVVMAFDEDGQADNEDRRVEICTRAYRLLTEKVGFPAE
FT                   DIIFDPNIFAVATGIEEHNNYGVDFIEATRRIKQDLPHALVSGGVSNVSFSFRGNEPVR
FT                   EAIHAVFLYHAIKAGMDMGIVNAGQLAVYDDIDEKLKEAVEDVVLNRRDDATERLLDLS
FT                   EEYKGQGGGKKEENLEWREWEVTKRLEHSLVKGIDTYVVEDTEEARQQYDRPIQVIEGP
FT                   LMDGMNVVGDLFGEGKMFLPQVVKSARVMKKAVAHLIPYIEAEKTGTENNGKILMATVK
FT                   GDVHDIGKNIVGVVLQCNNFEVIDIGVMQPGAEILKAAKEHDVDVIGLSGLITPSLEEM
FT                   ANFAADLEREGMTTPLMIGGATTSRAHTAVKIEPNYSGPVVWVKDASRAVGVAQSLISP
FT                   ELRENYAAEIREEYEKLRVQNAGRKKKTQWVTLEKARANKPQIDWSSYTPTKPKALETD
FT                   KLPGEPKVLHPHGDGSVLLRFDDFDLNEVRNFIDWTPFFHSWQLHAAYPRILDDEKVGE
FT                   EARKLFKDGQEMLDRMIEEKWVTLRGVVGFFPANTVNDDDIEVYTDESRSKVLKKLHHL
FT                   RQQTEKRRGQPSHSLADFLMPKEAGGPDYLGAFAVSAGGDVDAKAEEYEKANDDYHAIL
FT                   VKSLADRLAEAFAECMHQYVRKHYWGYVPDEALENEDLIDEKYQGIRPAPGYPACPEHT
FT                   EKGTLWELLQADEHADMTLTESYAMLPVSAVSGWYFAHPESRYFGLGKVNRDQVEDYAK
FT                   RKGMSFEEAERWLAPNIGYDDSDEAKAEARAEREARSA"
FT   gene            complement(194299..195060)
FT                   /locus_tag="TK90_0183"
FT   CDS_pept        complement(194299..195060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0183"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   noc:Noc_2997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70699"
FT                   /db_xref="GOA:D3SCI0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCI0"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADC70699.1"
FT                   /translation="MTILEHLGLLFIAILANGFSALAGGGAGLLQLPVLIFLGLPYPVA
FT                   LATHKIATVALGAGASLRHLKQSTFEPARLAVILAAGLPGVLIGAWLVLGIPPRAGEIA
FT                   LGLLTIALGWYSWRRPQLGQAVRETDKTLHHAVIGALGLFIIGILNGSLASGTGLMVTL
FT                   WLVRWYGMSYTQAVGYTMVLVGLVWNGAGALLLGTFGTVQWDWLPALLVGSFIGGYLGA
FT                   ALAHRYGNRLVKRTFEVVTVLTGIALLAPVP"
FT   sig_peptide     complement(194989..195060)
FT                   /locus_tag="TK90_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.959 at
FT                   residue 24"
FT   gene            195125..195709
FT                   /locus_tag="TK90_0184"
FT   CDS_pept        195125..195709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0184"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mms:mma_0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70700"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70700.1"
FT                   /translation="MLALPAHADIYRWVDDGGTVHYSNTPQPEASQRERRVFDSHGLMR
FT                   EIIPAPPTAEEREQARAEQERAQQELEAARQARADRVARERQLRQAYENLDEIEELRAR
FT                   REAAIGGDIARSEAQEITLLRERERIRRQYESSESASARARFEVQLEDLEVRIDRERAY
FT                   RRGQEDRLAAIQQRLDLDREDYQRLVGNGEG"
FT   gene            complement(195718..196596)
FT                   /locus_tag="TK90_0185"
FT   CDS_pept        complement(195718..196596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0185"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: mca:MCA2781 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70701"
FT                   /db_xref="GOA:D3SCV6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCV6"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ADC70701.1"
FT                   /translation="MDTQTAHSVAHVLIEALPYIQRFAGKTIVIKYGGNAMTEDHLKAS
FT                   FARDIVLLKQVGVNPVVVHGGGPQIGQLLERLGKQTEFVNGLRVTDRETMDVVQMVLGG
FT                   IVNQEIVSLINRFGGRAVGLTGKDGQMIRANPLRDYGASEGQPTVDLGHVGEVEGVDPA
FT                   IVHTLDESDFIPVIAPIGFDRDGKAYNINADTAAEKLAVVLDAEKLFLLTNTPGVLDGN
FT                   GELLPKLSAPQVDEMIRDGTIHGGMIPKIRCALDAVRSGVNATHIVDGRVEHAVLLELL
FT                   TDEGVGTLISR"
FT   gene            196754..197272
FT                   /locus_tag="TK90_0186"
FT   CDS_pept        196754..197272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0186"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /note="PFAM: cytochrome c oxidase subunit II; KEGG:
FT                   eba:ebA3665 cytochrome-c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70702"
FT                   /db_xref="GOA:D3SCV7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCV7"
FT                   /inference="protein motif:PFAM:PF00116"
FT                   /protein_id="ADC70702.1"
FT                   /translation="MLQSISLWLTILLVVPVTATFLWVAFSRPAAVDAGDLTARSYRLR
FT                   DWSFWVLLAVVTPVFLYTLTLMPYGTDPEAEGVQAVNVTGHMWRWDLSQDEFRVGEPVQ
FT                   FRVTSQDVNHGFAIYDEDMTLLTQTQAMPGYTNILEYTFEQPGTYQVLCLEYCGVAHHA
FT                   MVAELTVTE"
FT   sig_peptide     196754..196852
FT                   /locus_tag="TK90_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.880) with cleavage site probability 0.489 at
FT                   residue 33"
FT   gene            197279..198730
FT                   /locus_tag="TK90_0187"
FT   CDS_pept        197279..198730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0187"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   eba:ebA3666 cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70703"
FT                   /db_xref="GOA:D3SCV8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCV8"
FT                   /inference="protein motif:PFAM:PF00115"
FT                   /protein_id="ADC70703.1"
FT                   /translation="MSDTTMEPAVPRGARNAVITYLATTVVVLLLMMVFGLLMRLEQAG
FT                   MDLMGAAGFYQVLTAHGAGMVGAVALGSSAVMWYFLRRHVALSTGVFLLNLALFLLGAV
FT                   LILGGIFIGGFAGAWTFLYPLPQTPMGLWTQAAAASFFLGLLAIGVGFLLLYIDIARAL
FT                   ITNYGGLGRSLGLPQLFGRAGDPPPPAVVASTMVLIVNTLGIVAGAAILSMSLINLYQP
FT                   AFEIDSLWAKNLTYFFGHVFINATIYMAVIGVYEILPRYTGRPWKVSRVFLAAWAASTV
FT                   MVLLVYPHHLLMDFSQPTSLHVLGQVISYTSGLPVLLVTAWGALTNVYRSGIRWDIASG
FT                   FVFLGVFGWAAGVIPAIIDATIVVNTVMHNTLWVPGHFHFYLLLGVVAMMFGFMAWLTR
FT                   SQAEGDGFFDRLGFWTFTGGGLALVAVFLYSGASSVPRRFAEHLPEWAAYAQLGSVAAA
FT                   LVILGTLLLALRFFLGLKRVANNVA"
FT   gene            198720..199331
FT                   /locus_tag="TK90_0188"
FT   CDS_pept        198720..199331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0188"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   eba:ebA3668 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70704"
FT                   /db_xref="GOA:D3SCV9"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCV9"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ADC70704.1"
FT                   /translation="MWRNAIYGLTIIALGLGGFTTLSLATDGFRAFTAEEARRLAAREN
FT                   PAPVPAMKLEDARGGELDLAELGDRYVVLDFIYTGCHHACTTLGASFHRIQEALPEDVL
FT                   GERVALLSITFDLENDDAARLLEYGERFSANPEAWHLARPKTREDLDRLLRHFQVVVIP
FT                   DGQDFVHNGAIYVVEPDARVAGIHDIDAVDDVLAYLEPRW"
FT   sig_peptide     198720..198797
FT                   /locus_tag="TK90_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.933 at
FT                   residue 26"
FT   gene            199331..199948
FT                   /locus_tag="TK90_0189"
FT   CDS_pept        199331..199948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0189"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: net:Neut_1877 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70705"
FT                   /db_xref="GOA:D3SCW0"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW0"
FT                   /inference="similar to AA sequence:KEGG:Neut_1877"
FT                   /protein_id="ADC70705.1"
FT                   /translation="MRPSTVWAGPALLAVLVLTPLRPWLEASLIGHMLVQIPLLVLAGA
FT                   LMARSLPEAWRIRAARLDAYGVLGLLLALFVVVYWLLPRNLDAAVLEAGAGWLKIVTLV
FT                   LLAGMPLGLTAPLLPLLVRGVLWVKGTAMFFVMGWLYREAPDRLCNAYLLGEQLMLGNI
FT                   MLGLGAISLAAILALLFFGPPNRHRQVVAGETLDQSQLSRAL"
FT   gene            200177..201358
FT                   /locus_tag="TK90_0190"
FT   CDS_pept        200177..201358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0190"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: Oxidoreductase FAD-binding domain protein;
FT                   globin; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   KEGG: pag:PLES_24401 nitric oxide dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70706"
FT                   /db_xref="GOA:D3SCW1"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW1"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ADC70706.1"
FT                   /translation="MLSDDHKAIIQKTVPILESGGEDLTRHFYSIMFRDYPEVRPLFNQ
FT                   AHQASGQQARALANAVLQYARHIDEMEALGPLVGQIVNKHVSLQVQPEHYPIVGECLLR
FT                   AMRELLGEEIATDAVLEAWGAAYQQLADILIAAEEDAYQQAEAQAGGWRGLRSFVVRRK
FT                   VPESEEITSFYLEPQDGGPVPPFQPGQYIGLKVDIDGEELRRNYSLSIPPGADGLRISV
FT                   KREPKGRVSRFLHDRIREGDVLQLTPPAGDFVLRESDRPLALISAGVGITPTMAMLDPA
FT                   LQAGRRVHFIHCARHSGVHAFREQVEARAREHDHLRPYFCYSEPANEDAADATGFLTRD
FT                   KLAEWLPHRTEVDVYFLGPTPFMRQVRQQLRELGVPDERCFFEFFGPARALEA"
FT   gene            complement(201359..202183)
FT                   /locus_tag="TK90_0191"
FT   CDS_pept        complement(201359..202183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0191"
FT                   /product="peptidase C26"
FT                   /note="PFAM: peptidase C26; KEGG: aeh:Mlg_2749 peptidase
FT                   C26"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70707"
FT                   /db_xref="GOA:D3SCW2"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW2"
FT                   /inference="protein motif:PFAM:PF07722"
FT                   /protein_id="ADC70707.1"
FT                   /translation="MAGSEQDAAAPSDHPRPRRPVVAITGPDQGGGPAWLFTALAVWRA
FT                   GGRPLRVRPGKPRPQRSFDALVVGGGADVDPELYGESLPQGPNPEAIRGAERRLSQRLI
FT                   GYLFYPALWLLRRMFQSHGGVLDVERDRLEKALIHRALDEHRPVLGICRGMQLINVVRG
FT                   GTLQQDLAEFYVETPQARSLLPVKPVMLDGRSHLAEILGAGAIHVNALHNQAVDQLGQG
FT                   MRIVGREETGVVQAIEAEHGWCIGVQWHPEYLPQKTRHQRLFRALVAATRSV"
FT   gene            complement(202170..203162)
FT                   /locus_tag="TK90_0192"
FT   CDS_pept        complement(202170..203162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70708"
FT                   /db_xref="InterPro:IPR022025"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW3"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2750"
FT                   /protein_id="ADC70708.1"
FT                   /translation="MPERFHDLPWPDNPEGSPRKVGVEIEMAGVSLERMAEAIRAEFGG
FT                   QVRCESPFVARVCDTDQGDFRVELDARVLKDRAYRSHLRRLGIELDDSDEAALDRWLAD
FT                   AAGRLVPHEIVAPPIPASALPRLDRVRAALQEAGALGTERSLLYAFGLQLNIEVHSTDA
FT                   AWILDVLRAFLLLYEMLTNAGEIDLARRLSPYIRAFPGTFVRETLNPDFQPDQGQLIDH
FT                   YLAHNTTRNRPLDMLPLYAELDQERIDAAPVEHELVKARPAFHYRLPNCEIDDPEWSLA
FT                   HPFNGWVEVERLAADRERLERMGREYLERPSQALGRWADDWARKLRGWF"
FT   gene            203274..203639
FT                   /locus_tag="TK90_0193"
FT   CDS_pept        203274..203639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0193"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="KEGG: cja:CJA_0769 dihydroneopterin aldolase;
FT                   TIGRFAM: dihydroneopterin aldolase; PFAM: dihydroneopterin
FT                   aldolase; SMART: dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70709"
FT                   /db_xref="GOA:D3SCW4"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW4"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ADC70709.1"
FT                   /translation="MDRIYLKDLRIDAVVGVYDWEQRIQRPLRFDIQLATDTRIAAHSG
FT                   EITDTVDYEAVANAVRAIVTREPHALLESLAEEIAEALMAEFRTPWVRIELGKPGAVAG
FT                   VAEVGIVVERGTLPASA"
FT   gene            203894..204631
FT                   /locus_tag="TK90_0194"
FT   CDS_pept        203894..204631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cps:CPS_0478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70710"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW5"
FT                   /inference="protein motif:PFAM:PF09694"
FT                   /protein_id="ADC70710.1"
FT                   /translation="MKKFTRSALAAAIVTVGSTGGVAFTSTATAELSVNIGAVSNYYFR
FT                   GGSETDGGAAIQGGIDYEHESGFYVGTWASNVDFGTDDEGVEDQTSYELDLYLGFADEF
FT                   ANGFGYDVGYVYYAYPDARDDSGSLSADFGEIYGELSFDTGPVGLYTGIAHVVTDSSDS
FT                   ALERKDTYYYGGLDIPFMDVYSVGFLVGRQTFDDTDENDNYTHYTASLTRDAGDWGEFS
FT                   FNLEYVDESDEDVGAWVGWTKTF"
FT   sig_peptide     203894..203986
FT                   /locus_tag="TK90_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.524 at
FT                   residue 31"
FT   gene            204697..205035
FT                   /locus_tag="TK90_0195"
FT   CDS_pept        204697..205035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0195"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   sde:Sde_0234 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70711"
FT                   /db_xref="GOA:D3SCW6"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW6"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ADC70711.1"
FT                   /translation="MKMITAVIKPFKLDDVREAISEIGVQGMTMTEVKGFGRQRGHTEL
FT                   YRGAEYVVDFLPKVKLEVAVDENLVDQVVEAISKSASTGKIGDGKIFITPVEQVVRIRT
FT                   GETGPEAL"
FT   gene            205073..206326
FT                   /locus_tag="TK90_0196"
FT   CDS_pept        205073..206326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0196"
FT                   /product="putative ammonium transporter, marine subtype"
FT                   /note="TIGRFAM: putative ammonium transporter, marine
FT                   subtype; ammonium transporter; PFAM: ammonium transporter;
FT                   KEGG: aeh:Mlg_0079 ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70712"
FT                   /db_xref="GOA:D3SCW7"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW7"
FT                   /inference="protein motif:TFAM:TIGR03644"
FT                   /protein_id="ADC70712.1"
FT                   /translation="MEIEQQVVELAYAMDTFYFLVAGALVMWMAAGFTMLEAGMVRTKS
FT                   VAEIATKNIALYSIASIMYMLIGYNIMYGDGLSSVIPSLGFLITGDNAVGDVLGSDGDI
FT                   YYSDRADFFFQVVFVATAMSIVSGAVAERMKLWAFLAFAVVLTGFIYPIQGFWSWGEGF
FT                   LDQIGYLDYAGSGIVHFTGAAAALAGVLVLGARKGKYGKDGQINAIPGSNMPLATLGVL
FT                   ILWLGWFGFNGGSELKVSDIESANAVAAVFANTNLAAAGGVVAALITTRLVFGKADLTM
FT                   ALNGAVAGLVSITAEPLMPSPFLAMIIGAIGGVIVVFSIVALDKLKIDDPVGAISAHGT
FT                   AGIWGVMAVLLSNPDATFFGQIAGLLAIFAFVFTASLIVWAILKAVMGIRLSEEDEDIG
FT                   ADITECGLEAYPEFTGKQ"
FT   gene            206529..207149
FT                   /locus_tag="TK90_0197"
FT   CDS_pept        206529..207149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0197"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: tmz:Tmz1t_0166 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70713"
FT                   /db_xref="GOA:D3SCW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC70713.1"
FT                   /translation="MDRLFEAHELKTAHLGPLELQLQPGELVQVTGASGSGKSLLLRAL
FT                   ADLDPNTGEVRLAGAPRDSMPPVQWRRQVAYVPAETAWWDERVDDHLPADFSRETVLHL
FT                   LEQVALPEESLHWEVERLSSGEKQRLGLLRALLNHPRVLLLDEPTANLDLENTRRIERA
FT                   VRTYLAEEEAAALWVSHDTLQRQRLGGRILTISNGKLEAPAWS"
FT   gene            207140..207946
FT                   /locus_tag="TK90_0198"
FT   CDS_pept        207140..207946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0198"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   hha:Hhal_2410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70714"
FT                   /db_xref="GOA:D3SCW9"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCW9"
FT                   /inference="protein motif:PFAM:PF03649"
FT                   /protein_id="ADC70714.1"
FT                   /translation="MELISLSPFDLSLAALLVVALAGVTVWARMGLGRSLLIAGARTVI
FT                   QLLLVGLILQTLFDHAQLGWVALMAVVMLAVAGYEVMARQQRRFAGLWGYGIGTVTMFI
FT                   SAFAVTVLALTTMVGPTPWWEPQYAIPLLGMLLGNTMTGIALGLDRLTQTVWRERRTIE
FT                   GRLAMGASWSEAVTTMRREAARSGLMPTINAMAAAGIVSLPGMMTGQILAGAPPVEAVK
FT                   YQILIMFLITAGTGFGTLGAVWFASRRLFDTRERLRLDRLKAGRHA"
FT   sig_peptide     207140..207226
FT                   /locus_tag="TK90_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.769) with cleavage site probability 0.730 at
FT                   residue 29"
FT   gene            complement(208235..208519)
FT                   /locus_tag="TK90_0199"
FT   CDS_pept        complement(208235..208519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_25470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70715"
FT                   /db_xref="InterPro:IPR031552"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX0"
FT                   /inference="similar to AA sequence:KEGG:HRM2_25470"
FT                   /protein_id="ADC70715.1"
FT                   /translation="MTTGVEVLQSTRFRRAYKRLHPAQKADVDDAVADIIRDPELGTSK
FT                   KGDLAGVMVYKFKSRGQLMLLAYEYDPRTRHLLLLGTHENFYRDLKRDS"
FT   gene            complement(208519..208746)
FT                   /locus_tag="TK90_0200"
FT   CDS_pept        complement(208519..208746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pph:Ppha_0897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70716"
FT                   /db_xref="InterPro:IPR021831"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX1"
FT                   /inference="similar to AA sequence:KEGG:Ppha_0897"
FT                   /protein_id="ADC70716.1"
FT                   /translation="MSLPVRIDETLYQQARAHAKAEHRTIAGQIEFWAEVGRTAMDNPD
FT                   LPIDFICELLIARAEGRELATPFTPEGQRD"
FT   gene            complement(209064..209915)
FT                   /locus_tag="TK90_0201"
FT   CDS_pept        complement(209064..209915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0201"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; KEGG: maq:Maqu_0521 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70717"
FT                   /db_xref="GOA:D3SCX2"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX2"
FT                   /inference="protein motif:TFAM:TIGR00417"
FT                   /protein_id="ADC70717.1"
FT                   /translation="MALDNNWFSEPHEDMALSLRIKQKLHEEQTPYQKIEIYETEAFGN
FT                   LMVIDDCVMLTGRDNFIYHEMMSHPVLYSHSAPKNVVIIGGGDCGTLREVLKHDEVEKA
FT                   VQVDIDERVTRLSEQYFPELCDANDDPRAELLFDDGVQYLKDAAPGSIDVIIVDSTDPV
FT                   GPAEGLFSTAFYRDCVKALGADGLLVQQSESPLLHTDSIIRPMHDSLRAANFIDALTMH
FT                   FPQATYPSGWWTCTIAAKDCPVSFLREEAAEELPFVTHYYNAAIHRAAGATPEFFRRKL
FT                   FA"
FT   gene            210231..212135
FT                   /locus_tag="TK90_0202"
FT   CDS_pept        210231..212135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0202"
FT                   /product="arginine decarboxylase"
FT                   /note="TIGRFAM: arginine decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; KEGG: aeh:Mlg_0072 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70718"
FT                   /db_xref="GOA:D3SCX3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX3"
FT                   /inference="protein motif:TFAM:TIGR01273"
FT                   /protein_id="ADC70718.1"
FT                   /translation="MTVTPWNLDEARATYGIDHWNGGFFEVNAAGNVAMRRADWPDHPG
FT                   VDLYELAGRLREEHVGPPVLVRFQDVLDGRVRRLARAFDAAARELEYEGAFTAIYPIKV
FT                   NQQRSVVDQILAAGDQPDAEGLTPRVGLEAGSKPELMAVLAQSRPGAAIICNGYKDREY
FT                   VRLALIGRQLGHRVYIVIEKPSELEEVIRQAEAMQVEPLLGLRVRLASIGKGKWQNTGG
FT                   EKAKFGLSAADVLGILGRLRGLGWLDRLQLLHFHMGSQIANIRDIQNGMGEAASYFAAL
FT                   TEAGAALRVVDVGGGLGIDYEGSRSRNECSINYSVEEYALNILRPLKRICEEQGLAMPE
FT                   VFSESGRALTAHHAVLITNVIDCEPAPGDGDVPPAENGELPEIAAMRALLEDGERPASE
FT                   IYHDAAYGLSEVQARFARGMLSLADRARAEAIYFALCQRLLARPEALPAEIHAELTDKL
FT                   ADKVFCNFSVFQSIPDTWAINQIFPIMPLHRLAERPTRRAVLQDLTCDSDGHIEHYVER
FT                   EGTHTTLALHPWNDREPYYLGIFLVGAYQEILGDLHNLFGDTDTVNVELLPEGGYRLVD
FT                   PERGDTVDELLSYVHFAPDDLRRTFRAKIDAAGLRGEAAGRLLAELEQGLTGYTYLED"
FT   gene            212140..212388
FT                   /locus_tag="TK90_0203"
FT   CDS_pept        212140..212388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0203"
FT                   /product="protein of unknown function DUF709"
FT                   /note="PFAM: protein of unknown function DUF709; KEGG:
FT                   avn:Avin_32960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70719"
FT                   /db_xref="InterPro:IPR027354"
FT                   /db_xref="InterPro:IPR038068"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX4"
FT                   /inference="protein motif:PFAM:PF05166"
FT                   /protein_id="ADC70719.1"
FT                   /translation="MQCYVYRATRRADTYVYLPQKDDFSELPDGLTRALGRLEFALEFE
FT                   LTPERALAQEDPQKVLANLEEQGFHLQLPPPEDEPST"
FT   gene            212806..214623
FT                   /locus_tag="TK90_0204"
FT   CDS_pept        212806..214623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0204"
FT                   /product="GTP-binding protein TypA"
FT                   /note="KEGG: aeh:Mlg_0941 GTP-binding protein TypA;
FT                   TIGRFAM: GTP-binding protein TypA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   elongation factor Tu domain 2 protein; elongation factor G
FT                   domain protein; SMART: elongation factor G domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70720"
FT                   /db_xref="GOA:D3SCX5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX5"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ADC70720.1"
FT                   /translation="MTEKLRNIAIIAHVDHGKTTLVDQLLRQSGTLDARGDHGERIMDS
FT                   NAIEKERGITILAKNTAIEWQDYRINIVDTPGHADFGGEVERVLSMVDSVLLLVDAVDG
FT                   PMPQTRFVTQKAFAMGFKPIVVVNKVDRPGARPDWAVDQVFDLFDRLGATDEQLDFPIV
FT                   FASALNGFAGMDSSVTEGDMTCLLETIVEHVSPPNVDADGPFQMQVSSLDYNSYQGLIG
FT                   IGRVKRGRIKPNTPVKVVDREGKVRNGRMLQIMGFHGLERVEVAEARAGDIITFTGMDE
FT                   LYISDTLCDPNNVEAMEPLTVDEPTVTMTFQVNTSPFAGREGKYVTSRVLRDRLLEELK
FT                   HNVALRVEETDDADKFKVSGRGELHLGILIENMRREGYELGVSRPEVVIKEVDGVKQEP
FT                   YEAVTVDVEEQHQGTIMEKLGERRGDMTNMVPDGKGRVRLDFIIPSRGLIGFQTEFMTA
FT                   TSGTGILHHIFDHYGPYQPGAVASRQNGVLIANAAGKALGFALFNLQDRGKLFIGPGDE
FT                   VYEGMVIGLHSRENDLVVNALKAKQLTNIRAAGTDENIQLTPPIRMTLEQAIEFIDDDE
FT                   LVEVTPENLRIRKKFLLEHERKKASRASA"
FT   gene            complement(214888..215274)
FT                   /locus_tag="TK90_0205"
FT   CDS_pept        complement(214888..215274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0205"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   pna:Pnap_3715 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70721"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX6"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADC70721.1"
FT                   /translation="MRILLDTHALLWWFTNDSRLSARAREVIGDLESTVLVSAASAWEI
FT                   ATKHRLGKLQIGGVVIQRFDELVTADGFTHLAVNYPQAIHAGTYSVDHRDPFDRILAAQ
FT                   AELEQIPLLTTDPALRDFPIRCIW"
FT   gene            complement(215276..215506)
FT                   /locus_tag="TK90_0206"
FT   CDS_pept        complement(215276..215506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0206"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: pna:Pnap_3716
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70722"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX7"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADC70722.1"
FT                   /translation="MSTTVNVHEAKTHLSRLLKRAHDGEEIILAKSGRPYARLVPLEPT
FT                   PLRRQPGRVTGQVEDAFFAPLPEDELAAWEK"
FT   gene            215790..216011
FT                   /pseudo
FT                   /locus_tag="TK90_0207"
FT                   /note="hypothetical protein"
FT   gene            complement(216072..216491)
FT                   /locus_tag="TK90_0208"
FT   CDS_pept        complement(216072..216491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0208"
FT                   /product="putative prepilin like protein"
FT                   /note="KEGG: azo:azo2918 putative prepilin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70723"
FT                   /db_xref="GOA:D3SCX8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX8"
FT                   /inference="similar to AA sequence:KEGG:azo2918"
FT                   /protein_id="ADC70723.1"
FT                   /translation="MNTRARFIPAGFTLIELMVVVAVVAILAAIAYPSYQNHVTNTWRA
FT                   NAAGCLTETAQSMERRYTREMSYEGDLPQRGCMNESGMPERYDFRLAEVERAAFRLEAV
FT                   PQGVQASRDTQCGTLTLNERGERGAAANDNSGECW"
FT   gene            complement(216488..216805)
FT                   /locus_tag="TK90_0209"
FT   CDS_pept        complement(216488..216805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpa:BPP1129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70724"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70724.1"
FT                   /translation="MKTPEKPTTLARRRVLAVLLGSLSLAPIHAAAYLPQERTVEGVLE
FT                   RHLPGEDIVIIAGERYRLHPRAPRPAPPGRGHQDGSQPVIGSRVVARIVKGRIVHMERA
FT                   Q"
FT   sig_peptide     complement(216713..216805)
FT                   /locus_tag="TK90_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.797 at
FT                   residue 31"
FT   gene            complement(216829..220353)
FT                   /locus_tag="TK90_0210"
FT   CDS_pept        complement(216829..220353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0210"
FT                   /product="Neisseria PilC domain protein"
FT                   /note="PFAM: Neisseria PilC domain protein; KEGG:
FT                   pca:Pcar_2155 Tfp pilus assembly protein, tip-associated
FT                   adhesin PilY1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70725"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY0"
FT                   /inference="protein motif:PFAM:PF05567"
FT                   /protein_id="ADC70725.1"
FT                   /translation="MTPGTSTPRAAPRRALVAAALGLALASMPASVTAQVANKPLFLTG
FT                   PGLPPNVLLILDNSDSMQEGLSQGRVALDWDQCAPGEDLDPEACPAGARYEDSKGSIVK
FT                   RVGRSLINEYRGRINLGLMAYQQHPPSNARNDVFISAVDDPADLGTVLWRLVHRPHDVR
FT                   YASTPEPAFYDPDHEGPWDSDIKRFREPHPTRDDVWVFYNVAVPGYQWITAEDGATGFP
FT                   VHDETWFCEYAGNFTEDDLFPFDCYRDVTAGPGEQPVYSNQIPLNLLGTLTDSMRQRGV
FT                   THWGEHMIFSQLNQPEWRANHSPGLGYLHVPIGGFDADGNIDPEHWEAIERKLEPQRHD
FT                   WSPGDGNVLVDPDWPLIAAGLTPLEGTMRTARDYFLGQTEHFGTEQGNLDTPEIPRSCD
FT                   VNAAVWVTDGLPSVQADGTELGDDPATAIRQASDAIEDFHTTTDVDTYIVGFALPPGIG
FT                   ELDDAMPENPLDLLADSGGTGSAYDATSEDGLLDAMSRVFESVIAEATGSSAAVAANST
FT                   SLQAGSAIFQAGFDSSDWSGELRAFRLLAPAADNESLIDTSPAWDAESNLAAPTNRNLI
FT                   TWAPAADPEEGLPAWSQGNTVPFEFDALTQTQRDALGGEEDGPRRLDWVRGDQAHEGFG
FT                   EDQFRPRQRLLGDIVHSRPLFVHAQDFGYGQFEGVGEAYTDALTAWSSERPLVMVGAND
FT                   GKFHAFDGRLPCQTDVPEPIGGCSSEGGSEVFALIPNAVYDDLSELSHPNYDRRYVLDG
FT                   SPRLGHVHDGSEWRRIVVASQGAGGTGVFALDVDRQEVLWEIDAEHDAFSTSLGRVLGD
FT                   PVLGRAASGDWVTIIPNGYGSSQGQASLLILDTLSGEMLLEWTPNHPDNGDDNGMFTPV
FT                   PVDSNGDRRIDRVYAGDLGGNLWRLDLGGNGPAQWGAPGFLTTGTQTAPLFQARDAGGV
FT                   PQPITARPAVARDDSGHVNLFFGTGQYFEVGDNDPDNIGVQSLYGIRDTDEASVTRPEL
FT                   LTQEILHEVHAFGFDLRVTSDHTMEDNHAGWVMDLVSPLFGFQGERVVEDALIRHGDRV
FT                   VFATLIPEPSDDPCDVGGGTGWIMEFDAFGGGRLQRSPWDLSGEGFGDESFVEVETENE
FT                   DGSVESVRIPAHGIRSPVGIPTRPTVVEDTERRDREYKLPTGSEGQVWQMPDEERPGFT
FT                   WRSWRQLR"
FT   gene            complement(220385..220882)
FT                   /locus_tag="TK90_0211"
FT   CDS_pept        complement(220385..220882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0211"
FT                   /product="Tfp pilus assembly protein PilX"
FT                   /note="KEGG: pca:Pcar_2156 Tfp pilus assembly protein PilX"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70726"
FT                   /db_xref="GOA:D3SCY1"
FT                   /db_xref="InterPro:IPR025205"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY1"
FT                   /inference="similar to AA sequence:KEGG:Pcar_2156"
FT                   /protein_id="ADC70726.1"
FT                   /translation="MNTTPRSAPPRHRQQGSALIVGLVLLLVITLIAVTGMRNTILQER
FT                   MTGNMLDRNLAFQAAEAALRHGQMNLDPGAAAEPVDAPADPLAWEERLANGGGTAYAPP
FT                   DAESFGLYAMPRYYIEAVPVPPVDALAADEALPNQDLYRITVRAQGGSPEAVVILQATF
FT                   RH"
FT   gene            complement(220885..221919)
FT                   /locus_tag="TK90_0212"
FT   CDS_pept        complement(220885..221919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0212"
FT                   /product="type IV pilus assembly protein PilW"
FT                   /note="KEGG: rpi:Rpic_0672 type IV pilus assembly protein
FT                   PilW"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70727"
FT                   /db_xref="GOA:D3SCY2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY2"
FT                   /inference="similar to AA sequence:KEGG:Rpic_0672"
FT                   /protein_id="ADC70727.1"
FT                   /translation="MSTARSFASIRQRIRGFTLVELMVAMVLGLLIVGGVIALFVSTQQ
FT                   TSRTQEAMSRAQETGRFVIERIARDAREAGHQGCRGGNINNLLDTASADYDPWVHGVES
FT                   AFLPPEQPNDHLRGDVLTLHGMTAIGSIPVSVPNTTAPINTDETVDVAQGEVVLVADQA
FT                   GTTCELFQNAPAQPGVLSRATGANISPGNVAGDLTDFSGPATISVSRLETITYYIAESS
FT                   ASPGVASLFRRSTADTDSSGNPVRREIAEGVYDLRLEFGQDTNDNQQIDRFVAASNTAS
FT                   WSDSDWAQVAAVRVHLLVYNGLDNNVVDQPRTGLLFANELFDAPDRRLYLVFTTTVATR
FT                   NRLE"
FT   gene            complement(221916..222386)
FT                   /locus_tag="TK90_0213"
FT   CDS_pept        complement(221916..222386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0213"
FT                   /product="type IV pilus modification protein PilV"
FT                   /note="TIGRFAM: type IV pilus modification protein PilV;
FT                   KEGG: noc:Noc_2271 type IV fimbrial biogenesis protein
FT                   PilV"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70728"
FT                   /db_xref="GOA:D3SCY3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY3"
FT                   /inference="protein motif:TFAM:TIGR02523"
FT                   /protein_id="ADC70728.1"
FT                   /translation="MLYRSSPAFFVARTRGVTLIEVLVALVVLSIGVIGLAALQAQALQ
FT                   LNQGAYMRAQATNLAYDIADRMRTNREVALDGAYDTDFQPPPVCEAPEAGGDLASADLA
FT                   QWRMALACALPEGQGRIERDGDVFTITIRWDNRRLAEDGEDPIEVFVTRTGI"
FT   sig_peptide     complement(222255..222386)
FT                   /locus_tag="TK90_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.734) with cleavage site probability 0.602 at
FT                   residue 44"
FT   gene            complement(222396..222914)
FT                   /locus_tag="TK90_0214"
FT   CDS_pept        complement(222396..222914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0214"
FT                   /product="pre-pilin like leader sequence"
FT                   /note="KEGG: xcb:XC_1621 pre-pilin like leader sequence"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70729"
FT                   /db_xref="GOA:D3SCY4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY4"
FT                   /inference="similar to AA sequence:KEGG:XC_1621"
FT                   /protein_id="ADC70729.1"
FT                   /translation="MEDTPIRQTRRKGFSLVELMITIAVLVILISLAAPHFSTLVENHR
FT                   TSSTTNALASALNLARSEAVRRGLDAAVCPDGNDWEDGWETRVYAMDEDPSDCGQGTVL
FT                   QHWAGPASTIQVAANGPLAFDALGAQSSPEPTDATMRIWPQGCSGERARSLHVEPGGRV
FT                   STRPDNCPE"
FT   gene            complement(223007..223531)
FT                   /locus_tag="TK90_0215"
FT   CDS_pept        complement(223007..223531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0215"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2876 methylation"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70730"
FT                   /db_xref="GOA:D3SCY5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY5"
FT                   /inference="similar to AA sequence:KEGG:Bpro_2876"
FT                   /protein_id="ADC70730.1"
FT                   /translation="MRKDALGLTLVELMVTLAVFAVLIGIAAPAFGKLVEQNRVTSATN
FT                   SFLTTLHLARSEAVRRGSPVTLCTSQDGATCSPGSDWDGGWILYQNPALATHPSGPDAI
FT                   LRVGRETPRVEIAGNTPTREYITFDALGQSQQLSGAWLMGTIRICAGEGSGRAIVLANT
FT                   GRPRVGEATCG"
FT   sig_peptide     complement(223433..223531)
FT                   /locus_tag="TK90_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.667) with cleavage site probability 0.637 at
FT                   residue 33"
FT   gene            complement(223723..225378)
FT                   /locus_tag="TK90_0216"
FT   CDS_pept        complement(223723..225378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A2944 fimbrial biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70731"
FT                   /db_xref="GOA:D3SCY6"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70731.1"
FT                   /translation="MHNHTRFRVCGISLIEALIAIAVVSVGLLAIARLHGDLLSSAGDS
FT                   KARAEAMQIAETEIEKLRNASTLTDLNRRLENVRTEAPGRNADYTLEWSNLPDTSDFGF
FT                   FEPEVRVTWIDRRGDAQSVLISTAVAWSNPRFSVAAARADSEGGNFLNAPTGRARMGGG
FT                   ELLEGTDVTTVTNVIEGTSIEDGTETRQRDGEVQLVRDGEVVMTMDTTNPGELFSTISG
FT                   RVYYGGTISLNPVVTRVLSSDAGFCTRRGQEPLGSALKPFVDSASGYSYFYYQCYVGEG
FT                   WYGNVGIVRQENANPNDRSCVGDHLAEETSAWDSREPRTSSNRFYRSFIETTSGIRAIG
FT                   IGITPAEGDSQNPTYVAQNLTSHDFMLTRFRSGNNRPRDCFEALEDGEGAFEDNAGRHV
FT                   CLYEGGMGCGTDDGDSLPQPGDQETTLVAGNVEQINSPTGNSRPVLEDLTFDSVYATCG
FT                   PNRESLGQGRNEVESITSYECVIDWEGWTGETWSSDMILTLGPNTKLCDVGTAELGGGT
FT                   VTKSGDNVLIFDRISQTEALQFDFAVAHEDADCP"
FT   gene            complement(225423..226625)
FT                   /locus_tag="TK90_0217"
FT   CDS_pept        complement(225423..226625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0217"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA5109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70732"
FT                   /db_xref="GOA:D3SCY7"
FT                   /db_xref="InterPro:IPR025746"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70732.1"
FT                   /translation="MNHVPFTTPPAKQRGLATLVVALIIMVAVTLTVLFTAQTSILEER
FT                   MAANETRMKQTTNAAQAGLELAVAFAQDGEDNVSEIFEHDRTLERPVFYRSAFISPDAV
FT                   DEIPGCPDSPDDFPGVATALGQPDSLRNAGIWSCGWSDDQSARRGVTTTIRGAPSLADP
FT                   PTNPLTTRGGVNTNGRARVFNAYNNLTIWSGQDLDVTGNPGNTFIRNQDHPPLRESDPL
FT                   PDEPAQCGVGTVYVCTTDANMRGPDVITGDLQLSSLSDDDFFRNFMGQEPNSYRDNVVT
FT                   QLDPDNIDGMTNEVIWMTGDADLNETVGDRDNPVVLVVEGDAQLRGNFELHGVLYVRGN
FT                   LRASGTPTIYGASVIQGDTTDAGGTPYFVFDPVAASGAAELGARGAISGAWRDWTHWVN
FT                   E"
FT   gene            complement(226625..227497)
FT                   /locus_tag="TK90_0218"
FT   CDS_pept        complement(226625..227497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0218"
FT                   /product="Tfp pilus assembly protein PilW-like protein"
FT                   /note="KEGG: aha:AHA_0694 putative type IV pilin"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70733"
FT                   /db_xref="GOA:D3SCY8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY8"
FT                   /inference="protein motif:COG:COG4966"
FT                   /protein_id="ADC70733.1"
FT                   /translation="MLTTRLRPECCLPRIRPSRGFTLVELMIGILVGTIVVAGVIALYI
FT                   TVIRGSAFVVTEARVTQDTRISMDLMASDIRRAGYSHPSRIEVSEETGMPENPFMDETR
FT                   NITIHDHDGGTANCILVSYDPTFQYAPEDASLEFDLSDLIGSRQFVFGYRLNSAGVIQI
FT                   LASSDVTTTESCADGSWEALTDPRTIRVNSLVFSTEGSTCLNTSLDLSSDSGNTEDDAF
FT                   WEAEEESRSFCEQAYNGALEPDRDNVLIESRQIRVTLEAADRSSGNTQVTFDESVRVRN
FT                   NRIFAVEAN"
FT   gene            complement(227491..228039)
FT                   /locus_tag="TK90_0219"
FT   CDS_pept        complement(227491..228039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0219"
FT                   /product="putative type IV pilin"
FT                   /note="KEGG: tau:Tola_2517 putative type IV pilin"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70734"
FT                   /db_xref="GOA:D3SCY9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCY9"
FT                   /inference="similar to AA sequence:KEGG:Tola_2517"
FT                   /protein_id="ADC70734.1"
FT                   /translation="MSQLSRQFGITLIELMITISVLVILITLAVPAFNLAEQRRLVGAA
FT                   ESALDQIQTARSEAIKQGRDIWFVSQTDGDDWCHGISQTAGCDCFEPAGAGDACEITIA
FT                   GEEDPILRTTVSSDYRNINMTGDQELRFDHVRSMVSGSRETIAFTSSPNSFQMEVQINP
FT                   IGRPSACGTNRTMGAYPAC"
FT   gene            228243..228665
FT                   /locus_tag="TK90_0220"
FT   CDS_pept        228243..228665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0220"
FT                   /product="pilus assembly protein"
FT                   /note="KEGG: eba:ebD88 pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70735"
FT                   /db_xref="GOA:D3SCZ0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ0"
FT                   /inference="similar to AA sequence:KEGG:ebD88"
FT                   /protein_id="ADC70735.1"
FT                   /translation="MRRQQNRPKGFTLIELMIVVAVIAIIAVIAYPAYQNHILKAQRAD
FT                   AHDSLLRIQLEQERFRANNPEYAGNSELTESRPVGLGLNDVTDDGHYNLAISSSSGSGF
FT                   TATATATGRQANDSSCGTITLEVSGGQAARTPEACW"
FT   gene            228850..229731
FT                   /locus_tag="TK90_0221"
FT   CDS_pept        228850..229731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0221"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   tbd:Tbd_1278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70736"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ1"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ADC70736.1"
FT                   /translation="MTAEAATRNVQAMEQADLLDLQQRAARKVRLDVTFRDEARSGAVT
FT                   PELQVIPAGEGEIGSDASEYGHQEHESPRRYVVLERPFALGRFAVTREEWDAFAEATGW
FT                   EPWDWLVWPRTPRTPIFNIKPASIQQYLEWLSEETGKRYRLPTEAEWEYACRAGTRTPF
FT                   AFGEVVGCRDVHFNSLFPYEERRQRRKWYLPACFPLSRPLDVGSFQPNLWGLYDMHGNV
FT                   QEFTSTPWHDDHASLPRDGVYRRDPDNEWVVVKGGSWFDPAVATRSAARRRRNIDEMDT
FT                   NLGFRVLRELDD"
FT   gene            229968..230960
FT                   /locus_tag="TK90_0222"
FT   CDS_pept        229968..230960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0222"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: bgl:bglu_2g16070
FT                   transposase for IS1663"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70737"
FT                   /db_xref="GOA:D3SCZ2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ2"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADC70737.1"
FT                   /translation="MAHIGIDVSKNKLDCMWVRDLEAGKVKPKVFPNRPDQYPELLRWL
FT                   QRNTGEAPETLQVYLEATGIYHEPLAYWLHEQGVRVHVLNPAQVRFHAQGMGVRNKTDR
FT                   KDSMMLARYGIERAPRRWQPEPPEVRELKRLLSRLEALEEDIRREENRLEKAQFSEDTL
FT                   AQASIDNVLQALREEHRRLQQQIDDHFDAHDHLKRDRALLESIPGIGRVLSASMAATLR
FT                   SRAFTSARQAAAFHGLVPVLQESGTSVQRPPRLAKAGSGRLRKTLYMAAVVATRYNPDV
FT                   RRQYHRLLRRGKAKMAAIGAAMRKLLHIAFGVLKSQTPYQPRNDTPCTS"
FT   gene            231066..231344
FT                   /locus_tag="TK90_0223"
FT   CDS_pept        231066..231344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0223"
FT                   /product="plasmid maintenance system killer"
FT                   /note="PFAM: plasmid maintenance system killer; KEGG:
FT                   noc:Noc_2762 plasmid maintenance system killer"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70738"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ3"
FT                   /inference="protein motif:PFAM:PF05015"
FT                   /protein_id="ADC70738.1"
FT                   /translation="MIRSFRCRETRALFETGRSRRWSSVRTIVERKLIQLQAAETLQDL
FT                   RSPPGNRLEALSGDREGQHSIRINAQWRICFRWTDEGPEDVEIVDYH"
FT   gene            231369..231668
FT                   /locus_tag="TK90_0224"
FT   CDS_pept        231369..231668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0224"
FT                   /product="plasmid maintenance system antidote protein, XRE
FT                   family"
FT                   /note="KEGG: maq:Maqu_3198 XRE family plasmid maintenance
FT                   system antidote protein; TIGRFAM: addiction module antidote
FT                   protein, HigA family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70739"
FT                   /db_xref="GOA:D3SCZ4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ4"
FT                   /inference="protein motif:TFAM:TIGR02607"
FT                   /protein_id="ADC70739.1"
FT                   /translation="MSTSGMRPIHPGEVLREEFLAPLGLSVNALAGALHVPTTRMNDIV
FT                   RERRGISADTAMRLARYFGTSERFWLNLQLEYELRQAQLELSERVRREIEPRAA"
FT   gene            complement(231766..232305)
FT                   /locus_tag="TK90_0225"
FT   CDS_pept        complement(231766..232305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0225"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: mca:MCA0403 suppressor for
FT                   copper-sensitivity D, putative"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70740"
FT                   /db_xref="GOA:D3SCZ5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ5"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADC70740.1"
FT                   /translation="MTETRPEKPQRPKPSRRRRALSWGVQIGIALLIFLAVRAWMARDM
FT                   VEGPAPEFEAQLLDGTPVTLADYADEPMLLHFWATWCPICRLEEGEIVRLSQSHPVLTV
FT                   SMQSGTPEEVLEHLNERERELAVINDPQGELASQYNVRGVPATFIINPDGEIVFRKQGY
FT                   APPLELRLRLWLARWL"
FT   gene            complement(232302..232775)
FT                   /locus_tag="TK90_0226"
FT   CDS_pept        complement(232302..232775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0226"
FT                   /product="leucine-rich repeat-containing protein"
FT                   /note="KEGG: dge:Dgeo_0869 leucine-rich repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70741"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ6"
FT                   /inference="similar to AA sequence:KEGG:Dgeo_0869"
FT                   /protein_id="ADC70741.1"
FT                   /translation="MPAHPNPGAYNAPAMTDLKQQYKAMTFEERMDLALSVDLEVHWRP
FT                   LLVRDQHAQVKAYFSRRMDLTPEEVALLLADPNQTVRLNCAKRPDLTPEQVEACVNDRD
FT                   PNLRYFVARNPLLTEAQREQLMDDEDELVRIAVRKGPKKRGTRARPGQAEMIR"
FT   gene            232869..233951
FT                   /locus_tag="TK90_0227"
FT   CDS_pept        232869..233951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0227"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: sfr:Sfri_1938
FT                   quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70742"
FT                   /db_xref="GOA:D3SCZ7"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ7"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ADC70742.1"
FT                   /translation="MTAPVAEIPIFQVPRTDHVTASLHALTDAQRDELVRRIKRLLIER
FT                   NAVLVAHYYVDESLQRLADETGGCVADSLEMARFGKEHPAETLVVAGVRFMGETAKILS
FT                   PEKRVLMPTLEAECSLDLGCPADEFAKFRAQYPDHTVVVYSNTSVDVKAQADYVVTSSI
FT                   AVPLVEHLRDQGKKVLWAPDKHLGDYIRRTTGADMVLWDGSCVVHDEFRAWALEDLRGR
FT                   HPGAAVLVHPESPREVIHQADVVGSTSQLIAAVKDRPEQEFIVATDKGIFYKMQQAAPD
FT                   KTLIEAPTGGHSATCTSCAHCPWMAMNDLVSLAETLEDTAEPAKNEIFVDETARQKALV
FT                   ATQRMLDFAAEHRKATAGDA"
FT   gene            complement(233982..234974)
FT                   /locus_tag="TK90_0228"
FT   CDS_pept        complement(233982..234974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0228"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: bgl:bglu_2g16070
FT                   transposase for IS1663"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70743"
FT                   /db_xref="GOA:D3SAX7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3SAX7"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADC70743.1"
FT                   /translation="MAHIGVDVSKNKLDCMWVRDLEAGKVKPKVFPNRQDQYRELLHWL
FT                   ERNTGETPEGLHVYLEATGIYHEPLAYWLHDQGVQVHVLNPAQVRSHAKGMGVRNKTDR
FT                   KDSMMLARYGIERAPRRWQPEPPEVRELKRLLSRLEALEQDMRREENRLEKARFSEDTL
FT                   AQASIDNVLQALREEHRRLQQQIDDHFDAHHHLKRDRTLLESIPGIGRVLSASMTAALR
FT                   SRAFTSARQAAAFHGLAPVLEESGTTVRRPSRLAKIGSSRLRKALYMAAVVATRYNPDV
FT                   RHQHQRLLTRGKAKMSAIGAAMRKLLHIAFGVLKSQTPYQARHETPCTP"
FT   gene            complement(235255..235461)
FT                   /locus_tag="TK90_0229"
FT   CDS_pept        complement(235255..235461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70744"
FT                   /db_xref="UniProtKB/TrEMBL:D3SCZ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70744.1"
FT                   /translation="MAHLDWSHYPTNELKLVYSTLHAQLTLEPELMDSELMADLQTHLQ
FT                   KAAKADGVDVSTHSQWAAWLNDR"
FT   gene            235755..236108
FT                   /locus_tag="TK90_0230"
FT   CDS_pept        235755..236108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0230"
FT                   /product="precorrin-3B synthase"
FT                   /note="KEGG: bac:BamMC406_1592 precorrin-3B synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70745"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD00"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_1592"
FT                   /protein_id="ADC70745.1"
FT                   /translation="MFKRRARLLVAAERPDGRASRVAELAAAAEFEDWIEVHPARAMAE
FT                   VRPEELAWADLLVAVDEPAARAMPAERPATCRPKYWRLPSETGADFDLQTLEALRCMVG
FT                   GMRMLARVDADEA"
FT   gene            complement(236400..236930)
FT                   /locus_tag="TK90_0231"
FT   CDS_pept        complement(236400..236930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70746"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70746.1"
FT                   /translation="MPPSNVIDGPRVATWRCPSCQEAVPRLLPNGDSNRIPVPPARMAL
FT                   PDNTVRQACERVQGLRAPEICFACGQAYQELLGTLVRPPAELGDARGEPGLNDSGIIGA
FT                   LLPIADQGTQILIFNVINEELRCTEIERLASFNPDRLTYPGSRGAIAPRIWALYEDHLA
FT                   QLHARAPTPYTPD"
FT   gene            complement(237040..237621)
FT                   /locus_tag="TK90_0232"
FT   CDS_pept        complement(237040..237621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0232"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: cyb:CYB_2461 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70747"
FT                   /db_xref="GOA:D3SD02"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD02"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADC70747.1"
FT                   /translation="MARTPSQMIELGTEAPNFSLPDVVSGDTISLDSFPDAKGYMIAFI
FT                   CNHCPFVQLIRHEFARYGREYSNKGIAVIAINSNDIQAVPDDAPDKMKDDARRFGYNFP
FT                   YCLDEDQSVAKAYHAACTPDLYLFDANRKLFYRGQFDETRPGSDNPVTGRDLRAASDAL
FT                   LAGQPAPEPQHPSLGCNIKWRPGNEPGYYG"
FT   gene            237771..238511
FT                   /locus_tag="TK90_0233"
FT   CDS_pept        237771..238511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0233"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   noc:Noc_0836 oxidoreductase FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70748"
FT                   /db_xref="GOA:D3SD03"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD03"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADC70748.1"
FT                   /translation="MGWVTGTVQERKQWTDRLFSLRVEADVEPFKAGQFNRLRLEIDGE
FT                   PVARPYSYVNAPDETPLDFYLITVPEGPLSNRLVQLEPGDTVELMPRATGFFTLDELPD
FT                   SRDLWLLSTGTALGPFLSMLKTDTPWQRFENIRLIHAVRKADELTYQDTIRQFQERDPK
FT                   QFQYIPFVSREPCPGGLEGRVPAAIAEGRLEHHAGLKIAPEHSQVMLCGNPAMVKDTSA
FT                   ILRERGLEKNRRRTPGHITTENYW"
FT   gene            complement(238617..239387)
FT                   /locus_tag="TK90_0234"
FT   CDS_pept        complement(238617..239387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0234"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sil:SPO2301
FT                   OsmC-like family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70749"
FT                   /db_xref="GOA:D3SD04"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD04"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADC70749.1"
FT                   /translation="MAIRNTSLPIDTPRGIRLNGVLVEPHDGPLLGQACIAHCFACSKD
FT                   FPATVRLARALGEEGIATLRFDFAGLGDSEGRFRDSTLDTYCEDLNAALDALKQATGEP
FT                   TDLLIGHSFGGAMAIHVGSQREELAGIVTIAAPSRPGHVAHLFGDIADTIQHEGFARVN
FT                   IGGRPVEIGRAFLDSIEAPTLDSALERMSQPLLLLHAPGDTVVSVDHARKIFQQAHHPK
FT                   SFIALHQTDHLLSRPEHTRYVAGLIHAWAANLLD"
FT   gene            239447..239677
FT                   /locus_tag="TK90_0235"
FT   CDS_pept        239447..239677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0235"
FT                   /product="protein of unknown function DUF465"
FT                   /note="PFAM: protein of unknown function DUF465; KEGG:
FT                   bja:bsr7110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70750"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD05"
FT                   /inference="protein motif:PFAM:PF04325"
FT                   /protein_id="ADC70750.1"
FT                   /translation="MTAQTSEEGLLETESQIRARLAELESEHRALDSAIAVMHEQPAPD
FT                   AFAIQRLKKRKLQLKDAIQRLRSRLIPDLNA"
FT   gene            complement(239763..241058)
FT                   /locus_tag="TK90_0236"
FT   CDS_pept        complement(239763..241058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0236"
FT                   /product="Flavocytochrome c sulphide dehydrogenase
FT                   flavin-binding protein"
FT                   /note="PFAM: Flavocytochrome c sulphide dehydrogenase
FT                   flavin-binding; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; KEGG: hha:Hhal_1945
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70751"
FT                   /db_xref="GOA:D3SD06"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015323"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037092"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD06"
FT                   /inference="protein motif:PFAM:PF09242"
FT                   /protein_id="ADC70751.1"
FT                   /translation="MHNFTRRHFLKAFGITSAAALTGIGCAPRAARNGAKAHVVVVGGG
FT                   SGGATAARYLKQFSPDMMVTLIEPNATYVTCYGSNWVIGGFESMDAITHGYQNLRDRDG
FT                   IDVIEDKVVGVDADSRTVRLESGGSLQYDKLVMSPGIDFRYDDMPGIEEADAETIPHAW
FT                   KAGSQTELLRSQLLEMPNGGVFVMVAPPNPFRCPPGPYERVSLIAHYLKEHKPRSKIIV
FT                   LDSKDNFSKQGLFEEGWAMHYGDMIEWRGASDGGLVEEIDVGGMTARSDSGFERVRADV
FT                   MNFIPAQRAGQIAHDVGLTNDEGWVPVDQRTFKSEMDDNIYVLGDASVAGAMPKSGHSA
FT                   NNQGKIVAAAIVRELMDQEPLDPSSANTCYSLITPEHGISVAAVYKYQDGAQAGVEGSG
FT                   GVSPSGETSSFRRREAEYTRAWYAGITHDIWG"
FT   sig_peptide     complement(240963..241058)
FT                   /locus_tag="TK90_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.504 at
FT                   residue 32"
FT   gene            complement(241077..241391)
FT                   /locus_tag="TK90_0237"
FT   CDS_pept        complement(241077..241391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0237"
FT                   /product="cytochrome c, class I"
FT                   /note="KEGG: hha:Hhal_1162 cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70752"
FT                   /db_xref="GOA:D3SD07"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD07"
FT                   /inference="similar to AA sequence:KEGG:Hhal_1162"
FT                   /protein_id="ADC70752.1"
FT                   /translation="MKQSRLFVAGLVASLAMAGTASQAIADNDEITRGQLMAASCKACH
FT                   NAAGAEKGVPDLGRISADVIRSQMRAFRDGDRDATIMDRHAKGYTDEEIEAMSVYFSRF
FT                   "
FT   sig_peptide     complement(241311..241391)
FT                   /locus_tag="TK90_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.812 at
FT                   residue 27"
FT   gene            241620..241931
FT                   /locus_tag="TK90_0238"
FT   CDS_pept        241620..241931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0238"
FT                   /product="type IV pilus assembly PilZ"
FT                   /note="PFAM: type IV pilus assembly PilZ; KEGG:
FT                   noc:Noc_2668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70753"
FT                   /db_xref="GOA:D3SD08"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD08"
FT                   /inference="protein motif:PFAM:PF07238"
FT                   /protein_id="ADC70753.1"
FT                   /translation="MTGERRRHPRIPMTVEVVAECSDGSQVRLTTNDISGGGAFLAWED
FT                   RDQSGIDVLKGLGPGDQFMLQVFGLLGDGGEPPRVQAQVVRVMEDGVAVQFDSAALGA"
FT   gene            complement(241965..242360)
FT                   /locus_tag="TK90_0239"
FT   CDS_pept        complement(241965..242360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70754"
FT                   /db_xref="InterPro:IPR022254"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD09"
FT                   /inference="similar to AA sequence:KEGG:Hhal_1114"
FT                   /protein_id="ADC70754.1"
FT                   /translation="MTLPLGIEDDTLARLIQAAREFHAKEEVVFPDSSPDTSDDDWAMQ
FT                   VLADHAGDLTLRELEDTLSGLGPEYQAELQALSAVGRGDYAVEEWEGALEDARDDWSPD
FT                   TAHRLIANPMIADEWEAGLEQMQAADR"
FT   gene            complement(242368..242682)
FT                   /locus_tag="TK90_0240"
FT   CDS_pept        complement(242368..242682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0240"
FT                   /product="Protein of unknown function DUF2288"
FT                   /note="PFAM: Protein of unknown function DUF2288; KEGG:
FT                   mca:MCA3056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70755"
FT                   /db_xref="InterPro:IPR018741"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD10"
FT                   /inference="protein motif:PFAM:PF10052"
FT                   /protein_id="ADC70755.1"
FT                   /translation="MTQAPAPSEPEVPLEEEAGPLRWDELMPHFARGVVIRVAPELDLI
FT                   EVARAFRDDATHQVSEWLANNQVARASDDDARRWAANDPVFTAIVAAPWVLAQERSTAH
FT                   "
FT   gene            242779..243105
FT                   /locus_tag="TK90_0241"
FT   CDS_pept        242779..243105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rmr:Rmar_1895 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70756"
FT                   /db_xref="GOA:D3SD11"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD11"
FT                   /inference="similar to AA sequence:KEGG:Rmar_1895"
FT                   /protein_id="ADC70756.1"
FT                   /translation="MRPGPETVAKGDGRRRRVIGGAGMLGLLLAVLVAPFAAQAQFITE
FT                   DPRAAVWTLDEAVSRVEANYPGRVLSAREDLTEYGNRVFIVRILTDNQQVRTIKIEEGT
FT                   ELDP"
FT   sig_peptide     242779..242901
FT                   /locus_tag="TK90_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.885 at
FT                   residue 41"
FT   gene            243102..243818
FT                   /locus_tag="TK90_0242"
FT   CDS_pept        243102..243818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0242"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; transcriptional regulator domain protein; KEGG:
FT                   pol:Bpro_1956 two component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70757"
FT                   /db_xref="GOA:D3SD12"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD12"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADC70757.1"
FT                   /translation="MNLRVVVIEDDLALRSQIAEEMENNGCRVDTASDGDTGLYLLTEY
FT                   HCDIAVVDLGLPGMDGLDVIRKAREVKPQLPILILTARDRWQDKVEGLEAGADDYLTKP
FT                   FHIQELVARLRALARRSLQAGREQLQFGPLVIDTATDDVRLNDEPVSLTTFEYRLLLTL
FT                   VRQPGRVLSKEVLADYLYEHDEDRESNVIEVLIGRLRRKLDPGGSLGLIETLRGRGYRF
FT                   VREADTATPSDSTSGS"
FT   gene            243859..245181
FT                   /locus_tag="TK90_0243"
FT   CDS_pept        243859..245181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0243"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; KEGG: neu:NE1408 sensory
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70758"
FT                   /db_xref="GOA:D3SD13"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD13"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC70758.1"
FT                   /translation="MRHPLRQIRSSLTLRLALVAGATVLVFSLLTAWVLEAAFRDNAAD
FT                   AVETRLEAQVLLLMGLVEVVGRNEVRVPEMLPESRLQLPASGLYARILGPDGRTLWRSP
FT                   SAVGVSLRGWSEDDFFAFSLPVQWELDGGQVGLTFQMLEDREAFEEQVEQYRASLWQGL
FT                   MTMTFSLIVALGLALWFWGLWPLRRVQGDLEALRHGDHGRLEGPYPTEVQALTGSINDL
FT                   IEFERARLKRQQNALADLAHSLKTPISALRLNLESQNPDPEDMRRQVDRLQAMVQHQLS
FT                   QAQRLGPAPFQAPEPLAPIIERTCQALGRLASQQGVDLGSELDPGCALRMEPGAIFELL
FT                   GNTLDNAIRHATSRVRISTQCTPQAVTLTIDDDGPGIAPADRARVLERGERADVRGAAE
FT                   AGQGLGLSIIQALVQDHGGELHIEQAPELHGARIRMVFPTS"
FT   sig_peptide     243859..243954
FT                   /locus_tag="TK90_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.341 at
FT                   residue 32"
FT   gene            complement(245299..246555)
FT                   /locus_tag="TK90_0244"
FT   CDS_pept        complement(245299..246555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0244"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   aeh:Mlg_0415 D-amino acid dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70759"
FT                   /db_xref="GOA:D3SD14"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD14"
FT                   /inference="protein motif:PRIAM:1.4.99.1"
FT                   /protein_id="ADC70759.1"
FT                   /translation="MRVVVIGAGVIGVTTAWYLQEAGAEVVLVDAAPAPATGSSQANGG
FT                   MLHASHAEPWNTPGVGLDLLRFLGRTESPLLLRPRALPGLTGWGLRFLWNSRRSLFEQH
FT                   TRLNAQLAAFSLREIDRLQRELASEGLDFDFRRCGILKLFQDPASQAHNRSASEAMRDE
FT                   DVRFEDWDVERIIAEEPALAPVRDRLCGGLFFPGDAIGDAARFTEQLLAIGQRRGIRYY
FT                   PNVTVRRLRTHRGRIDAVETSEGPIAADACVVANGYHAPDLLRPLGLHLPVAPVKGYSL
FT                   TLPMNADCRLNLPLIDDANKVVMTPLGNRLRLAGTAEFAGRDRHLNIERAANVLDQCRR
FT                   TLTGLPATFDPQTMAPWTGLRPMSARGTPILGPTTIEGLHLNTGSGHLGWTFACGAAAL
FT                   VRAGVLGESPSFPMDDLRL"
FT   gene            complement(246581..250504)
FT                   /locus_tag="TK90_0245"
FT   CDS_pept        complement(246581..250504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0245"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /note="KEGG: noc:Noc_1301 ATP-dependent helicase HrpA;
FT                   TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   helicase-associated domain protein; helicase domain
FT                   protein; protein of unknown function DUF1605; SMART:
FT                   helicase-associated domain protein; DEAD-like helicase ;
FT                   helicase domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70760"
FT                   /db_xref="GOA:D3SD15"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD15"
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /protein_id="ADC70760.1"
FT                   /translation="MAAAGPDLDALARTVEALPQGRERRELGELLRRARQRHKRGQPCD
FT                   RLVSTLTERLARAEQGGAERQHLRPQPTYAGDLPIHAERERIVAAIREHPVLVLCGETG
FT                   SGKTTQLPKLCLEAGRGETGLIGHTQPRRIAARSVASRIAEELGTTLGGDRNSTVGFKV
FT                   RFSDQTGPNNWVKLMTDGMLLAELAHDPELRAYDTLIVDEAHERSLNIDFLMGVLKRLS
FT                   KKRPELRIIITSATLDPERLSAFFDDAPILTVAGRTYPVELRYRPIEPEDADEDNSTER
FT                   GERDLFDGIRDAVAECERAGPGDILVFLPGEREIRDAHKALRGQVRADTEVLALYARLS
FT                   AREQARVFQSHSGRRIVLATNVAETALTVPGIRFVIDSGLARISRYSWRSRVQRLSLEP
FT                   ISQAACDQRAGRCGRLGPGICIRLFSEDDYNLRPPFTDPEIQRSNLASVILQMAALKLG
FT                   QPRQFPFVDPPDPRLVKDGYRLLEELGAVDTRGRTTPRGRQLARMPIDPRHGAMLLAGA
FT                   DHGCVTETATIAAFLSLQDPRERPAEATQAADQAHREFQVEGSDFMGMLRLWEAWHTAR
FT                   EDLGSNALKRWCREHFLNFLRMREWQELRVQLLRLAREMDLKPNHQPADAEPVHRALLT
FT                   GLVSQIGQKTERGDYLGARNRRFQIHPGSVLAKKKPAWVMSAEIAETTRVYARDNARIE
FT                   PDWILAAAPHLLKHHIFEPHFQRRSGRVGAFDRITLYGLVVAPKKPVDFAKHDPSEARR
FT                   ILIREGLVGGELRTRSKGVQANREAVAEIAEQEARGRRRDLLVEEDRLFDFYDARLPAD
FT                   ITDGTSFETWARKAEKQDPDALRIDRAELLNEPDATLPQGAYPDHLELEGLRLPLAYRF
FT                   EPGQPDDGVTVTIPIAALNAVPDWLGDWLVPGLLEERVTGLLKSLPKGLRRQFVPAPDF
FT                   AAAALARIEHRQGPLIPALAEALRAMTGTEIPLDAWRPETLEPHLVMRFRILDPEGQEQ
FT                   ASGRNLAALKRRLGGSAEAHFDASRPDEITREGITEWDFGALPESVEFDHQGAQLRAFP
FT                   ILVDRGDAVSLELEPDPAKAERAHRAGLRRLFLLSARKTARDLRRQLPEIERACLNYST
FT                   LGSCEALRDQILEAAADRVFLAEPWPRDAEAFRERLEARLPEFSPTVMELSRLAAEILR
FT                   HWHDLRTRLQGDLPLSWIEAARDIRGQLEALVPADFLLRTPHDVLPELPRYLQAIDKRL
FT                   ERLTQAPDKDRARRVAVEPLWQQAQELIARAPDHPDVLAFRYRIEEFRVSQFAQELGTR
FT                   EKVSPKRLEREYADVIQRLASGT"
FT   gene            complement(250504..251088)
FT                   /locus_tag="TK90_0246"
FT   CDS_pept        complement(250504..251088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0246"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: aeh:Mlg_2773
FT                   sporulation domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70761"
FT                   /db_xref="GOA:D3SD16"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD16"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADC70761.1"
FT                   /translation="MAQARRKRRKTTPARSSRPIPGWVWMFAGLLIGLGIAAVLYLQGA
FT                   DRSPDIGALFGEPETPAERAPAAEPERLPTDDEPRFRYYELLPEDEVRVPRGEREVPQD
FT                   QVIPPPASPAEGDPVILQIGSFRRFEQADEMKARISLLGLSPQVHEVQVEGETWHRVFV
FT                   GPFTQEDDVNRALDRLRSENIEALRLRHRDG"
FT   sig_peptide     complement(250954..251088)
FT                   /locus_tag="TK90_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.779 at
FT                   residue 45"
FT   gene            complement(251092..252855)
FT                   /locus_tag="TK90_0247"
FT   CDS_pept        complement(251092..252855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0247"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: aeh:Mlg_2774 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70762"
FT                   /db_xref="GOA:D3SD17"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD17"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ADC70762.1"
FT                   /translation="MKDALTQALAAALETLVADGRIPPDHGVEVQVTRARDREHGDFAS
FT                   NLAMQLARPAKAKPRDLAEALCAAMPAVPGLAGTEIAGPGFINFRLAADARTQVLGRIA
FT                   AQGADFGRSSVGNGRPVQVEFVSANPTGPLHVGHGRGAAFGATVADLLDFCGFDVTREY
FT                   YVNDAGRQMNILAASVWLRYLEQHGVQVPFPTNGYQGDYIYPVAESLTAQIGEQAVHPA
FT                   TAVTRDLPPDEPAGGDKEVYIDAVIARARELLGPELYRTVFDCGLNAILEDIRDDLREF
FT                   GVEYQCWFSERSLADSGAIDAAVQDLQAHGALYEQDGALWFRSTDYGDDKDRVVRRENG
FT                   DYTYFASDIAYHREKFQRGFERVINIWGADHHGYVPRVRAALQALGLEADRLDVLLVQF
FT                   AILYRGGERLPMSTRAGQFVTLRELRDEVGSDAARFFYVQRRCDQHLDFDLDLAKSQSN
FT                   DNPMYYIQYAHARIASVLRTAAERGHTASALDDTGLSACLTEPQEDDLLDRLDRFPEVI
FT                   AAAAEACEPHQIAQYLRELAAGFHTYYNAVPFLNAEDATVIGARLALLTGIKQVLHNGL
FT                   RLLGVTAPERM"
FT   gene            complement(252931..255126)
FT                   /locus_tag="TK90_0248"
FT   CDS_pept        complement(252931..255126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0248"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: hha:Hhal_2267 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70763"
FT                   /db_xref="GOA:D3SD18"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD18"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ADC70763.1"
FT                   /translation="MPETGIAQVALDRPLDRLFDYRIPEDTDLRPGQRVRVPFGRGEAI
FT                   GIVVALANQSDVPENKLREALGSPDAQPILTPMVLELLRFGARYYHHPLGEALLSALPP
FT                   ALRRGHPLPILAPEPLWRLTAAGHRALAEGQVRGRRQLAILRALPALGAALDRTTLSTA
FT                   AALQITAKDLRQLEARGWLEQTRADPLAPAPPTGTGYTLTPEQEAAIAAVSPDDPRPML
FT                   LEGVTGSGKTEVYLRMAADAVARGRQVLFLIPEIALTPQLAGRIQQRFPGQVALLHSGL
FT                   AEGERLRAWEAARQGERRIVVGTRSALFVPLPEPGLIIVDEEHDSAFKQQDGFRYSARD
FT                   LAIKRGQLEHTPVVLGSATPTLETLHAARQGRYTHVHLRSRPDGTQPPSVETIDTRVHS
FT                   PDEGLTAPLLDAMQQTLAAGAQCFVLLNRRGFARVLACESCGWVADCPDCDAHLTVHTQ
FT                   DRRAICHLCGHQERRAERCPECGEALINRGLGTQRLEQALARHFPQTPIIRLDRDSVRH
FT                   KGALETALDRIRQLDAAIVVGTQMLAKGHDFPRVGLVGVIDVDQGLFSVDLRATEHTLQ
FT                   LIVQAAGRAGRGDGGGRVLLQTGHPDHPLMRGLDAGNYPAMLEPLLAEREAAGLPPYGH
FT                   LALVRVEAAEAAAAHRHAETIAGHLLAARHGDLRVLGPAPAPRHRVNRRFREQILLRAA
FT                   ERQALHRTLTQARHAWQTEDLPRGVRIAIDVDPVSLA"
FT   gene            complement(255503..256891)
FT                   /locus_tag="TK90_0249"
FT   CDS_pept        complement(255503..256891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0249"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   sde:Sde_1276 response regulator receiver domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70764"
FT                   /db_xref="GOA:D3SD19"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD19"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADC70764.1"
FT                   /translation="MSLIINLAYFAAAVLFIVGLKQMSSPTTARPGIIWAGVGMVIATL
FT                   VTFVHPEISGGVNYTLIILGIAIGGALAWWSGKKVAMTDMPQMIALYNGMGGGAAAGIG
FT                   AIYLLQATPETVTNTGLAIAVTGSLIGSVAFSGSLVAYAKLEGLMKKTFTFGGQQIVNI
FT                   AIFAITVLLGFMMATSGGEIGSFSLLLFFVLALAFGILMTLPIGGADMPVVISLYNALT
FT                   GLAVGLKGIVLDNPALMIAGIVVGAAGTLLTQLMAKAMNRPIKNILFSQFGGSSGGAEE
FT                   AIEGTMKEIQANDAGIMMAYAEKVIIVPGYGMAVAQAQHKIWEFTQLLQKRGVDVKFAI
FT                   HPVAGRMPGHMNVLLAEAGVPYDIIFDLDEINEEFKTADVAMVIGANDVVNPVARTNPE
FT                   SPIYGMPILNADQAKNVICVKRGKGAGFSGIENHLFYADNNQMLYGDGQKVAAELVASV
FT                   KALG"
FT   gene            complement(256888..257199)
FT                   /locus_tag="TK90_0250"
FT   CDS_pept        complement(256888..257199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0250"
FT                   /product="pyridine nucleotide transhydrogenase subunit
FT                   alpha"
FT                   /note="KEGG: aeh:Mlg_2770 pyridine nucleotide
FT                   transhydrogenase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70765"
FT                   /db_xref="GOA:D3SD20"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD20"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2770"
FT                   /protein_id="ADC70765.1"
FT                   /translation="MIIEGFIALYIFMLAAFTGYEIISKVPVILHTPLMSGSNFVHGIV
FT                   LVGTMVALGHAQTPLEQAIGFVAVILAAGNAVGGYVVTERMLEMFTTSKKDDKKGDKA"
FT   gene            complement(257196..258329)
FT                   /locus_tag="TK90_0251"
FT   CDS_pept        complement(257196..258329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0251"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: aeh:Mlg_2771 NAD(P)(+) transhydrogenase
FT                   (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70766"
FT                   /db_xref="GOA:D3SD21"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD21"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ADC70766.1"
FT                   /translation="MAIKLSVPKESASGERRVALDPTVAAKFSDLGVTVQLEKGAGSNA
FT                   HFPDTAYEKATVVDTETAYGQSDLMVRVAPPTVEEVNQLPEGSTVVSLFHAHRNPDVVK
FT                   AMQERKILSFAMELIPRISRAQSMDVLSSQAAVVGYKGAIMGSDLSCRFFPMLTTAAGT
FT                   IRPAKVIVIGAGVAGLQAIATAKRLGAMVEAYDVRSATKEQVESLGAKFLDLGVSAEGE
FT                   GGYARELTAEEKQQQQDALSEFIAKADVLITTAAIPGRESPKLIPKDMVEGMKPGAVIV
FT                   DLAAEGGGNCELSKPGKTSRHKGVIIHAPLNVPSQVPLHASEMYAKNLLNFLTPMIAEG
FT                   GEFKPDWDDEVIAKSVLTRDGEIVHEATREALKGAQS"
FT   gene            258721..259302
FT                   /locus_tag="TK90_0252"
FT   CDS_pept        258721..259302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0252"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   mca:MCA2596 HNH endonuclease domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70767"
FT                   /db_xref="GOA:D3SD22"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD22"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ADC70767.1"
FT                   /translation="MLPTEHQVLRTDAAGMPLEWIGLEQAVRLYYTEQVAYACGSLLYR
FT                   VRGGINARTGLQSRVEVNSIIATFGTRQSRFNHYIPPLNNTTLFRRDAHLCLYCGQHFY
FT                   ERDLSRDHVTPISQNGADTWNNVVTACKRCNNHKAGRTPEQAGMQLLAIPFTPTHAEYI
FT                   YLKGKRVLADQMEFLLAHFPRTSPLRGRLG"
FT   gene            259412..260506
FT                   /locus_tag="TK90_0253"
FT   CDS_pept        259412..260506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0253"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="KEGG: hna:Hneap_0045 ferrochelatase; TIGRFAM:
FT                   ferrochelatase; PFAM: ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70768"
FT                   /db_xref="GOA:D3SD23"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD23"
FT                   /inference="protein motif:TFAM:TIGR00109"
FT                   /protein_id="ADC70768.1"
FT                   /translation="MKYFGEADYRHGQPRKAGVLLTNLGTPDEPTAPALKRYLKEFLWD
FT                   PRVVEFPRPLWWLILNGIILNIRPRRSAAKYATVWTDDGSPLLAISRRQVEGVRNRLAE
FT                   QVGDEVPVALGMRYGNPSIEAGLDELRRQGVRRVIVLPLYPQYSGSTSGSTFDAVADVL
FT                   KGWRWVPDLQFVASYDAEPGYIEALASSVREHWNAHGRADRLVMSFHGIPKRYLLKGDP
FT                   YHCLCHATGQKLAARLGLNDDQWQVTFQSRFGREEWLKPYTDKTMKALPKEGVRSVDVI
FT                   CPGFSADCLETIEEIGDENREIFLKAGGERFHYIPALNDRADHLDFLAGLARQHIAPWL
FT                   DDPDNAFEARASARERALALGAQQ"
FT   gene            260513..261295
FT                   /locus_tag="TK90_0254"
FT   CDS_pept        260513..261295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0254"
FT                   /product="molybdopterin binding domain protein"
FT                   /note="PFAM: molybdopterin binding domain; SMART:
FT                   molybdopterin binding domain; KEGG: aeh:Mlg_1211
FT                   molybdopterin binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70769"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD24"
FT                   /inference="protein motif:PFAM:PF00994"
FT                   /protein_id="ADC70769.1"
FT                   /translation="MDETTAPGRVEEAPGDTEIGAVIIGDELLSGKRRDRHQEHLTAAL
FT                   AEKGLELAWIRIVGDHAGRLTQTFRETLATGAEVFSFGGIGATPDDRTRACLAKALGLP
FT                   LRPHPDFMAILEERFGAEAWPHRVRMAELPEGASLIPNPVNGIPGLSCGRHHCVPGFPV
FT                   MAEPMVRWVLDQRFPGRDAAAGSVEEVLVLENVTESRLVPVLEAMEAAFPDLRISCLPR
FT                   MDRQAPQVELGLRGPRARVTEGQAALRQHLIAGGFLGH"
FT   gene            261378..262133
FT                   /locus_tag="TK90_0255"
FT   CDS_pept        261378..262133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0255"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: mei:Msip34_0690
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70770"
FT                   /db_xref="GOA:D3SD25"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD25"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ADC70770.1"
FT                   /translation="MPLGRSEWKTPHVNLPVPGPEWSDPAERPPARAPVGVESRVPEAC
FT                   EPEGWLDALVHDQRCVWPDFLPAESVDALRDEVYALRDAAQLAQARIGRGGERHHDRAT
FT                   RGDWIHWLDGASPAQQAFMERLDAIRLQVGRTLIPGLFETESHFALYPPGTHYARHVDA
FT                   FQAGNCRRLSLVFYLNRDWQEQDGGQLAIYDDAGRECQRIQPTAGTLVMFLSQSVPHAV
FT                   LPTRRWRASIASWMRVRDLSGPLASLDRF"
FT   gene            262235..265504
FT                   /locus_tag="TK90_0256"
FT   CDS_pept        262235..265504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0256"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /EC_number="1.17.4.1"
FT                   /note="KEGG: aeh:Mlg_1471 ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent; TIGRFAM:
FT                   ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit
FT                   domain protein; SMART: Hedgehog/intein hint domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70771"
FT                   /db_xref="GOA:D3SD26"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD26"
FT                   /inference="protein motif:TFAM:TIGR02504"
FT                   /protein_id="ADC70771.1"
FT                   /translation="MGDSWQSHDNVISIQGTSPDVSLQPSSYSIWAERYQLRDAHGEPV
FT                   DASMEAMFDRVARALAAVEAPDQRAPIEREFRWALDNGAIPAGRILANAGAEAHKPQTT
FT                   LINCTVSRTIRDSLQAILDANTVAGLTLKAGAGIGYDFSTLRPKGALVAGAGAPTNGPV
FT                   AFMQIFDQTCRTIGAAGGRRGAQMATLDIGHPDIERFILAKRRKGRLTQFNLSVLVRDA
FT                   FLEAVERDDEWALAFPLLPVEQDGVPASDLVYRDWPVVEDGYRVDDQGRVACRVCRRVR
FT                   ARELWETLMRSTYDVGEPGVILIDQVNRQNNAWFDEVIRATNPCVTADTWIHTSIGPRQ
FT                   VRDLLGQQFRVRVDGRDYTTGEQGFVPTGAKQVVRLATAEGYQLKLTADHRLRRVTRYT
FT                   RYVTETEWCAAARLREGDRVLLNDHRAHAEWPGEYTHEQGYLLGMLVGDGTLKNDKAVL
FT                   SVWKLAAVVGTSPDAVSPAGVEGIMEEVMRSARTLPHRSDFSGWQEVAGRNEFRLSLAA
FT                   LKSLAEEVGMGPGAKSVTPAMEQASSEFCRGFLRGMFDADGSVQGGQQKGVSVRLSQSD
FT                   MSRLEAVQRMLLRLGIASSIYRNRRSAGMRHLPDGNGGAKEYAIKAQHELIVRGENLQR
FT                   FLQQVGFADTDKKRRLEQALARYKRGLNRERFVARVTKIEPGGIEEVFDVSVPDVHAFD
FT                   ANGLCAHNCGEQPLPPDGACLLGSVNLTRFVSAPFSADTAFDWERFERVVRVFTRMLDN
FT                   VADISGLPLPEQRAEMLRKRRHGMGILGLGSALAMLGETYGSESAAGFTAEVCRRLALA
FT                   SWRAGLELAREKGPAPIMDEGFTLTADMLRRQPALAEAGYQVGDVLKGRELHARFSPYM
FT                   QHVAVQDPALVAALAEEGARFTHATSIAPTGTISFSVANNASNGIEPTFLHHTTRNIRR
FT                   PGRRTREAVDCYSYELLAYRALVDPEAGPEDLPANAITAERVGVDAHIRMQAAAQPWVD
FT                   SAISKTLNVPSDIPFEGFKEVYLQAWRAGLKGCTTYRPNPQAQMGVLVDPERLRSTWYT
FT                   FTLTDGRELTLRGDEEVEYEGQIHTAANLFAALDEGYYDDV"
FT   gene            265524..266231
FT                   /locus_tag="TK90_0257"
FT   CDS_pept        265524..266231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0257"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="KEGG: bph:Bphy_3305 ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70772"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD27"
FT                   /inference="similar to AA sequence:KEGG:Bphy_3305"
FT                   /protein_id="ADC70772.1"
FT                   /translation="MHRIDQPIIAFRRSDAPQGEGASGGDDHPLGKRIPSRPEGELESV
FT                   TEKVRYWTQGGPQTVYLVVSFVAVSGTVSGERVTIERPIEFFLPTGQHSESYQWISATM
FT                   RSLSLAARGGYAARALRDLRKVTWDRGPVRSGTNDYGKPLYHPSEVAAIAHALQQILQR
FT                   RGFLDPDGHPRPLRDLAATYRDNARTARPPDMPTLELPQSMPMGASLCPQCGDHLEIVD
FT                   GCPTCRDCGYSKC"
FT   gene            complement(266336..266527)
FT                   /locus_tag="TK90_0258"
FT   CDS_pept        complement(266336..266527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmj:P9211_06071 micrococcal nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70773"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70773.1"
FT                   /translation="MRVLVLAAIAALMSVPALAAPAPMTAVVIDASSTVNHGGGCRKSS
FT                   PPGQCCHRDNSTGTVHCH"
FT   sig_peptide     complement(266468..266527)
FT                   /locus_tag="TK90_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            266910..267338
FT                   /locus_tag="TK90_0259"
FT   CDS_pept        266910..267338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_1405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70774"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD29"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70774.1"
FT                   /translation="MAHILNPYADDQPEPKHIVLRARSGEAVSANFTLQDRRGRQSAAE
FT                   YLFHLYSTIKQKLDEPVLDTAAPSPDDQAAMQRLILYSAGAHDTMFGTFNASSASSEMP
FT                   EEERNEFVEIFLLACATVIEGQRITVDLQRGLVTAETA"
FT   gene            complement(267353..268234)
FT                   /locus_tag="TK90_0260"
FT   CDS_pept        complement(267353..268234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0260"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   lch:Lcho_4143 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70775"
FT                   /db_xref="GOA:D3SAI3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3SAI3"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADC70775.1"
FT                   /translation="MVRCITTLAKKAPVKRVCDLLEVNRSGYYAAQTRRRRPRQPCALE
FT                   ARVKEAFEQSEWTYGSRRVQAALRSDGVTVGRYRVRRLMREQGLRPVWKRAFVVTTQRD
FT                   ATAPVVENHLDRQFQPSRPNAAWVTDITYIRTRTGWTYLAAVLDLFNRKVVGWSMSRRL
FT                   DAELACSALRMALQSRQPEPGLLVHSDQGCQYTSDAWRRLLVQHGARASMSRRGNCWDN
FT                   AVAERFFLNLKTERVWRRDYANHGEATRDITDYIVGFYNERRRHSTLGYLSPNAYERKW
FT                   TAEPPIEVSEIA"
FT   gene            complement(268234..268524)
FT                   /locus_tag="TK90_0261"
FT   CDS_pept        complement(268234..268524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0261"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   net:Neut_2190 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70776"
FT                   /db_xref="GOA:D3S9A5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3S9A5"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ADC70776.1"
FT                   /translation="MGRRNFDPEYKLRVARMVVDEGQGVPQVVRDTGVGETAVRRWVEQ
FT                   LKADRSGEAGDGRPLTPEQRRIRELEEENRRLREDKALLKKASAFFARELL"
FT   gene            268782..269849
FT                   /locus_tag="TK90_0262"
FT   CDS_pept        268782..269849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70777"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70777.1"
FT                   /translation="MGKPTFQYHPVRYAKHMRPAFEMTADQFYGHSGGDREELGGLLAS
FT                   TVFGEVARRLIEADPHPTVPADPDQWGQHQEMVFGAYQSSLTNGENIFHIQPALADMFT
FT                   KTDVDQIAVDQLRLPFDAFYLHFGQVDGLQLPSRGRYIDGAYVQDGEVLMICFTAADPG
FT                   LDYAEPLPVARFMAADEQLEFVLGGEPGMTVGQSIQDAQRDFTRVDHLREVYTQWEPAF
FT                   PAATRLLMNALCYLGSPHREVNERFSDDTPKTIARKYASATSRKQRDRVLSKAKAQGFR
FT                   RIQFLGDSIQGAAAVRGGGEVSPHWRRGHWRNQAHGPERRQHRLVWIQPTIVKGDQGAP
FT                   VKGKHLYEVDSKPGE"
FT   gene            complement(269915..269991)
FT                   /locus_tag="TK90_R0002"
FT                   /note="tRNA-Met3"
FT   tRNA            complement(269915..269991)
FT                   /locus_tag="TK90_R0002"
FT                   /product="tRNA-Met"
FT   gene            complement(270287..272176)
FT                   /locus_tag="TK90_0263"
FT   CDS_pept        complement(270287..272176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0263"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   non-essential domain protein; sigma-70 region 3 domain
FT                   protein; sigma-70 1.1 domain protein; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; sigma-70
FT                   region 1.2; KEGG: kko:Kkor_2176 RNA polymerase, sigma 70
FT                   subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70778"
FT                   /db_xref="GOA:D3SD33"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD33"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ADC70778.1"
FT                   /translation="MNREEQQSQLKELIAKGKEQGYLTYTEVNDHLPDSIIDSDQVEDI
FT                   IAMINDMGIAVHEQAPDADSLLLSDGSVSADEDAEDAVAALASADSDFGRTTDPVRMYM
FT                   REMGTVELLTREGEIRIAKRIEEGLMQVLFALAHHPGAIEHLIREYDQIVENNGRLTDL
FT                   VVSFIDPKNPLDGEAVARGLVSPEDAQKAEEAQKAAAAEASPELDAIVEEVEDAEEEDA
FT                   EPVDTGPDPEEARERFNKLRKLHAKAHKAFEKGDRKAYATAREATAKYFMEFKLVPRMV
FT                   DQLTTKLHGTIDRIRSHERRIMELAVNQAQMPRKSFIDSFPKNETNLDWIKQACKAKGK
FT                   YTTALAEHEDEIVRLQKKLAEIEHEASLNISEIKEINRRMSIGEAKARRAKKEMVEANL
FT                   RLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSI
FT                   ADQARTIRIPVHMIETINKLNRVSRQMLQEMGREATPEELAERMEMPEDKIRKVLKISK
FT                   EPISMETPIGDDEDSHLGDFIEDEKVASPSDSAARESLSEATREILSTLTPREAKVLRM
FT                   RFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPTRAELLRTYTDAE"
FT   gene            complement(272377..274161)
FT                   /locus_tag="TK90_0264"
FT   CDS_pept        complement(272377..274161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0264"
FT                   /product="DNA primase"
FT                   /note="KEGG: avn:Avin_46990 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; DNA primase
FT                   catalytic core domain; TOPRIM domain protein; DNA primase,
FT                   DnaB-helicase binding domain; DNA primase DnaG
FT                   DnaB-binding; SMART: zinc finger CHC2-family protein;
FT                   Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70779"
FT                   /db_xref="GOA:D3SD34"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD34"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ADC70779.1"
FT                   /translation="MAGLIPQAFIDELLERSDIVEVIQRRVSLKKAGREFAACCPFHGE
FT                   KTPSFYVSPQKQFYHCFGCGAHGTAISFLMEYENLSFPEAVEQLAEQAGLEVPREAGGD
FT                   DKREAHAPLYEALNAAAEYYVQQLRQTPKAVEYLKNRGIDGNTARDYQIGWAPPSGLIE
FT                   ALQPRFSPQQLVDAGLAARRDDGGIRERFRARIMFPIRDRRGRITGFGGRLIEDGEPKY
FT                   LNSPESEVFHKGQTIYGLFEARKAGTRLDDIVVVEGYMDVVGLARAGFRRAVACMGTAL
FT                   TRAHLDSLFRQVSRITLCFDGDAAGRRAAWRSLAEALPAIQGLREVRVLFLPEGDDPDS
FT                   LVLRDGLAGWEGRLAAALPLSETLVRLLREEHPTDTAEGRTRFAHAAMKLVATTRDPLF
FT                   RDQLVERVAQETHLSPERLGEQLREAEDGNVRATGPASGPSDIPEAPSAEPAGAARETP
FT                   SALWGALLARILQHPELEWSQSELADLTAFPGTAAQTLGKLLEALQERPGCSSAHLLER
FT                   FRDDRHFNRLQALAARELGDGDPKVTQQVAMDCARQLLLQQARTRIRELTRADGGLATE
FT                   QREELARLTALLQKTNTG"
FT   gene            complement(274423..278886)
FT                   /locus_tag="TK90_0265"
FT   CDS_pept        complement(274423..278886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0265"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: glutamate synthase; ferredoxin-dependent
FT                   glutamate synthase; glutamine amidotransferase class-II;
FT                   glutamate synthase alpha subunit domain protein; KEGG:
FT                   aeh:Mlg_2763 glutamate synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70780"
FT                   /db_xref="GOA:D3SD35"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD35"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ADC70780.1"
FT                   /translation="MRQNQLNGTLYRPEFERDNCGFGLIAHMDGVASHWVVDTAIKALE
FT                   RMTHRGAIAADGKTGDGCGLLMKTPEAFLRTLASESNIELAERFAAGIVFINPDRIAET
FT                   RAAVENAIERGPLSLAGWREVPVNPEDACGAEALKSQPHILQVFINAPANMDGDAFERA
FT                   LFVVRRRAEIAMGDDPVFYVPSLSARVVSYKGLVMPENLPVFYRDLQRPELETSICVFH
FT                   QRFSTNTFPQWGLAQPFRFLAHNGEINTVQGNRNWAVARQHKFATENLPELAELEPLVN
FT                   LEGSDSQSLDNMLEVLLAGGMDLFRAMRLLVPPAWQNVAHMDSDLRAFYEYNSMHMEPW
FT                   DGPAGIVLTDGRYAACTLDRNGLRPARYVITKDRHITLASEIGVYDYAPEDVVAKGRLK
FT                   PGQMLAVDTESGELLQPEDVDRINRTRQPYRQWLRAHVKHLKSQLDDNQLFSGEPMPPE
FT                   RLETYEKLFDVTFEERDQILRVLAEAGQEAVGSMGDDTPFAVLSRHTRSLFDYFRQQFA
FT                   QVTNPAIDPLRESIVMSLETCFGREQNLFEETPDHAHRLVSDSPVLSEAKFRELCNQTE
FT                   DAFRVERMDLNYDVHAGSLEDAVKALTANAVEAVRGGAVVLVLSDRGIDPERRPIPAAL
FT                   AVGAVHHALIRAKLRTDANIVAETATVRDPHHFAVLLGYGATAIYPYLAYSALHGMCES
FT                   GEIPNADPLTLAQNYRRGINKGLFKILSKMGISTIASYRGAQLFEIVGLADEVVDTCFT
FT                   GTTSRIKGTRFADIEADLETLSKRAWNPRKSAGQGGLLKYVHGGEYHAYNPDVIQTLHR
FT                   AVQSGDYGVYQEYADLVNERPVTVLRDLLKVRDDIEPIDLDEVEPEAEILPRFDSAGMS
FT                   LGALSPEAHEALATAMNRLGGRSNSGEGGEAVSRYGTERMSKIKQVASGRFGVTPHYLV
FT                   NAEVLQIKVAQGAKPGEGGQLPGHKVNKMIAELRYSNPGVALISPPPHHDIYSIEDLAQ
FT                   LIFDLKQVNPDALVSVKLVSEAGVGTIAAGVAKAYADLITISGYDGGTGASPLTSVKYA
FT                   GTPWELGLTETHATLRGNDLRDKVRLQTDGGLKTGLDVIKAAILGAESFGFGTGPMVAL
FT                   GCKYLRICHLNNCATGVATQDKVLRMNHFIGLPEMVMHYFQFVARETREWMAKLGVRSL
FT                   TDLIGRTDLLEILPGETPKQQHLDLNGLLASGDLDDKPRFCKEPKNEPFDKGELAEKMV
FT                   AEMLEAIENKAGGEYHFDVANTDRSIGARLSGEIAKRHGNQGMSDAPITVRMKGTAGQS
FT                   FGVWNAGGLHLYLEGDANDYVGKGMTGGKLVIRPPEGSSFASQDTTIMGNTCLYGATGG
FT                   KLFAAGQCGERFGVRNSGAIAVVEGIGDHGCEYMTGGVMVVLGNTGINFGAGMTGGFAF
FT                   VLDRENDFPDRINNELIDLHRLDTEDMEAHRNYLEELITEFVHETDSAWGREILEQFDH
FT                   YQGSFWLVKPKASELRGLLANLRQAA"
FT   gene            complement(279048..280898)
FT                   /locus_tag="TK90_0266"
FT   CDS_pept        complement(279048..280898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0266"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: syn:slr1753
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70781"
FT                   /db_xref="GOA:D3SD36"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD36"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ADC70781.1"
FT                   /translation="MALSDQCLKQLGLHTAPFDETPDEHFIYSDPLLDGLLESARAALD
FT                   APGAIVIMTGENGSGRSLQLMRLLAMLPEPFELIAFRARINTQFESVDNTIRNYLRSHN
FT                   ADDPDRPLTELLAERVALGRDPVIAMDDAHLVGTDIVNNLMRMRSEVLESQGRAPRVVL
FT                   VGSGGLLRRRLYLPDPSDEDQVTRVNLRAFNLEQTGAYLRHRLQAAGLDDPDRLLDQET
FT                   IHHLQTTSQGLPGNLNREANQILERHCRSERHAASAAGTTAPGIALGDEAEREEASSPT
FT                   TREPAGVTIDSDADLDRENDAEPVLRAQREEDEFTPAAEALAHTDADDEPEWPPEHELD
FT                   APPEEKRAAPFWNQRWFVPAVAATVAIGIAAPVALQLMDGGDTEAEQEVVELPLPETRP
FT                   PASPDQDDLVAPDPLEHTDDTLTSPDIEPLPGQERPSGDPIAGIEAEPAAEPEPQPEPQ
FT                   PEPQPEPQPEPQPEPEPAPEPEPEPEPAPEPEPEPEPEPEPEPEPETTTEALADEDGDS
FT                   ERLRGDLEWLGSQSSDAFTIQLIAAPDMSTARGYADRHNLGGIRYIPTRVNNRDFVVVL
FT                   AGSFASREAAEGAASDLPEAVRNEGPWIRSIGSVQGVARE"
FT   gene            complement(280911..282101)
FT                   /locus_tag="TK90_0267"
FT   CDS_pept        complement(280911..282101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0267"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="KEGG: mfa:Mfla_2454 deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70782"
FT                   /db_xref="GOA:D3SD37"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD37"
FT                   /inference="protein motif:TFAM:TIGR01353"
FT                   /protein_id="ADC70782.1"
FT                   /translation="MSPEALATTPRVDRASGLAPYAADPSASRGRTYPEAPTRHRSDFQ
FT                   RDRDRIVHSSAFRRLEYKTQVFISHEGDLFRNRLTHSLEVAQIGRSIARALNLNEDLVE
FT                   AIALAHDLGHTPFGHAGQHALNDCMKAYGGFEHNLQSLRIVDLLERHYAEFDGLNLTFE
FT                   TREGILKHCSPQRARDLGAIGVRFLEKQQPSLEAQLANVADEIAYNNHDVDDGLRSGLL
FT                   DMDQLTEVRLFRKCLEAVRARYPDLEPRRVQHETVRRMIDALVSDLIESSQAAIDHEQP
FT                   ETPDDVRRAGQPLIRFSPDMAEQAHELKVFLRENLYHHHQVHAVMHKARQLIQELFAAF
FT                   DSEPRLMPEHFQRHAERLAEADPHAPQRAIADYIAGMTDRHAIREHHRLFDLGTLT"
FT   gene            complement(282091..283215)
FT                   /locus_tag="TK90_0268"
FT   CDS_pept        complement(282091..283215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0268"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase; KEGG: pst:PSPTO_5126
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70783"
FT                   /db_xref="GOA:D3SD38"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD38"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ADC70783.1"
FT                   /translation="MMPLMNAPGTQNLNVELGERSYPIRIGPGQLAAADTLRPALEGRR
FT                   VAVVTNTTVGPLYGEALRETLEQCGIAGELLWIELPDGEAHKTLATVESIITRLLEARL
FT                   DRGSRIVALGGGVVGDIAGFAAAIYQRGIDFVQIPTTLLAQVDSSVGGKTGVNHPLGKN
FT                   MIGAFHQPRAVLIDTDTLKTLPERELQAGLAEVIKYGLIRDADFFAWLEAHIDELRALE
FT                   PKTLAYAIHRSCACKAEIVAADEREGGIRALLNLGHTFGHAIEAGMGYGQWLHGEAVGT
FT                   GMAMAARMSERMGWLSRAERERAEALIQRAGLALEPPDTMTAERFRELMAIDKKVSSGR
FT                   LRLVLLRAIGQAELTDQFDVSALDATLHEGARVA"
FT   gene            283392..283607
FT                   /locus_tag="TK90_0269"
FT   CDS_pept        283392..283607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0269"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; PFAM: ribosomal
FT                   protein S21; KEGG: smt:Smal_0326 30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70784"
FT                   /db_xref="GOA:D3SD39"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD39"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ADC70784.1"
FT                   /translation="MPHVRVRENEPFEVALRRFKRTCEKAGVVAEVRRREYYEKPTTER
FT                   KRKAAAAVKRQLKKNSRDMTRRVRLY"
FT   gene            283648..284097
FT                   /locus_tag="TK90_0270"
FT   CDS_pept        283648..284097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0270"
FT                   /product="Protein of unknown function"
FT                   /note="PFAM: Protein of unknown function; KEGG: rso:RSc2217
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70785"
FT                   /db_xref="GOA:D3SD40"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD40"
FT                   /inference="protein motif:PFAM:PF09424"
FT                   /protein_id="ADC70785.1"
FT                   /translation="MSLKARLQDDVKQAMRAREKERLAALRLIQAEVSQFEVDERREAD
FT                   DDAVLAILNRMLKQRRDSIDQYRKGGREDLAEREAAEITVIEAYMPEPLGDAELEQMIG
FT                   EAIAETGAAGPSDMGKVMGVLKPRVFGRADMGVVSQKVRSALGHS"
FT   gene            284196..285599
FT                   /locus_tag="TK90_0271"
FT   CDS_pept        284196..285599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0271"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: aeh:Mlg_2764 glutamate synthase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70786"
FT                   /db_xref="GOA:D3SD41"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD41"
FT                   /inference="protein motif:TFAM:TIGR01318"
FT                   /protein_id="ADC70786.1"
FT                   /translation="MASNPMQFLDLPRQDPQKTPAEIRIHEFGEIIGQFDPATAGQQAG
FT                   RCLACGNPYCEWKCPVHNFIPNWLKLVEEGNLFAAAELSHKTNSLPEVCGRVCPQDRLC
FT                   EGACTLNDGFGAVTIGSVEKYITDEALKAGWRPDLSDVTPTDKRVAVIGAGPAGLGCAD
FT                   ILARNGVQAVVYDRYPEIGGLLTFGIPPFKLEKQVIRTRREILEGMGVEFRLNTEIGRD
FT                   IQMDTLLEEYDAVFLGMGTYTAMQGGFPGEDMPGVYPALPFLISNIRQVMGWEHDEDGF
FT                   IDVAGQRVVVLGGGDTAMDCNRTSIRQGAASVTCAYRRDEENMPGSRKEVVHAREEGVQ
FT                   FEFNVQPVEIVGDGKVEGVKVVRTQMGAPDERGRRRPEPVPGSEHVIPADRVLIAFGFR
FT                   PSPADWFAEYKIGVDEGGRVQAVGEHAFQTGNPKVFAGGDMVRGSDLVVTAVFEGREAA
FT                   EGILEYLGV"
FT   gene            285608..286666
FT                   /locus_tag="TK90_0272"
FT   CDS_pept        285608..286666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0272"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: kpu:KP1_0237 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70787"
FT                   /db_xref="GOA:D3SD42"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD42"
FT                   /inference="protein motif:TFAM:TIGR01464"
FT                   /protein_id="ADC70787.1"
FT                   /translation="MSQTLKNDRLLRALLREPVDRPPIWIMRQAGRYLPEYRETRAQAG
FT                   SFMNLCQNPELACEVTMQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFRDPI
FT                   RSLEAIENLPVPDPEQELRYVMDAVRLIRRELNGEVPLIGFAGSPWTLATYMVEGQGSR
FT                   DFAETKRLMYGEPQAMHALLQKVATAVTEYLNAQIRAGAQAVMVFDTWGGSLTPRGYRE
FT                   FSLAYMQRIVDGLIRDHDGRRVPVTLFTKGGDAWLEAQAETGADALGLDWTIEIAEASR
FT                   RVGDRVALQGNLDPSVLYAPDAVVREEALRVLDGFDRDTGHVFNLGHGIHPGIDPERVA
FT                   TLVETVTSYRRD"
FT   gene            complement(286688..287317)
FT                   /locus_tag="TK90_0273"
FT   CDS_pept        complement(286688..287317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2753 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70788"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD43"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2753"
FT                   /protein_id="ADC70788.1"
FT                   /translation="MSPSRIRQELAQEAARILLDDGIRDFALAKRKAAEHLGVEPRHEM
FT                   PRNIEIQEAAIERSRLFATDDSRQAYRERLEAARIVMERLSALEPRLVGPLLDGIVERQ
FT                   PLVNLHAFAETVEEVILDLGERGIRCQTGERRYRSRQGREQRVPFLSFRGPNDTDIELT
FT                   VFPLDGLRQAPPSPVDGKPMARAGRADVDRLLAAANADAPAAADAS"
FT   gene            complement(287317..289689)
FT                   /locus_tag="TK90_0274"
FT   CDS_pept        complement(287317..289689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0274"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: hha:Hhal_2253 1A family
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70789"
FT                   /db_xref="GOA:D3SD44"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD44"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADC70789.1"
FT                   /translation="MKPILKIFAALLALILAAGIGVSAAIAALYVHYAPTLPEAEAVRD
FT                   VRLQTPLQVRTADGLLMGEFAEERRIPLPIEDIPERVRQAFIAAEDERFYDHPGVDIVG
FT                   LARAAINEISTRGERSQGGSTITMQLARNVFLTRDRTYERKLREIFLAIRMEQEMTKDE
FT                   ILELYLNKIYLGQRAYGIEAAARVYYGRSIDELELDEIAVLAALPKAPSTTNPVASAQR
FT                   AEIRRNYVLRRMLDTGAISDSEYEEAVARPVSSERHVAATEVDAHWVAEAARQIVFNLW
FT                   GEDAYRRGLQVHTSIDSRYQEAANQALREGLLEYDERHGYRGPEGRLGDEVMADAEARE
FT                   RALKAQGVHGRLLFPAVVMEREGDGTLQVDGGQIGELTIEPRDQEWARTPEFERGDVIR
FT                   VRPYTDGRWRLAQKPEVTGAVIAQSPADGAIVALAGGFDFFENRYDRSTQAQRQPGSAF
FT                   KPLVYALALQDGYRPDGVLVDAPMVFDDPALGAEWRPQNYSRQFQGEMSMRDALAQSRN
FT                   LASIRLLNSLGPQRVHEQLPRFGLDPDKHPSNLSMVLGTGAVTPLQLNNAYGVFASGGK
FT                   LHSPWIITRIETDDGEVLYTAPTERACPEPCENPAGQDLYLNASGGPLQYTDPAQVLDP
FT                   GAAWQMSNMLGHVITAGTGRQAQQLGRSDLAGKTGTTNSYRDAWFSGFNADIVATAWVG
FT                   FDDNRELGRRESGGRTALPLWIRFMDSVLTDTPERPVERPDDLQRVAILPDGRRAPSEE
FT                   TPGANIQWLIPQQVPERGQAPAGPRGENGQGPAESVF"
FT   sig_peptide     complement(289606..289689)
FT                   /locus_tag="TK90_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.833 at
FT                   residue 28"
FT   gene            289833..290900
FT                   /locus_tag="TK90_0275"
FT   CDS_pept        289833..290900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0275"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   kko:Kkor_2245 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70790"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD45"
FT                   /inference="protein motif:TFAM:TIGR01175"
FT                   /protein_id="ADC70790.1"
FT                   /translation="MLSLGKSKQGLLGVDVSSAAVKVLELARQGKGYRVEAFAVEPLPD
FT                   GVMVDKVCQDTEAVGSALARAVKRSGTKLKHCAMAVPSSAVITKTIQMSATLSDTELEG
FT                   QVFVEADQYIPYTLEEVNLDFQVLGKNEKNPQLVDVLVVASRRENVDSRVAIAESAKLT
FT                   PELVDVEAYAIEHASERLVEQIPDRENKPIVAIVDVGSSVTAVYVVSQTEGVIYTREQN
FT                   FGGRMLTEEIMRRYSMNYQEAGSAKMSGDLPADYVSNILEPFKQTMMDQIQRLLQYFYV
FT                   TRPQDSIDHILLGGGCAAIAGVDEMLEESSGTPVSVANPFRGMALSRRVNQQRFANDAP
FT                   ALLTACGLAMRGYAS"
FT   gene            290897..291460
FT                   /locus_tag="TK90_0276"
FT   CDS_pept        290897..291460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0276"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   pmy:Pmen_0543 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70791"
FT                   /db_xref="GOA:D3SD46"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD46"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ADC70791.1"
FT                   /translation="MIYINLLPWREKAREQRRKQFFGAVGGAVVVGVLLAFGAHTYMNA
FT                   LIDHQQSRNQMLESEIRELDRKIARIRDLDEQRQALIARMEVIQTLQARRPEAVHLFDQ
FT                   LVETLPDGTYLNEVRQEGERIRLTGRAESNTRISTLMRRIDGSPWLADSNLQIIETRED
FT                   GSLQVRDFRLDANQTRPSDVEEDS"
FT   gene            291460..292041
FT                   /locus_tag="TK90_0277"
FT   CDS_pept        291460..292041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0277"
FT                   /product="Pilus assembly protein PilO"
FT                   /note="PFAM: Pilus assembly protein PilO; KEGG:
FT                   noc:Noc_0249 pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70792"
FT                   /db_xref="GOA:D3SD47"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD47"
FT                   /inference="protein motif:PFAM:PF04350"
FT                   /protein_id="ADC70792.1"
FT                   /translation="MNIKELNEIDFNNIGEASWAVKVLILVVIVLVILGLSYYFFIGDQ
FT                   RTDLERAENREQQLRVEFEDKQQRAANLEAYEEQLEEMERMFASLLELLPSSAEIPSLL
FT                   VDISQTGLQAGLEIELFEPRGENRRDFYAEVPIRLRVRGDYEELAEFVSGTSALPRVVT
FT                   MHDMHIRRGNSDDDLLMDATARTYRYLEDH"
FT   gene            292041..292583
FT                   /locus_tag="TK90_0278"
FT   CDS_pept        292041..292583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0278"
FT                   /product="Pilus assembly protein PilP"
FT                   /note="PFAM: Pilus assembly protein PilP; KEGG:
FT                   ttu:TERTU_3582 type 4 fimbrial biogenesis protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70793"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD48"
FT                   /inference="protein motif:PFAM:PF04351"
FT                   /protein_id="ADC70793.1"
FT                   /translation="MRNPAQRSLGAAFALGLLATFGLSGCAPDKSDLERYIAEINERPG
FT                   SGIDPIPTLEPHEPYLYPGHTRSPFDSSVIAQPELAVAQGEPGDAEVDPDRPREFLESF
FT                   PLDSLRMVGSLEQDEVRYALVRTPDRGIQRVTVGNYMGENHGRIVEITATRVKLVEVVP
FT                   DAFGGYVERENSVALAD"
FT   sig_peptide     292041..292118
FT                   /locus_tag="TK90_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.963 at
FT                   residue 26"
FT   gene            292603..294735
FT                   /locus_tag="TK90_0279"
FT   CDS_pept        292603..294735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0279"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB short domain; KEGG: maq:Maqu_0830 type IV
FT                   pilus secretin PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70794"
FT                   /db_xref="GOA:D3SD49"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD49"
FT                   /inference="protein motif:TFAM:TIGR02515"
FT                   /protein_id="ADC70794.1"
FT                   /translation="MMKRMGRKTGNNYRGLHMGSSMRALAGTVMAALLFMVSQGVAATE
FT                   LEEIRAASISGDRVQVNLRFSGTPPEDVRAFAIDSPPRIALDLPDAGNALRSRETDLNV
FT                   GPLLTATAVESGDRTRVVLNLTQPSEYQTRVEGNNLILTLGRGVSEADSDVQQVVDRAG
FT                   EPSERATRSARPVEITGIDFRRGSEGEGRVEIDLSRSGAEVNVREQAGKVELTFPRARV
FT                   DESLERRLDVLDFATPVRTIDTVAERERVRMEVDAHGEYEVLSYQSDRRFVLEVAPITE
FT                   AEREARRREEEQFEGERLSLNFQDIEVRSVLQLLADFTDLNIVVSDTVGGNITLRLNNV
FT                   PWDQALDIILRSRGLDKRMDGNVLYVAPSEEIAARERLEMEAARDRQELEPLRTEFVQI
FT                   NFAQAEQIASLIRGDETGQFLSDRGSITIDSRTNTLLVQDTQSRIEDVRRLVQTLDVPV
FT                   QQVLIETRIVIAEDTFNRELGARFGISGTRGDRRTRVGGAGSIEGADAARDASTAGVGG
FT                   IAIGDRLNSSLPASGDAGRAGISLLRSGVLLDLELSALQVEGRGEIISSPRVITANGQT
FT                   ASIKQGEEIPFQEATASGATSTQFIEAVLSTEVTPQITPNGNVILDIRVTKDEPSQREV
FT                   LGVPGINKREVNTQVFVGNGETVVLGGVYEIDSRTNLEKVPFFGDIPFLGNLFRNRSTE
FT                   NTKAELLIFVTPRVLD"
FT   sig_peptide     292603..292731
FT                   /locus_tag="TK90_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.595 at
FT                   residue 43"
FT   gene            294839..295381
FT                   /locus_tag="TK90_0280"
FT   CDS_pept        294839..295381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0280"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: rme:Rmet_4010
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70795"
FT                   /db_xref="GOA:D3SD50"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD50"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ADC70795.1"
FT                   /translation="MQNIVLVGPMGAGKSTIGRGLAGLLRRPFFDTDQEIQRRTGVDIP
FT                   TIFEFEGEAGFRKRESAMLESLLERDGIVIATGGGIVERPENRERLREHFVIYLRVPVD
FT                   EQFRRTRRNRKRPLLNEVADPRAKLQELFERRDPLYREIASMTLEGRGRRVRDAVRGVC
FT                   DALKVQRPDLCQPRSEG"
FT   gene            complement(295409..295846)
FT                   /locus_tag="TK90_0281"
FT   CDS_pept        complement(295409..295846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70796"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD51"
FT                   /inference="similar to AA sequence:KEGG:Rfer_0101"
FT                   /protein_id="ADC70796.1"
FT                   /translation="MGGASDECLTAYYEAFRAADIERMMRLWAERPDIVCVHPGSPRAH
FT                   RGVSEVMESWLLVFARELNIGIEPRIVGRQETTESLSVVIEEAITRPGDVAATGTILIS
FT                   QTWRRSGNGWRLQFHHASHGRRAPPSQQGMFVPDGGGSTRH"
FT   gene            complement(295846..296256)
FT                   /locus_tag="TK90_0282"
FT   CDS_pept        complement(295846..296256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: app:CAP2UW1_2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70797"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD52"
FT                   /inference="similar to AA sequence:KEGG:CAP2UW1_2941"
FT                   /protein_id="ADC70797.1"
FT                   /translation="MATFPSPETAETAFYEAFQAGDSDVMRRIWLDSPRCVCIHPGGER
FT                   LVGTDVILESWDDILPNMRGVVIHRTELNVIPGQNLVIHTLRENLYVSGERRGVMLATN
FT                   GYCLEGENWRMCLHHASPDPDPPPAWDTGRVH"
FT   gene            296373..297251
FT                   /locus_tag="TK90_0283"
FT   CDS_pept        296373..297251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0283"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: hha:Hhal_0921
FT                   ketohexokinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70798"
FT                   /db_xref="GOA:D3SD53"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD53"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADC70798.1"
FT                   /translation="MARILTTGIVTLDHTLDVERYPREDDEIRALASSSQPGGNAANTA
FT                   RILAQFGHRAALAAVLAEDASGDWLRDRLAAGGVETTACARYPGATPTSCILRSRDSGS
FT                   RTIVHHRDLPELSAADLRRIAWEEYDWLHFEGRQPETLRTVLPRVREAVTDQPISLELE
FT                   KRRPGLEACLEWADVFMLSRDWAAGIAARPEEAAADLARRYPGRIVTVTAGAEGAWLAQ
FT                   DELQVYCAPTPGLSVVDSVGAGDTFNAGLINALVSGEPPEQALVAAVRLAERKLQQAGF
FT                   DGLAAADVARP"
FT   gene            complement(297248..297814)
FT                   /locus_tag="TK90_0284"
FT   CDS_pept        complement(297248..297814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0284"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: aeh:Mlg_0023 redoxin
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70799"
FT                   /db_xref="GOA:D3SD54"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD54"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADC70799.1"
FT                   /translation="MKHRSHGFGWVALVAASAFVLAGCEEPTPEMDTAEANGAEAADTA
FT                   AEETQGDRRIDFTLPDLDSNDRQLSEWDGDLIVLNFWATWCPPCKKEMPLFQETWEEHR
FT                   DDGFTIVAVAVDELSATQHFVDDFGIEFPILIGQDEAVAVGREYGNRIGALPYTVLIDR
FT                   DGIIRDTHRGEVEEEDLQAWLDDYL"
FT   sig_peptide     complement(297746..297814)
FT                   /locus_tag="TK90_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.528 at
FT                   residue 23"
FT   gene            complement(297811..300180)
FT                   /locus_tag="TK90_0285"
FT   CDS_pept        complement(297811..300180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0285"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: mca:MCA1041 DsbD family thiol:disulfide
FT                   interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70800"
FT                   /db_xref="GOA:D3SD55"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD55"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ADC70800.1"
FT                   /translation="MHLLNLRNWLATLLVAFLLTPGLAHAIFDDDLLDPDDAFSLSAEA
FT                   IDADTIRLTWEIADGYYMYREQFEFEPESEGLELGEPNIPDGEKKTDEFFGEVETYRDE
FT                   VSIELPILAADSTEIELTARSQGCADLGVCYPPHFQTVSLELPGLPGENGEEAAEEEAT
FT                   EDEAADEERSALDEMGDLSGDVGAAGDLLEPEEAFAASLEAISQNAVILRFEIAEDYYL
FT                   YRDQLDVRIAEGDGIELGPVNPPEGERHEDEFFGETEIYRDQVEILVPVLRDEDDVSEI
FT                   TLAIDYQGCWDGGVCYPPLTQEVSVSFDADLATEVDEDALPETGDEALDEIDTAEAAPE
FT                   EADDETAAPVTQQDRIAAQLADGQIWLVALAFFGFGLLLTFTPCVFPMIPILSNIIIGQ
FT                   KNLTTRKAFLISLVFVLAMALTYTIAGVFAGLAGANLQAAFQNPWIIGTFVTIFIALAM
FT                   SMFGFYELQMPASVQSKLSQISNRQEGGTYMGAGIMGFLSALIVGPCVTAPLIGALLYI
FT                   SHTGDAVLGGIALFSLSMGMGAPLLAIGTSAGRLLPKAGPWMDAIKAVFGVGLLAMGIW
FT                   LLERVIPGEVAMFLWATLLIVTAIYMGALRSLPEGTSGWYSLWKGLGVVILIYGILLMI
FT                   GAATGGKDVFRPLASLNQPVASTTGEQGPTEMEFTKINSLEDLEREVERARENGQPVFV
FT                   DFYADWCVDCVRLERTTFQDPRVIRAMADVHLLKADVTENTSEHRELMRNFSLFGPPAM
FT                   IFYDSDGNELRNYRNVGYLNADRFLAHVESAIGVTP"
FT   sig_peptide     complement(300100..300180)
FT                   /locus_tag="TK90_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.585 at
FT                   residue 27"
FT   gene            complement(300168..300512)
FT                   /locus_tag="TK90_0286"
FT   CDS_pept        complement(300168..300512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0286"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   tbd:Tbd_2560 divalent cation tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70801"
FT                   /db_xref="GOA:D3SD56"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD56"
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /protein_id="ADC70801.1"
FT                   /translation="MPEKEPDNTNVRAWLVLTTLDDPAEAENLAGELVQRGLAACVHIL
FT                   PAGRSIYVWKGNIETDSEVTLLIKTSVDARDDLQAHLTEHHPYETPEIIAVPITHGSPD
FT                   YLNWITQCTS"
FT   gene            complement(300529..301356)
FT                   /locus_tag="TK90_0287"
FT   CDS_pept        complement(300529..301356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0287"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   hna:Hneap_0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70802"
FT                   /db_xref="GOA:D3SD57"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD57"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ADC70802.1"
FT                   /translation="MSIDRLNQGNSTRRLLLSAVACCAFLALTPAGSAAEENGALEGHL
FT                   DWGQTYRITAPVAGKIEAIEVRPGEHVDQDTALFRLDTRRVEADLRAAQAAIERLQLEL
FT                   NEANREVEKAEDLYDQTLIALREVELARIQQATVAARLAEARAQRDRARADRDDATIRA
FT                   PASGRITRIDVSPGQFVNPALAPAVLAVLGSGDSMRVRALVTPDRIGSLSEGQDVTITV
FT                   GEHEFSGTIDRIGWELVGKDEDQRYRVEAEFSPGDDAVLRPGQPARIELRTNS"
FT   sig_peptide     complement(301249..301356)
FT                   /locus_tag="TK90_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.588 at
FT                   residue 36"
FT   gene            complement(301396..302790)
FT                   /locus_tag="TK90_0288"
FT   CDS_pept        complement(301396..302790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0288"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   tbd:Tbd_2116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70803"
FT                   /db_xref="GOA:D3SD58"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD58"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ADC70803.1"
FT                   /translation="MHPGHAVPRHARLRIAAPLLATFIVFTLALLPAISAAQGLPADGV
FT                   IDPEPLPEPLRLQNALTAVDALHPQVQRARAEREIAEQELASTQAGRDVTVNARLEARW
FT                   IEPNDLAPDQSRNDSRATLVARKLLSDFGQSNAREAASTQRLEAAREMEILAHARHSLH
FT                   VMERYFNVLLADLGFARDTEAMAAAFVSKERAEERAQRGQVSDIEVFRLESEYQTLRVQ
FT                   RQRALQNQRRARDELAEALNRPGERIRTVLAPALPLDLPELPGLDDLMAELDSANPTLA
FT                   AERMQVEAAARGVDAARAQRRPRLYAEAETGYWNREFGGDRNPFAAGLVLEVPLYEGRR
FT                   QDSRVGHAVAARQRAEADLGQARIEARNRLRELYHEAQALRMQRDEAEWRMDYRQLYID
FT                   RARYLYDIEDQADLGDSMVQQSAAAYFNAQTEFELAMVYERLALLTGRGDLSPFRLAGT
FT                   AVAETE"
FT   gene            complement(302799..303353)
FT                   /locus_tag="TK90_0289"
FT   CDS_pept        complement(302799..303353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0289"
FT                   /product="Thioredoxin-related protein-like protein"
FT                   /note="KEGG: tcx:Tcr_0523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70804"
FT                   /db_xref="GOA:D3SD59"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041737"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD59"
FT                   /inference="protein motif:COG:COG2143"
FT                   /protein_id="ADC70804.1"
FT                   /translation="MRASRIISLFPTLLAALLLALPGLGSAGVEDPRDPTHHFFDPTFG
FT                   DFPEELEEAREAGKKGILLFFEMDDCPFCHRMKNQVLNQPEVQEFYKERFRIFAVDVEG
FT                   AIEVVNFEGETKTMMDFATRDFRVRATPVFQFFNLDGEPITRFTGATRDVDEFLLLGEF
FT                   VAEGHYEDGNFTRFRRERAGR"
FT   sig_peptide     complement(303270..303353)
FT                   /locus_tag="TK90_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.761 at
FT                   residue 28"
FT   gene            303544..304029
FT                   /locus_tag="TK90_0290"
FT   CDS_pept        303544..304029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0290"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   noc:Noc_2923 FxsA cytoplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70805"
FT                   /db_xref="GOA:D3SD60"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD60"
FT                   /inference="protein motif:PFAM:PF04186"
FT                   /protein_id="ADC70805.1"
FT                   /translation="MRSPFLPLFVFLGLVLLEIFGFAWVGDAVGALATVALVIATAAAG
FT                   LLLFRLQGFYHWRRLQQSLARGEMPARGLVEGWLLMSAAVLLLLPGFFTDAAGFVLLVP
FT                   PLRRWAAEGILRRGMIRARASGPGAAGPGDPIEGEFRRHDAGDESASDERLDHDDRR"
FT   gene            304165..304455
FT                   /locus_tag="TK90_0291"
FT   CDS_pept        304165..304455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0291"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; SMART: chaperonin Cpn10;
FT                   KEGG: noc:Noc_2922 co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70806"
FT                   /db_xref="GOA:D3SD61"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD61"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADC70806.1"
FT                   /translation="MNLRPLHDRVIVKRMEEERTSPGGIVIPDSAAEKPIRGEVIAVGN
FT                   GKILESGEVRALDVKAGDKVLFGKYSGTEVKVEGEDVLVMREDDIMAVIEG"
FT   gene            304507..306165
FT                   /locus_tag="TK90_0292"
FT   CDS_pept        304507..306165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0292"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: aeh:Mlg_0019 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70807"
FT                   /db_xref="GOA:D3SD62"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD62"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADC70807.1"
FT                   /translation="MSAKEVRFGNDARTRMAKGVNTLANAVKVTLGPKGRNVVLDKAFG
FT                   APTVTKDGVSVAKEIELDDKFENMGAQLVKEVSSQTSDAAGDGTTTATVLAQSIVREGM
FT                   KAVTAGMNPMDLKRGIDKAVKSATEELKKLSKPCTEHKAIAQVGSISANSDTAIGEIIA
FT                   DAMDKVGKEGVITVEEGSSLENELDVVEGMQFDRGYLSPYFINNQQNMSAELDDAYILL
FT                   FDKKISNIRDLLPILEGVAKSNKPLLIIAEDIEGEALATLVVNSMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAVLTGGQVISEEVGLSLEKTTVEDLGRAKKVQVTKENTTIIDGMGQNK
FT                   DIKARVDQIRTQIEEATSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALLRACAAIAKLKGENDEQTAGVNIARRAMEEPLRQIVYNT
FT                   GEEPSVILNKVLEGKGNYGYNAASGEFGDMIEMGILDPTKVTRSALQNAASVAALLITT
FT                   EAMVAELPKKDDGGAGGGMDDMGGMGGMGGMGGMM"
FT   gene            306578..307219
FT                   /locus_tag="TK90_0293"
FT   CDS_pept        306578..307219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0293"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: har:HEAR2583
FT                   putative outer membrane protein 3a (II*;G;d)"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70808"
FT                   /db_xref="GOA:D3SD63"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD63"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADC70808.1"
FT                   /translation="MNHKLVKNILAASVATLLIGTASQAVAQEPPAANVTDRSGNVVMD
FT                   RSGECVRTRSWAPENVRHSECAGYIQETAEAPEPDPAPEPEPEPEPEFETTTLSAQALF
FT                   DFDSADLRPEGRDALRELARSLTADDVEYSSVLVEGHTCTIGPADYNQGLSERRAQSVA
FT                   DFLASEGVREDDIRTVGYGEDRPTADNSTREGREANRRVEVTSDVRQRAD"
FT   sig_peptide     306578..306661
FT                   /locus_tag="TK90_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            307409..307909
FT                   /locus_tag="TK90_0294"
FT   CDS_pept        307409..307909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70809"
FT                   /db_xref="GOA:D3SD64"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD64"
FT                   /inference="similar to AA sequence:KEGG:Tbd_2569"
FT                   /protein_id="ADC70809.1"
FT                   /translation="MNLHTFKLRKGIRLAGLTVVLVLGGMLLSGAASAHGIERATDLQS
FT                   LAQNGDGKPTLIMFASTSCPYCDRAEHQHLGPMSEDASYEGIHIRKVILDREEVRDFDG
FT                   QVRRGHELGRAYGARVVPTIMAFDAEGNPVGEPLVGIPNEQLYRSQIRQRIQQAIRHNG
FT                   GSS"
FT   sig_peptide     307409..307513
FT                   /locus_tag="TK90_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 35"
FT   gene            complement(307941..312089)
FT                   /locus_tag="TK90_0295"
FT   CDS_pept        complement(307941..312089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0295"
FT                   /product="protein of unknown function DUF490"
FT                   /note="PFAM: protein of unknown function DUF490; KEGG:
FT                   abo:ABO_0741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70810"
FT                   /db_xref="GOA:D3SD65"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD65"
FT                   /inference="protein motif:PFAM:PF04357"
FT                   /protein_id="ADC70810.1"
FT                   /translation="MRRLGKALLWLIGGVLLLLVLAVGSVVALLASENGTRWLAEQAER
FT                   HAPVDLRIERVEGTLFTELAIHGLYLSLPDGPHIELDEGLLSIDARAGLRGELRIPVVH
FT                   ATGLLIDLPPEAIDDDEEPFELPDAIRLPLAVQLEDVLLSDLRVYREGTPLVAITQIAA
FT                   RARASGALIELQQLDLDMPEIQAQLQARVETEGDYAVTAQGTWTAPLPDAVAEGLDTSE
FT                   AQGRLDLDGHLRERLRLHHALSAGVDLTLQAEVVNALGDPRFDVEATWTPFAYRIAPDR
FT                   TAHVATGRLHASGEPGDWSLGLDGGARLDELPAIELVLQAHGDLSMAEIETLRLDSGAG
FT                   RLTLAGPVRFDEALDWDLQLALDDLDPTPLGLEMDAGLERLRANLQGRLPLDTEQTPLA
FT                   ALEAAIDIHELRGYFEDHVLTGQLGLTLADGTARLRESQLNVDEDALTATLSGQAAGLG
FT                   GDLADPEHALDLEMDLALTAPDLARLQEELEGHLEQLRIAVSGRYTPASGQLQAQLHLD
FT                   PLRAESHGIGVTGDGRVDLTETGARIDRLRLAMDDGGRLDLAGDVGWAEGLDWDLALQA
FT                   EALDPAIITPEAPGRLDLTLTTRGRQAEDGVLHLQAELERLTGTLREQPVEGHGRAELE
FT                   GDALTVEQLELALGANTLSAQGRWTEVLDFRLRVDAPELHQLWPDLAGQLNLDAHVTGS
FT                   PEAPQVAAEGDGAGLRLGNIALARVQLSAEAGLAEDAPARLDLRLEDLEPATGIHLASV
FT                   RLGATGTIDDHRLDLDVDGQELGTLALALTGGFDLETTHWSGRLTRLDMTQPQAGDWSL
FT                   PAPVALEGGPESARLERLCLTREGGRICAEGRWQEATGGDFSALLEDLELGWLEPLLPP
FT                   ELGIEGQINAEASGRLDGEGRIDADLAVRPTDGRLMVRDEDGELQDVPYRDAYLDARVR
FT                   DRDVDVGFRLGFLDGGIARATLELRPDGDDMRIDGDLEARLDDLSWIAAASPDIQRLRG
FT                   VLDARLTFGGRLDAPLVEGAVRFTDGGVLIPDAGIDILIPEVTANVVSAEEMTLDGRLE
FT                   SGDGAIDLAGRVDLGDDGPRAEMQLRGEDFLAVSRVDAEATITPDLELVFTPEDGIRVR
FT                   GEVLLPWARIRPPDLPPGAIRVSGDEIILGEELEEAQALKTDIRIRIRLGDDVRFDGHG
FT                   LTARFAGEVDVEEIAGRPTQLFGEIRIPEGRFNAYGQDLRVDRGILLFQGPAETPELDL
FT                   RAVRTVREYNVTVGLEIGGTPDNLRSRVFSEPAMDETEAMAFLLTGRPLSGASESDGNM
FT                   IASAAAAYGLEQSALITQRIGTELGLDEVTIDTEGGIEESALTLGLYLSPRLLLRYSVG
FT                   LFDNTSRVLLSYELSRRLTLETSSGTTEQTVDLIYRIER"
FT   gene            complement(312086..313876)
FT                   /locus_tag="TK90_0296"
FT   CDS_pept        complement(312086..313876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0296"
FT                   /product="surface antigen (D15)"
FT                   /note="PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: abo:ABO_0742
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70811"
FT                   /db_xref="GOA:D3SD66"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD66"
FT                   /inference="protein motif:PFAM:PF01103"
FT                   /protein_id="ADC70811.1"
FT                   /translation="MTLFSRPHPFSLSHAHAVRQVRWIGILLVLLAFPLAADEDDGPVP
FT                   GLVLEGGTEFQRENIRNSLNLARQPCDLPGFRERRLLRDTKERARNALRAVGHYDAELD
FT                   LSLEHDDDGCWDLHLTFDPGPPTTVETIDIQVTGEGVGDLAFEAVLSQTDIQEGDVLRH
FT                   DRYDTLRNRMTRIAADRGYFDADLHTRRLEVDRENRTATIRLHMDTGDRYRIGRVTLDQ
FT                   DILAPEFVERMIPFEEGDPYSSSQIIALQRNLNDSGYFSGVRVRPLRDQAEDRHVPIVA
FT                   EFEPRRRHSYEAGIGYSTDIGPRLRFRFENRYANQLGHRYHAELEASPVRSGVGFNYAI
FT                   PLRDPLREQLNLFTTYRTEDTDTQQSDRFQVGANRVLQRTGGWQTTEGLRYEYEDYTVG
FT                   EETDRSRLLIPSYRIGRMEADDPMTPRRGYRFDITVQGAQEELLSSTSFAQVLASGKFV
FT                   RAIGPGRVLARADAGFTEVDSVRDLPSSLRFFAGGDASIRGYGYQKVGPTNEDGDVIGG
FT                   RHKVVGSLEYDIPVRGNWSAAAFVDAGNVVNEWTEFDPVYGVGMGVRWRSPVGPIRVDI
FT                   AHGPDSDDDFRIHFSMGPDL"
FT   gene            complement(313972..315087)
FT                   /locus_tag="TK90_0297"
FT   CDS_pept        complement(313972..315087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0297"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: eba:ebA4892
FT                   transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70812"
FT                   /db_xref="GOA:D3SD67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD67"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC70812.1"
FT                   /translation="MTQAATSNAAIQVAHTPLLELDDIDIGYDGKAVVHGVSLALPEGQ
FT                   IGCLLGPSGCGKTTLLRAIAGFEPVMRGAIHLGGRAVSEPGHTVPPERRGVGMVFQDFA
FT                   LFPHLSVADNIAFGIRDWSRDARADRVQTLLKLVGLPGYGEAYPHALSGGQQQRIALAR
FT                   ALAPKPALLLLDEPFSSMDVELRGDLAREVRRILRAEHTTAILVTHDQHEAFAFADRIA
FT                   VINQGRIAQWDTAYNLYHRPADRFVANFVGEGTLIPGMVCTEDRVDTAFGELQGSMSEH
FT                   LPPGTAVDVLVRPDDIAIDNEQGTVQTEILDKAFRGADFLYTLKLPDGISVLCMAPSHD
FT                   NFVIGEHVRLRLDFTHLVVFSRGSGVDCPSV"
FT   gene            complement(315089..316858)
FT                   /locus_tag="TK90_0298"
FT   CDS_pept        complement(315089..316858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0298"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmw:Mmwyl1_3753
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70813"
FT                   /db_xref="GOA:D3SD68"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD68"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADC70813.1"
FT                   /translation="MSAQPSNPALPATRTISWGRPRLSFSLWSVVAITVALVLALPVLV
FT                   IFGHVFIPAGEVWEHLRQTVLADYVTNSLALVVGVGIGVLLIGVPVAWLVSMCEFPGRG
FT                   IFQWALMLPLAMPAYIIAYTYTGMLDFSGPVQSLIRDLTGLGYGEYFFPEIRSLGGAMV
FT                   MLMLVLYPYVYLLSRAAFLEQSVCVLEVSRTLGQGPFGGFRRVALPLARPAIIAGLTLA
FT                   LMEVLADYGTVAYFGISTFTTGVFRTWYGLGDPAAAAQLSAVLLTFVFILIVLERWSRA
FT                   KARFHHTSRRYSTLPRYRLQGWKAAAAFTACLLPVVLGFLLPAAQLSIWAAQTTDHWMN
FT                   ARFAELVFNTFWLAVAAAVIAVVLALVLAYAKRMQGGPFTNLAVRVAGMGYAIPGTVIA
FT                   IGVMIPFAAFDNALDGFMRDTFGLSTGLLLSGTVFALLFAYAVRFLAVSLQTVEAGLGK
FT                   IQPSMDDAARSLGMRPLQTLTRVHLPIMRGTLLTALLLVFVDVLKELPATLILRPFDFN
FT                   TLAVRAFELAGDERLAESSSAALAIVLVGLVPVILLSMTIGRSRPGQGAPNQRPDAEAD
FT                   APQKPLPMPAGTT"
FT   gene            complement(316986..318023)
FT                   /locus_tag="TK90_0299"
FT   CDS_pept        complement(316986..318023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0299"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ilo:IL1059 ABC-type Fe3+ transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70814"
FT                   /db_xref="GOA:D3SD69"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD69"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADC70814.1"
FT                   /translation="MSFRPLSWLVMAAAAVAVSMPLVGCSPADEDEVNLYSARQENLIQ
FT                   PLLEQFTEETGIKVNLVTGSADSLLQRLRHEGRNSPADVLITVDAGRLHHAQQAGVLQA
FT                   VESDTLNENIPERYRDPEGEWYGLSLRARPILYHKDRVDPDDLSTYEALTDEQWEGRIC
FT                   IRSSDNVYNQSLVAAMIATEGAEAAEAWAEGIVNNMARRPQGGDRDQIRAVADGVCDVA
FT                   IANTYYLGLMLDGDGSDRDVAEQIGVFWPNQDDRGTHVNISGAGVTAHAPNRDNAIRLI
FT                   EYLTSQEAQEWYAEANQEYPIRDDVPASEILQGFGEFKSDDIELHLLGDNNSEAVRIMD
FT                   RVRWR"
FT   sig_peptide     complement(317949..318023)
FT                   /locus_tag="TK90_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.742 at
FT                   residue 25"
FT   gene            318162..321089
FT                   /locus_tag="TK90_0300"
FT   CDS_pept        318162..321089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0300"
FT                   /product="(Glutamate--ammonia-ligase) adenylyltransferase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   GlnD PII-uridylyltransferase; KEGG: aeh:Mlg_2698
FT                   (glutamate--ammonia-ligase) adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70815"
FT                   /db_xref="GOA:D3SD70"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD70"
FT                   /inference="protein motif:PRIAM:2.7.7.42"
FT                   /protein_id="ADC70815.1"
FT                   /translation="MDKPLPETPEALPPFLEEEVGHLLQDLGEKAAWPGSLSGQAATPL
FT                   AFSHYLAQMVRRHPDYLLDSLDDEGRVPERDDDAFAAMLRTALEDVDSEGQLKRALREI
FT                   RHREMIRIGWRDLEGRAGLDEVMHDLSRLAQGLIRGALGWLDRHYQRRHGQPRGGDGAA
FT                   QSLVVLGLGKLGGGELNFSSDIDLIFAYAESGETDGERVLDNGAYFQKLGRALIAALSE
FT                   VTADGFCYRVDMRLRPFGDSGPLVMHFDAMEDYYQAHGREWERYALIKARPLAGDAAAG
FT                   DALMKRLRPFIYRRYLDYGTLANLRELKQMINDESARRGRYEDVKHGEGGIREIEFIAQ
FT                   SFQLIRGGRDQALQRRDLLGVMEVLRARELLPGYAVDQLERSYRFLRRVENRLQMLNDQ
FT                   QTHRLPRSAGDRTRLALSLGFDSEVTFEAALVREQRRVHAHFEQVFTAPQRDDAETMDS
FT                   SPEADREQQLHRLWQGSLDDDVAREVLSSLGFDDSGAALEGLVALRESPGVRAMSTTGR
FT                   QRLDRLMPLLVGALAELDAPDTVLPRALQMVRTIARRSVYLSLLVENPLALSQLVKLVA
FT                   ASPWISEQLTRFPVLLDELLDPRALYAPPDRDGLREELEAELAQFPGEDHEQMLDRLRQ
FT                   FKQVQTLRVAAADIMGFLPLMKVSDHLTWLAEVMLERVLQLAWDKLVERHGEPRCGEGD
FT                   DLRPARFAVIGYGKLGGFELGYGSDLDVVFLHDSEGEEAQTVGPKAIDNAEFFARVAQR
FT                   IVHLLGAFTPAGRLYEVDTRLRPSGTSGLLVSGLQAFRRYQDESAWTWEHQALVRARFV
FT                   AGDAELGKEFDALRREVLTRERDAVALRTEVIEMRQRMLAEHASKKGQGFHLKRDRGGI
FT                   TDIEFMVQYWVLVSAHDHPAVCDWPDKIRTLDALGCEGVISEDLSEALADAYRDLRNRI
FT                   HRLTLAGRDARVEEPDEELLAVRDRVIETWNDLFGAPDSVANKNA"
FT   gene            321103..322023
FT                   /locus_tag="TK90_0301"
FT   CDS_pept        321103..322023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0301"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: hna:Hneap_2135
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70816"
FT                   /db_xref="GOA:D3SD71"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD71"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ADC70816.1"
FT                   /translation="MSMADRDGVIWLDGQMVPWREAQTHVLTHTLHYGMGVFEGVRAYK
FT                   TGRGPAIFRLQDHTRRLFNSAKILGMTIPYSADELNDAQVASVRDNGLESAYLRPMCFL
FT                   GSEGMGLRADNLKVHAMVAAWHWGSYLGDEGMEKGIRIRTSSYSRHHVNVTMCKAKANG
FT                   NYMNSMMALQEATRCGYDEAMLLDTEGYVAEGSGENIFLVRDGVLLTPDLTSALDGITR
FT                   RTVITLAEEEGLRVVEKRITRDEVYIADEAFFTGTAAEVTPIREVDDRPIGSGTRGPIT
FT                   ERLQSRYFDVVQGRDRQHDGWLTYL"
FT   gene            322326..322550
FT                   /locus_tag="TK90_0302"
FT   CDS_pept        322326..322550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0302"
FT                   /product="Zinc finger, CHCC-type"
FT                   /note="PFAM: Zinc finger, CHCC-type; KEGG: nmu:Nmul_A1061
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70817"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD72"
FT                   /inference="protein motif:PFAM:PF10276"
FT                   /protein_id="ADC70817.1"
FT                   /translation="MVNPDTAHHQDQYETANAQPEITVTKKDLPLHCPTPKMALWASHP
FT                   RVFLPIDETPDGRFQCPYCGTQFILKGDA"
FT   gene            322627..324060
FT                   /locus_tag="TK90_0303"
FT   CDS_pept        322627..324060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0303"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM: PfkB
FT                   domain protein; cytidylyltransferase; KEGG: aeh:Mlg_2810
FT                   bifunctional heptose 7-phosphate kinase/heptose 1-phosphate
FT                   adenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70818"
FT                   /db_xref="GOA:D3SD73"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD73"
FT                   /inference="protein motif:TFAM:TIGR02198"
FT                   /protein_id="ADC70818.1"
FT                   /translation="MKLSLPPFDQARVLVIGDLMLDRYWHGGTDRISPEAPVPVVHVRE
FT                   IEQRPGGAGNVALNLAALGGHADLVGITGEDEAASELAGLLEGAGVACHFRRQPGAATI
FT                   TKLRVISRHQQLIRLDFEDGFPGIRASDLLPQMEPLLTGAGAVVLSDYAKGALREPQPL
FT                   IEVARAAGVPVLVDPKGRDFSLYRGATLITPNLTEFEAVVGRCADEADLVARGEALARD
FT                   CGIDGLLVTRGEDGMSLIRPGHAPVHLGARAREVFDVTGAGDTVIATLAAGLATGLELP
FT                   QAMALANIAAGIVVAKLGTATVSVAELRRALQDQEQTGRGVLTEDELLHAVADARVHGE
FT                   RIVMTNGCFDLLHAGHVAYLERARSLGDRLIVAVNDDDSVRRLKGEGRPVNPVEQRMAV
FT                   LAGLASVDWVVPFSEDTPARLIGEVLPDRLVKGGDYRPQDIAGHDAVVAHGGRVEILDF
FT                   LDGCSTSSMIERMRKPAGS"
FT   gene            324149..325102
FT                   /locus_tag="TK90_0304"
FT   CDS_pept        324149..325102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0304"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   aeh:Mlg_2809 ADP-glyceromanno-heptose 6-epimerase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70819"
FT                   /db_xref="GOA:D3SD74"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD74"
FT                   /inference="protein motif:TFAM:TIGR02197"
FT                   /protein_id="ADC70819.1"
FT                   /translation="MIIVTGGAGFIGSNLVKELNRRGRTDIVVVDNLTHGQKALNLTDC
FT                   IIADYHDKEDFRDLIEADAHLGPVEAVFHMGACSATTEWDGRYIMRNNFAYTRELFHWC
FT                   QDRRIPFIYASSAAVYGGNDTFREEPAHERPLNAYGYSKLAFDQYLRRHMDALTAQVVG
FT                   LRYFNVYGPREGYKGGMASVIHHFSNQLREGDTVRLFEGCDGYADGEQRRDFVDVRDCV
FT                   NLKLWLLEHPEVNGIYNCGTGRARTFNDMARATIDWFGRGEIEYIPFPDHLKGRYQSYT
FT                   QADLSQLRAAGCDLEFHDIEDGVRAYLDAVAVDQAD"
FT   gene            325118..326038
FT                   /locus_tag="TK90_0305"
FT   CDS_pept        325118..326038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2808 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70820"
FT                   /db_xref="InterPro:IPR021266"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD75"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2808"
FT                   /protein_id="ADC70820.1"
FT                   /translation="MSDQPLHRVRADEYESPGDRLERSLEEGRVLLFEPGRLPLPDEED
FT                   LVFLRDEVGRLLSLKNISYHPHGDFISGLKNEGDAGERVRRILSEYGQRVEGFLGHLLP
FT                   GFTSGWSPRKVNFRPVQEKGRVIKRHSNNELLHVDAFPAGATHGWRPLRFFTNINPEEA
FT                   RIWRVAEEFGELYRQFGAAAGIAPPPRLRQGLAERAWTGSLRALSALNLPQLEVVGDTS
FT                   PYDRAMRRMHNWMKDSDDFQNAPGRGTELAFEPYHSWCVLTDQVSHAALAGQHALVATF
FT                   YVRPEACHMPERSPWGVLEAAGRAA"
FT   gene            326077..326787
FT                   /locus_tag="TK90_0306"
FT   CDS_pept        326077..326787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0306"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: aeh:Mlg_2807
FT                   3-deoxy-D-manno-octulosonic-acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70821"
FT                   /db_xref="GOA:D3SD76"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD76"
FT                   /inference="protein motif:PFAM:PF06293"
FT                   /protein_id="ADC70821.1"
FT                   /translation="MLFDAALPASPEPWWFDFDALERRGLVTGRGGGRGSVVFFHSPLE
FT                   SDDEWVLRHYMRGGTIARILGDRYLWQGVDDTRPWREWSYTARLFEEGLPVPRPVAGRV
FT                   VRTGPLYAADLITVRVPGARSLDENLGEAGVSDATWRAIGGCIRRFHDAGHWHPDLNSR
FT                   NILIAPDGAVSIIDWDRGRHRAGTDGDWREANLQRLRRDLDKRLRIRDRWVYTDVCFDR
FT                   LRAGYEAGAISGEG"
FT   gene            complement(326754..327878)
FT                   /locus_tag="TK90_0307"
FT   CDS_pept        complement(326754..327878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0307"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   aeh:Mlg_2806 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70822"
FT                   /db_xref="GOA:D3SD77"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD77"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADC70822.1"
FT                   /translation="MRPRLPLNEPPASLCILRFSALGDVTHMTPVVRTLQREWPQTRLT
FT                   WVVGKAERALVGDIPGVEFVIFDKTAGWAGYRALWQQLKGRRFDVLLHNQFALRANIAS
FT                   LGIRAGLRLGYDRARSRDLHGLFINARIPPHPGQHVIDIYFSFIETLGIRRRHMVWDIP
FT                   VPDNAAERARDEIPDGTPTLVISPCSSHHLRNWTAEGCAQVADHAAREHGLQVLITGGP
FT                   SALEREMGEAVARQSQLAHRNLVGATSIKEMLAILGRATAVVSPDSGPAHMANAMGTPV
FT                   IGLYACTNPGRARPYYSGQWCVDRYDEAARRELRKPASEIRWGTKIERPGVMELIRPED
FT                   VIERLDALMAAGAPRALPPAETTVHPSPEIAPAS"
FT   gene            complement(327886..328854)
FT                   /locus_tag="TK90_0308"
FT   CDS_pept        complement(327886..328854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0308"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   aeh:Mlg_2805 lipid A biosynthesis lauroyl (or palmitoleoyl)
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70823"
FT                   /db_xref="GOA:D3SD78"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:D3SD78"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ADC70823.1"
FT                   /translation="MPKPKSAHPAHPSNWGYSLGIGLLWLLGQMPPRLVLRLGEALGPV
FT                   SYALARQRRLIIRRNLELCFPEQSKLEREALVRENFRHTTRGFMELALSWFGGRAVDRL
FT                   PLQVEGLEHLEAERRAGNPVILLSGHFTSVEISGRLLRQLSEMAVIYKPMDKHPLADAT
FT                   MRHGRERAIGPVLSKDDLRGIVRTLRKGLPVWYAGDQNYRSQQKVFVPFFGTPAATVTG
FT                   LSRLARMARARVIPIFYYKLDDGPGYRVVFHPPLRGFPSGDDTADAATMNRIIEEAVRE
FT                   APGQYFWAHRRFKDQPDTTADMYPGVKDHRRDRRQRRQGSS"
FT   gene            329170..330000
FT                   /locus_tag="TK90_0309"
FT   CDS_pept        329170..330000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0309"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="KEGG: aeh:Mlg_2804 Mn2+-dependent serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70824"
FT                   /db_xref="GOA:D3SDK4"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDK4"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2804"
FT                   /protein_id="ADC70824.1"
FT                   /translation="MNSVSTEFPSPTKAALEAAAAAARGRAFRVREDGQQWFAKKAVPG
FT                   RSRIRALGGRMLARLMLGEWPSLSPLMLGGQEQIEYEAARLRALREAGEAVPAVVSLQP
FT                   GYLVLAEGGQPLGRVLRDKTREAQAALLCWVAQDLARFHGRGLWHGGAQLRNHLLANGE
FT                   RDLVRIDFEEPLDRLMPLAARQVVDLYLLIHSTTALKGYSEAAMRALCGRMVRAYLDVR
FT                   APEPAALEYLERGRRVLGALETWGGWFARPVSKDARRLFVTSAVLAEVVPQGGV"
FT   gene            complement(330020..331798)
FT                   /locus_tag="TK90_0310"
FT   CDS_pept        complement(330020..331798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0310"
FT                   /product="lipid A ABC exporter, fused ATPase and inner
FT                   membrane subunits MsbA"
FT                   /note="KEGG: aeh:Mlg_2803 lipid A ABC exporter, fused
FT                   ATPase and inner membrane subunits MsbA; TIGRFAM: lipid A
FT                   ABC exporter, fused ATPase and inner membrane subunits
FT                   MsbA; PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70825"
FT                   /db_xref="GOA:D3SDK5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDK5"
FT                   /inference="protein motif:TFAM:TIGR02203"
FT                   /protein_id="ADC70825.1"
FT                   /translation="MGNRSIDQNPKHPTAGESWQLYKRIFAFVRPYWRLGVLAIAAMIL
FT                   AAAGQAAFAWIIQPLVDGTFIEQDPTARVWVPAALIGIFLFHGITMFASDYSVAWIGRK
FT                   VVKDVRQAVFEQYLRLPAAFFDRHSPGTLLAKLTYNVTQINAAASKAIIVLIRDSFTVI
FT                   FLLAYMTYLSGWLVLIVFSIAPLVGLVVVGANKKFRKVSRRMQKSVGDYAQIAEDGIRG
FT                   QAEVKIFGATDYEAHRFERTNERYHRQLMRHKAVQAISQPLSQLGAIIALAIIVYLATM
FT                   DMVLQTITPGGMISFIVAMLLMLPPLKRIVGVNAEIQKALAAGESVFEILDTPPEPDHG
FT                   QRPLDHAEGRIEFDHIWLRYPQQSEWVLKDVSLNIAPGETVALVGRSGSGKTSLARLLP
FT                   RFYEPEQGEIRLDGYPIREYRLRDLRSQMALVSQHVVLFNDTLANNIAYGLPEKPTDDQ
FT                   LREATRAANALEFIEQLPEGFDTVVGENGIMLSGGQRQRVAIARALLKDAPILILDEAT
FT                   SALDSESEQKIQDALEVLMRNRTTLVIAHRLSTIEDADRIVVLDAGQIVETGTHAELLE
FT                   RNGAYAALQKVQFAED"
FT   gene            332003..332842
FT                   /locus_tag="TK90_0311"
FT   CDS_pept        332003..332842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0311"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   aeh:Mlg_2801 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70826"
FT                   /db_xref="GOA:D3SDK6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDK6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC70826.1"
FT                   /translation="MSSHTIVPGRISISIPHWQVLPLLLPCLRSIRKNTSGKDVEVIVI
FT                   DNGSKDESLDYLRSLEWIRLIERPEEGLFNFPDNVWTSHDIALKEATGEFLVTMHTDLF
FT                   VKRGDWLDEYLKAMAGNPRLGGVGTWKLELKNPVYEFQKRVFHVIRSNIKYALGLRKKR
FT                   YEWKQGHYPKDFCAMYRRQILLDEGLTFRSIEGKKGFYDQSGGYSISAQLWDKGYPTRV
FT                   IPVRTMIPRIVHLGHGTAAVSPEKAHRRNQHKLETRRDTLFDEPWVQELQSNVALDR"
FT   gene            333099..334268
FT                   /locus_tag="TK90_0312"
FT   CDS_pept        333099..334268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0312"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eta:ETA_00820 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70827"
FT                   /db_xref="GOA:D3SDK7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDK7"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC70827.1"
FT                   /translation="MNLHFVRLNVLGGVERILTELVQRAALCDRKEAAFLLATSVHPFL
FT                   REAWSEHGCRAYPLKAFAQWFPVPRKPASARDFRARWVARAVRPNRVISWNGINSRFPG
FT                   IAASASGARLIHYEHGAAWNCSDDQGMRYLAGVDSVVCISLAAKRLLQERWGYKGEVHV
FT                   LPNVLLPSMLKTAAGGRPDSGGRKIVGAAGRLVPLKGFLSLVPMLRRLLDKGLDVEVRL
FT                   AGTGPEGPAIRALAEKYNVSDRFVFLGSVGEMSEFYRTLDVFVVPSIREPFGLVALEAS
FT                   AHGLPVIGSDVDGIPEALSEVVGSDVVRPTVPMSDYAQMGSSLRGVPTRVYDPAGDFLT
FT                   APRAIDGAELADRVETLLTAGVVVPPMHPSVAASRFFAYADTLKGLLSR"
FT   gene            334332..335528
FT                   /locus_tag="TK90_0313"
FT   CDS_pept        334332..335528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0313"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eta:ETA_00820 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70828"
FT                   /db_xref="GOA:D3SDK8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDK8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC70828.1"
FT                   /translation="MRIFHIVNLKTVAGIERAFCAFVSAEKMSSMQHYVASRGVSSRLA
FT                   GTLHKNCERVFTPGVWRGSRFPLVPRRGIDREIKKRLSEVNPDVVISWSSATSVSALDW
FT                   CARSNTPFIYWEHGRAWEEASRPSRVYATLLEQADRIICNSSASARMIGHFWRQGGKTT
FT                   VVPNGLRPECSVAAPVVREFEGDAEVTVGFAGRLVPAKGAVVLVHALGLLRKSGVPVTL
FT                   RIAGEGPEKEGIVAQIRRLGLSDVSMVVGFEDDMSRFYRGCDLVVCPSIREPFGLVSIE
FT                   AQASGRPVIVSEVDGLPETIDVEKTGLAVRPSEAVGYLESLGGSTSPLPEFSYFPDRDV
FT                   IGPPRVVSADDLAESIAKMITSPDFSKMSRRAASFAREEFSFDVHVSRVCKVLHDVVG"
FT   gene            335533..336726
FT                   /locus_tag="TK90_0314"
FT   CDS_pept        335533..336726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0314"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: aeh:Mlg_2800
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70829"
FT                   /db_xref="GOA:D3SDK9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDK9"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ADC70829.1"
FT                   /translation="MTKVSEFTRQWTADGYFLVAYLLFCSGFVFLSSSGGHSTIYALLV
FT                   VAPFLAVVRREHFGFLRESGLLTLILVLLVYFWASVAWGEGGDIDDYRRYGWRAFMVLV
FT                   FVWVTVRLALNYDRFVWWVVLVVAGSVFLSSLVALQAYGVGSLFDLRRLSGLGRVSNPN
FT                   QFGALLGFSVILIAGCLIGWTRGRVWTAVLWIVGGTLLAAAVLTQGRGTLVGLLCGLSL
FT                   MFVLTRRWMALLGIALLGALVLWLFGGGGLEARGFLDRTSAIEMRLELWKAGLALIKEA
FT                   PVFGHGMAFSQSYQVGSYQTGSVHNLYIGIAVVGGLVGAALLVGSLLYGMWVAVREKSP
FT                   ISPLVVGLIGFSMVYYMVEFEHIVRYPALSWLLIWFPLALAVSVEIRARRAKAAVQS"
FT   gene            complement(336723..337754)
FT                   /locus_tag="TK90_0315"
FT   CDS_pept        complement(336723..337754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0315"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   aeh:Mlg_2797 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70830"
FT                   /db_xref="GOA:D3SDL0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL0"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ADC70830.1"
FT                   /translation="MKTNNQSAVLVMLDRHLGNFLVASPVLRHLARQFQTAQLILHSPH
FT                   AALAQRIPGLPKPHLISAARDNLWSRARLFHQTLSAIRQHRPQMVIDFGGSKTAALAGG
FT                   LSRATWRICHQGAPHARLYNRHADPGGLGHHRIDTYGALAAAAGHGYGWGHPSLQATEE
FT                   DHADLASRGLGDPGDIVCLHVAGGKGYKHWPLEKYARIIDWLANQGLRPALIGAAPDRL
FT                   AANQVLEHCQQRPLDLVEQLPIGTLIALLSQCQLFVGNDSGPMHVAAAAGSPVVALFGP
FT                   TDPSRWGPLSNRTTIVRGTQAVAPGQGKSAYAEGRTMESISLDSVLAAIAQQLETNTPS
FT                   LFN"
FT   gene            complement(337751..338569)
FT                   /locus_tag="TK90_0316"
FT   CDS_pept        complement(337751..338569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0316"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: aeh:Mlg_2796
FT                   Mn2+-dependent serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70831"
FT                   /db_xref="GOA:D3SDL1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL1"
FT                   /inference="protein motif:PFAM:PF06293"
FT                   /protein_id="ADC70831.1"
FT                   /translation="MDRLVRISGNRKAHGLPSSTVATRLSTGDWPPADHELRVIKRNRK
FT                   VVSGFLQTAQQNLPGLFFKHYLTRPSLFSRRAAKRIWRINWSLHNQGVPVPRPHALITG
FT                   NSGVWFITEAIEDAAALTERLADNALTPGQMQTVTIEATRAIAHMHSLGVIHGDLKWGN
FT                   ILVTEELTPVLVDLDSARQRWRVSARAGAKDLARFIVGGLEQGLNTAWAARICSVYCET
FT                   RVLSETTIYETMRPVVRRISLRHQRRYGRRPVSLDTDPEYPPNDNVPNSK"
FT   gene            complement(338570..339406)
FT                   /locus_tag="TK90_0317"
FT   CDS_pept        complement(338570..339406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0317"
FT                   /product="Mn2+dependent serine/threonine protein kinase"
FT                   /note="KEGG: aeh:Mlg_2795 Mn2+-dependent serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70832"
FT                   /db_xref="GOA:D3SDL2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL2"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2795"
FT                   /protein_id="ADC70832.1"
FT                   /translation="MIRHHIFKSLGFAPRYLAATNRCPELAAVANAIACSRQFDGWRVL
FT                   SSSAQTRVAKGEWNERPVFLKLFIPRSRSEPVKALVRGSRGVRAVDQSIRMNESGFATP
FT                   TSLCHGWIRGSIEYVATDALPHPTVNDLATHEGGAIALGTRERWQLLNLVGAEIARLHT
FT                   AGWIHGDLRLGNILCEWHGPDGAPKFWYLDNEGNRRSRRTSDRMRNLVQLLMTPRNLLS
FT                   RFDQYRLLQGYAKAQELSREQSRTLARAVEQARTRRWKRRLARGGPKARYSSQASD"
FT   gene            complement(339403..340266)
FT                   /locus_tag="TK90_0318"
FT   CDS_pept        complement(339403..340266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0318"
FT                   /product="lipopolysaccharide kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: aeh:Mlg_2794
FT                   lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70833"
FT                   /db_xref="GOA:D3SDL3"
FT                   /db_xref="InterPro:IPR017172"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL3"
FT                   /inference="protein motif:PFAM:PF06293"
FT                   /protein_id="ADC70833.1"
FT                   /translation="MSVLRRNELVMDDAFRAALTARCGPGDPFEQAMALDGEVVRNVDG
FT                   RRTFRFELGGQHYFAKVHNGMPWRRILRKLSQFRIPVLGAEPEWRAIHRLQELGIPTTP
FT                   PVAFGIRRGLNPARERSFVITRDLGRTRTLEQECLSWPEQPPAFAFRLQLIREVARIAR
FT                   TLHGSGMNHRDFYLCHFRLDLNTNEDATRSGRIPPRLHLMDLHRVQHHRRLPARARIKD
FT                   LGGLYFSALDIGLGHRDLLRFIREYRHSSIRVTLNSDSTLWQRVTQRARWQYQREHGRV
FT                   PEGLPR"
FT   gene            complement(340263..341399)
FT                   /locus_tag="TK90_0319"
FT   CDS_pept        complement(340263..341399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0319"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   aeh:Mlg_2793 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70834"
FT                   /db_xref="GOA:D3SDL4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL4"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC70834.1"
FT                   /translation="MHLAFVLFKYFPHGGLQRNFRRITELALERGHQIDVFTLAWEGWT
FT                   PEHPQLKLHVLRVPGWRNHTRYRHFARRVQSEVQALQPDRVVGFNKLPGLDVYYNADPC
FT                   FIERAQARSRFYRLSGRYRVHAALERAVFRTEANNRILLLSEAEKPLFQRWYATPEDRF
FT                   HLMPPYVSADRFANADTPQRRRALRKELGLGDDSLMLLMVGSDFRRKGVDRSIRALAAL
FT                   PDGLRERASLYVLGKGRAAPLMRLARRLGIAGRVHFLQGRDDVADFLFAADLLLHPAYQ
FT                   ENTGTAIVEAIAAGLPALVTANCGYAFHVERAGCGEVLTTPFEQPMMDAALARMLSQPK
FT                   LQAWRDAALCYSERTELGARAEHALRVIEAPRYGETAA"
FT   gene            complement(341399..342469)
FT                   /locus_tag="TK90_0320"
FT   CDS_pept        complement(341399..342469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0320"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: aeh:Mlg_2792
FT                   lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70835"
FT                   /db_xref="GOA:D3SDL5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL5"
FT                   /inference="protein motif:TFAM:TIGR02195"
FT                   /protein_id="ADC70835.1"
FT                   /translation="MCFRAGRGIVLSSSGAHTPAVLVVGPAWVGDMVMAQSLFMTLKQR
FT                   EPAPAVDVIAPAWSLPILERMPEVRRPIPLPVGHGELALGRRWHLGRSLRYAHYQQAIV
FT                   LPRSAKAAVPAFASGIPRRTGYRGELRYGLLNDIRPLDRQRLYRTVDRFVALGHAPDAP
FT                   QPPPIPEPRLEISERGRDEARIALGLGNQDAPVLALCPGAEYGPSKRWPAEHYAEVARA
FT                   RLTAGWQVWLFGSQKDRPVTQAIAEAAPGCADLAGRTQLGQAIDLLACADLVITNDSGL
FT                   MHIAAATGRPVIAVYGSSDPGYTPPLTSHRRILHLGLECSPCFQRECPLGHLNCLRKLA
FT                   PEQVLEAADALHGERR"
FT   gene            342723..343322
FT                   /locus_tag="TK90_0321"
FT   CDS_pept        342723..343322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0321"
FT                   /product="phosphoheptose isomerase"
FT                   /note="KEGG: net:Neut_0158 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70836"
FT                   /db_xref="GOA:D3SDL6"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL6"
FT                   /inference="similar to AA sequence:KEGG:Neut_0158"
FT                   /protein_id="ADC70836.1"
FT                   /translation="MREGIIEELTAASRLFGRLAEDRAFVAEVETVGQRWLQCIRDGGK
FT                   VLLAGNGGSAADAQHIAAEIVCRYRAVRPGAAAIALTTDTSVLTAIGNDFGYEHVFARQ
FT                   VEALGQSGDVFVGITTSGRSPNVLEAFEMARQHGLVAVALTGEKGLPETHTADHVLRVP
FT                   DAATARVQEVHGLIGHLLCGIVEDALVADQDRSGSV"
FT   gene            343319..343864
FT                   /locus_tag="TK90_0322"
FT   CDS_pept        343319..343864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0322"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /note="TIGRFAM: D,D-heptose 1,7-bisphosphate phosphatase;
FT                   histidinol-phosphate phosphatase family protein; hydrolase,
FT                   HAD-superfamily, subfamily IIIA; KEGG: reu:Reut_A0723
FT                   D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70837"
FT                   /db_xref="GOA:D3SDL7"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL7"
FT                   /inference="protein motif:TFAM:TIGR00213"
FT                   /protein_id="ADC70837.1"
FT                   /translation="MSARALFLDRDGVINVDHGYVHRPDQVEFVSGIFELVAAATARQW
FT                   PVVVVTNQSGIGRGYYGDREFRQLTDWMRERFAERGGRIEAVYHCPHHPHDAQPDYRRA
FT                   CPDRKPEPGMLLRARDDLDLDLPGSVLVGDRASDLEAARRAGVGARLLFDPLGTEPLPA
FT                   EDGAIRIRALPEAIAWLD"
FT   gene            343878..345143
FT                   /locus_tag="TK90_0323"
FT   CDS_pept        343878..345143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0323"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: sbo:SBO_3635
FT                   3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70838"
FT                   /db_xref="GOA:D3SDL8"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL8"
FT                   /inference="protein motif:PFAM:PF04413"
FT                   /protein_id="ADC70838.1"
FT                   /translation="MCHIVYTALLRLAAPALLARLVRRARANAVPVARWREWLGAGESL
FT                   TPGSIWVHAASVGEVEAAVPLARALCSRYPERALLMTTTTPEGAARVEAALGSDVQHAY
FT                   LPLDLPGAVRRFLRRTRPAVALIVETELWPNLYRACEQAGVPLWVVSARLSPRSLKRYR
FT                   RLQPLVRETLARAEKVLAQDESAARGFRELGAPNARVQVMGNLKFDRALPPGHEEAGGL
FT                   RVSVAPERAPVWVAVSTREGEEEAVLEAHLVVRESHPDAVLLWVPRHRDRFDVAFAAAR
FT                   AAGLSVGRRTQCPGPPLDVLVGDTIGEIGAYLGAADAAFVGGSLVPLGGQNVLEPAALG
FT                   LPVLVGPSTEHFTFAVERLEDRGALWRVQDAESLGRAVAELLGDSECRKTMGDAARTVI
FT                   DEGRGAVERVLAELENRLHDLR"
FT   gene            complement(345171..345761)
FT                   /locus_tag="TK90_0324"
FT   CDS_pept        complement(345171..345761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0324"
FT                   /product="protein of unknown function DUF335 SprT"
FT                   /note="PFAM: protein of unknown function DUF335 SprT;
FT                   SMART: protein of unknown function SprT; KEGG: asa:ASA_1200
FT                   SprT protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70839"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDL9"
FT                   /inference="protein motif:PFAM:PF03926"
FT                   /protein_id="ADC70839.1"
FT                   /translation="MTRTASNPSHALDGTYRTGEYDKNGSKLQEPRNILTPEEEAKIRQ
FT                   KVCAFYIKACPEQPNTTPEVLFNLKGKAAGQWRLRNGHEQLRFNAQAFLQDWDAHFPET
FT                   VAHEVAHSLVYRTFGLRRVRPHGPEWRSWMEAFECEPRVTHSTPLKGRSVRTYTYRCAC
FT                   QTHALSARRHYLIQRRRYRYECLECGQRLRREK"
FT   gene            345790..346227
FT                   /locus_tag="TK90_0325"
FT   CDS_pept        345790..346227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC608731"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70840"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70840.1"
FT                   /translation="MSLDSKKASELSAEELYALARQREKEEAERQEAERRKKREKLMEK
FT                   RKEMIARHRKELNELERQIRELGGRVGRAGGGRRSGRGGSSVSQQLVEIVAEKSEMATK
FT                   EIKERAEKAGLDTKNISQTLAYLKRQGRLKSPRRGVYKSAA"
FT   gene            complement(346258..347436)
FT                   /locus_tag="TK90_0326"
FT   CDS_pept        complement(346258..347436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0326"
FT                   /product="ribonuclease D"
FT                   /EC_number="3.1.13.5"
FT                   /note="KEGG: mca:MCA2378 ribonuclease D; TIGRFAM:
FT                   ribonuclease D; PFAM: 3'-5' exonuclease; HRDC domain
FT                   protein; SMART: 3'-5' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70841"
FT                   /db_xref="GOA:D3SDM1"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR006292"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM1"
FT                   /inference="protein motif:TFAM:TIGR01388"
FT                   /protein_id="ADC70841.1"
FT                   /translation="MHDHGLIETPEALQAFLDSIAGTDWIALDTEFLREKTYYPQLCLV
FT                   QAATLDQLACIDPLRLDIQQLAPLFRDPGITKVFHAASQDMELLYRELGFVPSPVFDTQ
FT                   IAASMLGYGEQVGYANLVKTVLERDLDKSQTRTDWSRRPLSAEQIRYAADDVRHLATLF
FT                   NRLLHELDTHDRMHWLRPEMEALSNPALYEPDPEQSWQRVSGVKRLKPKERGVLKCVAA
FT                   WRERTAQSSNRPRRWVLSDDLLLDIARRTPADAQGLRELRQFPGGMKPEHTESLLAAIR
FT                   EGQALPREQWPQLPEKPRLDERDEVLVDIGMALLRECAREHQISAAAIAQRKDVIELLK
FT                   SDGKSGRLSSGWRREIAGQTIQHWFSGESRLACKPSGELDMEPVSETIAASP"
FT   gene            complement(347429..347731)
FT                   /locus_tag="TK90_0327"
FT   CDS_pept        complement(347429..347731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0327"
FT                   /product="protein of unknown function DUF1244"
FT                   /note="PFAM: protein of unknown function DUF1244; KEGG:
FT                   ttu:TERTU_2951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70842"
FT                   /db_xref="InterPro:IPR023163"
FT                   /db_xref="InterPro:IPR036810"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM2"
FT                   /inference="protein motif:PFAM:PF06844"
FT                   /protein_id="ADC70842.1"
FT                   /translation="MDPKTRTEIEAAVFQRLLQHLDERKDVQNIDLMNLAGFCRNCLSK
FT                   WYVAAAEERGESIDYEGAREIVYGMPYSEWKERYQKEATAEQKAAFEASQKSSHA"
FT   gene            complement(347831..348322)
FT                   /locus_tag="TK90_0328"
FT   CDS_pept        complement(347831..348322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0328"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: aeh:Mlg_0171 rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70843"
FT                   /db_xref="GOA:D3SDM3"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM3"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ADC70843.1"
FT                   /translation="MNRALGIPWLIALTLVVALALSIVPIPDALPPARPEWLLLALVYW
FT                   IMAFPQRFGVLTAFIMGLLLDALYGQLLGQNAIALAVVAYIVLQIHPRLRVYPVWQQTI
FT                   VVAVLTALYKLLALWPQGAIGLPPGSAWYWAPVATSALVWPLIFVLLRDMRRRWLLHLS
FT                   "
FT   sig_peptide     complement(348260..348322)
FT                   /locus_tag="TK90_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.395 at
FT                   residue 21"
FT   gene            complement(348319..349197)
FT                   /locus_tag="TK90_0329"
FT   CDS_pept        complement(348319..349197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0329"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: hha:Hhal_1006 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70844"
FT                   /db_xref="GOA:D3SDM4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM4"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ADC70844.1"
FT                   /translation="MILLGVALMALDHRLNELQTVRNALSTVAYPLQVAVDAPIRAGSR
FT                   LLESFTSREDLITENRILREENAELRARQLRFDALQMENDRLRALLNTAERAQERVEIA
FT                   KLLAVDLDPFRQQIVLSKGNRHGVYPGQPVIHPDGVIGQVLSTQMVSSTALLISDPGHA
FT                   LPVLSARTGLRGIVVGTGNPRRLEMRHVPPQEDIEEGDLLLTSGLGGRFPPDYPVARVI
FT                   SVERQPGQPFLDIQAEPLAALDRSREVLLLWTRERPDADTDAHPEEEGETTGREAEPEG
FT                   EADMPEAADNP"
FT   gene            complement(349380..350426)
FT                   /locus_tag="TK90_0330"
FT   CDS_pept        complement(349380..350426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0330"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: aeh:Mlg_0169 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70845"
FT                   /db_xref="GOA:D3SDM5"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM5"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADC70845.1"
FT                   /translation="MFKRLLGLFSNDISIDLGTANTLIYMRGQGIVLNEPSVVAIRQDR
FT                   GPGGPRSIEAVGIEAKKMLGRTPEHVVTIRPMKDGVIADFTTTEKMLQYFIKKVHERRI
FT                   FRPSPRVLVCVPCGATQVERRAIRESAFGAGARKVYLLQEPVAAAIGAGIPLDEAVGSM
FT                   VLDIGGGTSEVAVLSMNGIVYSESVRIGGDTFDEAIMSYVRRNYGVLIGEATAERIKHA
FT                   VGSAYPGKELLEIEVKGRNLAEGVPRSFTLNSNEILEALQDPLYGIVSAVRTALEQTPP
FT                   ELGSDVAERGIVLTGGGALLQQIDRLLMEETGIPVVIADDPLTCVARGGGRVLEMLDEK
FT                   QVDFLSME"
FT   gene            350569..350856
FT                   /locus_tag="TK90_0331"
FT   CDS_pept        350569..350856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0331"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: aeh:Mlg_0168 aspartyl/glutamyl-tRNA amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70846"
FT                   /db_xref="GOA:D3SDM6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM6"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ADC70846.1"
FT                   /translation="MSVEASEVQRIAHLARLAMSDEQAREFAGGLSDIFAFVEQLDGAP
FT                   IEGVEPMAHPLDAEQRLRSDAVTEPDNREGFQAIAPAVEGGLYLVPRVIE"
FT   gene            350924..352375
FT                   /locus_tag="TK90_0332"
FT   CDS_pept        350924..352375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0332"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: mca:MCA0098 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70847"
FT                   /db_xref="GOA:D3SDM7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM7"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ADC70847.1"
FT                   /translation="MSQETLSGWVRKLQAREISSRELTQLYLERIERLDPQLNSFITVT
FT                   AESALAQADAADARLANGEQTPLLGVPVAQKDIFCTEGVRTSCGSRMLDPFISPYNATV
FT                   VERMNAAGAVMLGKTNMDEFAMGSSNETSFYGPVRNPWDTERVPGGSSGGSAAAVGARL
FT                   VPGATGTDTGGSIRQPAAFCGITGLKPTYGRVSRYGMIAFASSLDQGGPMAVTAEDCGL
FT                   MLNAMAGFDERDSTSVERPAEDFTAGLNQDLTGLRIGLPKEFFGEGLDEKVRGVIDAAV
FT                   EVLKGRGAEIREVSLPYSHLSVPAYYVVAPAECSSNLARFDGVRYGHRCDNPEDLMDLY
FT                   TRSRGEGFGDEVKRRIMVGTYVLSAGYYDAYYLKAQKVRRIIADDFRSAFEDVDVLLGP
FT                   TTPELPFALGAKADPVSMYLSDIYTIAANLAGLPAMSLPAGEIDGLPVGLQLIGNYFDE
FT                   ARLLGVAHQYQQETDWHTRVPAAFA"
FT   gene            352386..353819
FT                   /locus_tag="TK90_0333"
FT   CDS_pept        352386..353819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0333"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="KEGG: aeh:Mlg_0166 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit B; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, B subunit; PFAM: GatB region; GatB
FT                   central domain protein; Asn/Gln amidotransferase; SMART:
FT                   Asn/Gln amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70848"
FT                   /db_xref="GOA:D3SDM8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM8"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ADC70848.1"
FT                   /translation="MEWETVIGLEIHAQLNTVSKIFSGAPTAYGAEPNRQACAVDLGMP
FT                   GVLPVLNQGAVEKAVMLGLAIDAEITPRSVFARKNYFYPDLPKGYQISQYELPIVGLGH
FT                   LDIELEDGTTKRIGVTRAHLEEDAGKSLHEGFESMTGIDLNRAGTPLIEIVSEPELRSA
FT                   KEAVAYMKKLHSLVRYLDICDGNMQEGSFRCDANVSIRPKGQTEFGTRAELKNLNSFRF
FT                   VERAINHEVERQIDVIEGGGSVVQETRLYDPDRDETRSMRTKEEANDYRYFPDPDLLPV
FT                   VVDAAFVNQMRERLPELPGAKRARFVEQYGLSDYDAGVLTAAREMGDFYEAVAAGCGAP
FT                   KLAANWVMGEFSAAMNRSEVELADAPVNAEGLAGLLARIQDETISGKIAKEVFEAMWNG
FT                   EGDADTVIEAKGLKQITDTAAIDAIIDEVMANNPQQLEQYRGGKDKLFGFFVGQVMKAT
FT                   QGKANPAQVNERLKAKLDG"
FT   gene            353838..354734
FT                   /locus_tag="TK90_0334"
FT   CDS_pept        353838..354734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0334"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: noc:Noc_2074 HSP33
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70849"
FT                   /db_xref="GOA:D3SDM9"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDM9"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ADC70849.1"
FT                   /translation="MREPDTLHRFMLEEAGVRGEWVHLDAAWQALLERHEYPPVVRDLL
FT                   GQAYAAVALTAATLKFDGSLILQVTGTGPVHMIVAQADGQGRLRGLARFRETPPEGATL
FT                   AECAGDNARLMLTLDPGDGGERYQGVVELEGETLADAMNVYFERSEQLPTRLWLAANQQ
FT                   SAAGMLLQAVPGEGGHAVTRDPEDWNRANILADTTTPEEMLELDAGTLLGRLFAEERVR
FT                   LFDGTPVQFHCPCSRERVSETLRGLGQDEIRGIIEEQGQIEVTCEFCNAQYHFDPVDAE
FT                   ALCATQTVQPPTPDTRQ"
FT   gene            354835..355251
FT                   /locus_tag="TK90_0335"
FT   CDS_pept        354835..355251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_0330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70850"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70850.1"
FT                   /translation="MYSRHTEIPTLDTRPGWQVEARYYNQAALALRRLGPEIRLPLPIL
FT                   KHLDLILQPDAWVVVDRVLNDMPVVAWTAFRAAHRHNLHRPVACELRLYHSMATMVTNR
FT                   ALACMADRLTVALAQEDQRIPRGQVIAFRSRSSA"
FT   gene            complement(355253..356002)
FT                   /locus_tag="TK90_0336"
FT   CDS_pept        complement(355253..356002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0336"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: pae:PA4663 molybdopterin
FT                   biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70851"
FT                   /db_xref="GOA:D3SDN1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN1"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ADC70851.1"
FT                   /translation="MDDPELLRYSRQIMLPGVGVEGQQRLQEAHAVIMGLGGLGSPVAA
FT                   YLAAAGVGRLTLVDPDHVEVTNLQRQILHTDADIGRDKVESAARRLAAMNPNCRVETRA
FT                   ERLDVDAMTTLFAKADVVLDGTDNFASRGAINRAAVASGTPLVSGAVIRFEGQLTTFDY
FT                   RDPEAACYHCLYGEGGGDEDTCAANGVLASLPGVIGSLQATEALKLLIGLPTLSGRLLI
FT                   VDATNMQFREIRLRRDPDCPVCGQRPA"
FT   gene            356166..356525
FT                   /locus_tag="TK90_0337"
FT   CDS_pept        356166..356525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70852"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70852.1"
FT                   /translation="MKRMMIALAPAALLAFALTAPAHAAQPVSGFVHTGAAAFDPDALQ
FT                   HVHHRPGHYGGPPHARSHPGYRGHKYSKRSHNRGRGHKRGHYYSYQEHHHHHYHSRPRH
FT                   RSPSGSMNLHLHLPF"
FT   sig_peptide     356166..356240
FT                   /locus_tag="TK90_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(356582..357802)
FT                   /locus_tag="TK90_0338"
FT   CDS_pept        complement(356582..357802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0338"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: bcm:Bcenmc03_6812 transposase
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70853"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:D3S9U4"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ADC70853.1"
FT                   /translation="MLDKKTLQKLGGWEGYRLERAVWPDEAGGTLELHLKPTRQWMHCE
FT                   RCGHRTRQVHETTLRRVRDLPLFEYRVVLVVPRRRVWCEHCGGPQLERLSWLGRYQRLT
FT                   NRLADACSQLLRSASIQAVAAFYGLGWHTVKTVDRHRLAASLLEPDWASIRYLAMDEFA
FT                   LHKGHRYATVVIEPIRRQVLWVGEGRSRETARAFFEQLPEGVRERIEAVAIDMTTAFEL
FT                   EIRAQCPRAEIVYDLFHVVAKYGREVIDRVRVDEAKRLGEDRRARRVIKSSRWLLLRNR
FT                   ASLNAGQAVHLDELLQANQALLTVYLLRDELKRLWFQRRPEQTWQAWRHWVQQAQESGI
FT                   HALQRFARLLEPYLPGIVSRCRHRLNTSVVEGINNTIKVIKRRAYGYRDQDYFFLKIRA
FT                   AFPGNAR"
FT   gene            complement(357894..358745)
FT                   /locus_tag="TK90_0339"
FT   CDS_pept        complement(357894..358745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0339"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="TIGRFAM: protein-(glutamine-N5) methyltransferase,
FT                   release factor-specific; modification methylase, HemK
FT                   family; PFAM: methyltransferase small; KEGG: aeh:Mlg_0272
FT                   HemK family modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70854"
FT                   /db_xref="GOA:D3SDN4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN4"
FT                   /inference="protein motif:TFAM:TIGR03534"
FT                   /protein_id="ADC70854.1"
FT                   /translation="MTTTLDALLRELRDRLQAAGSEEPGLEARLLLGAATGLDTSALIA
FT                   RGLEAPTASQRERADALCRRRETGEPIAHILGRRAFWTLDLGISPACLIPRPETELLVE
FT                   RAIAAIDACERAHPRVLDLGTGSGAIILALKAERPAIEAVATDRSPDALRQARANADAL
FT                   GLDVAFLQGTWLDPFKPSDAFDVIVSNPPYIAPDDPHLTRGDLRFEPREALAAPEAGLG
FT                   DLYTIIDTALTHLLPGAPLLLEHGFDQARDVRVCMEQEGYREVQSLRDPAGHERITIGV
FT                   HA"
FT   gene            complement(358752..359837)
FT                   /locus_tag="TK90_0340"
FT   CDS_pept        complement(358752..359837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0340"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   aeh:Mlg_0278 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70855"
FT                   /db_xref="GOA:D3SDN5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN5"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ADC70855.1"
FT                   /translation="MKASFRNKLEGLAERHAEIAQLLATPDAAEDADQLRRLSQEYSQL
FT                   EPVAEAWKAWHDNQAALEEARAMLAEDDPELRAMAEAEIETLADQAEALEAELHRHLIP
FT                   KDPHDNANVFLEIRAGTGGDEAAIFAGDLLRMYTRYAEQQNWKLEILSASEGEHGGYRE
FT                   VIARLAGQGAYSRLKFESGAHRVQRVPETESQGRIHTSAATVAILPELDEVEMPDINPA
FT                   DLRVDTFRASGAGGQHVNKTDSAVRLTHLPTGIVVECQEERSQHKNRAKAMTYLAARLF
FT                   EAEREAQAAAQSAERKSLVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLEQVMAGDLD
FT                   PVIDPLIHEYQAEQLATLSEG"
FT   gene            complement(359834..361132)
FT                   /locus_tag="TK90_0341"
FT   CDS_pept        complement(359834..361132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0341"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="KEGG: aeh:Mlg_0279 glutamyl-tRNA reductase; TIGRFAM:
FT                   glutamyl-tRNA reductase; PFAM: Shikimate/quinate
FT                   5-dehydrogenase; Tetrapyrrole biosynthesis, glutamyl-tRNA
FT                   reductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70856"
FT                   /db_xref="GOA:D3SDN6"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN6"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ADC70856.1"
FT                   /translation="MLFTLGINHKTAPVAIRERLSVNESQLGEALHSLRSGVLLPETAI
FT                   LSTCNRTEVYFREGGKQSEHRVLDWLGGYHGIDRDELRPYLYLHHDGSAVRHTLRVASG
FT                   LDSLVLGEPQILGQMKTAYQHAHDAGTLGRSLERLFQHAFATAKDVRTQTAIGQSAVSV
FT                   AFAAVSLARQIFGDLKPLTALVIGAGETIELALQHLSGHGIGRVIVANRTEERAQAVAE
FT                   RFDGEAISLNQLPDRLAEADIVISSTAAPLPILGKGAVERALRKRRHKPMFMVDIAVPR
FT                   DIEPEVGQLEDVYLYTVDDLQEVIDENMASRQAAAAQAEEIITQRASEFMRWLRARDSV
FT                   DSIRQLRQRAEAVKAESLARAEAMLRAGKSPEEAMQLLAHSLTNKLMHAPCKSLNTAAH
FT                   EGDARLLDAAHRLFQLPSPEDDPGHDPESGSRS"
FT   gene            361365..363113
FT                   /locus_tag="TK90_0342"
FT   CDS_pept        361365..363113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0342"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein;
FT                   Tetratricopeptide TPR_4; Sel1 domain protein
FT                   repeat-containing protein; TPR repeat-containing protein;
FT                   KEGG: aeh:Mlg_0280 tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70857"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN7"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ADC70857.1"
FT                   /translation="MKWSNPIGPEMIRPLFVALAALVLVGCAHMPLGASEGEALETDRP
FT                   VILPIMPAQDPEAALMLGVLVGEIAVRSGQYEEAARYYGAAALLSDDPAIAERATRIAL
FT                   FARDRNQALQSSERWRQLAPESLDALQLSTVLRLDLGQPDPAAEQMGTVIDLQAVQGGD
FT                   PYAALGAVVGQTHNREAALEALEKLTDQRQDDVGVHRVFAEAALRFAPGDPALEATARG
FT                   VERFPESVSLRLLRARALDEAGQSDEALEELRATVANHPESREARFGYARMLAEHDDRE
FT                   MAREEMDRLVEQDPEDVQLLLALALMNLEAEQLGPARTYLERLDALGEREDDIAYYLGR
FT                   LHEMEDDPEGARQAYERVGGGGHADDARLRAARMTLEIEGESAARERFEQMQQGPDTEL
FT                   ARRAYVGEANLLREKGEYTAARERLNRGLVQFPGDTRLLYMRGLVHERQDDIEAAEADF
FT                   RAILDNDPENVAALNALGYTLADRTDRYEEALDLIERAYAQEPDDAAIIDSYGWVLYRL
FT                   GRLDEAEDFLRRAYDLSDDGEIASNLAVVLWERGERDEARSILEAALEREPDHERLLRV
FT                   RDELLE"
FT   gene            363113..363763
FT                   /locus_tag="TK90_0343"
FT   CDS_pept        363113..363763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0343"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="TIGRFAM: outer membrane lipoprotein LolB; PFAM:
FT                   outer membrane lipoprotein LolB; KEGG: aeh:Mlg_0281 outer
FT                   membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70858"
FT                   /db_xref="GOA:D3SDN8"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN8"
FT                   /inference="protein motif:TFAM:TIGR00548"
FT                   /protein_id="ADC70858.1"
FT                   /translation="MLSGSPESRAPSWAGVTRWVSGVVVALVLIGCTAPMPRTEDPAAR
FT                   QAFDERAEVVKAFDEWRLAARLGLSTETEYWSAQLNWRVQQERHVLDLSGPMGRGGGRL
FT                   TLAPDQPAVLVTRAGEQYQAEDPDALVAYLTNESIPVSGMRYWVRGLLAPGADYDLETD
FT                   EDGLPRRIEQSGWVIEFGEFDEVDGMALPVRMDLEREGVELRVRIANWHMATR"
FT   gene            363760..364650
FT                   /locus_tag="TK90_0344"
FT   CDS_pept        363760..364650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0344"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: hha:Hhal_0990
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70859"
FT                   /db_xref="GOA:D3SDN9"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDN9"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ADC70859.1"
FT                   /translation="MNGDFDVAFPAPAKINRFLHITGRRPDGYHELQSVFQFVGLADSL
FT                   RFEPLERGRFEMSTEGVDGDNNLCLRAARALADAAGSPFGVRVHLDKCIPIGGGLGGGS
FT                   SDAATTLVALNHLFDLGRSEDELAAIGLGLGADVPVFVRGRAAWAEGVGDRLVPVEPDL
FT                   AWLLLLDPGVSVATGPIFGAAELTRDCPAETISPEIDAARFRNVFEPLVRRQYPAIGEA
FT                   LDWMGGQTERARLSGTGGCIFGMFPNKAAARQAQAAQPRPWRSWVTSLTNVSPLRQWLP
FT                   GRGAAEGAEQRVIGP"
FT   gene            364641..364714
FT                   /locus_tag="TK90_R0003"
FT                   /note="tRNA-Gln1"
FT   tRNA            364641..364714
FT                   /locus_tag="TK90_R0003"
FT                   /product="tRNA-Gln"
FT   gene            364856..364929
FT                   /locus_tag="TK90_R0004"
FT                   /note="tRNA-Gln2"
FT   tRNA            364856..364929
FT                   /locus_tag="TK90_R0004"
FT                   /product="tRNA-Gln"
FT   gene            365071..365144
FT                   /locus_tag="TK90_R0005"
FT                   /note="tRNA-Gln3"
FT   tRNA            365071..365144
FT                   /locus_tag="TK90_R0005"
FT                   /product="tRNA-Gln"
FT   gene            365287..365361
FT                   /locus_tag="TK90_R0006"
FT                   /note="tRNA-Gln4"
FT   tRNA            365287..365361
FT                   /locus_tag="TK90_R0006"
FT                   /product="tRNA-Gln"
FT   gene            365632..366567
FT                   /locus_tag="TK90_0345"
FT   CDS_pept        365632..366567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0345"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: hna:Hneap_1168 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70860"
FT                   /db_xref="GOA:D3SDP0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP0"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ADC70860.1"
FT                   /translation="MVFAGNANPRLAQSVAEHLGLPMGKAIVGRFSDGEVQVEILENVR
FT                   GRDVFLIQPTGQPTNENIMELVIMVDALRRASAGRITTVIPYFGYARQDRRVRSARVPI
FT                   SAKVVANMIEAVGADRVLTIDVHADQVQGFFNVPVDNIYASPVLLGDVWRHVSGNLTVV
FT                   SPDVGGVVRARAIAKRLDDADLAIIDKRRPRANESEVMHIIGDVRDKSCIIIDDLVDTA
FT                   GTLCQAAKALKAHGAASVSAYATHPVLSGAAIDNINGSALDELVVTDTLALQPNAQACA
FT                   KIRQLSVAEMLAETIRRINREESVSSLFVD"
FT   gene            366690..367376
FT                   /locus_tag="TK90_0346"
FT   CDS_pept        366690..367376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0346"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: Ribosomal protein L25-like; KEGG:
FT                   nmu:Nmul_A0590 50S ribosomal protein L25/general stress
FT                   protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70861"
FT                   /db_xref="GOA:D3SDP1"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP1"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ADC70861.1"
FT                   /translation="MSMSFTIEAEKRDEQGSSASRRLRRAGKLPAILYGGENDAQPITL
FT                   DHNAMVHNLKHDAFYSHILTVKLDGKSEKAILRDVQRHPFKPTIYHVDLLRVSANQPIR
FT                   VHVPLHFHNEEECKGVKLGGGMVSRMLNDIEVECLPGDLPESIDIDVAEMDVGDTIHIS
FT                   ELKLPKGVESVALMHGDDYDYAVVSVLLPRAAKAEEEDGEEVEAAEAEGGEEAASGDEG
FT                   ESEDKE"
FT   gene            367409..368020
FT                   /locus_tag="TK90_0347"
FT   CDS_pept        367409..368020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0347"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: hha:Hhal_0987 peptidyl-tRNA hydrolase;
FT                   TIGRFAM: peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70862"
FT                   /db_xref="GOA:D3SDP2"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP2"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ADC70862.1"
FT                   /translation="MAIRLIVGLGNPGPRYAETRHNAGFWFVDALARRYSTEFRSESRF
FT                   DGEGARLTLPEGDCWLLKPMSFMNKSGLPVRKCADFYRIAPEEILVVHDELDLDPGVAR
FT                   LKMGGGHGGHNGLRDLHRHMGGPNYARLRLGIGHPGHRDDVVPFVLDRPGRDDARAIED
FT                   AIDAALDQVPALIAGRWDEAVRNLHGGGSKAAHATSEETR"
FT   gene            368017..369111
FT                   /locus_tag="TK90_0348"
FT   CDS_pept        368017..369111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0348"
FT                   /product="GTP-binding protein YchF"
FT                   /note="TIGRFAM: GTP-binding protein YchF; PFAM: Protein of
FT                   unknown function DUF933; GTP-binding protein HSR1-related;
FT                   KEGG: aeh:Mlg_0286 GTP-binding protein YchF"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70863"
FT                   /db_xref="GOA:D3SDP3"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP3"
FT                   /inference="protein motif:TFAM:TIGR00092"
FT                   /protein_id="ADC70863.1"
FT                   /translation="MSLKCGIVGLPNVGKSTLFNALTRAEIAAENYPFCTIDPNVGVVE
FT                   VPDPRLARLTEIVKPERTLATTVEFVDIAGLVAGAAQGEGLGNQFLAHIRETDAIAQVV
FT                   RCFEDDDIVHVAGKVDPLADIETISTELMLADLETANKALTRLARAAKSQDKTAIAQLK
FT                   AAEKVAAGLDQGVPARAQDLDEDERRLLYDLHLLTIKPLMYIANVDEASLAGGNAMVEA
FT                   VQAKAAEEGAEVVSVCAAIEAEIAVLDPEERVEFLADLGLEEPGLDRVIRTAYRLLDLQ
FT                   TFFTAGEKEVRAWTVRRGSTAPQAAGVIHTDFERGFIRAEVVGYDDFVANNGEQGAKDA
FT                   GKWRLEGKEYLMHEGDVVHFRFNV"
FT   gene            369193..369522
FT                   /locus_tag="TK90_0349"
FT   CDS_pept        369193..369522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0349"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: hna:Hneap_1149 glutaredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70864"
FT                   /db_xref="GOA:D3SDP4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP4"
FT                   /inference="protein motif:TFAM:TIGR00365"
FT                   /protein_id="ADC70864.1"
FT                   /translation="MDVMDRIRQQVEDNPVVIFMKGTPQFPMCGFSSRAVEALKRCEQE
FT                   FAYVNVIADQEVMQNLPRFADWPTFPQVYVDGELIGGCDITLEMFESGELKKAVDEAHA
FT                   KRAAS"
FT   gene            complement(369758..370444)
FT                   /locus_tag="TK90_0350"
FT   CDS_pept        complement(369758..370444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0350"
FT                   /product="ribonuclease T"
FT                   /note="KEGG: aeh:Mlg_2268 ribonuclease T; TIGRFAM:
FT                   ribonuclease T; PFAM: Exonuclease RNase T and DNA
FT                   polymerase III; SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70865"
FT                   /db_xref="GOA:D3SDP5"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP5"
FT                   /inference="protein motif:TFAM:TIGR01298"
FT                   /protein_id="ADC70865.1"
FT                   /translation="MAEPVQLDPQHRPMANRFRGFLPVVVDVETGGFDCRRHALLQVAA
FT                   VFLRRDENDHLVRDRTVSLHVRPYEGSEMDPKSLEVNGIDPYHPLRAAYPEDQAMGRLF
FT                   SEVRREVKINHCKRAILVGHNAHFDLGFVHTAAERCGIKRNPFHPFSSLDTVSLAALAF
FT                   GQTVLARAADAAGLGWDAEAAHSAAFDAEKTADIFCQIANRWQDGVGVPQNALRLPDPE
FT                   ELPPGS"
FT   gene            370719..373382
FT                   /locus_tag="TK90_0351"
FT   CDS_pept        370719..373382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0351"
FT                   /product="2-oxo-acid dehydrogenase E1 subunit, homodimeric
FT                   type"
FT                   /note="TIGRFAM: 2-oxo-acid dehydrogenase E1 subunit,
FT                   homodimeric type; KEGG: mca:MCA3000 pyruvate dehydrogenase
FT                   subunit E1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70866"
FT                   /db_xref="GOA:D3SDP6"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP6"
FT                   /inference="protein motif:TFAM:TIGR00759"
FT                   /protein_id="ADC70866.1"
FT                   /translation="MDPNATEHDIDPQETQEWIDALASVLETDGPERAHALLERLVDKA
FT                   RRSGAYLPYSANTAYVNTIPTHLEPEYPGDGAVEHRIRSYIRWNAMAMVVKANRVSAEL
FT                   GGHIATFASAATLYDVGFNHFWHAPSHDHGGDLLFAQGHSSPGIYARAFMEGRLTEEQL
FT                   DHFRREVDGKGLSSYPHPWLMPDFWQFPTVSMGLGPIMSIYQARFMRYLQDRGLAQTEN
FT                   RRVWSFVGDGEVDEPETLGAITLASREKLDNLTWVVNCNLQRLDGPVRGNGKIVQELEA
FT                   IFRGAGWNVVKVLWGRYWDPLLAKDTDGLLQKRMMEAVDGDYQNYKSRDGAYVREHFFG
FT                   KYPELKRMVANMSDEDIWRLNRGGHDPVKVYAAYKAAAEHKGQPTVILAHTVKGYGMGS
FT                   AGEAQNRTHSQKKMDADDMKQFRDRFNIPLSDEQVEKAEYIKPDPDSEEMKYMHERRKD
FT                   LGGYLPVRRPLATPLEIPGLDAFNGLLEASGEREMSTTMAFVRLLTLLARDKKIGKNIV
FT                   PIVPDEARTFGMEGLFRQLGIYSSVGQLYEPQDKDQVMYYKEDKKGQILEEGINEAGSM
FT                   SSWIAAATSYSTHGVAMVPFYIFYSMFGFQRIGDLIWAAGDMRARGFLMGATAGRTTLA
FT                   GEGLQHDDGHSLMMAANVPNCIAYDPTFAYELAVIVQDGMRRMYAEQQSVFYYITVMNE
FT                   NYPQPAMPKGAEEGIRRGLYRLQAGGRKKKKVRLLGSGTILREAMAAAELLDQDFGVAA
FT                   EVWSATSFNELARDGRDAERHARLHPEAKPRTSWVEECLGGSDAPVVAATDYVQAYADQ
FT                   IRAFVPADYRVLGTDGFGRSDTRAALRRHFEVDRYHIAVTALKALADAGTVEVKTVADA
FT                   IKMYKIDVERPNPLQA"
FT   gene            373411..374718
FT                   /locus_tag="TK90_0352"
FT   CDS_pept        373411..374718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0352"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /note="TIGRFAM: pyruvate dehydrogenase complex
FT                   dihydrolipoamide acetyltransferase; PFAM: catalytic domain
FT                   of components of various dehydrogenase complexes; E3
FT                   binding domain protein; biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: aeh:Mlg_0270 pyruvate
FT                   dehydrogenase complex dihydrolipoamide acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70867"
FT                   /db_xref="GOA:D3SDP7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP7"
FT                   /inference="protein motif:TFAM:TIGR01348"
FT                   /protein_id="ADC70867.1"
FT                   /translation="MSNTTTVHVPDIGDFKDVEIIEVIVSPGDTVSPEDPLITLESDKA
FT                   SIEIPAPQGGTVKTLKVKAGDRVNEGDPILELEPSDEGAAEEASGKEEAPKEEAPAEPA
FT                   PEAEEQKPSEAPKAADRADPRPSPTEHIRDESAFRKAHASPVVRKFARELGVDLAKVEG
FT                   SGRKGRILREDVQGFVKRALSQGAGGGLGVEPMPEIDFSEFGPVETQPLSKINKLTGKN
FT                   LHRNWVTVPHVTQFDEADITELEDFRKSLKAEYEKKGVKVTFLPFLMKAVVSALKQYPR
FT                   FNASLDATGENLIIKQYYNLGIAVDTPDGLVVPVVRDVDRKSLVDIASELMDLSQRARD
FT                   KKLKPADMQGGCLTISSLGGIGGTQFTPIVNAPEVAILGVSRSSMKPVWNGQEFEPRLI
FT                   LPLALSYDHRVIDGALGARFATTLSALLSDMRRMLL"
FT   gene            374738..376522
FT                   /locus_tag="TK90_0353"
FT   CDS_pept        374738..376522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0353"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="TIGRFAM: dihydrolipoamide dehydrogenase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: aeh:Mlg_0271 dihydrolipoamide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70868"
FT                   /db_xref="GOA:D3SDP8"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP8"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ADC70868.1"
FT                   /translation="MSQTKTIEVPDIGDFKDVEIIEVLVQPGSEIAPEDPLITLESDKA
FT                   TIDVPAPEAGTVKKLHVKVGDKVSKGSKLLDLEASGEAAGGEDAPASGGEKAESAKAES
FT                   GAASESKKAAAPKAAADPNTDSQCQVLVLGSGPGGYTAAFRAADLGLDVVMVERYPQIG
FT                   GVCLNVGCIPSKALLHAGEVLHEAERFAALGIKFGEPEIDLDGLRGYKGNAVKKLTGGL
FT                   KQLCKQRKVRVVQGAGEFVGANSIAVEGDGGREVIGFEHAIIAVGSQAIKLPGFPWDDE
FT                   RVMDSTDALDLAEIPERMLVVGGGIIGLEMACVYEALGTKVTVVELSDTLMPGADRDIV
FT                   RPFEKRAKKRFENIFLKSKVTEAKATKAGIVCQFEGEAKGLPEDDTFDRVLVAVGRSPN
FT                   GAKINAEAAGVQVSERGFIEVDSQQRTNVEHIFAIGDVVGQPMLAHKATHEGKVAAEVI
FT                   AGHKVHFDARAIPSVAYTHPEVAWMGVTEEQAKADGIEYTKGVFPWAASGRAIALGAED
FT                   GMTKLLFDADGRVIGAGIVGPSAGDLIGEAMLALEMGAEMEDIGLTVHPHPTLSETVAF
FT                   AAEVAHGSITDILPPKKR"
FT   gene            376529..377476
FT                   /locus_tag="TK90_0354"
FT   CDS_pept        376529..377476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0354"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: scl:sce5306
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70869"
FT                   /db_xref="GOA:D3SDP9"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR041544"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDP9"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADC70869.1"
FT                   /translation="MSVLRHVLPLFVGGLWLTHGVAQAGVVPHRESLERSDWQVIELDD
FT                   ACRIEQGVRHGGTLRFETQPGLALRAFWHAPYAMPEGATARLRTGAPEWLGASPKSPLD
FT                   LEMRAERPDRFRVPDAQVQALKARLLVGHDVRIDFPGAEDAVHFRGIRFAQRAEAFEAC
FT                   YTGAEGPDVGALDRWSVYFATGSRELDSRGRETVARAAETLRTVERPRVRLVGLTDAEG
FT                   PRELNERLSRQRAEAVRAALVEAGVPGDGLTVEAGGVDPEADGEREGSRRVDIWWLGGA
FT                   DAAAGPSSVAETATETEPQAVPESAPGVPGSAGW"
FT   sig_peptide     376529..376603
FT                   /locus_tag="TK90_0354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.742 at
FT                   residue 25"
FT   gene            377535..378758
FT                   /locus_tag="TK90_0355"
FT   CDS_pept        377535..378758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0355"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: sde:Sde_2423 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70870"
FT                   /db_xref="GOA:D3SDQ0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ0"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ADC70870.1"
FT                   /translation="MSSKISRVVLAYSGGLDTSVILKWLEDQYGCEVITFTADLGQGEE
FT                   VEPARAKAEALGVKQIYIEDLRETFVRDYVFPMFRANTIYEGEYLLGTSIARPLIARRM
FT                   VEIAEETGADAIAHGATGKGNDQVRFELGAYALKPGIRVIAPWREWDLNSRERLMAYAE
FT                   QHNIPVDYKKQGTKSPYSMDANLLHISYEGGPLEDPWTEAEDDMWRWSVSPEAAPDESE
FT                   TLTIGFEKGDPVSINGERMSAAELLAKLNERGGAHGVGRLDIVENRYVGMKSRGCYETP
FT                   GGTILLKARRALESITLDREAAHLKDELMPRYASLIYNGYWWSPERRMLQAAIDDTQGV
FT                   VNGEVRLRLYKGNVIVAGRRSEDTLFDNAIATFEDDAGAYDQKDAEGFIRLNALRLRIA
FT                   ASRNRKPI"
FT   gene            378760..380763
FT                   /locus_tag="TK90_0356"
FT   CDS_pept        378760..380763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0356"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: hna:Hneap_0681 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: GGDEF domain containing protein;
FT                   PAS fold domain protein; SMART: GGDEF domain containing
FT                   protein; PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70871"
FT                   /db_xref="GOA:D3SDQ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC70871.1"
FT                   /translation="MSPRAYFRRSPGCLSWFGRGGLGGVVLLWGLFFGALLATPAGAKA
FT                   EAAERELIFAVLAHRGEDAAREQWTPFAEYLEQTLEGIQVRLLPVDNDALQAGAAEDRF
FT                   DLVLTNPGSYVMLEQRHGISRIATMLPAEVGREEDRFGAVIVAREGRVDLVELGDLVGQ
FT                   RISAVHPDAFGGWWMAWRELQAAGLDVEDDLDRVVFTGFPVSRGLDLLLAGEVDAATFR
FT                   TGILEDLREQGDPRVEQVRLIGERAVPRFPYRTSTRLYPEWPLAMRGDLDAEIAQAVLR
FT                   AILALDAEHPVSQAAGIAGWSAPRSYEDVQGLMYDLGVGLYAPEPFAVLRWARDNLAVL
FT                   LAVLAAGIAAILLYVLRVHARMRIAGHNLRRAMCAIPNAVITLDARGGIVYMNPAAEQM
FT                   AGLVRLQALGCTLEQVLDLREMGTDRPLGAERSEPLAANLGEHTEARLVTPSGQERIVR
FT                   IDRTALDPVAGSSVRTLLVLADISEERELVDRLVHEASHDPLTGLLNRRAFEREMQRAM
FT                   DNAREYSSVASLVLVDLDYFKAVNDRHGHQVGDELLRRVGTILRQLTRSRDAVARIGGD
FT                   EFAVVAFDTDAEQARILGQRICSALGDRPLQVEARDVTIGASVGVVQLGAGLAGVDAAF
FT                   VAADRACYSAKSEGRGQVGVARKADIHPITGS"
FT   gene            381081..381866
FT                   /locus_tag="TK90_0357"
FT   CDS_pept        381081..381866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0357"
FT                   /product="VacJ family lipoprotein"
FT                   /note="PFAM: VacJ family lipoprotein; KEGG: psa:PST_1656
FT                   VacJ-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70872"
FT                   /db_xref="GOA:D3SDQ2"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ2"
FT                   /inference="protein motif:PFAM:PF04333"
FT                   /protein_id="ADC70872.1"
FT                   /translation="MSVFSHLRIGLAALMVLGLAGCASVPSEDRHPDDPWESYNRVVFE
FT                   INDDFDQALLRPTAVQYRRLPQPVQTGVGNFFSNLNDFTVLFNNLLQGNLEDAASDTGR
FT                   IMFNTTFGLLGLIDVASPMGLEKNNQDFGQTLGAWGVARGPYLQLPLLGPSTARDAPAR
FT                   LVDGYTNPLYHTNLRSDHTGWWVGLMALDVVDMRAGLIPTERMLAQLSDDRYIALREAY
FT                   LQRRDFLVRGASDERATEMLDELDELEALEAMEAEEGTD"
FT   sig_peptide     381081..381152
FT                   /locus_tag="TK90_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.653) with cleavage site probability 0.552 at
FT                   residue 24"
FT   gene            381863..382375
FT                   /locus_tag="TK90_0358"
FT   CDS_pept        381863..382375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0605 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70873"
FT                   /db_xref="GOA:D3SDQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ3"
FT                   /inference="similar to AA sequence:KEGG:Mlg_0605"
FT                   /protein_id="ADC70873.1"
FT                   /translation="MNSLWTMLDILRLRRGPQDLPADGGTLIFWLGIALVTGMAVGIPM
FT                   YGTSQALILNVLDLAVLYLFIVVVLRLGGVPDRWRQTFTAMAGTGALLGLLMALLMLID
FT                   APADPEEVSTGALLALLTLVAWLLLVFGHILQQALELGSRLVGMLMALGYVVVSSVVTQ
FT                   TALGVLS"
FT   gene            382372..383775
FT                   /locus_tag="TK90_0359"
FT   CDS_pept        382372..383775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0359"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; KEGG: pmy:Pmen_3826 UDP-N-acetylmuramate"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70874"
FT                   /db_xref="GOA:D3SDQ4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ4"
FT                   /inference="protein motif:TFAM:TIGR01081"
FT                   /protein_id="ADC70874.1"
FT                   /translation="MSADHLHILGIGGTFMGGLAQLARARGYRVTGSDQKLYPPMSEQL
FT                   EQAGIAYHEGHDPATLPEQGPVVVGNVMTRGMPIVESLLDRGLSYTSGPQWLAEHVLHD
FT                   RWVLAVAGTHGKTTTASLLAWILDHAGLSPGFLIGGVPGNFGVSARMGEAPFFVIEADE
FT                   YDSAFFDKRAKFVHYRPRTLVLNNLEFDHADIYPDLAAIERQFHHLVRTIPGQGLILLP
FT                   ACDAALERVLEMGCWTPVERITTDPDTGDTVALAARPLNEDASEFEVLVNGVVQGRVAW
FT                   EMTGQHNLSNALAALGAARHAGVPLAAGIAALPAFRGVRRRQELRAEIDGIRVIDDFAH
FT                   HPTAIRLTLEGLRGRVVPGGRLIAVLEPRSNTMRMGIHAEALGAALERADAAHLYHAPD
FT                   IDWSTDDLERQLGGQLAVARDIESLLQGILATARPGDTLVIMSNGGFDGLHQRLIAGLQ
FT                   SREPSGTPA"
FT   gene            383772..384410
FT                   /locus_tag="TK90_0360"
FT   CDS_pept        383772..384410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0360"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: csa:Csal_1536
FT                   aromatic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70875"
FT                   /db_xref="GOA:D3SDQ5"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ5"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ADC70875.1"
FT                   /translation="MSGKPRSIALALTGASGAPYGLRLLECLVQAGVQVHLMLSKPAQV
FT                   VLGLETDLDVPGRPAEIARFFAERHGAADGQIRCYGPEQWTAPVASGSAVPEAMVVCPC
FT                   TTATVSAIATGASRGLIERAADVVLKERRRLVLVVRETPFSEIHLENMLRLARMGAVVM
FT                   PANPAFYHRPQSIDDLVDFMVARVLDHLDIEHALGPRWGEASLPPEGPA"
FT   gene            384407..385015
FT                   /locus_tag="TK90_0361"
FT   CDS_pept        384407..385015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0361"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   aeh:Mlg_0602 peptidase S16, lon domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70876"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ6"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ADC70876.1"
FT                   /translation="MTTLPLFPLNTVLFPEGLLPLRIFETRYLDMVRRCLREDDRFVIV
FT                   AIEPDTESGAPRPEAETDPSVGFHPIGTEVAIVDWDQRPDGLLGILVKGERRHQLHNPR
FT                   RAEDGLWLAEVEPLQERPDVSLPVDYASLADLLERLLDQLGTPWSHLERRFDDSSWVVG
FT                   RLTELLPIDLEIKQQLLEADDPIERLERLRAAMLAASKS"
FT   gene            385072..385455
FT                   /locus_tag="TK90_0362"
FT   CDS_pept        385072..385455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0362"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: bpe:BP1713 thioredoxin 2"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70877"
FT                   /db_xref="GOA:D3SDQ7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ7"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ADC70877.1"
FT                   /translation="MAVQELTQDTFESTITGNNIVILDFWAPWCGPCQQFAPTFEAASE
FT                   QHSDVVFAKVNTDEEQGIAGAFQIRSIPTLMIFREQIIVFSQPGVLSAGQLDEVLGKVR
FT                   ELDMDQVRADVERQQQEQQAGQA"
FT   gene            385499..386446
FT                   /locus_tag="TK90_0363"
FT   CDS_pept        385499..386446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0363"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: hna:Hneap_0304
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70878"
FT                   /db_xref="GOA:D3SDQ8"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ8"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADC70878.1"
FT                   /translation="MLTVMTQMGALIVAGVVWRLLRPGGLDADTARRVLTTLVYYLLLP
FT                   ALVLQVLWTAPLGLDSLRIALVAGTTVLAMVAVTLLACRLCLAERAAVGAMLLAAAWPN
FT                   ATYLGLPVLDSLFGDAGRAVAIQYDLFACLPLVLTLGILLARRYGDPEAVRLYGGGGAI
FT                   RGLVAVPSIWAAVLGVALNLAGLPLVTWLDTWLGFLADSVAPLMLFSLGLALVFDRFRG
FT                   RDLRPLVMVSVIQLLIAPLFALGLVWWVGLEGVPGIGSVLEAAMPAMVLGLVFCDRFRL
FT                   DTGLYAAAVTLTTALSLVTLPLWFAIAGYLIPGG"
FT   gene            386550..387527
FT                   /locus_tag="TK90_0364"
FT   CDS_pept        386550..387527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0364"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   aha:AHA_1269 putative K+-dependent Na+/Ca+ exchanger-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70879"
FT                   /db_xref="GOA:D3SDQ9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDQ9"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ADC70879.1"
FT                   /translation="MVLPVIAVIAGLVLLTWSADRFVFGASAFARSVGVSALLVGLTIV
FT                   AFGTSAPEIVVSVLATLQGNPGLAVGNAIGSNIANIGLVLAMAALVAPLVIGHGLVRRE
FT                   LPILMGVSLAVLFLLLDGELGRLEGGLLISGLLLVTAWVIHIARRAQALDPAEAPEEVR
FT                   GMVEAIPATTSTGRALGWLGLGLALLIASSQLVVWGAVGIAEQLGISDLVIGLTIVAIG
FT                   TSLPELATSLVAAFRREAGLAIGNVIGSNLFNLLAVLAVPALIAPLAIEPEVLVRDYPV
FT                   MLGMTATLFVFALARGSQLRRWQGGLLLVVFAGYLVHLGMTATA"
FT   gene            387524..388501
FT                   /locus_tag="TK90_0365"
FT   CDS_pept        387524..388501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0365"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: aeh:Mlg_2225 KpsF/GutQ family protein;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: sugar isomerase
FT                   (SIS); CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70880"
FT                   /db_xref="GOA:D3SDR0"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR0"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ADC70880.1"
FT                   /translation="MNFNPDTTRKLALAVLNDEAEAVRRLADRVDDAFLEACRHILECR
FT                   GRVVVTGMGKSGHIGSKLAATLASTGTPAFFVHPGEASHGDLGMITRDDVVIALSNSGE
FT                   TDELLTILPLIRRLDVPLIALTGNPGSRLGQDATVHLDVSVEREACPLGLAPTSSTTAA
FT                   LAMSDALAVAVLDARGFTADDFARSHPGGRLGRRLLVHVADIMHTGDAIPRVGPEAPLK
FT                   DALFEITRKGLGLVIVADPEAHILGVFTDGDLRRTLDRGESLEALTIGQVMTRGGHAAR
FT                   PQWLAVEALETMESKRINALPVVDDDQRLVGVLNMHDLLRAGVA"
FT   gene            388501..389040
FT                   /locus_tag="TK90_0366"
FT   CDS_pept        388501..389040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0366"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="KEGG: noc:Noc_2789 phosphatase KdsC; TIGRFAM:
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI
FT                   family; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70881"
FT                   /db_xref="GOA:D3SDR1"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR1"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ADC70881.1"
FT                   /translation="MDRHDEALHSRQAAVRLLILDVDGVLTDGSLFMGDAGEQYKAFHS
FT                   RDGHGIRLALDGGLEVAILTGRTSGVVEHRMRDLGVQHLVQGRRDKGAALHELLEQSGH
FT                   APDEAAFVGDDIVDLPAMRRVGLGIAVADSHPLVLQHAHWVTQAPGGRGAVREVCEGLL
FT                   AAQGRLEALFAEYVDG"
FT   gene            389037..389600
FT                   /locus_tag="TK90_0367"
FT   CDS_pept        389037..389600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0367"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   aeh:Mlg_2227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70882"
FT                   /db_xref="GOA:D3SDR2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR2"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ADC70882.1"
FT                   /translation="MKWVAGPVALILLPMAALVAGAVASEHEPEGEVTLEIEGFTLHAT
FT                   GEDGELSHRLRGTRLREFGRDGPQLIDDPDLDIFDAGGIEWHWTAPEALHRPMDEILDL
FT                   IGPTRGVQPERGERVRTVIESADVTVATDTMIATSDAPSTLEQPGLFQRGTGLRVDSRG
FT                   DTIELFHDVYTLYSESGEEEAAND"
FT   sig_peptide     389037..389105
FT                   /locus_tag="TK90_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.269 at
FT                   residue 23"
FT   gene            389593..390117
FT                   /locus_tag="TK90_0368"
FT   CDS_pept        389593..390117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0368"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG: psa:PST_1033
FT                   OstA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70883"
FT                   /db_xref="GOA:D3SDR3"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR3"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ADC70883.1"
FT                   /translation="MTERGGSSLARAGWSVLLGSALLLLAAPVIAQQQPLPVEITADRA
FT                   EMDDRRGVSTYTGDVVVIRGDMTLEADKVYVRSRDRRPYEMEAHGEPARLESPDPETGE
FT                   MRIATALRIDYLLNEDRVILTDQAHVITAAEEARGKRIVYDLETDVIEAERGEADDERV
FT                   RIRIQPREDDE"
FT   sig_peptide     389593..389688
FT                   /locus_tag="TK90_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.947 at
FT                   residue 32"
FT   gene            390168..390896
FT                   /locus_tag="TK90_0369"
FT   CDS_pept        390168..390896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0369"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hha:Hhal_2125 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70884"
FT                   /db_xref="GOA:D3SDR4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC70884.1"
FT                   /translation="MAGYLTGRELTKRYGKRTVLDRVDVDLAPGEVVGLLGPNGAGKTT
FT                   CFYSLVGLIRPNRGRITLGDRDITRAPIHSRARAGLGYLPQEASIFRRLSVWDNLQAVL
FT                   ELRSELDRHERRRIGDALIEEFQLETVRHSPGIALSGGERRRAEIARALAGDPRFICLD
FT                   EPFAGVDPISVGDIQAVIGHLAQRGIGVLISDHNVRETLGICDRAYILSEGRILSAGTP
FT                   QELLDDPQVRRVYLGENFRL"
FT   gene            390955..392448
FT                   /locus_tag="TK90_0370"
FT   CDS_pept        390955..392448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0370"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor;
FT                   sigma-54 factor core-binding region; KEGG: maq:Maqu_2715
FT                   RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70885"
FT                   /db_xref="GOA:D3SDR5"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR5"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ADC70885.1"
FT                   /translation="MLKPGLNLQLGQTLTMTPQLQQAIRLLQLSTLELQAEIQQALESN
FT                   PMLEQVEDEGEEAPPERPEEGGERVDGDRMQADTAGDDVIPEELSTDSRWDDIYEPAPS
FT                   PRGLDDRDPLENTSDGEDEGLQDHLLWQLHLSHLTPRDQRIGAALIDAISPDGYLDSEL
FT                   EALAEMISQGEDEPVGVDEVEAVLHWIQQCDPLGVGARDLRECLEIQLRHLAPDAPARD
FT                   AARAILENGMESLAKRDYRALQRQSGVRDPDELARALDLIRTLNPRPGAQISESTSEYV
FT                   VPDVYVRHDRDGWRVDLNPEIAPRIRINDLYAGMVRQVSDARDSAFMRDQLQEARWFLK
FT                   SLHSRNDTLLRVAQAIVVRQQGFLEHGEVAMQPLILRDIAETLEMHESTISRVTTQKYM
FT                   HTPRGVFEFKYFFSSHVGTADGGECSATAIRAMIRELIGGETPNKPLSDAKLAQILSDR
FT                   GINVARRTVAKYREAMHIPSSSERRQMASMPSGTKQKGA"
FT   gene            392451..392789
FT                   /locus_tag="TK90_0371"
FT   CDS_pept        392451..392789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0371"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   aeh:Mlg_2231 sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70886"
FT                   /db_xref="GOA:D3SDR6"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR6"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADC70886.1"
FT                   /translation="MQINLTGHHVDITDALRDYVNEKFAKLERHFDKVIDVHVVLTHEK
FT                   NQNLNNKAEANLQVSGNHIHAEASHEDMYAAIDGLIDKVDRQLIKHKEKVKDHHRAEGA
FT                   QRNREQAL"
FT   gene            392794..393264
FT                   /locus_tag="TK90_0372"
FT   CDS_pept        392794..393264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0372"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: aeh:Mlg_2232 PTS
FT                   IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70887"
FT                   /db_xref="GOA:D3SDR7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR7"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADC70887.1"
FT                   /translation="MTIAELITRARIRLEPECSSQKRALETLAELLAVGGEESAGPASG
FT                   AIFEALSAREKLGSTGLGHGVAIPHGRLAELDAPRVAVLRLDQGVDFDAMDHEPVDILI
FT                   ALLVPEAATSAHLDLLAQLARGLSQPDNIASLRRAGDADALERELTRAFGDA"
FT   gene            393332..394363
FT                   /locus_tag="TK90_0373"
FT   CDS_pept        393332..394363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0373"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   xfn:XfasM23_0668 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70888"
FT                   /db_xref="GOA:D3SDR8"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR8"
FT                   /inference="protein motif:PFAM:PF07475"
FT                   /protein_id="ADC70888.1"
FT                   /translation="MNEALGEGGIARDITVEVLIQAMGNRLDLRYVHGEQVAPDRNLVG
FT                   GDGDDLPLAGHLNLIRPNRIQVIGDFEARYIARLSDDQREQLILEMARTGTTAVIFAED
FT                   TCPFSEMPDVPDEQLPLILCSSTSSHEIISLLRYFLQQRLAHFEVRHGVFMEILGIGVL
FT                   ISGASSVGKSEVALELISRGHRLIADDAPEFARIAPDIVRGHCPALLQDLLEVRGLGVL
FT                   NVRAMYGDSAIKGGKYLRLIIDLRDHNEPSPVPDDRLNGRRGEIDILGLRIPLISLPVA
FT                   PGRNIAVMIEAAVRNHMLHMQGYVAGDDLRARQRRQMSGEPEEPPYHRAIPATTVPNPD
FT                   PEG"
FT   gene            394364..395248
FT                   /locus_tag="TK90_0374"
FT   CDS_pept        394364..395248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mca:MCA0739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70889"
FT                   /db_xref="GOA:D3SDR9"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDR9"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ADC70889.1"
FT                   /translation="MRLLLVSGLSGSGKTVALHTLEDAGYFCVDNLPLPLLPGLIEQVR
FT                   SGDYDADEDRHLAVGVDVRSGLAALEGFADLLRELRGKGLQVEVMFLQASSEVLLRRYH
FT                   LTRRRHPLARDGVPLVDAIERERDWLGHVAAEADLTVDTSRLSMHDLARTLRDRVGLLG
FT                   EERLSLLFQSFGFKHGAPLDSDFVFDVRCLPNPHYERDLAPLTGRDAAVCEFLAGHAEV
FT                   EEMYDGIQGFLEQWVPRIRQDHRSYVTVSIGCTGGRHRSVYLVERLAAAWRGREHVTVS
FT                   TRHRELSLPLESE"
FT   gene            395253..395678
FT                   /locus_tag="TK90_0375"
FT   CDS_pept        395253..395678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0375"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: hna:Hneap_0745 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70890"
FT                   /db_xref="GOA:D3SDS0"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS0"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADC70890.1"
FT                   /translation="MGVGLILITHQNLGDTLLQTARSMLGDLPEDCESMAMSQNDDPDE
FT                   VLARARARLGELDSGSGVLILTDMFGSTPSNVASRVARGANARVIAGINLPMLIRVLNY
FT                   RHLPLTELVNKALSGGHDGILLCDQECSDAAARSPHR"
FT   gene            395650..395919
FT                   /locus_tag="TK90_0376"
FT   CDS_pept        395650..395919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0376"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: eba:ebD68 sugar
FT                   transport PTS system phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70891"
FT                   /db_xref="GOA:D3SDS1"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS1"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ADC70891.1"
FT                   /translation="MPQREVPIVNRLGMHARAAAKFVSLASQYASDVTVSRNAQEVNGK
FT                   SIMGVMMLAAAQGSEVTITTDGEDAEEALDALTELVANRFGEDA"
FT   gene            complement(395970..397067)
FT                   /locus_tag="TK90_0377"
FT   CDS_pept        complement(395970..397067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0377"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: aeh:Mlg_2214
FT                   histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70892"
FT                   /db_xref="GOA:D3SDS2"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS2"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ADC70892.1"
FT                   /translation="MSLPHESRSPDALMRPEVLAQPAYQVADATGLIKLDAMENPHPWP
FT                   GALENAWLDALREPQLNRYPDAGARELEKKVRAAHGVPEAAGLLFGNGSDELIQILIMA
FT                   VAASGRPVLAPEPTFVMYGVLARAMGVPFIGVPLNRDFTLDLDAMHAALSEHNPAVVFL
FT                   AYPNNPTGTLDDAAAVQAIVEANPGVTVVDEAYAPFAAHSFLPEVGQHDGLMVMRTVSK
FT                   LGLAGARLGYLAASAGWIDALDRLRLPYNINTLTQRSVAFALDHREALDDQARGIIEER
FT                   GRLSDALAANDGVEHVFPSQANFILFRVREGQGHASFAALRDAGILIKDVGRAHPLLAD
FT                   CLRVTVGRPDENDAFLAALRNALSG"
FT   gene            complement(397064..398368)
FT                   /locus_tag="TK90_0378"
FT   CDS_pept        complement(397064..398368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0378"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: pag:PLES_48271 histidinol dehydrogenase;
FT                   TIGRFAM: histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70893"
FT                   /db_xref="GOA:D3SDS3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS3"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADC70893.1"
FT                   /translation="MPSIARLDTQQPDFDQALEHLLSWESVADTGVRDAVDEILAAVRT
FT                   EGDAAVLRYTAKFDRLDRSAVADLEIPRERLQAALESIPAEQRQALETAATRIRQYAEH
FT                   QKMQDWDFTDEDGTVLGQRVTALDSVGLYVPGGKAAYPSSVLMNAIPAKVAGVELLVMV
FT                   VPAPGGELNDLVLAAAAVAGVDRVYTIGGAQAVAALAYGTQTIPAVDKIVGPGNIFVAA
FT                   AKREVFGTVGIDMIAGPSEILVVCDGETDPDWIAADLFSQAEHDEQAQSILLSWDEAFL
FT                   DRVAEAMDRLLAEMPRAEIIRTSLDKRGALVKVRDSSEAIAVANRIAPEHLELSVADPQ
FT                   AMLDAGLRHAGAIFMGRYTSEALGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSIIH
FT                   CSAEGAAKLGQTAAALAHGEGLTAHARSAELRGGQ"
FT   gene            complement(398383..399450)
FT                   /locus_tag="TK90_0379"
FT   CDS_pept        complement(398383..399450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0379"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: bpt:Bpet2738
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70894"
FT                   /db_xref="GOA:D3SDS4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS4"
FT                   /inference="protein motif:TFAM:TIGR00034"
FT                   /protein_id="ADC70894.1"
FT                   /translation="MTADTDDLRIRDIQEVSAPDTLREELPITDAASETVFAARQACHR
FT                   ILHGEDDRMQVIVGPCSIHDVDAALEYADRLKGLRDELSDALHIVMRVYFEKPRTTVGW
FT                   KGLINDPDLDGSFHINKGLRVARGLLRDLAIKGMPAATEYLDLISPQYIADLVAWGAIG
FT                   ARTTESQVHRELASGLSCPVGFKNSTDGSLRVAIDAIRSASRPHHFLSVTKAGRSAIFS
FT                   TTGNDDCHIILRGGKQPNYDAESIEQACKELRMAELPEQVMVDCSHANSRKDPKRQVDV
FT                   ARSLAEQIAGGDRRIMGAMLESHLVGGRQDILPGKPLTYGQSITDACMGWDETETSLKL
FT                   LADAVRARRKAAVPA"
FT   gene            complement(399461..400111)
FT                   /locus_tag="TK90_0380"
FT   CDS_pept        complement(399461..400111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0380"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: pmy:Pmen_0883 ATP phosphoribosyltransferase
FT                   catalytic subunit; TIGRFAM: ATP phosphoribosyltransferase;
FT                   PFAM: ATP phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70895"
FT                   /db_xref="GOA:D3SDS5"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS5"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ADC70895.1"
FT                   /translation="MMDPNALTIALSKGRILKDTLPLLASAGIELLEDPDKTRKLILDT
FT                   NREDVKIVVVRATDVPTYVQHGAAAIGVAGKDVLMEHGAAGLYEPLDLRIAACRLMLAG
FT                   RPGQQPDPQQRLRIATKFVNITQNYFAQQGRQVEIIKLYGSMELAPLVDLADYIVDLVD
FT                   TGNTLKANGLEPLELITPISSRLIVNQAAMKMRHRTIQNLIEGLREAVTPATT"
FT   gene            complement(400146..401405)
FT                   /locus_tag="TK90_0381"
FT   CDS_pept        complement(400146..401405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0381"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   aeh:Mlg_2217 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70896"
FT                   /db_xref="GOA:D3SDS6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS6"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADC70896.1"
FT                   /translation="MDKLIITGGRRLEGQVWISGAKNAVLPILSATLLADGPMTIGNVP
FT                   HLQDVTTTMELLGRMGVSLTVNERMRIEVDPTTLTQCVAPYDLVKTMRASILVLGPLLA
FT                   RFGEAEVSLPGGCAIGSRPVNLHLRGLEALGAEIDVEGGYIHARAKRLKGARVVFDQVT
FT                   VTGTENLLMAATLAEGETLIENAAREPEVVDLADCLAAMGAKIQGAGTDTIRVQGVENL
FT                   QACEYDVMPDRIETGTFLVAAAVTRGRVRCRNTRPELLDAVLAKLVEAGARIETGPDWI
FT                   ELDMEGRRPKAINLRTAPFPAFPTDMQAQMMTLNTVAEGTGSVVETVFENRFMHALELQ
FT                   RMGADITIEGNTAIVKGVEQLVGAPVMATDLRASASLIIAGLVAEGETAVDRIYHIDRG
FT                   YECIEEKLSQIGAGIRREPV"
FT   gene            complement(401507..401833)
FT                   /locus_tag="TK90_0382"
FT   CDS_pept        complement(401507..401833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0382"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: aeh:Mlg_2219 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70897"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS7"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ADC70897.1"
FT                   /translation="MADARLHATPEGLALSGTLTFATVPGLESRIRALLAGLPARTRVD
FT                   LGEVTRIDSAGVALLVTLWRRVHEQGGELGFHSIPQGLVPLVELYDLQSVIADSVPAGQ
FT                   TDAA"
FT   gene            complement(401826..402494)
FT                   /locus_tag="TK90_0383"
FT   CDS_pept        complement(401826..402494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0383"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   tmz:Tmz1t_0892 toluene tolerance family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70898"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS8"
FT                   /inference="protein motif:PFAM:PF05494"
FT                   /protein_id="ADC70898.1"
FT                   /translation="MKTLRFWALPAPLWLLLLLALPGAAQADNPTEIIKQSIDEVYEKL
FT                   RANEDRAQEDPDFVIGVIEDKILPGVDVEGMSRLVLARHWRDASSEQRERFTEAFKNTL
FT                   LQAYGVQLADHLDKEIRVIERRSRQDDRMAVVATEIVMGSGQSNLQVNYRLRPVNGEWK
FT                   VFDVEAEGLSFVGNFRNRFNEEINRNGLDALIERLEDGDRELVDDAMEGIADETSNNDG
FT                   "
FT   sig_peptide     complement(402411..402494)
FT                   /locus_tag="TK90_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 28"
FT   gene            complement(402516..402974)
FT                   /locus_tag="TK90_0384"
FT   CDS_pept        complement(402516..402974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0384"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: hha:Hhal_2118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70899"
FT                   /db_xref="GOA:D3SDS9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDS9"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ADC70899.1"
FT                   /translation="MKVRFFELAVGVFVLLGVAALFYLAIQVSNVTDYHDRDTYTVTAY
FT                   FDNIGGLKTRAPVTVSGVRIGRVAEIRYDPEQFRAEVTLAIRAEHDYLPMDTQAAIHTA
FT                   GLLGEQYIALEPGGDYDTLQDGDEVMFTQSALVLENLIGRFMTNMGSD"
FT   sig_peptide     complement(402897..402974)
FT                   /locus_tag="TK90_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.642) with cleavage site probability 0.517 at
FT                   residue 26"
FT   gene            complement(403007..403789)
FT                   /locus_tag="TK90_0385"
FT   CDS_pept        complement(403007..403789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0385"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   noc:Noc_2785 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70900"
FT                   /db_xref="GOA:D3SDT0"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT0"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ADC70900.1"
FT                   /translation="MIDAIASLGRSSLNALVVFGRAFLFLLQVLASLDIVIRRFGLTVV
FT                   QIYSVGVRSLLIIIVSGLFVGMVLGYQGYITLVNFGAAEALGGVVALSLVRELGPVVTA
FT                   LLFAGRAGSALTAELGLMKTTEQLSAMEMMAVNPYRRIFAPRFVAGFLSMPLLAAIFSA
FT                   VGVMGGYIVGVGMLGVDSGAYFSQMQSVTDWNEDVLSGVIKSIVFGFVVTWIAVFQGFN
FT                   AMPTSEGISRATTQTVVVSSLAVLGLDFILTGLMFGTG"
FT   gene            complement(403782..404615)
FT                   /locus_tag="TK90_0386"
FT   CDS_pept        complement(403782..404615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0386"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hch:HCH_05314 ABC-type transport system involved in
FT                   resistance to organic solvents, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70901"
FT                   /db_xref="GOA:D3SDT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADC70901.1"
FT                   /translation="MAEPVAEDSPHIVIENLRFRRGRKVVFEDLSMRIPRGQVTTVMGP
FT                   SGSGKTTLLRLIGGQLRPDGGRIWVDGQEVARLSTRRLYALRKRMGMLFQSGALLTDLS
FT                   VFENVAFPLREHTELPEDVLRTLVLLKLEAVGLRSARDLDPASLSGGMARRVALARAIA
FT                   LDPDLIMYDEPFTGLDPITMGQIVTLIRRTNQSLGLTSVLVSHDVTEAMAISDHVVLIA
FT                   DGRAVDAGAPDDLRARASDWSAQFLEGRPDGPVPFHYPGDSYREDLLGVRERRDD"
FT   gene            complement(404697..405338)
FT                   /locus_tag="TK90_0387"
FT   CDS_pept        complement(404697..405338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0387"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_0978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70902"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70902.1"
FT                   /translation="MSKDQQALELQAAGVAGPGDPWWETFFPDDLPADWQLEYYTHYHS
FT                   RLLLPATAWAASVEGPFGPWAEAVPAKLQLTLDWPGGLPPEAGVAALARIENELGGTLQ
FT                   GVALGVMGAEDAAAVEAALKGGHVKTALRAGPAEVHQLPGTREALWYPGQDGTGLWQIE
FT                   PETDLDPMGWRALVETLIAAGGQGPTPVFLRARPDRLSEFRTIAQLLGVG"
FT   gene            405414..406511
FT                   /locus_tag="TK90_0388"
FT   CDS_pept        405414..406511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0388"
FT                   /product="Luciferase-like, subgroup"
FT                   /note="PFAM: Luciferase-like, subgroup; KEGG: afr:AFE_2321
FT                   monooxygenase, luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70903"
FT                   /db_xref="GOA:D3SDT3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT3"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ADC70903.1"
FT                   /translation="MRFDLFHELSVPDFLQTSETEVIDRTLALWERADRLGYGTAWLVE
FT                   HHLMPEFSHSTAPDLVLAAASQRTERLRLGLGVVPLPYHHPLRVAQRVGMLDQLSGGRL
FT                   DLGIGRGFSPREYATFGAEMSESRARVDAGLDALRQAFATGRITQDGPFHHLDDVPVMP
FT                   RPVQDPHPPIWTAAVSPESFTWAAEQGIGALAGPFKPWQMIREDIRLYHESWDASRTDI
FT                   AHPPRVGMTLGVLCLPDGKRARREAKPAFEWFYRHMFQQTLPVLERLIEGYDYYRSLGR
FT                   FRHLVKAGINLKILDMLGMTLVGTPAECRERIEGLREAGVDQVLLAFGAGAVPHELALE
FT                   SMDCFAEEVMPAFAERAPGATGTAG"
FT   gene            406518..407435
FT                   /locus_tag="TK90_0389"
FT   CDS_pept        406518..407435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0389"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   afe:Lferr_1961 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70904"
FT                   /db_xref="GOA:D3SDT4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADC70904.1"
FT                   /translation="MRVAVTGAAGRLGQVLIPALAAAEGIQAVTAIDRRPVVAAARTTP
FT                   LQSDLADLGAEHLAGHDSLIHLAFQLMGGQGGRRRRDRDWVRAQNVELSRHVFQAAAAA
FT                   GVRQIVFLSSAAVYGPWPDSPRPLTERSPARPRFPYAEDKVATEQALLAVAAQYPAVTT
FT                   CILRPPAVVGPHAHPLLRQVARSRAYPAGAEVPVQILWEEDAADAVARAVARQAEGIFN
FT                   LGAEPVWSLRRMALHGRRWGIPVPQGMIRALHPLAWRLTRHAGDPGWVQGLDGALQMDC
FT                   SRAREHLGWTPRVSTSECLERLRR"
FT   gene            complement(407796..408602)
FT                   /locus_tag="TK90_0390"
FT   CDS_pept        complement(407796..408602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0390"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mfa:Mfla_2237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70905"
FT                   /db_xref="GOA:D3SDT5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT5"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADC70905.1"
FT                   /translation="MISAPLGLGLLFVLLGLVAGIPAGMFGIGGGLILVPVFVAIFSLL
FT                   AFDAASLVQLAVGSSLGAIIPTAILSARAHHRRGGVDGTAVRRLLPGIIFGALLGAWLA
FT                   TRIDSDHLGRIFGAFEVAIGIWMLLNVQPPKAPVPRRSVWLGGGTVIGAVSSLIGIGGG
FT                   TLTTPFLVSQGLELRRAIGSAAALGVPIAIGASLVFALPQWTDPAYQAPEWALGYLYLP
FT                   AILGVVIGTAISVRAGVWLTHHLPVGVLRRGFAGVLILAGILMLIR"
FT   gene            complement(408984..410261)
FT                   /locus_tag="TK90_0391"
FT   CDS_pept        complement(408984..410261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0391"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: tcx:Tcr_1570
FT                   glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70906"
FT                   /db_xref="GOA:D3SDT6"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT6"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADC70906.1"
FT                   /translation="MQETERLFEAAKQHIPGGVNSPVRAFKGVGGTPIFMDRANGAYMW
FT                   DADGQRYIDYIGSWGPMVAGHAHPEVIDAVREACNNGLSFGCPTRLENDMAAKVCELVP
FT                   SMDLVRMTNSGSEATMSAIRLARGYTGRDRIVKFEGNYHGHGDSLLVKAGSGALTLGQP
FT                   SSPGVPKELAALTSTLTYNDPDGVRAFFAEKGDEVACIIVEPIAGNMNCIPPEPGFLET
FT                   LREVCDQHGAVLIFDEVMTGFRVSKNCAQGYLGVTPDLTTLGKIIGGGMPVGAFGGKRA
FT                   IMEHLSPLGPVYQAGTLSGNPIAMTAGLKTLEILSRPGFHDELEQRTKKVVAGFEDAAR
FT                   EAGVALTTNQVPGMFGLFFSDQKVTDFAGATACDTAAFGRFFHAMLGEGIYLAPSAFEA
FT                   GFMSNAHSDADLDATIEAARKCFKAL"
FT   gene            complement(410496..411140)
FT                   /locus_tag="TK90_0392"
FT   CDS_pept        complement(410496..411140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0392"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: azo:azo3450 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70907"
FT                   /db_xref="GOA:D3SDT7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT7"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ADC70907.1"
FT                   /translation="MTTDSRAPLRGLYFITPAVPEGVDPRATHLAHAEAALRGGASLIQ
FT                   FRDKELQGDAREAIARELVALAHTHGARCIINDDTELAARIQADGVHLGRDDPDPAAAR
FT                   ALLGPDAVIGVSCYNELARAEAAARAGASYVAFGTMFASPTKPEAAFAGPALVRRARAA
FT                   LDLPICGIGGITPDNAAEVVAAGADLVAVIQGISAAPDPEAAARRISALFD"
FT   gene            complement(411130..411918)
FT                   /locus_tag="TK90_0393"
FT   CDS_pept        complement(411130..411918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0393"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: cvi:CV_0151 hydroxymethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70908"
FT                   /db_xref="GOA:D3SDT8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT8"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ADC70908.1"
FT                   /translation="MNHPPIALTIAGSDPGGGAGLQADLTTFTRLGVHGATAVTAITVQ
FT                   DTRNVVDFTVLPPEQLRAQIEVTLADLEVAAIKISMLGSVENVTVISALLGAHPHIPVV
FT                   LDPVMVAGGGGALATEAVVDATREALLPRATLITPNGPEAARLARSEDPAQWGHQLRQL
FT                   GARNVLVTGGHEGTEQDPIINRLYREDDHVRPFELPRHPAGFHGSGCTLAAAIAAFLAR
FT                   GRDIEPAVIEAQAFMNDAIARGYAPGRGQHIPNRLCPHDD"
FT   gene            412002..412448
FT                   /locus_tag="TK90_0394"
FT   CDS_pept        412002..412448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_2573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70909.1"
FT                   /translation="MSHEFEVESIRPLVAAAKAGGTLNAEVDQALAALEQEINHIAAEL
FT                   QVEHVGPGVGMADMNAEHVYRLVIRQHEIDVTRHEWSLWVCDALDNCDFRATWPVTGAG
FT                   RLRRKQVTAVVPELVTGYRDAVVAAGKGDTPAGQRLEQMAGLFS"
FT   gene            complement(412441..413127)
FT                   /locus_tag="TK90_0395"
FT   CDS_pept        complement(412441..413127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0395"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); KEGG: neu:NE0097 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70910"
FT                   /db_xref="GOA:D3SDU0"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU0"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ADC70910.1"
FT                   /translation="MNLALFDLDNTLLAGDSDHAWNQFLAEVGAVHPTCHAETNDRFYQ
FT                   EYVAGTLDIHEFCRFAFSPLAEHPRAQLEQWREQFIETLIRPMIAPGAQHLLARHREAG
FT                   DELVIITATNQFVTQPIAEILDVDHLIATLAEEREDGEFTGELTGVPCFQEGKIERLRQ
FT                   YLADHPDPEGTITQASFYSDSRNDIPLLEQVGRPVAVDPDPTLAAHARERGWPVISLRE
FT                   PEGSVS"
FT   gene            413322..413888
FT                   /locus_tag="TK90_0396"
FT   CDS_pept        413322..413888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0396"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aeh:Mlg_0427
FT                   dinucleoside polyphosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70911"
FT                   /db_xref="GOA:D3SDU1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADC70911.1"
FT                   /translation="MQVIDCEGYRANVGIILCNRERQLFWGKRVGQDAWQFPQGGIRAE
FT                   ETPEQAMYRELREETGLLPEHVEVLGNTQHWLRYRLPERMVRRHRRPVCIGQKQRWFLL
FT                   RMMGNETDVILDAMGTPEFDDWRWIDYWRPAREVVHFKRQVYRRALCELVPLMFPELEA
FT                   RRPRNAHGRDASDQAPSQVSPVSPR"
FT   gene            413909..416176
FT                   /locus_tag="TK90_0397"
FT   CDS_pept        413909..416176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0397"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="KEGG: aeh:Mlg_0428 phosphoenolpyruvate-protein
FT                   phosphotransferase PtsP; TIGRFAM:
FT                   phosphoenolpyruvate-protein phosphotransferase; PFAM:
FT                   PEP-utilizing protein; PEP-utilising protein domain
FT                   protein; PEP-utilising protein mobile region; GAF domain
FT                   protein; SMART: GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70912"
FT                   /db_xref="GOA:D3SDU2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU2"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ADC70912.1"
FT                   /translation="MLEVLRRVVQEVNGAADFFEALHIIVTRVKAALDIDVCSIYLKSP
FT                   QSGRLVLMASEGLREESIGHVEMDPSEGLVGLVASRAEPVNLDSAQDHPRFRYFPETGE
FT                   EHFLAFLGVPIIHQRNLLGVLVVQQHQARKFDDEHVSFLITLAAQLAGAIAYAEFNDEI
FT                   SSETPLIGHVNVEATGIAGSPGVAIGRAVVAYRLADLDSIPDREGVGVDEELERFAKAV
FT                   AETRTEIEDLKQRMGEALGADEQVLFDAYLMLLGSDSLVHKTEARIRNGQWAPSALRDT
FT                   VRESVRVFDDMEDPYLRERAADVRDLGRRVLSHLLPAERSQEEFPDGGILVGDDLTASH
FT                   LAEVPIERLGAMVSAKGTGSSHIAILARALNIPAVMGVSELPVGRLENREILVDGYRGR
FT                   LFVNPNAELRTEFERLVREERELAEDLRALAKDPAATRDGVAVPVLANSGLLADIKPSL
FT                   ESGAEGVGLYRTEVPFMIRDRFPGEEEQVQLYEQVLASFDPMPVTLRTLDIGGDKALPY
FT                   FPVKEDNPFLGWRGIRISLDHPEIFLTQLRAMLKASCAHDNLQILFPMISALDELKGAM
FT                   TLLNRAREELLDEGFMIPMPKVGVMIEVPAAVYLAETLARRVDFLSVGTNDLVQYLLAV
FT                   DRNNARVANLYDTLHPACIRALELITDGAHRAGKPVSVCGEMAADPAAVILLLGMGIDS
FT                   LSVSVSAIPRVKWVIRSFSTDRAEALLAQCRMLENAEQIRSLLNNALVQAGLGGLVRAG
FT                   KN"
FT   gene            complement(416187..416705)
FT                   /locus_tag="TK90_0398"
FT   CDS_pept        complement(416187..416705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   aeh:Mlg_0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70913"
FT                   /db_xref="GOA:D3SDU3"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU3"
FT                   /inference="protein motif:PFAM:PF03653"
FT                   /protein_id="ADC70913.1"
FT                   /translation="MEAYNWLVSLHVIFMVTWFAGLFYLPRLFVYHAMTDDALGHERFK
FT                   IMERKLFYGIMTPGGVLTIAFGGAMLALIPGYLDEPWMHFKLTLVALLVIYHIWCGWIV
FT                   RDFRDDLNRREHTWFRWFNEFPVPILVGVVVLVINRSIEDALIAIGVVLAIFVLAALIG
FT                   WWKRRREAA"
FT   gene            complement(416768..417283)
FT                   /locus_tag="TK90_0399"
FT   CDS_pept        complement(416768..417283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0399"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: aeh:Mlg_0432 redoxin
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70914"
FT                   /db_xref="GOA:D3SDU4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU4"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADC70914.1"
FT                   /translation="MSSFRIDRKAIIGGIFILALIGVALAIWLTDDGMRPAPDFTATTL
FT                   DGEEVSLSDYEGRPVMISFWATNCPSCVREIPKLIHLHETYAEKGFELLAVAVSYDPIN
FT                   RVESMREDREMPYKVIHDSEDGMSQAFGGVRLTPTTFVISPGGRIVYQKLGDPDFEQIE
FT                   RHLQRWLS"
FT   sig_peptide     complement(417203..417283)
FT                   /locus_tag="TK90_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.789 at
FT                   residue 27"
FT   gene            417386..418441
FT                   /locus_tag="TK90_0400"
FT   CDS_pept        417386..418441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0400"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: avn:Avin_46040
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; SMART: Semialdehyde
FT                   dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70915"
FT                   /db_xref="GOA:D3SDU5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU5"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ADC70915.1"
FT                   /translation="MTATTNSKPIRIGVVGATGYTGVELLRLLARHPSAELAVVTSRGE
FT                   AGTAVADLFPSLRGAVDAVFREPDPDVLGECDVVFFATPHGVAHAMAGALLERGVRVID
FT                   LSADFRIRDPELWARWYGQAHGAPEYLDEAVYGLPEIHRERIRSARLIAVPGCYPTAVT
FT                   LGVLPLLEQGLIDPADVIADAKSGVSGAGRKAQIGGLFAEVQENFRAYAAGGHRHWPEI
FT                   HQTLSGVAGGEVGLIFQPHLVPMTRGIHATLYLRPRRAETDWQACFEQRYADEPFVDVL
FT                   PPGSHPETASVRGTNRCRIAVAQPPHSDRLVVLSVIDNLVKGAAGQAVQNMNLMFGCPE
FT                   DEGLRELAVFP"
FT   gene            418475..419215
FT                   /locus_tag="TK90_0401"
FT   CDS_pept        418475..419215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB4354 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70916"
FT                   /db_xref="GOA:D3SDU6"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70916.1"
FT                   /translation="MPRRRPRIPPPRPVRQRRRRWGLGVLLLAPFLLVVGIGGWLWMHW
FT                   PDEGVIDPQVRIDALTDELQREVEARQQAEAEQQRALRRLSLLETEVDAYRDDVERQET
FT                   ELARLRDEVAFYERLAENNDDSSLGLRDLALQATGQSGVWDVVFQIDRPGLNRSLDVRW
FT                   SVEITGRFEGDDEDTTLDHDDLGVEQERTIEGFRLLRNVRVRVVLPEGFTPEAVAVRVE
FT                   PDEDDGPDAVMKRGEWGRMAGEGA"
FT   gene            419212..419646
FT                   /locus_tag="TK90_0402"
FT   CDS_pept        419212..419646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0402"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   xac:XAC0498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70917"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU7"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ADC70917.1"
FT                   /translation="MIGRKKGRGSKRTRRVDTMIGENAVVRGELEFSGGLYVEGRVVGS
FT                   IRAPSDPSAVLMVAPQGVVEGQVMVPHLVVNGEVRGDMHMSEYVELGATARLHGHLYYK
FT                   SLQITEGASIDGQLERMEEPLQGELEEPPVEESEPQTAVS"
FT   gene            419762..420142
FT                   /locus_tag="TK90_0403"
FT   CDS_pept        419762..420142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0403"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   noc:Noc_1044 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70918"
FT                   /db_xref="GOA:D3SDU8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU8"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ADC70918.1"
FT                   /translation="MSEAMTSNTEAEMDMEIPNPLIFTDAAASKVKGLIEEENNENLKL
FT                   RVFVSGGGCSGFQYGFTFDETVGDGDTVVENGGVTLLIDPMSFQYLVGAEIDYTEGLEG
FT                   AQFVIRNPNATTTCGCGSSFSV"
FT   gene            complement(420208..421338)
FT                   /locus_tag="TK90_0404"
FT   CDS_pept        complement(420208..421338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0404"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   xac:XAC3899 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70919"
FT                   /db_xref="GOA:D3SDU9"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDU9"
FT                   /inference="protein motif:PFAM:PF03702"
FT                   /protein_id="ADC70919.1"
FT                   /translation="MTQRLIGLMSGTSRDGVDAVLVEIEGDGSLHTAGHCHLPYPDALE
FT                   EDLAAAATAEALRFEHLGTLDARVGLFLSRAVQQLLGSTGLKAQDILAIGSHGQTVHHA
FT                   PGADPAFTWQIGDPFRIAEATGIDVIAHFRQRDLAAGGEGAPLACAFHAAWLGHASETR
FT                   AILNLGGIANLTWLEPGQPVRGCDSGPANTLLDGWARRHLGQPYDADGSWARTGHVDRS
FT                   LLEQLLADPYFQRPAPKSTGPEHFSPHWLRQVGGERIDRLNTEDVQATLVELTVEGVRL
FT                   TLESLRTTAPDRVIVCGGGAHNGYLMERLQSQLAGSTVETSERHGIPPQQVEGAAFAWL
FT                   AYRHLQQEAGNLPEVTGARGPRILGCRIPGRAPEST"
FT   gene            421523..422728
FT                   /locus_tag="TK90_0405"
FT   CDS_pept        421523..422728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0405"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="KEGG: aeh:Mlg_0438 tyrosyl-tRNA synthetase; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ib; RNA-binding S4 domain protein; SMART: RNA-binding
FT                   S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70920"
FT                   /db_xref="GOA:D3SDV0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV0"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ADC70920.1"
FT                   /translation="MELDDQLAVFRRGADEILLEEDLRERLKEGRPLRIKAGFDPTAPD
FT                   LHLGHTVLINKLRQLQDLGHHIIFLIGDFTGRIGDPSGKNATRPPLSSEDIERNAATYR
FT                   DQVFRILDPDRTEVAFNSTWMEPLGAAGMVQLASRHTVARMLERDDFHKRYRDHQPIAI
FT                   HEFLYPLIQGYDSVALKADVELGGTDQKFNLLVGRELQKQEGMPPQVILTMPILEGLDG
FT                   VQKMSKSLGNYIAVQDAPDDMFGKLMSISDELMWRYYELLSLRPMGEVRAARRAAEAGE
FT                   RNPRDIKFELGRELVDRFHGPGRGEQAQAAFVERFQKHALPEELPEVTVAVPAEGLLLP
FT                   NALKSAGLVASTSEGRSMIRQGAVRLNGERIEDPGTLIEPGEPVVIQVGKRRVARVSRP
FT                   CA"
FT   gene            423231..424758
FT                   /locus_tag="TK90_R0007"
FT   rRNA            423231..424758
FT                   /locus_tag="TK90_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            424833..424909
FT                   /locus_tag="TK90_R0008"
FT                   /note="tRNA-Ile1"
FT   tRNA            424833..424909
FT                   /locus_tag="TK90_R0008"
FT                   /product="tRNA-Ile"
FT   gene            424933..425008
FT                   /locus_tag="TK90_R0009"
FT                   /note="tRNA-Ala1"
FT   tRNA            424933..425008
FT                   /locus_tag="TK90_R0009"
FT                   /product="tRNA-Ala"
FT   gene            425196..428073
FT                   /locus_tag="TK90_R0010"
FT   rRNA            425196..428073
FT                   /locus_tag="TK90_R0010"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            428195..428309
FT                   /locus_tag="TK90_R0011"
FT   rRNA            428195..428309
FT                   /locus_tag="TK90_R0011"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            428454..428633
FT                   /locus_tag="TK90_0406"
FT   CDS_pept        428454..428633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_2556 protein of unknown function
FT                   UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70921"
FT                   /db_xref="GOA:D3SDV1"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70921.1"
FT                   /translation="MVTVGLVLIGIGTYAVLGGEVAFTPIAPREGSGFGGPIATIIGLA
FT                   FIAGGVYFLRESRR"
FT   gene            complement(428675..429949)
FT                   /locus_tag="TK90_0407"
FT   CDS_pept        complement(428675..429949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0407"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: maq:Maqu_1721
FT                   transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70922"
FT                   /db_xref="GOA:D3S8Z1"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D3S8Z1"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ADC70922.1"
FT                   /translation="MAHDTTENPNGPEDPLTDLLRRGARDLIQQAVEAELRTFMETYAE
FT                   DRMPDGRRAVVRNGYQPQRRVQTGIGDVPVQVPKTRDRSGGGRHFTSSLLPPYLRRARS
FT                   VEELLPWLYLKGVSSGDFQEALSALLGEQAQGLSASTLGRLKQQWLTEHAEWRERDLRA
FT                   YRYSYWWADGIHFNLRGEDDERACVLVIIGVLPDGTKEFVALDDGMRESEQSWYELLVR
FT                   LRDHQGLANGPKLAIGDGALGFWKALARVYPDTRRQRCWVHKTANVLNRLPKRSQPKAK
FT                   SALQAIWMAETRADAEQAFDAFLTAYGDKYPKAAETLAKDREDLLAFYDFPAAHWQSIR
FT                   TTNPIESTFATVRLRTDKTRGCVTRNTVLSLTFKLGQSTQKRWRRLRGYEWLDKLERGV
FT                   KFIDGIEQTEPTNDEASSITDRSAA"
FT   gene            complement(430100..430864)
FT                   /locus_tag="TK90_0408"
FT   CDS_pept        complement(430100..430864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bgl:bglu_1g24370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70923"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV3"
FT                   /inference="similar to AA sequence:KEGG:bglu_1g24370"
FT                   /protein_id="ADC70923.1"
FT                   /translation="MIRFCSLGSGSGGNALVVEIGSTRLLVDCGFSVQEIERRLARQGR
FT                   AASDLDAVFVTHEHGDHLGSAPALSRRYDLRVYASAGTRLAARDSAFAHLEEIQPDIPV
FT                   ELDDALIIPYTVPHDAREPTQFAFSDGASRLVLMTDAGHISPHMIDTASGAQGLLLECN
FT                   HCPEMLASGRYPAKLKRRIADGYGHLPNHDATRLLQSADTSKLEHLIGMHLSSDNNRPE
FT                   LAEQALCEGVGASRDEIAIASQDHGFEWRCIP"
FT   gene            complement(430984..432150)
FT                   /locus_tag="TK90_0409"
FT   CDS_pept        complement(430984..432150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0409"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bpa:BPP2261 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70924"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="InterPro:IPR042268"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV4"
FT                   /inference="similar to AA sequence:KEGG:BPP2261"
FT                   /protein_id="ADC70924.1"
FT                   /translation="MKLPFKPYHSATRATLAIATGLAVAGCGGWGGDRQSGPEYEMSRQ
FT                   MEDLEVPPDLIAPDTERAYRLPDDPGGRISARDMQQDTAQRQQQPAQAQPGAPTRTVQV
FT                   LPESAEVQLMRDGGTRWLQVDGDPGEIWDRLVAFWDSQNLRLERNEPQVGVMQTEWAED
FT                   RAGIPLRGTQNIFARALGNVYDANTRDQYRMRVERVNGQSEIYITHRGAEEQAEGQSWR
FT                   WAMRPSDPELEAEMLNRLLVYLTTGDPGEGGARVAETLVDRPTELQMTEQDGSPALLLG
FT                   GEYERVWRQLGTFLDRAGLLVDEQDRQAGIYEVTYRPDMTGDRDEPGFFGRIFGRGGDR
FT                   RENERYQIRLEDRGDGDLLIEARDIEGDRLSNRDAEFVLERIQTQMQR"
FT   gene            complement(432159..433037)
FT                   /locus_tag="TK90_0410"
FT   CDS_pept        complement(432159..433037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0410"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: pag:PLES_43151
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70925"
FT                   /db_xref="GOA:D3SDV5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV5"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ADC70925.1"
FT                   /translation="MFQGSMVALATPMHADGSLDWPALDRLLEFHIEAGTDAIVAVGTT
FT                   GESATLDFDEHCEAIAHTVKTVGGRLPVIAGTGANSTREAIALTRCAREAGADACLLVS
FT                   PYYNKPTQEGLYLHHKAIAEAVDIPQILYNVPGRTAVDMLPETVERLADIPNIVGLKEA
FT                   TGNNERTAELVQRVGGRLDLFSGEDANGLAFMLAGGQGVISVTANVAPALMSRMCRAVR
FT                   EGHADEAREINRQLDGLHSALFLEANPIPVKWALQRMGMIEEGIRLPLTPLSEPFHAPV
FT                   LDAMRQAGIEV"
FT   gene            433267..433821
FT                   /locus_tag="TK90_0411"
FT   CDS_pept        433267..433821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0411"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   hha:Hhal_2199 amino acid-binding ACT domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70926"
FT                   /db_xref="GOA:D3SDV6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV6"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ADC70926.1"
FT                   /translation="MAEVVGAGSHTHLILNLIGPDQPGLVAGVTRVIVDTGCNLESSRI
FT                   TTLDGYCCMALSASGNWKTLATLESRLERLEAELDLAITVRRGPLDESSQPAMAYAVDV
FT                   VALDAPGLVNALADFFTSRGVNLRDVQTRVYTAQHTGARMFAANMVVDIPAGQHLASLR
FT                   GEFMDFCDELNLDGVLDPIKA"
FT   gene            433869..434345
FT                   /locus_tag="TK90_0412"
FT   CDS_pept        433869..434345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0412"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: rpi:Rpic_1192 alkyl
FT                   hydroperoxide reductase/thiol specific antioxidant/Mal
FT                   allergen"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70927"
FT                   /db_xref="GOA:D3SDV7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV7"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADC70927.1"
FT                   /translation="MTIAIDQTVPEDLRVPATGEQTLGPGDFRGKVVVLYFYPKDSTPG
FT                   CTNESRDFAANKAAFDAAGAVILGVSRDSVKSHENFRTKQELPFDLLSDADEQLCEAFD
FT                   VIKMKNMYGKQVRGIERSTFLIDEQGVLRREWRKVKVPGHVDEVLAAVREMAGQ"
FT   gene            434428..435846
FT                   /locus_tag="TK90_0413"
FT   CDS_pept        434428..435846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0413"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; SMART: Nucleotide binding
FT                   protein PINc; KEGG: noc:Noc_1210 PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70928"
FT                   /db_xref="GOA:D3SDV8"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV8"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ADC70928.1"
FT                   /translation="MSETPEDPKRLFVLDTNVLMHDPTALFRFKEHDIFLPMVVLEELD
FT                   RGKKGVSEVARNVRQVSRFIDELMSGATHEQIAAGLPLQAESLSESTLAPSGRLFFQTR
FT                   NLTSRLPDSLPGSTPDNDILATAQALKTEWSDLPVTLVSKDINLRIKAAVIGLHAEDYY
FT                   NDQVLDDVSLLFSGMTELPADFWETHGAKMDSWQESGRTYYRVTGPLVSEWQPNQFVYR
FT                   EGENPLSAIVLEIDQPNESAVIELVDDYMTPRHSVWGINARNREQNYALNLLMDPEVDF
FT                   VSLLGAAGTGKTLLALAAGLAQTLEDNTYKEIIMTRVTVPVGEDIGFLPGTEEEKMTPW
FT                   MGALMDNLEVLAKSEGAGDWGRAATNDVLTSRIKIRSLNFMRGRTFLNRYIILDEAQNL
FT                   TSKQMKTLVTRAGPGTKVVALGNIAQIDTPYLTETSSGLTYVVDRFRNWTHSGHITLTR
FT                   GERSRLADYASNHL"
FT   gene            complement(436175..436558)
FT                   /locus_tag="TK90_0414"
FT   CDS_pept        complement(436175..436558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0414"
FT                   /product="6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein"
FT                   /note="PFAM: 6-pyruvoyl tetrahydropterin synthase and
FT                   hypothetical protein; KEGG: tcx:Tcr_1389 putative
FT                   6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70929"
FT                   /db_xref="GOA:D3SDV9"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDV9"
FT                   /inference="protein motif:PFAM:PF01242"
FT                   /protein_id="ADC70929.1"
FT                   /translation="MSARYTLRVLTDFASAHTLRDYPGQCANMHGHNWKVEAEVQAETL
FT                   DDAGMAVDFKVVKTAAREIAGQLDHRYLNDVPPFDTVNPTAENIAQWFFRQMSERLNRP
FT                   GLRMHALTLWETDRACVRYSEDG"
FT   gene            complement(436600..438501)
FT                   /locus_tag="TK90_0415"
FT   CDS_pept        complement(436600..438501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0415"
FT                   /product="deoxyxylulose-5-phosphate synthase"
FT                   /note="KEGG: lhk:LHK_02324 Dxs; TIGRFAM:
FT                   deoxyxylulose-5-phosphate synthase; PFAM: Transketolase
FT                   central region; Transketolase domain protein; SMART:
FT                   Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70930"
FT                   /db_xref="GOA:D3SDW0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW0"
FT                   /inference="protein motif:TFAM:TIGR00204"
FT                   /protein_id="ADC70930.1"
FT                   /translation="MTPTPLLDAIEWPADLRAHPASELPGLAGELRQFLIESVSRTGGH
FT                   LAANLGTVELAIALHYAFNTPDDRIVWDVGHQAYAHKILTGRRAGMASLRQYGGLAGFP
FT                   KRAESEYDAFGAGHSSTSISAAAGMALAAKHAGLDRRHVAVIGDGAMTAGMAFEALNHI
FT                   GDLDCNLLVILNDNDMSISPNVGAMNQYFTRLLSGRIYSSVREGSKRMLEFVPPVKAFA
FT                   ERAEEHMKGMLVPGTLFEELGFRYFGPVDGHDVNGLVSILKNLRGGHGPQLLHVVTRKG
FT                   QGYAPAEEDPCRYHGVSKFEPENGLKPSGPKAPTYTDIFSQWLCDQAAADERLLGITPA
FT                   MREGSGLVAFSEQFPERYFDVGIAEQHAVTLAAGMACEGQKPVVAIYSTFLQRAMDQVI
FT                   HDVALQKLPVLFAVDRAGIVGADGPTHAGTFDTALLRSVPNMLLMAPASERECRQMLST
FT                   GYAYEGPAAVRYPRGGGPGVLPEGGSEDLETLPIGRAEVVREGRGLAILSFGALLETAL
FT                   AAGEALDATVVSMRFIKPLDTELLARLASSHERFVALEDHARAGGAGSAVLEWLSAEGL
FT                   TLPCQVLGIPDVFTEHGSREQILADCGLDTEGVLAAIRHASGQENCAEDNGRLGFAG"
FT   gene            complement(438514..439407)
FT                   /locus_tag="TK90_0416"
FT   CDS_pept        complement(438514..439407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0416"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: mca:MCA0818
FT                   geranyltranstransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70931"
FT                   /db_xref="GOA:D3SDW1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW1"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ADC70931.1"
FT                   /translation="MATPDPSEALKAYQRRIETVLDQRLAADSAPDPRLIEAMRYATLS
FT                   GGKRLRPVLVYAAGATCGAPDDVLDAMAAAVEMVHVYSLIHDDLPAMDNDDLRRGRPTC
FT                   HRAFDEATAILAGDALQACAFEIMTAGVRALPGTAALDALAELAHAAGLHGMAGGQAID
FT                   LGACGKPIDLAELERMHRLKTGALIRVSVRLGAIAGGVPGDALGHLTRYAECIGLAFQI
FT                   RDDVLDVEGDPEVLGKACGADARLDKATFPSLQGLEASRERAVALVDEALAELQPFGQE
FT                   ADLLRFLARYIVDRMN"
FT   gene            complement(439417..439689)
FT                   /locus_tag="TK90_0417"
FT   CDS_pept        complement(439417..439689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0417"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII small subunit; KEGG: mgm:Mmc1_1050
FT                   exodeoxyribonuclease VII small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70932"
FT                   /db_xref="GOA:D3SDW2"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW2"
FT                   /inference="protein motif:TFAM:TIGR01280"
FT                   /protein_id="ADC70932.1"
FT                   /translation="MTDTSTDSPAEFEASLEALEALVARMESGELGLEQSLEEFQRGME
FT                   LVGLCQKALDDAQARIEKLASAPAEQGTVSGSAAGTPTDPDDVPF"
FT   gene            439951..440370
FT                   /locus_tag="TK90_0418"
FT   CDS_pept        439951..440370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0418"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: nmu:Nmul_A1847
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70933"
FT                   /db_xref="GOA:D3SDW3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW3"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADC70933.1"
FT                   /translation="MELKGSKTEEALKEAFAGESMANRRYLYFASKADVEGYNDVATVF
FT                   RSTAEGETGHAHGHLEYLESCGDPATGLEFGSTAANLKTAVAGETHEYTDMYPGMAKTA
FT                   RDEGFDEVADWFETLAKAERSHANRFQKALDQLDD"
FT   gene            440527..441879
FT                   /locus_tag="TK90_0419"
FT   CDS_pept        440527..441879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0419"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: nmu:Nmul_A1846
FT                   putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70934"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW4"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADC70934.1"
FT                   /translation="MSAPTHQREGSLEAPTRHPLDWKNPEFYNEESLFAELERVYDICH
FT                   GCRRCVSLCNSFPTLFDLVDESETMEVDGVDRKDYWKVVDHCYLCDLCYLTKCPYVPPH
FT                   EWNVDFPHLMLRAKAVRFQKEGAKAAHKFMSSTDTVGKLAGIPVVAGVVNAANKNGAMR
FT                   KVLDKTMGVHPDAPVPEYHSSKGRSRMAKVAKGVSNPEPAGATQGKVALYATCYGNYNE
FT                   PHLVEDLVKVFEHNGIEVTLVEKEQCCGMPKLELGDLKAVESAKDANIPAMKRMIDQGY
FT                   DIVAPVPSCVLMYKQELPLMFPDEPDVAAVRDRIFDPFEYLMERHKEGKLKTDFPEKLG
FT                   KIAYHAACHLRVQNMGLKTRDLLKLVPDTEIDVIERCSGHDGTYGVKSEFYETAAKICR
FT                   PVVNRVQKAESDHYSSDCPMAGHMIENGLQGKGEDKAPEHPLTLLRQAYGL"
FT   gene            441945..442247
FT                   /locus_tag="TK90_0420"
FT   CDS_pept        441945..442247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbc:CbuK_1623 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70935"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR030907"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW5"
FT                   /inference="similar to AA sequence:KEGG:CbuK_1623"
FT                   /protein_id="ADC70935.1"
FT                   /translation="MASDSYHEPVEELSDESRGMHRAIVSLMEELEAVDWYQQRIDACK
FT                   NEELKAILAHNRDEEIEHAAMVLEWIRRHNPVFDHELKDNLWSDKDYTKMGHHDH"
FT   gene            442288..442893
FT                   /locus_tag="TK90_0421"
FT   CDS_pept        442288..442893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A1845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70936"
FT                   /db_xref="InterPro:IPR021890"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW6"
FT                   /inference="similar to AA sequence:KEGG:Nmul_A1845"
FT                   /protein_id="ADC70936.1"
FT                   /translation="MEASVDKLSREDLYSLEKYHELRPQFRNEVMQHKRNRVVQVGPAV
FT                   TLHFEDRKTMQYQIQEMLRVEKIFDAEGIQDELDAYNPLIPDGSNWKATMMVEYPDVDE
FT                   RKVQLSKLIGIERKTYVQVEGHDKVYPIANEDLDRETDDKTSSVHFLRFELTPEMVSAV
FT                   KSGAAIAMGVEHENYSHRLDAVSEGTRESLASDLDAVN"
FT   gene            complement(443378..444370)
FT                   /locus_tag="TK90_0422"
FT   CDS_pept        complement(443378..444370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0422"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: bgl:bglu_2g16070
FT                   transposase for IS1663"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70937"
FT                   /db_xref="GOA:D3SDW7"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW7"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ADC70937.1"
FT                   /translation="MAHIGIDVSKNKLDCMWVRDLEAGKVKPKVFPNRQDQYPELLRWL
FT                   QRNTGEAPETLQVYLEATGIYHEPLAYWLHEQGVRVHVLNPAQVRFHAQGMGVRNKTDR
FT                   KDSMMLARYGIERAPRRWQPEPPEVRELKRLLSRLEALEEDIRREENRLEKAQFSEDTL
FT                   AQASIDNVLQALREEHRRLQQQIDDHFDAHDHLKRDRALLESIPGIGRVLSASMAATLR
FT                   SRAFTSARQAAAFHGLVPVLQESGTSVQRPPRLAKAGSGRLRKTLYMAAVVATRYNPDV
FT                   RRQYHRLLRRGKAKMAAIGAAMRKLLHIAFGVLKSQTPYQPRNDTPCTS"
FT   gene            complement(445006..446352)
FT                   /locus_tag="TK90_0423"
FT   CDS_pept        complement(445006..446352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0423"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: pap:PSPA7_5249 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70938"
FT                   /db_xref="GOA:D3SDW8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW8"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADC70938.1"
FT                   /translation="MAKAKTQYVCRECGAVSPKWAGQCGDCGAWNTLEEAVPATQAGPR
FT                   GGYAGEVAGITRLGEVEAGEVPRTGTGLSELDRALGGGLVHGSVVLLGGDPGIGKSTLL
FT                   LQTLAMLPVGDTLYVTGEESAQQISMRARRLGLEVDGLRLLTETQVENVIATCERERPR
FT                   VLVIDSIQTLYTAALQSAPGSVGQVRESAAALVRLAKQRGITVILVGHVTKDGQLAGPR
FT                   VLEHMVDTVLYFEGDPDGRYRMLRAVKNRFGAVNELGVFAMLENGLKAVSNPSAIFLSR
FT                   HQGPVPGSVVMVTREGTRPLLVEVQALVSESHAPQPRRITVGLEQNRLTMLLAVLHRHG
FT                   GVALFDQDVFINVVGGVRVTETAADLPMLAAALSSFRDRPLPQEMLAFGEVGLAGEIRP
FT                   VPNGEERLREAAKHGYTRAIAPAANAPRKPIKGMEVVAVSRLSEVLDAL"
FT   gene            complement(446352..447638)
FT                   /locus_tag="TK90_0424"
FT   CDS_pept        complement(446352..447638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0424"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   hha:Hhal_0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70939"
FT                   /db_xref="GOA:D3SDW9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDW9"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ADC70939.1"
FT                   /translation="MQEIPLSFLFGALIVLFLLSAFFSGSETALMALNRYRMRHRAQTG
FT                   HRGAALAARLLERPDRLIGLILLGNNFVNILIAQIATFIGWRLFGDTGVAIATGVLTLT
FT                   LLIFAETAPKTLAALHSERVAYPAAWVYTGLLKVMWPVVWMINVMANGVLRLFGVHMKP
FT                   GQRSALNTDELRSVVSEAGALIPANHQRMLLNLLDLERTTVEDIMIPRNEIVVLDLNEP
FT                   WNEVVEQLVHGSFTRLPVVEGELDHIVGFLHRRDVIPLIERDDFDAEDLRQILTPPYFI
FT                   PEGTALNRQLINFQQQKKRIGLVVDEYGDIEGLITLEDLLEEIVGEFTTDSPAMSDDVL
FT                   RQEDGSAMVDGGIHLRELNRSLGLELPVDGPKTLSGLIVEYLESIPEAPVSVRINDVVM
FT                   DIVQIKNNTIRTVRVVAPDLPTSPDNKEA"
FT   sig_peptide     complement(447549..447638)
FT                   /locus_tag="TK90_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.345 at
FT                   residue 30"
FT   gene            complement(447744..448544)
FT                   /locus_tag="TK90_0425"
FT   CDS_pept        complement(447744..448544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0425"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   aeh:Mlg_1939 cytochrome c assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70940"
FT                   /db_xref="GOA:D3SDX0"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDX0"
FT                   /inference="protein motif:PFAM:PF01578"
FT                   /protein_id="ADC70940.1"
FT                   /translation="MTTVAGLLAVALYLATTGYLIVATRTQPLAAGQPRAPLVLWLAAL
FT                   IVHLAALIPLVVTEAGLNLCLGNALSASLWLVAALLWLTALRHPLAVLGVMILPLTALA
FT                   ALGALLCEDGTRYATSAGIDVHILFSALGWAFLALSTAQAAVMAAQHRALHNHHTSGIV
FT                   RYLPPLFSMEVWLFRMIFIGWLFLGLSLLSGLIFVDDLFAQHLVHKTILSLLAWVIFSI
FT                   LLLGRWRLGWRGTRALAWTTGGFVVLVLAYFGSKLVLEVILGRV"
FT   gene            448701..450089
FT                   /locus_tag="TK90_0426"
FT   CDS_pept        448701..450089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0426"
FT                   /product="signal recognition particle protein"
FT                   /note="KEGG: amc:MADE_01690 signal recognition particle
FT                   protein; TIGRFAM: signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; Signal peptide binding (SRP54) M- domain protein;
FT                   GTP-binding signal recognition particle SRP54 helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70941"
FT                   /db_xref="GOA:D3SDX1"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDX1"
FT                   /inference="protein motif:TFAM:TIGR00959"
FT                   /protein_id="ADC70941.1"
FT                   /translation="MFDGLSSRLQETMKRLKGQARLTEDNIQDALREVRMALLEADVAL
FT                   PVVREFVKDVKEKALGQEVIGSLTPGQALIKVVHDELVATMGGENAALNLAVQPPAVVL
FT                   VAGLQGAGKTTSIGKLARLLREREKKKVAVVSCDVYRPAAIQQLETLAGQVEVTFYPSD
FT                   TSQKPEAIASEAVARARRDGTEVLLVDTAGRLHVDEDMMAEVKALHQAIDPIETLFVVD
FT                   SMTGQDAANTARAFGEALPLTGVVLTKADGDARGGAALSVRQITGVPIKFIGMGERPDA
FT                   LEPFHPERIASRILGKGDVLSLVEEASRQVDQDKAAKLTRKLKKGRGFDLNDLREQLGQ
FT                   MQKMGGISSMLEKLPGGGKLPDAVKNQANDKEIGRMMAVISSMTEHERRHPDIIKGSRK
FT                   RRIAAGSGTQIQDVNRLLKQHAQMSKAMKKFSKGGASKMMRALGGKLGGMGGMGGPGGG
FT                   MPFR"
FT   gene            450193..450450
FT                   /locus_tag="TK90_0427"
FT   CDS_pept        450193..450450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0427"
FT                   /product="ribosomal protein S16"
FT                   /note="TIGRFAM: ribosomal protein S16; PFAM: ribosomal
FT                   protein S16; KEGG: saz:Sama_0889 30S ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70942"
FT                   /db_xref="GOA:D3SDX2"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDX2"
FT                   /inference="protein motif:TFAM:TIGR00002"
FT                   /protein_id="ADC70942.1"
FT                   /translation="MVTIRLLRRGAKKRPFYSIVVTDSRKRRDSGYKEQIGFFNPVARG
FT                   QEEPLRIDLERVDYWLGHGAGMSERVNHLVKGYRKQQAAA"
FT   gene            450492..451001
FT                   /locus_tag="TK90_0428"
FT   CDS_pept        450492..451001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0428"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="TIGRFAM: 16S rRNA processing protein RimM; PFAM:
FT                   RimM protein; PRC-barrel domain protein; KEGG: aeh:Mlg_0885
FT                   16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70943"
FT                   /db_xref="GOA:D3SDX3"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDX3"
FT                   /inference="protein motif:TFAM:TIGR02273"
FT                   /protein_id="ADC70943.1"
FT                   /translation="MNEAGERIRVGRVSGVYGVKGWVRIFSETEPRAAIADFPHLWLRA
FT                   GADWRLVEVEAGRAHGHGVVMKFAETADREAAYGLMGAELAIERDWLPPAEDGEYYWAD
FT                   LLGMKVEHQDGTALGRISGFMETGANDVLVVRGDRERLIPWVRGQYILDVDLEGRRLRV
FT                   DWDPEF"
FT   gene            451010..451777
FT                   /locus_tag="TK90_0429"
FT   CDS_pept        451010..451777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0429"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="KEGG: aeh:Mlg_0886 tRNA (guanine37-N1)
FT                   methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N1)-methyltransferase; PFAM: tRNA
FT                   (guanine-N1-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70944"
FT                   /db_xref="GOA:D3SDX4"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDX4"
FT                   /inference="protein motif:TFAM:TIGR00088"
FT                   /protein_id="ADC70944.1"
FT                   /translation="MRFDIVTLFPELVTAVGESGVTGRAVQQGRLALETWNPRDWGAGF
FT                   HQAVDDRPYGGGPGMVMQYGPLASALEAARADATAPLHVIALTPQGRPIRQAMLRELVR
FT                   KPRVALVCGRYEGIDERFIEAQVDEEWSLGDYVLSGGELGAMVVIDACARLLPGVLGHA
FT                   DSAGQDSFSEGLLDCPHYTRPEVVAGRAVPQVLLGGDHGAIRRWRRREALGRTWERRPD
FT                   VLAREELGVEDLALLDEYRVERRKGGPHTESDD"
FT   gene            451787..452152
FT                   /locus_tag="TK90_0430"
FT   CDS_pept        451787..452152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0430"
FT                   /product="ribosomal protein L19"
FT                   /note="TIGRFAM: ribosomal protein L19; PFAM: ribosomal
FT                   protein L19; KEGG: saz:Sama_0892 50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70945"
FT                   /db_xref="GOA:D3SDX5"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:D3SDX5"
FT                   /inference="protein motif:TFAM:TIGR01024"
FT                   /protein_id="ADC70945.1"
FT                   /translation="MNSVIQELEAEQMKSDVPDFGPGDTLVVQVKVREGERERLQAFEG
FT                   VVIGKRSRGLNSAFTLRKVSYGNGVERTFQTHSPQIAEIKVKRRGKVRRSKLYFLRDRT
FT                   GKAARIKEDIKANRNGA"
FT   gene            452152..452727
FT                   /locus_tag="TK90_0431"
FT   CDS_pept        452152..452727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0431"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: rpf:Rpic12D_2414
FT                   methylated-DNA/protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70946"
FT                   /db_xref="GOA:D3SEA1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA1"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ADC70946.1"
FT                   /translation="MTRVAAQLRSRPPGFPLSADLAMRSQRCLLPGVALAFVWLESGQG
FT                   DLLACGWQRPDDPLDLSPLRDIPTADRSPPAFDPADYARDPTKWRATPAVPPGTEHARR
FT                   VWAALSAIPVGEVRTYAQIASQIGSAPRAVGQACRTNPWPLFIPCHRVVSARHRGTRDI
FT                   GGYAGDQDGPLAEVKRALLVHEGVPQLG"
FT   gene            453059..453913
FT                   /locus_tag="TK90_0432"
FT   CDS_pept        453059..453913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpb:RPB_4372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70947"
FT                   /db_xref="GOA:D3SEA2"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70947.1"
FT                   /translation="MFKKALLALPVAMAVGVAGTAAQADEWQDPNDVLQMLLEAQPDSK
FT                   YLHQSEMNIMMMPDNPALWLLDDGERLFHEERGPNNASLESCDFGKGEGVLEGAYVELP
FT                   RYFDDVGKVMDFEQRLVHCMKEIQGFTSDDSAVSQRHGSGSDIMRLTTYIAHQSSGYAW
FT                   NPPLDHPEEQAMRDAGEKLFFRRGGAMDFNCAACHGDSGKQIRASVLPEMRNSQEWTKA
FT                   VSWPAHRAGQDNVRSQNHRIRGCVWQMRHAGILPDTPVNTALISYWNDAARGEPAILPD
FT                   LKR"
FT   sig_peptide     453059..453133
FT                   /locus_tag="TK90_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 25"
FT   gene            453941..454630
FT                   /locus_tag="TK90_0433"
FT   CDS_pept        453941..454630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70948"
FT                   /db_xref="GOA:D3SEA3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70948.1"
FT                   /translation="MFNKNTVAAGVAAFASVALAAGCAVADGNKADDVDITAMSAEELA
FT                   EHLIFETNSWRDQEMQEGGTWRDRMTQDEIQKACSFDSTRNDLDGETAGRVVALAREQY
FT                   EAPEGDIELGDWRRGAELADSGFGYRIGHNNDDHGTREQGGNCYNCHVMDSSVSVQGTI
FT                   GPNLENYGAQRGDSQEIRQYVHQVISNPHQYFPCTQMPRFQGLLTEEQISHIMAYLLDP
FT                   ESPVNNR"
FT   sig_peptide     453941..454021
FT                   /locus_tag="TK90_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.765 at
FT                   residue 27"
FT   gene            454883..455566
FT                   /locus_tag="TK90_0434"
FT   CDS_pept        454883..455566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0434"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_2280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70949"
FT                   /db_xref="GOA:D3SEA4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70949.1"
FT                   /translation="MFNKKILTAAVVVSASAALAGCDQFFQDASDREVDITQMSPEELA
FT                   EHLVLETDSYRLDQEVQEGGTGRERMQQDEIQALCSLEGSPDSETAGQVVAAARAAYER
FT                   PDGGVELGDWRRGAELARSGYGYRVGHNNDDHGTREPGANCYACHQMDPAETTYGTIGP
FT                   SLANYGRERGTDESVLNYVHEVVSNPHQYFPCTYMPRFGRNFLTEEQISHVMAYLLDPE
FT                   SPVNQ"
FT   sig_peptide     454883..454945
FT                   /locus_tag="TK90_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.764 at
FT                   residue 21"
FT   gene            455777..457699
FT                   /locus_tag="TK90_0435"
FT   CDS_pept        455777..457699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0435"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; Heat
FT                   shock protein Hsp90-like; SMART: ATP-binding region ATPase
FT                   domain protein; KEGG: afr:AFE_3158 heat shock protein HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70950"
FT                   /db_xref="GOA:D3SEA5"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC70950.1"
FT                   /translation="MTDTQTASAAEAHTETRRFETEVSQLLQLMIHSLYSNREIFLREL
FT                   ISNGADACDKLRFEALAQPDAIPQPAELAIDVEVDKEARTVTVRDNGIGMSRDEVIEHI
FT                   GTIARSGTKAFLEKLTGDQKKDSQLIGQFGVGFYSSFIVADHVRLETRRAGTSEASGTR
FT                   WESRGDGEYSLSDCVRPEAGTEITLTLKEDADEFLELFRLRHIISRYSDHLAFPIRMRK
FT                   MDDDGKPTDEWETVNRASALWTRPKSEISDDEYREFYKHVAHDFEDPAAWTHNHVEGRQ
FT                   EYTTLFYIPKRAPFDLWDRDARHGVKLYVKRVFIMDDAEKLLPSYLRFVRGVVDSADLP
FT                   LNVSREILQDNRLVDSIRSGSVKKILGLLETIARNEPEKYAEIWQNFGRVLKEGPGEDY
FT                   ANREQIAGLLRFASTHNSDDTQNVSLADYIGRMKDGQDAVYVITADNASAARNSPHLEI
FT                   FRKHGIEVLLLSDRVDEWLLSHLREFDGKPIKNVAKGDLDLDKIIGEDAAKKDAADDSA
FT                   KADEDLGDLPERIQAALGERVDSVRASKRLVASPACIVLGEHEMALYLQELLKQAGQET
FT                   FSSKPVLEINPKHPLVERLRTAEGDDFDDLASLLFDQSLLAEGGQLEDPSGFVSRLNRL
FT                   LLQKA"
FT   gene            457818..458300
FT                   /locus_tag="TK90_0436"
FT   CDS_pept        457818..458300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0436"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   csa:Csal_1297 peptidylprolyl isomerase, FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70951"
FT                   /db_xref="GOA:D3SEA6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA6"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ADC70951.1"
FT                   /translation="MQVAQNAVVSIHYTLTNDAGETIDSSEGREPLAYLHGNGQLVPGL
FT                   ERELEGKAAGDKVQAKVAPAEGYGEKIDAMVQEIPLEAFQGVDSVQPGMQFQAETQNGP
FT                   LTVTVTKVEGDTATVDGNHPLAGENLNFDVEVVEVREASAEELEHGHAHGVGGHQH"
FT   gene            458526..458780
FT                   /locus_tag="TK90_0437"
FT   CDS_pept        458526..458780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0437"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: aeh:Mlg_0429 BFD/(2Fe-2S)-binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70952"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA7"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ADC70952.1"
FT                   /translation="MIVCICKSVRERDIRELIDSSQEGLRMRDLRDRLGVSSECGKCAR
FT                   RANCLLKGCSRDTAVNVLQVSGARTPPEPVGRPDPAVAM"
FT   gene            458944..459693
FT                   /locus_tag="TK90_0438"
FT   CDS_pept        458944..459693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0438"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   sbp:Sbal223_4165 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70953"
FT                   /db_xref="GOA:D3SEA8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA8"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADC70953.1"
FT                   /translation="MNFDQWIPSERLAGFLDAGGPVVLILLGASVVALAFVLVKLWQLW
FT                   RMRVTDVRPADEALNRFHRGDIQGAIQCAEATPNPAARAVARGIRGLQAGASESIVREE
FT                   VVRYGNATIQSLRQGLRPLEVIGALAPLLGLLGTVMGMIRAFRAMEEAGSQVDPAVLSG
FT                   GIWEALLTTAVGLAVAIPVVAALNWLETRVERVAHRMDDAVTRLFTGGQYAAVPLTAES
FT                   PVQPRPCEADEANSPGGALPRTADAGH"
FT   gene            459680..460078
FT                   /locus_tag="TK90_0439"
FT   CDS_pept        459680..460078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0439"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   hha:Hhal_0453 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70954"
FT                   /db_xref="GOA:D3SEA9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEA9"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADC70954.1"
FT                   /translation="MLDTSRPRRRNLISLTPLIDVVFILLVFFMLASSFLEWRAVQLEA
FT                   PAEAGGAGSMEGAMLVEIRSDGLRLAGEMLSEGDLHDRISARVREEADTRVLVMPAPGV
FT                   SMQDTVNVLEGLADVGARNLSVIRQAQP"
FT   gene            460075..460497
FT                   /locus_tag="TK90_0440"
FT   CDS_pept        460075..460497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0440"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   aeh:Mlg_1846 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70955"
FT                   /db_xref="GOA:D3SEB0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB0"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ADC70955.1"
FT                   /translation="MIGQRRHFQVAHRPRNDDESILPLINIVFLLLIFFMVAGQLSAID
FT                   PFEVEPVESAVDGQPGPDEFMVIIGTEGRLAVNQDEVDLDEMAGLVREHVERHGDAARV
FT                   RVKSDGRAEAVEVVGVLERLREAGIERIDLLTVPEV"
FT   gene            460497..461414
FT                   /locus_tag="TK90_0441"
FT   CDS_pept        460497..461414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0441"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: aeh:Mlg_1845 TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70956"
FT                   /db_xref="GOA:D3SEB1"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB1"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ADC70956.1"
FT                   /translation="MQPTFRHWMVAIVLAVALHLLVAMAFLLREPPAGAEDAGVGGLEI
FT                   SMAAAGGAPHAQQAEPAETTEAEPVDDEPVEAEPVEAVDAEPAEPERQPVEEAEVVEPE
FT                   PEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPEPDSDA
FT                   DSVEAADASPTDEDAEAVEDDPGDEEAGTPGAGATPADADAEGGGEPGVDPDYLAELQA
FT                   WVEQHKRYPRQAQRRREEGTASVWLRLDGDGNVVDYRIEEGSGSRILDRAVEEMVERAD
FT                   PFPAPSAIDRDEFEIVVPVTFSIR"
FT   sig_peptide     460497..460574
FT                   /locus_tag="TK90_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.786 at
FT                   residue 26"
FT   gene            461504..461938
FT                   /locus_tag="TK90_0442"
FT   CDS_pept        461504..461938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_3164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70957"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB2"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_3164"
FT                   /protein_id="ADC70957.1"
FT                   /translation="MHLPGRSIRILIAGLFVFGLSGNAAAEADPEISVQLNKLEADGDD
FT                   CRAHLVLENALGEALESFQLDMVVFDKEGVIQRRTAVELAPLREGSTSVRAFRMPDTDC
FT                   DGIGRILINEIAACEGPEGAIEGCVDRLEIESLADVPLIR"
FT   sig_peptide     461504..461584
FT                   /locus_tag="TK90_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.926 at
FT                   residue 27"
FT   gene            462171..462647
FT                   /locus_tag="TK90_0443"
FT   CDS_pept        462171..462647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0443"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: cvi:CV_3399 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70958"
FT                   /db_xref="GOA:D3SEB3"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB3"
FT                   /inference="protein motif:TFAM:TIGR00754"
FT                   /protein_id="ADC70958.1"
FT                   /translation="MQGDKDVIRYLNQALKGELTAINQYFLHSRMFKDWGLEKLAAAEY
FT                   EESIDEMKHADELINRILFLEGLPNLQDLGTLSIGENTREILEADLALEHASTPVYRDA
FT                   IAHCEQVRDFVTRDLLQKILDSEESHIDWLETQLQLIDRIGLQNYEQSQASSAS"
FT   gene            462696..462902
FT                   /locus_tag="TK90_0444"
FT   CDS_pept        462696..462902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0444"
FT                   /product="Hemin uptake protein hemP"
FT                   /note="PFAM: Hemin uptake protein hemP; KEGG: ade:Adeh_3132
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70959"
FT                   /db_xref="InterPro:IPR019600"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB4"
FT                   /inference="protein motif:PFAM:PF10636"
FT                   /protein_id="ADC70959.1"
FT                   /translation="MSSSEGRRIPESTDASPVSLRTHDHSLGTPREVASSELLRDADRL
FT                   FIRHEGQCYTLRVTSSKKLILNK"
FT   gene            463046..465250
FT                   /locus_tag="TK90_0445"
FT   CDS_pept        463046..465250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0445"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: ilo:IL2393 outer membrane receptor for
FT                   Fe3+-dicitrate"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70960"
FT                   /db_xref="GOA:D3SEB5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB5"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ADC70960.1"
FT                   /translation="MARKTKCRQVGLLTTPYTRNRRDWRRHAVTLAVLGVMGVPVAQAQ
FT                   DAEPTHLAPVQIIGDSVHARDLAGSGAVVEPEQLELDGTTDIHQALKTVPGMYVREEEG
FT                   YGLRPNIGVRAAPPGRSSKVTIMEDGVLMAPAPYSNPAAYYFPTTKRIHSIEILKGAPL
FT                   LRHGPQTTGGVVNLLSTPIPTERQGSIETVVGERGGLDVHGTWGDRVGDWSYMVETVQR
FT                   RSDGFKDIDRSNRDSGFRVEDYVAKLRWDGDRQSVELKAQHSEEVSNETYLGLTDGDFS
FT                   RAPNRRYGLSEIDQMDVEHQGASLTHEFDWSPHVRQTSTVYRNDTARNWFKLSGDLVAD
FT                   ANEGDERAYRILQGTEDTSGGELTYRNNNREYVSQGVQTEFDLALGDHWIRTGVRYHED
FT                   EMDRFQPDELYDQVNGSLVRQSRVEPTGSNNRLEDAKAWSLWITDEWRVTNRLRLNLAM
FT                   RYEDVRTSRVQYADPGRNTVEDRRSNAYSEWLPGASMTFDVNDNWQLLAGVHRGFSPLG
FT                   GGSSDGEQPETSINWELGGRYRTNNLFVEAIGFHSDFTDQREDCSVGSPCSDGSTSGTF
FT                   TTGEAEISGLELQAGTQFAMGRFQVPVSAAYTYTRARISRDNPAQGLEKGDHLQDIPRH
FT                   QLNLRAGLEHPSGWDHYAVLNYTDSSCSSVGCNRSGSSFDETDSLMTVDLTSRYALSSQ
FT                   TDIFLRASNVFDEQRIVARSPYGARPNQPRTISVGLKHRF"
FT   sig_peptide     463046..463180
FT                   /locus_tag="TK90_0445"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.756 at
FT                   residue 45"
FT   gene            465570..465761
FT                   /locus_tag="TK90_0446"
FT   CDS_pept        465570..465761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0446"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_3048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70961"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB6"
FT                   /inference="similar to AA sequence:KEGG:Csal_3048"
FT                   /protein_id="ADC70961.1"
FT                   /translation="MLNKSRLTIFFLALMLALGGASLAGCDNQGPAEEAGEDIDDAMDD
FT                   AGDTMEDAGEEMEDTFDN"
FT   sig_peptide     465570..465644
FT                   /locus_tag="TK90_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.567 at
FT                   residue 25"
FT   gene            complement(465905..466171)
FT                   /locus_tag="TK90_0447"
FT   CDS_pept        complement(465905..466171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_0959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70962"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB7"
FT                   /inference="similar to AA sequence:KEGG:SACE_0959"
FT                   /protein_id="ADC70962.1"
FT                   /translation="MKRSTGILATLAIAPFALILAGCGNGDMDMEEFEQQQMEQQEQGG
FT                   GEPMQPPADEGMQQQQPPQEGGQMPDEEGSMEPPADGGGEQDF"
FT   sig_peptide     complement(466103..466171)
FT                   /locus_tag="TK90_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.444 at
FT                   residue 23"
FT   gene            466409..467080
FT                   /locus_tag="TK90_0448"
FT   CDS_pept        466409..467080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0448"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein; KEGG:
FT                   nmu:Nmul_A0104 Sel1 repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70963"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB8"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ADC70963.1"
FT                   /translation="MADTPELENLVEQARKAWGRGDIEAAIDGWRAGAAAGDARCAYNL
FT                   GVLADEGQYQPRNPEAAARWYRRAAEAGFPDAAFNLAVLYEQGDGVAPDANEAARWFHV
FT                   AAERGNAQAMFNLGLKFDEGRGLPQDAEQAAQWYLLAAEGGEGRGAANLGRLFAMGEGV
FT                   ERSDVSAFKWYAIAAEMGVANAARYRERVARELSPDERLHAGEKAREWLQSQGQPVTRL
FT                   Q"
FT   gene            complement(467111..467554)
FT                   /locus_tag="TK90_0449"
FT   CDS_pept        complement(467111..467554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vesicle-mediated transport protein Bfr2/Che-1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70964"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70964.1"
FT                   /translation="MEVPVSNPSAAVPLGTRPTGSDRLGLGQTSAPAEFDRPLNDPEAG
FT                   EARRPIEDDAEQDSDRRGGDQSDRSLEFGARSEQELSSRARISAEQEAARMRRDGDTPD
FT                   DSAIRDGSSLGQDGVEALRRRVELAVRLAGPTEEPRRELNVVV"
FT   gene            complement(467580..467795)
FT                   /locus_tag="TK90_0450"
FT   CDS_pept        complement(467580..467795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70965"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC0"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2238"
FT                   /protein_id="ADC70965.1"
FT                   /translation="MIDGSASLTGIQNGVTRLRQQAHTVATEPAGGRESTTAQVGMIAS
FT                   QNQVEASVKTLQAEDRMIGSLLDVRA"
FT   gene            complement(467855..468979)
FT                   /locus_tag="TK90_0451"
FT   CDS_pept        complement(467855..468979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0451"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afr:AFE_2677 3-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70966"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70966.1"
FT                   /translation="MFSRLSAWITARSVPAGSAGRIVVLAPKQTLLAASDWLDDLAATA
FT                   GPLTLGVTDSERDGELPDPGGDRPTVALLPNLARERLARLQPRAVVVIGPAGELGPPLA
FT                   AITVPRLWVNAEGDAPAGVEWTGIFAARDQACKAPGAQVIGDPLAGAVELPAAPPPDSD
FT                   FCERFREYHEKGHPILLAPNTGPGEEAFAFAALFAVLRQTAAILLLAPADRERHEPVYR
FT                   DAIKYSLPIIRHNRFMTSFVPRKNRVYYIEDPDTLHSAYGCAHVTLPGGTLAASETPPD
FT                   LALPLAYGSAVVCGPADNPAQPDAATRLRLAAEHTGLVSRGSTPEEVADEVLARLAEGR
FT                   TAQDRRDDLAQWQQRQANARSTIRDALTGSLANA"
FT   gene            469069..469761
FT                   /locus_tag="TK90_0452"
FT   CDS_pept        469069..469761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0452"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hna:Hneap_1820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70967"
FT                   /db_xref="GOA:D3SEC2"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70967.1"
FT                   /translation="MQIRWIVGLIAMAVIMALAMWVYSNPGGQRTQQFTDLPWQVQVID
FT                   EQRTRVLGITLGESTMADQMGRLPVPDIRLFVDPDGSRSVEAYYVNARIPPFETNLVLR
FT                   PDLDEADLDRIESQTTSDRPMPSGAWRYGLSDEALSSLGNVPIVEMSYIPRARWTHDVL
FT                   VERFGEPAERMQVDSDHSYWLYPDRGLAIMVPRRGRVLMHFVTQERWAQTVSRLRDEGR
FT                   RMLGEDHE"
FT   sig_peptide     469069..469128
FT                   /locus_tag="TK90_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.819) with cleavage site probability 0.667 at
FT                   residue 20"
FT   gene            469754..470266
FT                   /locus_tag="TK90_0453"
FT   CDS_pept        469754..470266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0453"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   bra:BRADO2719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70968"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC3"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ADC70968.1"
FT                   /translation="MSDPADEPPVPFWERPLETLSHAEWEALCDGCGRCCLHKLEDEDS
FT                   GDLAFTWLACDLLDCETGACSDYANRRNFVPDCIQLTLEDLASYHWLPPTCAYRLRFEG
FT                   QPLPTWHPLLTGDPETVKQARVSVAGRVIRECDAPDLPLIDYVVDWPGEVPESARLWRP
FT                   VVRLPQE"
FT   gene            470269..470751
FT                   /locus_tag="TK90_0454"
FT   CDS_pept        470269..470751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0454"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: dde:Dde_0959
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70969"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC4"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ADC70969.1"
FT                   /translation="MSGYVDLFVYGTLKQGFANHRTFCKKALKIRAATIAGQLYDLPVG
FT                   YPAVQIPDNSILLKAGQDPARDAGRQHRFRGLTQPAPEGAQGLVHGEWIRLPDPPRTLP
FT                   HVDALEGVRPDGRGEYRRALVPAWTEDGPAALWVYWMPRLPPGARHLADGTWPARP"
FT   gene            complement(470762..470890)
FT                   /locus_tag="TK90_0455"
FT   CDS_pept        complement(470762..470890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70970"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70970.1"
FT                   /translation="MSASHRFKRGTYLSPNVMRFAAPISILHPARIVERTLQDHHS"
FT   gene            complement(470928..472589)
FT                   /locus_tag="TK90_0456"
FT   CDS_pept        complement(470928..472589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0456"
FT                   /product="DNA repair protein RecN"
FT                   /note="TIGRFAM: DNA repair protein RecN; PFAM: SMC domain
FT                   protein; KEGG: mpt:Mpe_A3335 putative DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70971"
FT                   /db_xref="GOA:D3SEC6"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC6"
FT                   /inference="protein motif:TFAM:TIGR00634"
FT                   /protein_id="ADC70971.1"
FT                   /translation="MLRLISIRDFAIIDHLELELDTGLSALTGETGAGKSILIDVIGQL
FT                   LGDRADAGMVREGTQQADLSAEFALPDTGPAGRWLAEQELADPDDDTVLLRRVLTRQGK
FT                   SRAWINGRPVAVGQLRTLGEWLVDIHGQHAHQQLLQRDTQRHWLDGFLEGDRVSRVREA
FT                   HGAWREAARALEQARESQADTSDRLDLLRFQTTELAELAPVQDEYPQLLVEQNQLAHGT
FT                   EVLTALQTASQQIEDDAGVDSRIGHVLHALQDAAQHDERVNPAVELLESARIQIDEAND
FT                   TLRRLADGIELDPERLAELDQRVGEYLRLARKHRVDPEALPGLHDELQTERDALENGDQ
FT                   TLEALEAREQETRTAFDAAAAALSKARRQTAKRIGQAVTDTMQELGMAGGHFEIAIEPA
FT                   DKPQAHGVDHIEFRVAANPGAAPQPMAKVASGGELSRIGLALQVLASQQQTVPTLIFDE
FT                   VDSGISGAVAEVVGRKLRTLGERHQVLCVTHLAQVAAQAHQQLEVQKSHGKDGTRTAIQ
FT                   PLDDERRIEALARLIGGTQLTETTRTHARELLAAAG"
FT   gene            complement(472597..473475)
FT                   /locus_tag="TK90_0457"
FT   CDS_pept        complement(472597..473475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0457"
FT                   /product="NAD(+) kinase"
FT                   /EC_number="2.7.1.23"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: ttu:TERTU_2444
FT                   putative inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70972"
FT                   /db_xref="GOA:D3SEC7"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC7"
FT                   /inference="protein motif:PRIAM:2.7.1.23"
FT                   /protein_id="ADC70972.1"
FT                   /translation="MMPEFNTIGLVGKASDSRTGPLVGRLVELLRTRGRQVRMEEDIPG
FT                   FERPDDIPLLPLAELAEAADLLVVIGGDGTLLSTARRIADAETPVLGINLGRLGFLVDV
FT                   SPETACEELGEVLDGAYELEPRAMLEAELIRDGVTIHEGIALNDVVLHVLSVVRIIEFD
FT                   TAIDGMDIGRLRADGLVVATPTGSTAYALSAGGPILTPQLDAMVMVPVCPHSLNHRPLV
FT                   VSGRSTVEIRLSSGSRSPAQIALDGQENIDFAPGDLVRIRRRERNLTLIHPREHYFLRV
FT                   LRTKLRWGEQP"
FT   gene            473588..474643
FT                   /locus_tag="TK90_0458"
FT   CDS_pept        473588..474643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0458"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: hha:Hhal_1478 heat-inducible transcription
FT                   repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70973"
FT                   /db_xref="GOA:D3SEC8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC8"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ADC70973.1"
FT                   /translation="MENAAINLDARARTLLRTLIESYIRDGQPVGSRTLARTSGLKVSA
FT                   ATVRNVMADLEDLGLIQAPHTSAGRIPTASGYRLFVDSLLQVREPTVEEIRAIQSGFDP
FT                   NATTQDLMGATSNLLSQVTRMAGMVRLPRHRNVALSQLEFLRLGERRVLAILVIDGKEV
FT                   QNRVLELERDFDQDQLQRMANYLNAHLAGKSLHAVRDALLREMRDVRENLDAMMLAAID
FT                   LGEKAVAGEDPDDVVVAGQTHLLSYEELADIDRLRQLLEAFNEKREILGILDQCIRSDR
FT                   VQIFIGRESGLDWFENCSVVTAPYSVDGEVVGVLGVIGPARMSYDRVIPIVDVTARLLG
FT                   SALGDPVHDTK"
FT   gene            474769..475350
FT                   /locus_tag="TK90_0459"
FT   CDS_pept        474769..475350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0459"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: mca:MCA1857 GrpE protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70974"
FT                   /db_xref="GOA:D3SEC9"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEC9"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ADC70974.1"
FT                   /translation="MSDQREPQEPAEASEAADSEHTQPEGAEAVDNTDARLQELEALAE
FT                   ERRDQALRAQAELENQRRRFERELENAHKYAMEKFASEMLEVGDSLEMGLQAARESKDV
FT                   ERIIEGAELTLKNLNRVFEKFGIQAEDPTGERFDPERHQAMSMQEDPENPPNTVVATMQ
FT                   KGYLLQDRVLRPAMVVVSKAPASPNIDESA"
FT   gene            475491..477422
FT                   /locus_tag="TK90_0460"
FT   CDS_pept        475491..477422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0460"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: aeh:Mlg_1900 molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70975"
FT                   /db_xref="GOA:D3SED0"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED0"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ADC70975.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMEGDQAKVIENAEGTRTTPSIVAFSDD
FT                   GEVLVGQSAKRQAVTNPQNTIFAAKRLIGRKFEEDEVQKDIKLVSYNIVKADNGDAWVE
FT                   VQGKKMAPPEISARVLQKMKKTAEDYLGEPVTEAVITVPAYFNDSQRQATKDAGKIAGL
FT                   EVKRIINEPTAAALAYGMDKQRGDRKIAVYDLGGGTFDVSIIEIAEVDGEHQFEVLATN
FT                   GDTFLGGEDFDNRLIDYLVEEFKKDQGIDIKGDPLAMQRVKEAAEKAKIELSSSQQTEV
FT                   NLPYITADNTGPKHLALKITRAKLESLVDDLVKRSIEPCKVALKDAGLSASEVDDVILV
FT                   GGQTRMPKVQEAVQAFFGKEPRKDVNPDEAVAVGAAVQAGVLGGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTKLIEKNTTIPTRANQVFSTAEDNQTAVTVHVLQGEREMASANKSLGRFD
FT                   LQDIPAAPRGVPQIEVTFDIDSNGILNVSAKDKATGKENKIVIKASSGLSDEEVEQMVK
FT                   DAEAHAEEDKKFQQLVGARNQADALVHSAEKSLKDLSDQVSDDERSAIEAAVAEVKKAM
FT                   EGDDVEAIEQSTQKLAEASGKLAEKAYAQGADAAGEAGAEQASGEQQADDVVDAEFEEV
FT                   DDDQKKQG"
FT   gene            477569..478714
FT                   /locus_tag="TK90_0461"
FT   CDS_pept        477569..478714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0461"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: hch:HCH_01225 DnaJ-like molecular chaperone;
FT                   TIGRFAM: chaperone protein DnaJ; PFAM: chaperone DnaJ
FT                   domain protein; DnaJ central domain protein; heat shock
FT                   protein DnaJ domain protein; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70976"
FT                   /db_xref="GOA:D3SED1"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED1"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ADC70976.1"
FT                   /translation="MSQRDYYEVLGVSKDASAADIKKAFRRLAMKYHPDRNPGDEEAEA
FT                   KFKEARAAYDVLSDDQKRAAYDRYGHAGVDGAAGGFGGGAGASNFSDIFEDIFGDIFGG
FT                   GGGRARGSRAFRGSDLQYNLDLTLEEAVFGTEVKIRIPTTVSCQACDGSGAEPGTSPET
FT                   CPTCNGVGQVRIQQGFFSVQQTCPRCEGSGKIVANPCKACNGNGRVQEQNTLDVKIPAG
FT                   VDSGDRIRLAGQGEAGVNGGPPGDLYVQVRVKPHKLFRREGSDLHIEVPISFATAALGG
FT                   ELEVPCLDGRVKLKVPAETQTGKQFRVGGKGVQSVHGGGVGDLICRVTVETPINLTKEQ
FT                   KALLRQFEDSTQAGGTKHSPQAHSWLDGVKGFFEDLNFWSK"
FT   gene            complement(478722..480794)
FT                   /locus_tag="TK90_0462"
FT   CDS_pept        complement(478722..480794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0462"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: pmy:Pmen_0619 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; PAS fold domain protein; GGDEF domain containing
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70977"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED2"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC70977.1"
FT                   /translation="MSETIRILFVTANPNLAEQVISSIRTRGSAVRPEQVETQDDLINA
FT                   LENTRHDVVVLIEPGLALSREVVDTALRDSGRRIPLVLLTERPEPERVLDYEAGSFAVV
FT                   DHEQVELASLMAIRAAEQRRLRQRIQRLEAALHESENRCQLLLDNSRDAIAYVHEGMHL
FT                   YANASWRERFGIEDPDEVDGLPLMDLVTADNRGEMKALLRRFQNGEEGDTARAHFHLQS
FT                   IDGLPFEADLRLSAASVEGEACTQLQLEASQEDPELAERIDFLSQRDLVTGLYNRQHFL
FT                   SAIESAQTRAEETEKPFALLTLAVDRFAEIRAKVGMSAADLLLADMGKLIEDHFPEPAI
FT                   AARLEGEHFGVLAPETRRQEVEERVHGLMQAVTAHVFELNQSSTNCTLSAGVVIADESA
FT                   PSTEDLLDQAHRALEEAVEAGGGVHRFYHPAEGELTQGQADQQWKLRIQDALDHDRLEL
FT                   RFQPIVHLHGNDRPRYSVFVRLRDADGHLHEPPAFLPAAERTGMAPAVDRWIVKTALTE
FT                   LAGCLKTQPKTQFFLKLGTGSMGDPTVVSWLNDDLHALRIPADNVVVELKEPTVVTNLK
FT                   PAMNVSRGLVEMHSHLCIDDFGNGLNPFQLLQHLEADHIKLDPSFVEGLAENEENQEAI
FT                   REYVDAAHAKGKQVIVPHVEDASVLAVLYGLNVNLVQGYFIQSPLAKPTFDFEAT"
FT   gene            complement(480804..482639)
FT                   /locus_tag="TK90_0463"
FT   CDS_pept        complement(480804..482639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_0620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70978"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70978.1"
FT                   /translation="MTDILPKLPTRSAGPESFPHRQPRSLRQWCRALPSADPESAFSHL
FT                   RQALRELNSLALEPGVRYLLVTLLEEPLLPLLQRNGRSLSQRTLPLGARSLRRAREQAE
FT                   ALDSLLTAWLLVAREHHGQGERGARALQAALALSAAQAVHHWRLYQPLPDDFWQRTYAV
FT                   LSWARAQNLAQAQPRDKPRYGLLSMVPVETLAARLMLLGGSDPNALEVGEVDLLARWLD
FT                   RLPLSCAEGLSATPHPGLPVLCAALDSAHPPGLTLREHARLHSDCCVELGPVLEQLREE
FT                   PRRLEPHRRPDERSLTERLLRLWSQLPTRQHSRETTEGQHRLCLLGIKRIQHFLCEELE
FT                   ERKRGTSDAFPPSGVTRDTDRVGVYHMSTAAERGSDFALVDAASPHRPPSELRKLADEP
FT                   PDTAAAAWENVGRGLESARPDEPRTPITKRHTPEQWTVDDIGAGGLRLRLAQPRQSLLI
FT                   GDLAALRHSDDHYWTIGVLRWIRYESEIEISIGVEFLAERGLPVQLQEYRNGRAAGPAH
FT                   PGLFASLRRDRGGAALFMPAQVFDHESRLVCWLAGRPRVLALDSERTGTTLFTETGCRM
FT                   TDLTLGEPPPDDMEANEAVTEQVRSGLSLTPRERK"
FT   gene            complement(482733..483779)
FT                   /locus_tag="TK90_0464"
FT   CDS_pept        complement(482733..483779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0464"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: csa:Csal_2532 L-lysine 2,3-aminomutase;
FT                   TIGRFAM: lysine 2,3-aminomutase YodO family protein; PFAM:
FT                   Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70979"
FT                   /db_xref="GOA:D3SED4"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED4"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ADC70979.1"
FT                   /translation="MITRTPRGTQPSDRTHAGDTTPLWQQALARAIRDPVTLARELELD
FT                   PAHLPGLHAGHTLFRVRVPRSYLARMRKADPQDPLLLQVLPQQQESEEHPGFVADPVGD
FT                   HDALAAPGLVHKYHGRVLLLTTGACAVHCRYCFRREFPYAEHNASQDDWAPAIAYIHAD
FT                   TSIREVILSGGDPLSLSDRRLADLVRRLEAIPHLERLRIHTRLPVVLPERVDEQLLSWL
FT                   GKGRLHHVLVLHANHPREFADPAAPALARLQARGITLLNQAVLLAGINDDPDTLCELQE
FT                   AGFRHGVLPYYLHLLDRTRGTAHFEVTEHRALELHQALHARLPGYLVPRLVREIPGEPG
FT                   KTPRWAGL"
FT   gene            483859..484422
FT                   /locus_tag="TK90_0465"
FT   CDS_pept        483859..484422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0465"
FT                   /product="translation elongation factor P"
FT                   /note="KEGG: aeh:Mlg_0684 elongation factor P; TIGRFAM:
FT                   translation elongation factor P; PFAM: Elongation factor P
FT                   ; Elongation factor KOW domain protein; Elongation factor
FT                   P/YeiP protein; SMART: Elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70980"
FT                   /db_xref="GOA:D3SED5"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED5"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADC70980.1"
FT                   /translation="MATYSTNEFKAGLKLLLDGDPQAIVENEFVKPGKGQAFNRVKLRN
FT                   LRTGRVLEKTFKSGESVEAADVMDTEMQYLYNDGEFWHFMVPDTFEQYAVGEAALGGCG
FT                   QWLKEQDVCTVTLWNGEPLSVVPPAFVEMKITQCDPGVRGDTAQGGTKPATLESGAVVK
FT                   VPLFVEEGETVKVDTRSGEYVSRV"
FT   gene            484442..485407
FT                   /locus_tag="TK90_0466"
FT   CDS_pept        484442..485407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0466"
FT                   /product="Lysine--tRNA ligase"
FT                   /EC_number="6.1.1.6"
FT                   /note="PFAM: tRNA synthetase class II (D K and N); KEGG:
FT                   smt:Smal_2581 lysine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70981"
FT                   /db_xref="GOA:D3SED6"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED6"
FT                   /inference="protein motif:PRIAM:6.1.1.6"
FT                   /protein_id="ADC70981.1"
FT                   /translation="MTDWRPGAAAAREARARLLTGLRGFFAARNVLEVETPILSHGAPL
FT                   DPMVESWTATSPDGASGYLQTSPEYPMKRLLADGAPDIYQIARVFRGGEAGPRHNPEFT
FT                   LLEWYRHGMDHHRLAREVVALIMNQAALDASWRRPARLREISYQALFQAHLGIDPLVAD
FT                   ADELQAVAARQGLDIQGALDRDAWLDLLISLAIAPAFPDDRLTVVHDYPESQAVLARPC
FT                   EQDARLAARFEVYWGALELANGYHELSDLAQFRERRDRDQALRRQRGQVLPRPDAHLDA
FT                   ALASGLPECAGVALGVDRLLMRLLGVERIEQVIDFPFESA"
FT   gene            485528..486994
FT                   /locus_tag="TK90_0467"
FT   CDS_pept        485528..486994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0467"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: aeh:Mlg_1692 D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; TIGRFAM:
FT                   D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70982"
FT                   /db_xref="GOA:D3SED7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED7"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ADC70982.1"
FT                   /translation="MRKCFFWFARRTFRRALSPWTLCAALLLVLPPAQAQFEHLPAPLQ
FT                   RAIQAQGLPPDSVGLWVQRVPDGAVLARLNADTPYNPASTVKLATSLAALHELGPNYTW
FT                   TTEIWATRPVQDGVLRGDLVIRGTGDPGMVTEEYWRMIGELRRTGLKRIEGDVILDASH
FT                   FQLPNGDPGDFNRQPLRAYNQLPYALHVNSNSQRFHVRPERRGNGIDVVVDPPLPGLEV
FT                   VNRLQPTRGGCGEWQRGIQFNVDQNAQRVTFSGQYPVNCGNYEMLRSVLTPEANHAEMF
FT                   RMAWDQWGGELTGRVRTGVLPVLHDEPIVRHRSRPLSDLIRVSNKWSSNVMSDHLLLTL
FT                   GARKNGPPATMDKGREALVHSLRDLGVDVGGMVVDNGSGLSRDARMTARQLGEILEAGW
FT                   KHPHRPEFQSSLALSGLDGTLRNRFRNGDLRGQMHLKTGHINEVSAVAGYVRTSSGDDV
FT                   IVTVLVNGPRAHIGHGRNLQDAVLEWAHGL"
FT   sig_peptide     485528..485635
FT                   /locus_tag="TK90_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.991 at
FT                   residue 36"
FT   gene            complement(487024..487629)
FT                   /locus_tag="TK90_0468"
FT   CDS_pept        complement(487024..487629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:all8565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70983"
FT                   /db_xref="InterPro:IPR011727"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70983.1"
FT                   /translation="MRPRQTTRWPSLILVIGLAGLLSGCAPTTLKAPAEPEDPVTVAVL
FT                   DHGRHSSLVLPTEPPGHWLRYSYGDWSFYVERNTGPGAMLAAVFASTRAALGRQELEGA
FT                   DLNAAVRTSLRVPLEDIHHIEVPATRAQALIEKLEAIWEEGADERVDSAAWGMSFVHHP
FT                   DAYTLRHNSNHVVAQWLESLDVEVSKKPVLSNWQVETR"
FT   sig_peptide     complement(487534..487629)
FT                   /locus_tag="TK90_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.714 at
FT                   residue 32"
FT   gene            487754..488317
FT                   /locus_tag="TK90_0469"
FT   CDS_pept        487754..488317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0469"
FT                   /product="protein of unknown function DUF1043"
FT                   /note="PFAM: protein of unknown function DUF1043; KEGG:
FT                   tmz:Tmz1t_0576 protein of unknown function DUF1043"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70984"
FT                   /db_xref="GOA:D3SED9"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:D3SED9"
FT                   /inference="protein motif:PFAM:PF06295"
FT                   /protein_id="ADC70984.1"
FT                   /translation="MVTTSAFATALRHNGDRVSSRKVTVEDQTAVGLWTALGILAIVVA
FT                   GLVGFWVGRVTSDERKLIRELEEELDRRMQELTRYRGQVNDHFDRTATLFATMAGSYRD
FT                   LYHHLAQSAEELADKPTRDRLEDRAGRLLSNVPNRDYGGSPGEGRSHRERDSEPEGDVP
FT                   DRRYESDYRESSDAEQSPSRPRAD"
FT   gene            complement(488432..488827)
FT                   /locus_tag="TK90_0470"
FT   CDS_pept        complement(488432..488827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0470"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: dsa:Desal_0535 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70985"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE0"
FT                   /inference="similar to AA sequence:KEGG:Desal_0535"
FT                   /protein_id="ADC70985.1"
FT                   /translation="MPARLLLILFVASVLVLAGCRGTAPVHNVSDTTVTDVHGERPSAE
FT                   QMQKAIRNAGAALGWQMSETESGLLEGRLSLRDHIAVVEIPYSDGAYSIRYKDSSNLNY
FT                   EDGRIHPNYNNWVQNLDNQIRAEISAL"
FT   sig_peptide     complement(488741..488827)
FT                   /locus_tag="TK90_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.887) with cleavage site probability 0.420 at
FT                   residue 29"
FT   gene            complement(488937..489677)
FT                   /locus_tag="TK90_0471"
FT   CDS_pept        complement(488937..489677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0471"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cbc:CbuK_0781 glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70986"
FT                   /db_xref="GOA:D3SEE1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE1"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADC70986.1"
FT                   /translation="MAVVHALIPAHNEAPTIAAVVAATQPHVDRVIVVDDGSQDGTADR
FT                   IGVQPGIVELLRLPRNRGKANALWTGMQHALEQGADAVITLDADGQHDATEIPNLIAAW
FT                   RAHPHHLVIGARLKGRETTPPLRLFGNRTADFWIGWASGQPLRDSQSGFRLYPADLLRR
FT                   LELPHGERRSFVFESEALIEAERLGFPVTLVPVRCIYPDQHRASHFRAATDTLRIIQMV
FT                   ALRLLARGLHPLGLLRHLGLLRRP"
FT   gene            complement(489687..490409)
FT                   /locus_tag="TK90_0472"
FT   CDS_pept        complement(489687..490409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0472"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rso:RSc0435 3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70987"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE2"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADC70987.1"
FT                   /translation="MSHRALITGASGAIGQAIARALADSGCEVLLHAHRNPGPAWDLAE
FT                   QIHSEGGQADVLVFDITDAAAARAQLEPVAAAQPVQILVHNAGVHDDAPLAGMSPEQWA
FT                   RPIDVALNGFYNVAQPLLLPMITTRWGRVIAISSVAGVVGNRGQANYAAAKSGLHGAIR
FT                   SLAQEVGSRGITANAVAPGIIETAMSESSFDAETIRRMVPAQRAGRPEEVAGLVAYLAS
FT                   EQAGYVSGQVIGINGALA"
FT   sig_peptide     complement(490350..490409)
FT                   /locus_tag="TK90_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.616 at
FT                   residue 20"
FT   gene            complement(490406..490861)
FT                   /locus_tag="TK90_0473"
FT   CDS_pept        complement(490406..490861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70988"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE3"
FT                   /inference="similar to AA sequence:KEGG:RSc0425"
FT                   /protein_id="ADC70988.1"
FT                   /translation="MKAASPQLNHEAICRLLPHAGAMCLLEAVVEWDEQAIRCRAISHR
FT                   APDNPLRNTTGLPALSALEYGAQAMAVHGALLADAGPPRAGFLAAVRNLRVHRTELDDL
FT                   NADLDITARSVMSDRNSSIYDLEVSAEGEPVLSARATVILQTEDDPT"
FT   gene            complement(490913..491689)
FT                   /locus_tag="TK90_0474"
FT   CDS_pept        complement(490913..491689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B3926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70989"
FT                   /db_xref="GOA:D3SEE4"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE4"
FT                   /inference="similar to AA sequence:KEGG:Reut_B3926"
FT                   /protein_id="ADC70989.1"
FT                   /translation="MKVGIAGVGLLGPGLADFASARPVLAGQEPYERAPVTIPPTTLLP
FT                   ANERRRTTDTIRLALKAAEEATADCDRSQLRSVFASSSGDMDIIDRICEALTQAEPMVS
FT                   PVQFHNSVHNAPAGNWSIATGNPAPATAISGFDATLAAGLLEAATLLQADGGEVLLAAY
FT                   DVASMATFRRVRPITEPFAVGLRLGPAVAGRPTLELALGEGGDPTPCRQDSLEALRGTN
FT                   PAARALPLLEVLARGEGGHVTLAAPLGRSLEIRVTP"
FT   gene            complement(491686..492870)
FT                   /locus_tag="TK90_0475"
FT   CDS_pept        complement(491686..492870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0475"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: azo:azo3911
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70990"
FT                   /db_xref="GOA:D3SEE5"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE5"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ADC70990.1"
FT                   /translation="MNPLVISAHTLTSATGTGRQANADALHKAHSGLRACDLDSVQLDT
FT                   HIGRVTGVEEIVLTDHLATFQCRNHQLAELGLRQDGFIEAVETARERYGAGRIAVLMGT
FT                   STSGIAATEQAYRRREPATGDLPPDYDYQHTQNMFSLADFVSTRLGLRGPAMVVSTACS
FT                   SSAKVFADAERFIAAGLCDAAVVGGVDSLCGMTLHGFNALQLVAPEPCRPLHAERAGIS
FT                   IGEAAGFFLLERPDSGAAGPRLIGHGESSDAHHMSAPHPEGLGAASAMEQALTRAQRSA
FT                   GAIDYVLMHATATPANDRSEARALARLFGADSRATGTKGLTGHTLGAAGAVGVAQALAS
FT                   LERGFVPATAGLDHPDPELELDARGVAEEREIRHVLVNAFGFGGNNCSLLLEAA"
FT   gene            complement(492910..495294)
FT                   /locus_tag="TK90_0476"
FT   CDS_pept        complement(492910..495294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0476"
FT                   /product="xanthomonadin exporter"
FT                   /note="KEGG: xcv:XCV4181 xanthomonadin exporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70991"
FT                   /db_xref="GOA:D3SEE6"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE6"
FT                   /inference="similar to AA sequence:KEGG:XCV4181"
FT                   /protein_id="ADC70991.1"
FT                   /translation="MPNRFPLSPGPALWLIGLLVAASILLWRGELVTDLQGFTPEPVTE
FT                   TGVALDPGGGPAGQILLLGLEGGNSQARADASDHLVQALRDHPAVAEIRNGRLDPDDPA
FT                   LDFLLEHRYLLSPEVTPERFSVDTLRDQLEERREDLGSAAPLMPRELIGRDPTGESLVV
FT                   LEQLGQAGGGGERDRHGVWVDPERERALLVLHSAAEGMDLDGQEALLKALDEAFAEYAD
FT                   DLGLLVAGPAVIAVEARGRIRGEITAFSLAASLALATLLLVVFRHPHPVWLAAVPLATG
FT                   ILSGAAVVTMVFGHLHGIALAFGITVLGIALDYPLHLFAHSRPPPRDGMRGVARELWPA
FT                   IGLGAGSTVLVYALMAITGFSGMAQLGLFVLTGVGVAAITTRWVLPRLMPQALQRDGVP
FT                   PARLPVPAALTQPPVAARWILAASVLGALVVIASTDPFPWEGNLGALHPVPQEHIDRDR
FT                   ELRHALGLPDIRHALLITAPDPERALQAIEALNPGLEDLRDQGTLTDYDHAAQVLPSQT
FT                   LQRIRQEALPAADTLRARLDTAVDGLGFRADAFEPFLEDVARTRDLEPLTPETLPEGPL
FT                   RQTTGTLLMPDVDRGDWLAWVRLSGVEDATAVRQWLQREPLADLPGLADVGVQHVDFLR
FT                   ASEDLVSGFRDQALERLALGVVAVALLLLLVTRAPGRSLRILTAVGSGLVLTVAALILL
FT                   GVSLSLFHLIALLLIVGLCLDYAVFFSRPLRDLQARQDTATSVSICALSTVAVFGLLAL
FT                   SSLPVLRAMGLTVVLGVVFSFLAAALLAQPPQSRRTVPANH"
FT   gene            complement(495298..495915)
FT                   /locus_tag="TK90_0477"
FT   CDS_pept        complement(495298..495915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0477"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cti:RALTA_B1474 conserved hypothetical
FT                   protein, putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70992"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC70992.1"
FT                   /translation="MTRPAKPCCRQLLGVRALALAVLLLACPLFAKAETSGDTLDQILE
FT                   ALADNPPSRIDFRETRQDPLLEFPETRTGTLVFEPPDILERRMDGDGGERVRIEGRQVI
FT                   VERRGSSREVDLDEQPGLAAFAALFRSLAKGEREGLEEHFEVDTEGDLEAWKLELAPRD
FT                   RALRRMILGLELQGEGGALLRLDTEESGGRHSRMQLDPQDGD"
FT   sig_peptide     complement(495814..495915)
FT                   /locus_tag="TK90_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.550 at
FT                   residue 34"
FT   gene            complement(495899..496798)
FT                   /locus_tag="TK90_0478"
FT   CDS_pept        complement(495899..496798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0478"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   xca:xccb100_4201 xanthomonadin biosynthesis
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70993"
FT                   /db_xref="GOA:D3SEE8"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE8"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ADC70993.1"
FT                   /translation="MSRGWFSQGERGSPLALRIILWVALHLGRPAGRTLLYPITAYFLL
FT                   FAPKSRGYSRDYLRRVLGREPRLREIARHFHSFAAVILDRVFLLSGKDACLDLHVHNRE
FT                   IFLEHVESGHGALLLGAHLGSFEALRVLAVGKNDFPVRVLMYRNHNQRITQLLEALNPE
FT                   VAASVIPLGDTETLLHARDCLEQGGIVATLADRVAESDKMVECRFLGGRAFFPQGPLLL
FT                   AAVLKVPVILCFGLYRGGNRYDIVFERFADVIEAPRGRREEALAEWVQRYADRLETRVR
FT                   EAPYNWFNFYDFWNDSSR"
FT   gene            complement(496795..497121)
FT                   /locus_tag="TK90_0479"
FT   CDS_pept        complement(496795..497121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0479"
FT                   /product="acyl carrier protein dehydratase-like protein"
FT                   /note="KEGG: xca:xccb100_4202 acyl carrier protein
FT                   dehydratase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70994"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEE9"
FT                   /inference="similar to AA sequence:KEGG:xccb100_4202"
FT                   /protein_id="ADC70994.1"
FT                   /translation="MAPIIATRRIPANHPSLPGHFPGQPVVPGVVILDTVDAVARASGL
FT                   GPVAALPRAKFLAPLLPEVDFRVEIDPPGTSGLRAFRVIRDGAETSEPLCSGQLKLHDA
FT                   GQTA"
FT   gene            complement(497125..498465)
FT                   /locus_tag="TK90_0480"
FT   CDS_pept        complement(497125..498465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0480"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   xop:PXO_03741 AMP-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70995"
FT                   /db_xref="GOA:D3SEF0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF0"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ADC70995.1"
FT                   /translation="MRDSNTLALIADHPTPLAWVAGRRVSRAAFLADVRTLARRIPAGG
FT                   AHFNLCEDRYRFAVAFAAILLRGGASILPPNRARTTLSEIAERHPGAHALVDERDLSIT
FT                   LPVIPVTVDGTEHAHNAGATPEIPSDQMAVHAYTSGSTGQPTAHSRSWNSLHVVTAQAL
FT                   RRFGLDTDGGTLVGTVPAQHMYGLESTVLYALLGPCTLLAERPFFPDDIRQAMAEHAPA
FT                   NLVTTPFHLDACLRAGLIWPRAARILSATAPLEQDRAQAAETLFGATVREIYGCTEAGA
FT                   IASRETAREPLWTVYDGIALTAQGSDRVAVQGPQHPAPVPLPDRIEWEDAQRFRMRGRL
FT                   ADQLNIAGKRASLAELNRRLNAIPGVEDGVFIPPDSGQDSGTARLAAIVVAPERSEAEI
FT                   LAALAETTDPLFLPRPLVMVEALPRSATGKLPRQVLLDLLDQHGQCA"
FT   gene            complement(498462..499076)
FT                   /locus_tag="TK90_0481"
FT   CDS_pept        complement(498462..499076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0481"
FT                   /product="ketosynthase"
FT                   /note="KEGG: cja:CJA_0100 ketosynthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70996"
FT                   /db_xref="GOA:D3SEF1"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF1"
FT                   /inference="similar to AA sequence:KEGG:CJA_0100"
FT                   /protein_id="ADC70996.1"
FT                   /translation="MSTRLAAAVALGYPVAVIAGIFLELPRLPLAWLALLILVLAWPVL
FT                   PVLGRAVMALVLAVLVLLLGAEPAGKWLIYAVPVLIQGALAWLFARSLRPGSTPLITRY
FT                   ALAMGASDSTPVHRYTRRLTAVWALLCGGLALLSAILAVAVPTTTWALFANGINYLFLA
FT                   ALFMLEYPLRRWLLRDEPRAGFLPYLAALARADHRQILRQR"
FT   sig_peptide     complement(499017..499076)
FT                   /locus_tag="TK90_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.923 at
FT                   residue 20"
FT   gene            complement(499073..499345)
FT                   /locus_tag="TK90_0482"
FT   CDS_pept        complement(499073..499345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0482"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG: xcb:XC_4101
FT                   acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70997"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF2"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ADC70997.1"
FT                   /translation="MAAQTAMEQEVARLIVDSLNLEEVSPEDIEPEAPLFREGLGLDSI
FT                   DALELALAISRAYGVQIRSDDENNRQIFASLRALTAHIEAHRATS"
FT   gene            499600..500274
FT                   /locus_tag="TK90_0483"
FT   CDS_pept        499600..500274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0483"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   ddr:Deide_07400 conserved hypothetical protein, precursor"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70998"
FT                   /db_xref="GOA:D3SEF3"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF3"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ADC70998.1"
FT                   /translation="MIGGRVGLRRVGPDGLLTFGLSNLVIVLTAGLSWLALWGRMHLWV
FT                   RSLDCPGRAPWVIVLGQQLQEGCPGPGYRLRLLRTLRLLRRDPEARVLLLGGYTSPEGP
FT                   SESAAGAAFLRQRGIPASRIFCEEDSRHTLENLQNARDLLVQRTGGRLPRCVLVTSRFH
FT                   LPRAVAIARGVGLEVCPCPAERSPRVPQVRLAREIWMLHWYHTGRLFARLIRHQGMLDR
FT                   IS"
FT   gene            complement(500311..503088)
FT                   /locus_tag="TK90_0484"
FT   CDS_pept        complement(500311..503088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0484"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: aeh:Mlg_0555
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADC70999"
FT                   /db_xref="GOA:D3SEF4"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF4"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ADC70999.1"
FT                   /translation="MDKSFDPKSIEQTQYERWEAANIFAPPESGEANYCILLPPPNVTG
FT                   TLHMGHAFQHTLMDTLIRYRRMHGDRTLWQGGTDHAGIATQMVVERQLAAEGKSRHDLG
FT                   REDFLKAVWEWKHESGGTITRQMRRLGDSVDWSRERFTMDDGLSEAVREVFVRLHDEGL
FT                   IYRGKRLVNWDPVLHTALSDLEVLSEEESGHLWHFRYPLADGSGHLTVATTRPETMLGD
FT                   TAVAVHPEDERYRHLIGKTIRLPLVGREIPIIADDYVEAEFGSGCVKITPAHDFNDYAM
FT                   GQRHDLPVINILTIDACLNENVPEAYQGLDRYEARKRVVADLEAEGLLEKIDDHKLMVP
FT                   RGDRSGTVVEPYLTDQWYVKAGPLAEPAIKAVEDGRIRFVPENWSKTYFEWMRNIEDWC
FT                   ISRQIWWGHRIPAWYDADGNVYVGRSEDEVREKHGLGAEVALEQDEDVLDTWFSSALWP
FT                   FSTLGWPEKTPELRDFYPTSVLVTGFDIIFFWVARMIMMGEHFMGDVPFREVYVTGLIR
FT                   DSEGQKMSKSKGNVIDPIDLIDGISADDLVAKRTQGLMQPQMAKKIEKSTRKAFPDGFP
FT                   AFGTDALRFTLAALATTGRDIKFDLGRIEGYRNFCNKLWNASRFVLMNVEGHDCSAAAD
FT                   TAEHRTLADRWILDRLATTAATATQQLDAYRFDLAAQTLYEFTWHDYCDWYLELTKPVL
FT                   NDEATPDAVKRATRHTLVTVLEALLRLLHPVMPFITESIWTNVKPHAGIGDDVEFLVQC
FT                   RWPAQDGFPRDATATAELDWVKDFITGLRRIRAEMDIAPGKPLPVLVKNWSEADQERYT
FT                   RHRGLLEFLAKPESVTWLDAADEAPESAMALVDDMQLLIPLAGLIDKDAELARLDKEIG
FT                   KLDKNLEQSEKRLSNESFVDRAPAEVVQKERDRVAEMHATRDQLDAQRERIRAM"
FT   gene            complement(504094..504939)
FT                   /locus_tag="TK90_0485"
FT   CDS_pept        complement(504094..504939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0485"
FT                   /product="Ketopantoate reductase ApbA/PanE domain protein"
FT                   /note="PFAM: Ketopantoate reductase ApbA/PanE domain
FT                   protein; KEGG: hha:Hhal_0702 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71000"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF5"
FT                   /inference="protein motif:PFAM:PF02558"
FT                   /protein_id="ADC71000.1"
FT                   /translation="MANILILGCGDLGCGVGEQLAAAGHTVWGLRRQPERIPEPIQPLA
FT                   GDFARADALPPLPPALDTVYFIATPGEFTEAAYRHAYVDGLCNTLAALEQARQHPRRIV
FT                   FVSSTSVFGADDGRWVDETSPAEPTRFSGRCLLEAEQLLADSPFAGVVVRFGGIYGPGR
FT                   EYHLRKVREGVRGQHEAPVWTNRIHREDCVGLLTHLFHLDEPEPLYLGVDDEPALRHEL
FT                   LGWLAQEMELDPPGTPPMPAGEVCGKHCRNARLRASGYRLRYPDYRTGYRALLDQLATT
FT                   "
FT   gene            505055..505477
FT                   /locus_tag="TK90_0486"
FT   CDS_pept        505055..505477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV_3559 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71001"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF6"
FT                   /inference="similar to AA sequence:KEGG:CV_3559"
FT                   /protein_id="ADC71001.1"
FT                   /translation="MRGYHLGKAGRRKGDACACGSGRNRAVCCGPYLDGAAAAPTAEAL
FT                   MRSRYAAFVEGREDYLLATWAAATRPESLMLEPDQRWLGLAIRATGAGGPEDQEGWVEF
FT                   VARSRVRGQGVRLHERSRFHREDGRWVYVDGEFPGA"
FT   gene            505474..506079
FT                   /locus_tag="TK90_0487"
FT   CDS_pept        505474..506079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0487"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; SMART:
FT                   heat shock protein DnaJ domain protein; KEGG: aeh:Mlg_2497
FT                   heat shock protein DnaJ domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71002"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021059"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF7"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ADC71002.1"
FT                   /translation="MIDGNRPAGSPVDAALLERVLEAVREYPRGCTEHGLIAQLRDLDV
FT                   EPFAAARLQEPLSLFQTHFVLFHCLYRLRDQLAGQGEWLRIHCLDIGVEPLPVVDAGSG
FT                   LPARGDPLRAYYLDLMRLERMDAAAVEALLGEFWSHLARDQQREQALEVLGLEDPVDAA
FT                   AIRQQYRRLAQRHHPDRGGDTATLQRINAARWVLLAQG"
FT   gene            complement(506080..506871)
FT                   /locus_tag="TK90_0488"
FT   CDS_pept        complement(506080..506871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0488"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   tbd:Tbd_2358 ferredoxin-NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71003"
FT                   /db_xref="GOA:D3SEF8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADC71003.1"
FT                   /translation="MPYSEEQITSTHRWSDKTFSFKTTRPEGLQFKNGQFVTLGLRPEG
FT                   KLIPRAYSIVSEPEAEELEFLSIHVPDGALTSRLAQAGPGDSVWINTKVTGSLTFDYVQ
FT                   PGRTLYMLATGTGLAPFISLIRSPELFEHFENAVLVHSVRTVEELAYRQEIESRISDRL
FT                   RYVPTVTRENHDFACPIAQQPYDNNQRGADMFRSGELFQILNLPPADPEHDRVMLCGNP
FT                   AMNREMSEWLVEHGWTQTNYKGVGNFTVEQAFVTTMSDSDD"
FT   gene            complement(506976..509429)
FT                   /locus_tag="TK90_0489"
FT   CDS_pept        complement(506976..509429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0489"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: nmu:Nmul_A0328 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: EAL domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; GGDEF domain
FT                   containing protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71004"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEF9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC71004.1"
FT                   /translation="MPDHPDSTRFQRLFEQAPEAQLVLNRAGHVVAANQAASRLLGYAQ
FT                   DELTGGIHITTIDLEATQADVDRAHGQPDERLPARFETRYRRRDGAEFPAEININAIHT
FT                   GEDIEVLATVRDITRQQQSEQALHELETQLSATIRHAPLLLFGLGPDGVFTLSEGAALH
FT                   SLGLQPGEVVGQDARLLYADHPAILSAIDRALEGEQFQSEVKVGDSHFAISWMPMEVAQ
FT                   SFQPGVLGVAWDITSLRAAEASTASERDRLLTTLHSISDGVLTADTTGRLTYLNPSARD
FT                   LLGVDATAVQGQRLDELLELEDTHTGHRVMNPVTQCLETGMTLESPERVLRRPDGAARV
FT                   VRLLVSPLRRPDHHSEGVVVVLHDHTELWRMTQQLNHQATHDELTGLCNRREFERRLDE
FT                   ALRTLEEGDTPHALFYMDLDQFKIINDTCGHQAGDALLRELADLLPAHIRDSDTLARLG
FT                   GDEFGLLLRHCPVERAEAIGNKLLATAQGLRFSWEGRRFDVGMSIGLVPIEGPGQNLPE
FT                   VLSQADSACYVAKDLGRNRLYTWKPSDQILRRRHGEMEWVGRLRAALEEARFVAYAQPV
FT                   KPLNGADLPLDHVEILLRLHGEDGTLITPGAFIPAAERYHLMPEIDRHVVELVFRQLAD
FT                   HRDRNPHHAPVVVSINLSGQSLAQDGMLEFITSRMSQFRIQAQQIIFEVTETAAISHHD
FT                   RAQGLIRALRYMGCRFSLDDFGSGLSSFGYLKNLPVDFLKVDGSFVRDIATNAVDAAMV
FT                   TAIHRVGHVLGLRTIAECVESEETMHHLREIGLDFVQGYHLAKPIPLTDHLAALASQGN
FT                   TDNQA"
FT   gene            complement(509530..510672)
FT                   /locus_tag="TK90_0490"
FT   CDS_pept        complement(509530..510672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0490"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; PFAM:
FT                   domain of unknown function DUF1730; KEGG: noc:Noc_0340
FT                   4Fe-4S cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71005"
FT                   /db_xref="GOA:D3SEG0"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG0"
FT                   /inference="protein motif:TFAM:TIGR00276"
FT                   /protein_id="ADC71005.1"
FT                   /translation="MIAEIVPEPLDPRQCAALAEQIRAWGRELGFQALRIAPATVPEAD
FT                   RQHLDRWLEKGSHGEMGWMAERAALRHDPAQLMAGVQRVISVRMDYFPPRTRRPAIQLA
FT                   ERDRAYVSRYALGRDYHKLIRKRLTELGRRIESEAGPHGYRAFTDSAPILEKALAARAG
FT                   LGWIGKNTNLLARESGSWFFLGELFTDLPLPVDDPVGEHCGACTACLDICPTQAFRGPY
FT                   DLDARRCISYLTIELKGSIPEDLRPLIGNRIYGCDDCQLVCPWNRFAEVSAEPDFVARH
FT                   GLDAASLVELFGWDETIFLHRTKGMAIRRIGHEQWLRNLAVALGNGPPSAEAEAALRAR
FT                   ADHPSPLVREHVGWALERLRSPSPSPAVDHLSRLTQAPGQ"
FT   gene            510692..512206
FT                   /locus_tag="TK90_0491"
FT   CDS_pept        510692..512206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0491"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: YjeF-family domain protein; protein of unknown
FT                   function UPF0031; KEGG: csa:Csal_1272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71006"
FT                   /db_xref="GOA:D3SEG1"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG1"
FT                   /inference="protein motif:TFAM:TIGR00197"
FT                   /protein_id="ADC71006.1"
FT                   /translation="MNDGPGGIPLTSALYDSEGMRALDAAGTALPEIAPGELMERAGAA
FT                   LLAAVRAHWPDVRRLGILCGPGNNGGDGYVLARLAAQAGLDVRLHGGPSRARPESDGRQ
FT                   ACRRWVEHGGVMAPLEAFDPLDAELWVDCLFGIGLERPLHDAYGEVVERLNASGRPVLS
FT                   ADIPSGVNADTGAVPGPAVRARHTVTMIADKLGLHTGAGVDYAGTVEVARLDLPEPIAR
FT                   GVMPRARHLGPEGWRDRLPARRPGAHKGDAGHVLVVGGAPEFSGAARLTALAALRAGAG
FT                   RVTLATHEDHAAWANADRPEIMVRAVPEPSDLLRLARQVDVIAAGPGLGTGEWGRRLWH
FT                   AVADAGVPLVVDADALNLLAATPRQMDSWVLTPHPGEAGRLLNRPTTEVESDRPAAVLE
FT                   LAQRFGGVSLLKGGGTLVADGGGEPLTCVTGGHAGMAIPGSGDVLTGIIVALRAQRLEA
FT                   RAAAEIGAAWHCAAGQVLRARLGSWRGLLAGELADALPAAAGEAGT"
FT   gene            512203..512670
FT                   /locus_tag="TK90_0492"
FT   CDS_pept        512203..512670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0492"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   spe:Spro_0427 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71007"
FT                   /db_xref="GOA:D3SEG2"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG2"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADC71007.1"
FT                   /translation="MNAGIRLPDAAATERAGAVLAGMEGLRIVYLEGDLGAGKTTWARG
FT                   LLQALGHAGNVRSPTYTLVEPYELQGRGVLHFDLYRLADPEELEYLGVREAFGEQALWL
FT                   VEWPERGAGWLPEPDLRVRLEAHEPDGRMLYVSGPAAADYRALVDKAFRVY"
FT   gene            512858..514225
FT                   /locus_tag="TK90_0493"
FT   CDS_pept        512858..514225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0493"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: noc:Noc_0337 N-acetylmuramoyl-L-alanine
FT                   amidase; PFAM: cell wall hydrolase/autolysin;
FT                   Peptidoglycan-binding lysin domain; SMART: cell wall
FT                   hydrolase/autolysin; Peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71008"
FT                   /db_xref="GOA:D3SEG3"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG3"
FT                   /inference="protein motif:PRIAM:3.5.1.28"
FT                   /protein_id="ADC71008.1"
FT                   /translation="MGQSSIPDMRRRQVLRALTALGLVGLPLPALARTGVERVRMSVDG
FT                   DTTRLVFDMDGDVEYSMFKLESPDRLVVDIKNARAVDELKLSSNPRSVVESIRHAPRDG
FT                   GDLRVVFDLRKPIEPRSFKLMPAQDSPHRLVLDLTSREGAPTQSAREESRDNGEPRRGR
FT                   SQEDLRDVVVAIDAGHGGHDPGAIGPAGTREKDVVLQISKRLAERVDNERGMKAVMIRT
FT                   GDYFLPLRERIERAREADADVFVSIHADAIANRNVQGSSVYMLSERGASSEAARFLAQR
FT                   ENQADLRLGGVPINGKDDSLTNVLLDLAQSGSLEASNTLAERMISELHRVGKVRKPEVE
FT                   RANFAVLRSPDVPSILVEAAFISNPSEERKLRSSDFQNSLADALLTGLRSYFSTHARPG
FT                   TLIADGQPDQHIIRPGETLSGIADRYSLSLADLRSANNVSDDRIYAGQVLRIPRDS"
FT   sig_peptide     512858..512956
FT                   /locus_tag="TK90_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.786 at
FT                   residue 33"
FT   gene            514359..516239
FT                   /locus_tag="TK90_0494"
FT   CDS_pept        514359..516239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0494"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM:
FT                   MutL dimerisation; DNA mismatch repair protein domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   avn:Avin_07520 DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71009"
FT                   /db_xref="GOA:D3SEG4"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG4"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ADC71009.1"
FT                   /translation="MSIEKLSEQLINQIAAGEVVERPASVVKELVENALDAGSTRIEVR
FT                   LEQGGIRLIQISDNGCGIHRDELPLALSRHATSKIRSMEDLEALHTLGFRGEALPSIAS
FT                   VSRLSMTSAVEGERNGWRLTGDGSDVFREAAPAAHPVGTTVEVRDLFFNVPARRKFVRT
FT                   ERTEFNHCETVIRTQAAACPEVAFTLRHNDRVVLDLPAAADPAQRVRALLGEAFMGAAT
FT                   PVGEQRAGLKLSGWLGAPTQSRAQPDQQFFFVNGRAIRDRVLAAAVRKAYQDVLYHGRH
FT                   PMFVLELELDPVQVDVNAHPTKQEVRFRESRMVHDFIFHALHKALADVRPGDGGMPGYL
FT                   PADTGSAPAPQERAIPAFPRERALSGLGAPEYRAEARSPAAGSGDRREYASGTSSDYAA
FT                   AWAEFRGPAAVAEPAPRSFEAAGGASESDDAEGMPPLGFALGQVAETFILAENASGLIV
FT                   VDMHAAHERITYERLKREWGSQGITSQPLLVPETLDVTPAEAALAEEHAGVLGALGFEL
FT                   DRAGPETLALRAAPALLRGRDTAQLVRDVLADLAAVGYSHRAEGEMNAVLGTMACHGSV
FT                   RAGRRLTLPEMNQLLRDMEATERSGQCNHGRPTWVELDHHALDRLFLRGR"
FT   gene            516239..517183
FT                   /locus_tag="TK90_0495"
FT   CDS_pept        516239..517183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0495"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: sml:Smlt1735 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71010"
FT                   /db_xref="GOA:D3SEG5"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG5"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ADC71010.1"
FT                   /translation="MGTFGLGRPPVVILAGPTASGKTALSLALAEALEGEIVSVDSALV
FT                   YRGMDIGTAKPTAEERARVPHHLLDIRDPEDTYSAADFARDAREAIAGIHARGRTALMV
FT                   GGTLLYLRALLDGFDEIPEVPNVVREQVRARLDVEGGQALHRELAGVDPEAAARIHPND
FT                   PQRILRALEVFEATGRPLSSFQQGAAARVPEGWVSLALWPEDRDVLRERIARRFDAMLE
FT                   VGFVDELMALQQRPELTAEHPSQRAVGYRQGWQWLAGELDFAQFRERAIAATRQLAKRQ
FT                   LTGLRRFPLHARLNASTVDRSEVLNVIRRADFQ"
FT   gene            517278..517532
FT                   /locus_tag="TK90_0496"
FT   CDS_pept        517278..517532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0496"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: hha:Hhal_0666 RNA chaperone
FT                   Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71011"
FT                   /db_xref="GOA:D3SEG6"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG6"
FT                   /inference="protein motif:TFAM:TIGR02383"
FT                   /protein_id="ADC71011.1"
FT                   /translation="MAKGQMLQEPFLNALRRDRVPVSIYLVNGIKLQGQIESFDQFVVL
FT                   LRSTVSQMVYKHAISTIVPSRQVRMNTEGEEAATAEAEA"
FT   gene            517557..518882
FT                   /locus_tag="TK90_0497"
FT   CDS_pept        517557..518882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0497"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: hch:HCH_05382 GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71012"
FT                   /db_xref="GOA:D3SEG7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG7"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ADC71012.1"
FT                   /translation="MFERPDSAGDRAVLVALAIGENPDIEAQVQEFDELVRSAGADVLE
FT                   LVRGSRDRPHPRLFVGAGKADEIRAAVEAHGADVVIFNHALSPSQERNLERHLQCRVLD
FT                   RAGLILDIFAQRARSHEGKLQVELAQLRHMATRLVRGWTHLERQKGGIGLRGPGETQLE
FT                   TDRRLLAARIKHIERRLEKVERTREQGRQARLRNEIPTVSLVGYTNAGKSTLFNRLTHS
FT                   DVYEADQLFATLDPTLRRLDLAPHQSLILADTVGFVRDLPHELVAAFKATLTETREAAL
FT                   LLHVIDAADPEREARIRQVEAVLEEIGAQDVPCWRVYNKIDRLESTPDAAEARFGSGDD
FT                   VFWVSAYTGEGIATLEEHLAETFTESMMRGWVELPASAGRLRAQLYEEKAVEAEQTTAD
FT                   GQIQLRLSLPQRRFQQLVSDAGLNPEQIEIVFDEPSSTAVGQ"
FT   gene            complement(518929..520512)
FT                   /locus_tag="TK90_0498"
FT   CDS_pept        complement(518929..520512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0498"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic;
FT                   Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: aeh:Mlg_1995 lytic
FT                   transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71013"
FT                   /db_xref="GOA:D3SEG8"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG8"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ADC71013.1"
FT                   /translation="MIRPRSRLPLGIILGLATLLASACSLHDSERALDTSQVDKPVVEG
FT                   PTQADVQAAMERQAREAADQAAETDDLWERTRLGFGFTDDLHHERVEQYIEHYRANPRI
FT                   IQLSTERAEPFAYFILSEIEQRDMPTELLLLPIVESGFAAEATSSGRAAGIWQFIPATG
FT                   DHFDLTRDHWYDGRRDVYQSTLAALDYLEALYQRFDDWYLALAAYNFGQGNVTRAMERN
FT                   AARGEPTDYWSLELSAEATAYVPRLLALRELFLEPDEHGTQITPIANEPALERIEPGRQ
FT                   ADLALIAEMIGLEADDLKRLNPGYQRHATHPSHAQHLFIPHDAAETLEVALAEHGDDPL
FT                   IRFREYTVARGDNLGSIAQRAGTRVAVLREMNGLNGDNIRAGQTLKLPVTGQEDAEIQV
FT                   AAAAESGELDTYEIQEGDSLWTISERTGMTISELRAANELERDAILRPGDTLQVTQAGS
FT                   GSSSDNGRSVAYEVQPGDSLSSIARQFQVSVSDLRRWNSLNGDGIRAGETLTLYVAEAD
FT                   EEAIARARDA"
FT   sig_peptide     complement(520441..520512)
FT                   /locus_tag="TK90_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.790 at
FT                   residue 24"
FT   gene            520514..521275
FT                   /locus_tag="TK90_0499"
FT   CDS_pept        520514..521275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avn:Avin_29610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71014"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC71014.1"
FT                   /translation="MALKDKPHSEYHQDPFLRWLSHWYEKPQGRRVRERLLQRIRQHAA
FT                   ATPGEVAIELSPVPMLEDSDTLGGPIVRMDSTRPGLLMEPEFWPLESDCARRIVLAHPC
FT                   AYSDLPAAVVAEAARVLEPEGMVFMLEGNRLQLGDQGGVRVSPLPEGLRRRQYREFMES
FT                   ADLEVLEQWSLSLLPPGLSEAWQQRLAPVDAWTRRGLPPLASVILTVAHKRVDLPLRPT
FT                   PQYRFATPSPRLRPGLVSSRSPYSRVRRTYD"
FT   gene            521268..521729
FT                   /locus_tag="TK90_0500"
FT   CDS_pept        521268..521729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0500"
FT                   /product="ribonuclease H"
FT                   /note="PFAM: ribonuclease H; KEGG: hha:Hhal_1585
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71015"
FT                   /db_xref="GOA:D3SEH0"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH0"
FT                   /inference="protein motif:PFAM:PF00075"
FT                   /protein_id="ADC71015.1"
FT                   /translation="MTDERVYIYTDGACRGNPGPGGWGAILRYRGTERELYGAEAETTN
FT                   NRMELTAAIRALETLKRPCKVELVTDSKYVKQGLTEWLPGWKRRNWKSASGSPVKNRDL
FT                   WEALDAEAARHDIEWYWVRGHSGHPENERADELANAGIDALLAGQPIEN"
FT   gene            521740..522456
FT                   /locus_tag="TK90_0501"
FT   CDS_pept        521740..522456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0501"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sde:Sde_2021 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71016"
FT                   /db_xref="GOA:D3SEH1"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH1"
FT                   /inference="protein motif:TFAM:TIGR01406"
FT                   /protein_id="ADC71016.1"
FT                   /translation="MRQIVLDTETTGLEPSEGHRVIEIGCLELDNRRPTGRKLHEYLQP
FT                   DREIDAGAIEVHGITNEFLADKPRFADVVGEFIEFVRGAELIIHNAPFDVGFINHELRL
FT                   LGEAAPVTELVEVCTVLDSLVMARRMHPGTRNSLDALCKRYEIDASGRTLHGALLDAEL
FT                   LADVYLAMTGGQVALGLDAGGDAGAEAGAPARAQRSGKPLPVIEPDADEQAAHEALLRT
FT                   LDEAAGGVCRWRATTS"
FT   gene            complement(522489..524351)
FT                   /locus_tag="TK90_0502"
FT   CDS_pept        complement(522489..524351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0502"
FT                   /product="TrkA-C domain protein"
FT                   /note="PFAM: TrkA-C domain protein; Citrate transporter;
FT                   KEGG: dsh:Dshi_0233 citrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71017"
FT                   /db_xref="GOA:D3SEH2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH2"
FT                   /inference="protein motif:PFAM:PF02080"
FT                   /protein_id="ADC71017.1"
FT                   /translation="MEEVAFTLEMGIVFGLLGLTILLFVTEVVRIDLAALGVLFLLGMV
FT                   ALIPGVAPIVEGEALFSGFASNAVIAIIAVMIIGTGLDRSGIMNRLADLILRFGGGTER
FT                   RVMATTSGAVGIVTSFMQNIGAAALFMPVINRIGAAARIPRSRLLMPMGFAAIVGGTLT
FT                   LVASSPLILLNDLMPAHLDDFGLFDVTPIGLALLATLIAYFAILGHWVLPARVPRDEDP
FT                   DESRVQTTSAWFRDVYGMDFGVREARLGDDSALTGMRVGDFEAAFGVHVVGVTTGDETR
FT                   IEPNRDIELERGAHLAILGPVTTIENTCDHTGTILKDELDVFARALSARHGGIAEVIIP
FT                   PGSDLIGQTVRDRGMRRTYGISVLRIQRGDDLIIDEVPDTPLKAGDTLVVHTPWENLQA
FT                   LEDDRDFVVVTSRYPRRRREEPATHRPLAALGSLALGLGLVLFTDLPLALALLGGALGM
FT                   VFTGVIAMDEAYRGISWKTVFLLASLIPLGLAVENSGAGEWIATNGMAQLEDMPVWVLQ
FT                   IAVFLLTTFFTLVMSNVGATVLLVPLAVSFASVAQGAGIDADPRVFALIVAIAASNSFL
FT                   LPTHQVNALIMDPGGYRVADYLRAGSLMTVLFMAVSLVVINLLF"
FT   gene            complement(524368..526080)
FT                   /locus_tag="TK90_0503"
FT   CDS_pept        complement(524368..526080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0503"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="KEGG: aeh:Mlg_0539 prolyl-tRNA synthetase; TIGRFAM:
FT                   prolyl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); YbaK/prolyl-tRNA synthetase associated region;
FT                   Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71018"
FT                   /db_xref="GOA:D3SEH3"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH3"
FT                   /inference="protein motif:TFAM:TIGR00409"
FT                   /protein_id="ADC71018.1"
FT                   /translation="MRVSQFPLNTLKETPADAEIVSHQLMLRAGYVRRLAAGLYTWLPL
FT                   GLRVLRRVENIVREEMNRAGALEVLMPAVQPAELWQESGRWDFYGAELLRLKDRHERDF
FT                   CFGPTHEEVITDLVRREIRSYRQLPVNYYQIQTKFRDERRPRFGIMRAREFLMKDAYSF
FT                   HLDADSLSRTYQQMHDAYCRIFERCGLDFRAVEADTGAIGGNASHEFHVLASSGEDAIA
FT                   FSPGGYAANVELAMCPQPAQAPPPSGEMEKIATPGVHTIEDLANFLDIPTAQTVKTLVV
FT                   AASEAVDADLVALILRGDHELNAVKAEKHPWIAEPLRMAEAAEIRAAFGADPGSLGPVG
FT                   SPIPVLADHSVLGMSDMVVGANENGHHLKQVNWERDLPRPESSDLRNITEGEPAPDGSG
FT                   PIEIRRGIEVGHIFQLGDKYSQALGARVLDEDGREQVVTMGCYGIGVSRVVAAAIEQNS
FT                   DERGICWPTAIAPFDIALCPIGAKKSQRVREAAEKLHDELEAAGFQVLLDDREQRPGVM
FT                   FADMELIGIPHRLVIGERGLDAGELEYQARTASEAEHLPMDGLLDALRERLQG"
FT   gene            complement(526139..526480)
FT                   /locus_tag="TK90_0504"
FT   CDS_pept        complement(526139..526480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0504"
FT                   /product="macrophage migration inhibitory factor family
FT                   protein"
FT                   /note="PFAM: macrophage migration inhibitory factor family
FT                   protein; KEGG: mca:MCA2795 phenylpyruvate tautomerase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71019"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH4"
FT                   /inference="protein motif:PFAM:PF01187"
FT                   /protein_id="ADC71019.1"
FT                   /translation="MPLLRVETNAALPDDPAGLCQRLSAQVADWLGKPEGYVMVACTHN
FT                   PAMCFAGSTDPLAYCELKSIGLPEGLTRELSRKLCDALQAELGLDPARVYIEFADAPRH
FT                   FWGTNSTTF"
FT   gene            526715..527764
FT                   /locus_tag="TK90_0505"
FT   CDS_pept        526715..527764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0505"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   vcj:VCD_000683 efflux transporter RND family MFP subunit
FT                   AcrA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71020"
FT                   /db_xref="GOA:D3SEH5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH5"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADC71020.1"
FT                   /translation="MTLKWMRPALWGLLLLPFSAQADFPFETATAERQTLAQERILDGR
FT                   VEAVQRSTISAQTSGRIREIYVDVDDFVEADELLLRVSDSEQQARVSQAEGDLAEARAR
FT                   FNEARSEFNRIQDVFDRGVVSRSEFERAEAELQSARARLRSAEGRVEEAREQLGYTEVF
FT                   APYSGIVTERHVEVGESVSPGSPLLSGISLDRLRVEVDVPQRLIHAVRERREAEVLLND
FT                   DRRLAAESLTIFPYADPASSTFRIRVNLPEQEDLGLFPGMFVKTAFFLNEVERLTVPRE
FT                   AVVYRSEVTAVYVIDDEDRVRFRQVRVGRTYDGYIEILGGLGEGERVALDPVHAAIYLK
FT                   EHQQVGADE"
FT   sig_peptide     526715..526783
FT                   /locus_tag="TK90_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            527757..531065
FT                   /locus_tag="TK90_0506"
FT   CDS_pept        527757..531065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0506"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   tbd:Tbd_2397 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71021"
FT                   /db_xref="GOA:D3SEH6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH6"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ADC71021.1"
FT                   /translation="MSEASTEAASGRMGISGRIAQAFLTTQITPLLALLGLLLGLFAIL
FT                   VTPREEEPQINVTMADVFIPFPGASAQEVAQLVATPAEQVLSEIEGIDDIYSTSRPNMA
FT                   QITIQFEVGEDRTAALVRLYNQVFSNQDWLPPGLGVGEPIIKPMGIDDVPIVNVTLWTE
FT                   DENRGGHDLLRVAHALESELKRVPGTRDIYTVGGPDHVVHVRFKPETLAAYNLSVDDLR
FT                   DSLQASNFSRDAGRLYEDDQEILVQAGDFITEPEAFAGLVVGMHDGRPIYLEDVAEVVQ
FT                   GPAYATEHVRFAHGAAAGDRARVGESHPAVTVAIAKQPGTNAPDIADALIERLEQLRGT
FT                   YIPDGIETTITRNYGATADDKANTLIQKLILATASVVILVWIALGWREAFIVGVAVVIT
FT                   LAITLFASWAYGFTLNRVSLFALIFSIGILVDDAIVVVENIHRHMVQGRKKLLEAIPYA
FT                   VDEVGGPTILATFTVIAALLPMAFVTGLMGPYMSPIPINASMGMIISLAVAYVVTPWLT
FT                   YKVLRRQAEQHAHVAPTGGGGHGAEGESASAGLMKIFNTLLRPFLGTSGRKKGNRLALW
FT                   VGTLLLILGSVSLAYFQLVVMKMLPFDDKSEFQVVLDMPEGTSLERTSMVLSEMADYLK
FT                   TVPEVDNVQTYAGTAAPINFNGLVRQYYLREGSHVGDIQVNLTHASDRSRKSHDIALGV
FT                   REAINAIADRHEAAVKVVEVPPGPPVMSPIVAEIYGPDYNGQIEVARQVRERFESTEGI
FT                   TDIDDSVEYPGPKKILQVDRERAARLGVSQQAVVQAIETALSGEDVTYLFGANVKYAVP
FT                   VRLEFDQAEKGSLDPVLGLKVRSRDGTLVPLSEVVNVVDSSLEHSIHHKNLLPVVYVMG
FT                   DLAGGLDSPLYGMFDMFFGLRDQPVAYGEPLEQLFISQPDNPYNFSLKWDGEWQVTYET
FT                   FRDMGIAYSVGLILIYLLVVAQFRSYMVPLIIMAPIPLTVIGVMPGHAFMDAFFMDAKF
FT                   TATSMIGMIALAGIIVRNSILLVDFINDEIRRGVDVIEAVVHAGAVRAKPIILTGLAAM
FT                   VGAGFILDDPIFSGLAISLIFGVFVSTLLTLVIIPVLYYLYVRNRVELIRAQAA"
FT   gene            531179..531397
FT                   /locus_tag="TK90_0507"
FT   CDS_pept        531179..531397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_1866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71022"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC71022.1"
FT                   /translation="MDVEMGEEGLNVLGISREQCATLVEVLKASEDQRFMDDPELRKLF
FT                   KLLAVLQSDLWDDMTAGQFDFAPYKKQ"
FT   gene            531428..531634
FT                   /locus_tag="TK90_0508"
FT   CDS_pept        531428..531634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_2036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71023"
FT                   /db_xref="GOA:D3SEH8"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH8"
FT                   /inference="similar to AA sequence:KEGG:Mlg_2036"
FT                   /protein_id="ADC71023.1"
FT                   /translation="MSDNGSRRPSNFVIGNIFLGAAALMLFFFVTLWEILGVVALVLWM
FT                   ALAAIGVYFIVKDKDINPGGPPN"
FT   gene            complement(531656..533035)
FT                   /locus_tag="TK90_0509"
FT   CDS_pept        complement(531656..533035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0509"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   aeh:Mlg_1273 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71024"
FT                   /db_xref="GOA:D3SEH9"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEH9"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADC71024.1"
FT                   /translation="MNLIFLALIVIAVATAAIREIQSTDPDEQPMQALSEGAIDAAGSA
FT                   VELALGLVGVMALFLGLMKIAEAGGLLTVLARLLRPLMVRLFPSVPPEHPAMGAMILNF
FT                   SANILGLGNAATPFGIRAMQELDKLNPHPGTATNAMALFLAINTSSITLLPTGVIALRA
FT                   SLGSEAPAAILPTTLFATLFATIAGITSALILQRYFRSPPPTRAPDADSPSTDETSERE
FT                   GTMREDGQEGAPEPSAQRRTQDDRPSEQQPMNIEVPSEGYPAWVSVLVLLGVLAIIPLT
FT                   IVYGQAIAPWIIPGLVVGFLSYGVIRGVPVYEVFVEGAKEGFNVALRIIPYLVAILVAV
FT                   GMLRESGALGMFVGLVGPLTTPFGLPAEALPMALLRPLSGSGAYGIMAGIMQDPATGPD
FT                   THVGILVSTLQGSTETTFYVLAVYFGAIGVKRVRHTLAAALSADAVAVIAAVTIVAILY
FT                   L"
FT   gene            complement(533052..533909)
FT                   /locus_tag="TK90_0510"
FT   CDS_pept        complement(533052..533909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0510"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mca:MCA2186 short chain dehydrogenase/reductase family
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71025"
FT                   /db_xref="GOA:D3SEI0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADC71025.1"
FT                   /translation="MSESQPRAVLITGCSSGIGLHAARALRARGYRVFATARRGEDVSR
FT                   LKNEGFEALQLDLDDSASIHSAVNEILHRTDGHLYGLFNNGAYGQPGAVEDLNRATLRA
FT                   QLETNVLGWLELTNAVLPAMRRAGEGRIIQNSSVLGFAALRLRGAYVTSKFAIEGLSDT
FT                   LRQELHGTGIHVALVEPGPIRSAFRANALKAFRRHIHREHSPWAETYRAAEARMANAEA
FT                   DAPFTLGPEAVTRCVVHALEARRPRVRYRITFPTKLFAFLGWLLPARAMDAVLRGVSRG
FT                   ENRG"
FT   gene            complement(533920..534297)
FT                   /locus_tag="TK90_0511"
FT   CDS_pept        complement(533920..534297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afr:AFE_0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71026"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI1"
FT                   /inference="similar to AA sequence:KEGG:AFE_0363"
FT                   /protein_id="ADC71026.1"
FT                   /translation="MAEKIVIMLLNLDLDRPGTLGAPFFQATVAAAMDLEVEMYFAAGT
FT                   TRLLRQGVAEKIYPGEAREKSVYSFMQDAHEAGCRFYACAGAMDENGLTLDNAIPELDG
FT                   MRGGGAFIGEVVEDDVATLTY"
FT   gene            534478..534762
FT                   /locus_tag="TK90_0512"
FT   CDS_pept        534478..534762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0512"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="KEGG: mca:MCA1777 hypothetical protein; TIGRFAM:
FT                   regulatory protein, FmdB family; PFAM: Putative regulatory
FT                   protein FmdB; SMART: Putative regulatory protein FmdB"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71027"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI2"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ADC71027.1"
FT                   /translation="MPIYEYQCKDCGEISEILQKISDPPATTCPECGAEALTKQVSAAG
FT                   FRLAGGGWYETDFKKDGKRNLKDGGGAGKSDSAASGKSEATPKAAATGT"
FT   gene            534766..535416
FT                   /locus_tag="TK90_0513"
FT   CDS_pept        534766..535416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0513"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   hna:Hneap_0474 protein of unknown function DUF502"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71028"
FT                   /db_xref="GOA:D3SEI3"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI3"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ADC71028.1"
FT                   /translation="MLVSLRRYLIAGLLVWLPLIVTGFIIKLLVDLLDFTILLLPPAWR
FT                   PEAVLGFSIPGAGIVIAIVVVFVTGVIVANIVGRKLVSLGESIVHRIPLVSSIYGAVKK
FT                   LTETVLADGGQAFRKVVLIEYPRRGLWSVGFLTGTGAGEVQDRTERDVITVFVPTTPNP
FT                   TSGFVLLVPREEAIELDMTVEDGLKFVMSMGVVTPLSSPTEAPAPVAREQGKS"
FT   gene            535518..537302
FT                   /locus_tag="TK90_0514"
FT   CDS_pept        535518..537302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0514"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); GAD domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; KEGG:
FT                   hha:Hhal_2226 aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71029"
FT                   /db_xref="GOA:D3SEI4"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI4"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ADC71029.1"
FT                   /translation="MRTHLCGRVTENELDSEVTLCGWVNRRRDHGGVIFVDLRDHAGLV
FT                   QVVFDPDREEVFARAEQLRSEYVIRMTGRVRRRPEGTENPDLTTGAVEILGLELEVLNA
FT                   AKTPPFPLDDEDVGEDTRLRYRYMDLRRPVMQQRLRLRAQVTAAMRRFLETREFLDLET
FT                   PMLTKATPEGARDYLVPSRTHPGSFFALPQSPQLFKQLLMMSGMDRYYQITRCFRDEDL
FT                   RADRQPEFTQLDMEMAFVDEADVMDVTEGLIRHLFREVQGVELPDPFPRMAYAEAMARF
FT                   GSDKPDLRIPLEFTELTEVMQAVEFKVFNGPANDPEGRVAALRVPGGAKLTRKEIDVYT
FT                   EYVGRYGAKGLAYIKVNDPADLEGGLQSPILKFLPEDVTRQILEKTAAAAGDLIFFGAD
FT                   KASVVNEAIGALRVKLGHDLELVEAGWQPLWVVDFPMFEYDDGDKRLYALHHPFTAPAV
FT                   DSPDALRANPREALSRAYDMVLNGTEVGGGSIRIHNPEMQQAAFEALGIGEDEAREKFG
FT                   FLLDALEFGAPPHGGLAFGLDRLVMLMSGAHSIRDVMAFPKTQTAACLLTDAPAPVGEK
FT                   QLRELGIRLRASATQQAG"
FT   gene            537324..537953
FT                   /locus_tag="TK90_0515"
FT   CDS_pept        537324..537953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_1762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71030"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI5"
FT                   /inference="similar to AA sequence:KEGG:Gura_1762"
FT                   /protein_id="ADC71030.1"
FT                   /translation="MAGMRASVVTVHGWHMPGLELALLERRLRAGGLEVHRFHYASRHQ
FT                   TPEQAARALAAFVEEVPGDLVHLVAHSLGGIIVRHLFTVAPVQRPGRIVMLGSPLAGSR
FT                   VAARLARNRLGRWWLGAALDRGLLGGSPILRGREIGMIAGSRPLGPAPLFAQMPPPHDG
FT                   FVAVDETRGPDVTRHLTLPVSHTGMLFDATVARETLHFLDRGDFLP"
FT   gene            complement(537976..539058)
FT                   /locus_tag="TK90_0516"
FT   CDS_pept        complement(537976..539058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0516"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   aeh:Mlg_1606 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71031"
FT                   /db_xref="GOA:D3SEI6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR022701"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADC71031.1"
FT                   /translation="MQPAAPRILLLSAYRADSHAAWADWLTRQFSEFDWERRELPGRHF
FT                   RWRIRGNPISWLETLGDAHPDAIMATSMVDLATLRGLHPALAQTPALYYFHENQFAYPT
FT                   QAGQNPSVDPQMVQLYGALAADRIAFNSRYNRDTFLDGVDRLLARMPDQVPPGVRTTLA
FT                   ERGEILPVPIQAITSTDHTERDPNLILWNHRWEYDKAPDDFAEAMLQLARKGIDFRLAL
FT                   LGPRPVSPPESLARLRADLADRIVVDTKCSREEYEEWLCRAGIVVSTARHEFQGLSLLE
FT                   AARAGVLPLVPDALVYPEQYPTSCRYATGDTESLAARLGAWLSGERPPVPDIGDWHAGR
FT                   LEPQWRRQIEDLLETRRGVD"
FT   gene            complement(539061..542279)
FT                   /locus_tag="TK90_0517"
FT   CDS_pept        complement(539061..542279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0517"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: tbd:Tbd_0152 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein; PAC repeat-containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71032"
FT                   /db_xref="GOA:D3SEI7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI7"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC71032.1"
FT                   /translation="MGLESTPLTLLYALNGLAFFTLGIVALMLPRRERFVPFAAHVGWL
FT                   VPFGLLHGTYGFLNAIGLHHELGVLSDRWSMTAWLAVSYLPLLEFGRRALLDIRPGLHL
FT                   PAWGVYGSLAIGLSAILLVAVEPATGLANGARYLIGFPGALLAGLAFLLHVRSPGAQPE
FT                   MQRHIPALGIAALAFLAYAAFLPFPARVDLGLPPWLPTQGDFLAATGVPIQTLRTGAAM
FT                   LFTLALISLARTIGAQHSDDLLRVLETVNGFVYRCRNNPQWDVIFVDGGVRELTGYEAR
FT                   DFYRGDITFAAWVHPDDSDYTWEGVQEGLKQDGHYQIQYRAVNRDGSVRWVFERGTGVY
FT                   DAHGHLIYLQGHVIDAHELVTTSRELERRSEELEAFRSTLDLTLDGVFLFDVDSLQFIY
FT                   VNQGAMDQTGRTRNELLQLHPYDIKPEFPETRFRSMLEPLRRGERDQLLFETTHQHVDG
FT                   HLIPVHISLQLVAPRGERPRYVAIVHDISQRKRNEEALLEALESLETSRDEQARLLELT
FT                   RREQGRMASLLSAMSIGILFEDRQGSIEYVNPAFRRMWAIADEVDLVGQPSRAVLEHST
FT                   HRFARPDHASRHVLHVLDTHEISERFEVDLYDGRILTQLSYPVHDADERSIGRLWLYED
FT                   VTHERQTAQQLVYLAEHDPLTGLYNRHRFQRQLEQAIHTARRRGTHLALIYFDLDEFKT
FT                   INDTFGHRAGDTVLVRAAGEIASLVREEEIFARLGGDEFAILVDHAAEREPEGLAERVA
FT                   RAISAIPFRFRGQNYRLTASIGIARYPEHGDNVEDLVAHADAAMYQAKDSGKNTWAVFD
FT                   ASRNTAERMLERMSWSQRIGKALEGGQFELHFQGIYHLDSGALNHMEALVRMRDPLAPG
FT                   EVVMPGQFIPVAEKTGQIVDIDRWVIRESIAHLARQPELPGIAINISGRSFDEPGLPQY
FT                   ITNELSQQGVDPRRLVIELTETAAVSEMQDAQRFIEALQQAGCLVCLDDFGSGFSTFAY
FT                   LKYLGVQVLKIDGMFVRDLPNNRDNQAFIRAMVDVARGLDKWTVAECVEDGDTLAMLAD
FT                   LGVDMVQGYHLNRPSPGFPPDRAP"
FT   gene            complement(542565..542888)
FT                   /locus_tag="TK90_0518"
FT   CDS_pept        complement(542565..542888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0518"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   hha:Hhal_1488 high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71033"
FT                   /db_xref="GOA:D3SEI8"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI8"
FT                   /inference="protein motif:PFAM:PF01355"
FT                   /protein_id="ADC71033.1"
FT                   /translation="MSDQPNANRRAFLRRASMAVAAVPLASLTTFGVAYAKPKAEDGHA
FT                   HDYVNNASDASDHDAYEDGAVCENCAFWAGEEENGWGGCHHQAFQEVLVNAEGWCDAHV
FT                   RGG"
FT   sig_peptide     complement(542778..542888)
FT                   /locus_tag="TK90_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.982 at
FT                   residue 37"
FT   gene            543215..543766
FT                   /locus_tag="TK90_0519"
FT   CDS_pept        543215..543766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0519"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb0724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71034"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC71034.1"
FT                   /translation="MFKLRTSLAMLAAGTLALAGTTAQAQERVGMEPSIAVMLGSVSPD
FT                   ASGTSTDWGYGIELGANCQLLQPRTGVLRHQLSVSRYSESPLRMTSTELNTHWMFETAP
FT                   NLELGFGPGLGYVRAELGDDTNGLWAAQFGGSLKYTMDNNMFLGVEARYQFTESDRFRS
FT                   GRGREDVDNLRVMAKLGVHF"
FT   sig_peptide     543215..543292
FT                   /locus_tag="TK90_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            543882..546632
FT                   /locus_tag="TK90_0520"
FT   CDS_pept        543882..546632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0520"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="KEGG: aeh:Mlg_0656 ATPase, P-type (transporting),
FT                   HAD superfamily, subfamily IC; TIGRFAM: ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; cation transporting
FT                   ATPase domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; SMART: cation transporting ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71035"
FT                   /db_xref="GOA:D3SEJ0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ0"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ADC71035.1"
FT                   /translation="MDESQNAQAPKNEAIAWHALDPDSALRARDSRREGLSADVARERL
FT                   DQYGRNQLRPPEQAGLIRRFFRHFHNILIYILLAAAAGTALLGHWVDTGVILAVVLINT
FT                   LIGFVQEGKAEKALDAIRKMLSPRALALRDGHRREVPAEELVPGDIVYLQAGDRVPADL
FT                   RLLEVKNLRVEEAVLTGESVAVDKSPEAVEREADLGDRTSMAFSGTLVAFGRGHGVVVA
FT                   TGEHTEIGRISSMLGEVESLQTPLVRQMEQFGRWLAGVVVVISAATFAFGYWVRSYPLD
FT                   EMFLAAASLAVSSIPEGLPAIMTIALAIGVQKMARRNAIIRRLPAVETLGSVSTICSDK
FT                   TGTLTRNEMTVQTVRTAGEEYGVSGVGYAPQGDFSVDQQEVEADEQPALMEVLRAGLLC
FT                   NDAQVFEREGEWVMEGDPTEGALVVAARKAGLDPHLEAERLPRTDVIPFESDHRYMATL
FT                   HHDHDGHARIFLKGAPERVLELCDQVRTGEGTDDLDREAWHQVMETIAARGQRVLAIAS
FT                   REVPPDQRELNFDHVEEGGFALLALVGIIDPPREEAIQAVAECREAGIRVKMITGDHLA
FT                   TARAIGEQLGLGRDAEAHAGHELDDVDDDRLAQMAEDTDVFARTSPEHKLRLVQALQGR
FT                   GRIVAMTGDGVNDAPALKRADVGVAMGGKGTEAAKEASEMVLADDNFASIAHAVEEGRT
FT                   VYDNIRKAILHMLPTNAGQSLTIMMAILMGLALPLTPVQVLWVNMVTSVTLAMALAFER
FT                   AEPGVMQRPPRDPDQPLLSGFLLWRIPFVAVLLWLGTFGHFVYMETFVGVSDELARTVA
FT                   INTLVAGQAFYLLNLRLIHQPVLPGLELFRSHSMWIAIGVLILLQLAFTYAPVMHTLFG
FT                   TTTIGLGDWLRILAFGLAVFVVVELEKLVVRQVLARRRGIAPTAV"
FT   gene            complement(546665..548722)
FT                   /locus_tag="TK90_0521"
FT   CDS_pept        complement(546665..548722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0521"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   sensor"
FT                   /note="KEGG: rxy:Rxyl_2783 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: diguanylate cyclase; PFAM: EAL domain protein;
FT                   GGDEF domain containing protein; SMART: EAL domain protein;
FT                   GGDEF domain containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71036"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC71036.1"
FT                   /translation="MNRRRSDALPDEERARLEGLIYEEREARQRAESLAETRLQDLYAK
FT                   QQQIELLNTIASAANQSDSIAEVLRTALNAIGEFLDWPVGHAYLARKTSSSDLELGPTG
FT                   IWHLRTLDPVEAFRESTEDTVFRSGQGLPGRVLEQRAPVWVEHLDQDLNFPRRAAAATS
FT                   GLCSGFAFPVMVGQEVACVLEFFTAETTPEQPEVLALLAQAGVQLGRVVERNRHAERLI
FT                   HHASHDPLTGLPNRRLFHDRLEHAIARYAREPESLFAVLFVDLDRFKLVNDSLGHTAGD
FT                   ELLAQVGKRLLTALRQNDTVSRPGGNQNTRPDDTLARLGGDEFTILLEGLHEPVDALRV
FT                   AERLQAILHQPFSIAGQTVYVTVSIGIATRPYGQACPVVSPDQDGPTCAEDLMREADMA
FT                   MYRAKSLGKARCEFCDPGMQSQALESLRLETSLRESVERNAFVVHYQPIMSLADNRITG
FT                   FEALVRWEREGELLPPDRFIPIAEDAGLVHLIDMQVLYTACSQLQAWNAQRSGPPLTIS
FT                   TNLSARQLTRPELVDEVATILCGTDTPPEQLRLEITETATLGNLDELIATLKGLKALGV
FT                   SLAMDDFGTGYSSLSYLHRLPLDILKIDRAFVAGLDRDEYSQRLVQTVINMARNLGLEA
FT                   VAEGVESNTHAATLRALGCTRAQGYYYSRPVPADRAGDLLAADQLPLVTA"
FT   gene            complement(548927..549460)
FT                   /locus_tag="TK90_0522"
FT   CDS_pept        complement(548927..549460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71037"
FT                   /db_xref="GOA:D3SEJ2"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ2"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1402"
FT                   /protein_id="ADC71037.1"
FT                   /translation="MFLPALAALLASSALIGCDGLPGLDATPEHHQRDWDDETLQYGER
FT                   MYMQHCAVCHGENREGAENWRQRDADGYMPPPPLDGSAHTWHHPYWQLKDMIRYGAEAR
FT                   GGAMPSFEDTLSYDDVEAIIAFIQAQWPDEIFEAWIRYDQNHPTQEAWEEEMGEPWVTH
FT                   ASDPRTPSTGREHH"
FT   sig_peptide     complement(549407..549460)
FT                   /locus_tag="TK90_0522"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.687 at
FT                   residue 18"
FT   gene            complement(549538..550104)
FT                   /locus_tag="TK90_0523"
FT   CDS_pept        complement(549538..550104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0523"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: apt:APA01_25340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71038"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC71038.1"
FT                   /translation="MDHIRTTGLALVAAAALALSAPLVLAEEQAAEDETATEMEELRED
FT                   WAQTREEIQADAERDREATRSRTRETLDTMDQQLTTLRERTREGWDDLSDATRERRERA
FT                   FDALVRERDNLAEWSAETRERSSGAWQGVREGARDAWGGVRDGSRKAWGSVRDAVRGDR
FT                   PPAEQGEPGTQENPADPDDPAVQTD"
FT   sig_peptide     complement(550024..550104)
FT                   /locus_tag="TK90_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            550222..550638
FT                   /locus_tag="TK90_0524"
FT   CDS_pept        550222..550638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_1036 Smr protein/MutS2"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71039"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC71039.1"
FT                   /translation="MRDTRLIGALLLGGLLAGCAPFPSEQKRATDVFQPQPTERKALEI
FT                   PQLEPAGTPGVAVMDWVDASGWREGLGTDYSSLEIHHQRRERAEVFVKNLRDDAVRDYE
FT                   YRLTLRERDDGWVVTGLERRVICRRGLSGDGLCR"
FT   sig_peptide     550222..550302
FT                   /locus_tag="TK90_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.626 at
FT                   residue 27"
FT   gene            complement(550666..551328)
FT                   /locus_tag="TK90_0525"
FT   CDS_pept        complement(550666..551328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0525"
FT                   /product="Caffeoyl-CoA O-methyltransferase"
FT                   /EC_number="2.1.1.104"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   ava:Ava_1652 O-methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71040"
FT                   /db_xref="GOA:D3SEJ5"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ5"
FT                   /inference="protein motif:PRIAM:2.1.1.104"
FT                   /protein_id="ADC71040.1"
FT                   /translation="MSNRSIGLDDHLQAYVLDRSLRESSLLAELRAETAGLPEHNMQIA
FT                   PEQGQFMALLARLVGARRYLEVGTFTGYSALAVGQALPDDGEVVCLDHSEAWTAIARRY
FT                   WDRAGLAARMDLRLGDARASLRQLEDEGQSGRFDLAFIDADKTGYPEYFETCLRLVRPG
FT                   GLIMVDNTLWHGRVADRHCDDEDTRAIRDFNQALHRDERIDLSLVPIGDGLSLARRR"
FT   gene            complement(551338..552390)
FT                   /locus_tag="TK90_0526"
FT   CDS_pept        complement(551338..552390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0526"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: aeh:Mlg_2651 permease"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71041"
FT                   /db_xref="GOA:D3SEJ6"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ6"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ADC71041.1"
FT                   /translation="MVFEIAQQTLALALTAAPWLLLGLAAAGLVKAFLPEAALQRWLGG
FT                   PGLAPTVRAAIAGAPLPLCSCGAIPTALALHRGGAGRGPTTAFLIGTPGVGVDSVAISY
FT                   ALLGPLMAVARVAGALVTAITTGLLVGRTRASRTSAGSAQGAGSGCGSSACCDTPATVP
FT                   PAPPGPWTRLLEGQRYAFGDVLDDIRLWLVAGLVVAGALLTLVPPAALAAYGSGLPAML
FT                   LLAVIGIPMYLCATAATPIAVALLAAGVSPGAVLVFLLAAPITSLATLGVFRRELGNAA
FT                   VSLYLIGIGASTVALGLTLDAGLGLSGLSPAITPGQATEWMPPAVEWVALAVLVVLALH
FT                   PLRWLNAGRT"
FT   gene            552548..553015
FT                   /locus_tag="TK90_0527"
FT   CDS_pept        552548..553015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71042"
FT                   /db_xref="GOA:D3SEJ7"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ7"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1610"
FT                   /protein_id="ADC71042.1"
FT                   /translation="MTGYALANLLHLLAVVVWVGGMFFAYMFLRPVAGQQLDGAARLKL
FT                   WEGVFARFFPWVWASVILLLASGLWMIFGFFGGMGNVHPSVHVMLLLGLVMMAIFAHVF
FT                   FAPYRRMRQAIAANDTDEGLRRLSQIRVLVGINTLLGLVVIVVATGGRLPF"
FT   gene            complement(553012..553497)
FT                   /locus_tag="TK90_0528"
FT   CDS_pept        complement(553012..553497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71043"
FT                   /db_xref="InterPro:IPR021710"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ8"
FT                   /inference="similar to AA sequence:KEGG:MXAN_6436"
FT                   /protein_id="ADC71043.1"
FT                   /translation="MAPNSRGNGTPGDVPEAGAELARAYAATHYRIEPPGQAFVLRIGE
FT                   RDPGLEACLQAQSWRQASLLTAWNPRSRIVPEQENRERHARIKYELEQAGWACWPTIHR
FT                   DPTGHWPDEPGYCVLGMGEADLDPWLIAFGQNAAVLIQPPSAPRLIWHPESRRPVSP"
FT   gene            553654..555381
FT                   /locus_tag="TK90_0529"
FT   CDS_pept        553654..555381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0529"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: tbd:Tbd_2428 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PAS sensor protein; PFAM: GGDEF domain containing protein;
FT                   PAS fold-3 domain protein; SMART: GGDEF domain containing
FT                   protein; PAC repeat-containing protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71044"
FT                   /db_xref="GOA:D3SEJ9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEJ9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC71044.1"
FT                   /translation="MSVDRLRVPGITSVFALVLLLVAAIAVFSWWRVQHLQQDIQTLTE
FT                   EHIQKVDHVHRMRSLVRERVLRASLVVSAEDTALQERYYREFRELAPRFVETLTAAESQ
FT                   AERPADRQRMQELRELTSVGAPLLEDIVDIALVGDRNEALGMLYADLMPIQEEVLGQME
FT                   RILEAFHRDNARAIEAMAQRHEQSQQWMLGATALAAVLIILLAAWVRYRLRRNHQALQD
FT                   ELRERMRVEARLRETQGGLEAAVARRTAALEETTARLEEAQRSAGAGFWDWDIRNGQLN
FT                   WSAHVFELFGLDPRVDEAGFESYIHAVHPDDRTRVRRTINQALASEAVYRVDHRVVRPD
FT                   GGVRHVRVEGEIARDDAGRPLQVLGMVRDITLEKASEERLWHQAHHDSLTGLANRSLFQ
FT                   EHLRQALRRAQRHERGLALVVCDLDGFKPINDRLGHDAGDVVLVTVAGRLREGVRECDV
FT                   VARMGGDEFVILLENMDDPDALLGVGLKLIERFAEPIEVNREAVQVGLSMGAALYPHDS
FT                   ADAEGLMLQADRAMYAAKEAGGGGIVLYEQVDASRASRSHTRHRRRGPLGCGLGLEGP"
FT   gene            complement(555393..558278)
FT                   /locus_tag="TK90_0530"
FT   CDS_pept        complement(555393..558278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0530"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: hna:Hneap_1682 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; PAS fold-4 domain protein; GGDEF domain containing
FT                   protein; GAF domain protein; SMART: EAL domain protein;
FT                   GGDEF domain containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71045"
FT                   /db_xref="GOA:D3SEK0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC71045.1"
FT                   /translation="MSGPLIAALYLLAGLCLYASASHLLHASHSVRRVEHLLFAAMCLL
FT                   LAGSAISIALSYQATSIEAYTGPMKAYYGLIAALYVLFAAFIARYTETPARVLLSVLGI
FT                   LMVVVWVANARQPHGLQWTEIAELGSVALPWGETVTRAVGSPSPWFLLGLAGLLLVFGF
FT                   SLWALVSHWRREGGHLPLILIGALLLFLLATIQGVLVRLGIIDSIPLSVFGYLGMILVM
FT                   SLVLHRETQERVRESEHRFRDLVHQAPMAIEVLTPDGGVRQVNTAWETMHGHAGVKGMN
FT                   VLHHPDPIDGHVTEDIRAAARGARRSIAPFACHAVADPAKAPAGSRWVKGYVYPLKNHR
FT                   GEVRDIIVMQEDITLARRGEDALRVIAQGFRADNRQSFFQNLVLRLREVFRADYALAGI
FT                   NVPDLPGHVETAALCRDGELVGNIRYALASTPCDEVLSQGLCVYPDRVQELFPRDEMLV
FT                   EMGARSYLGAPMIDSQGRELGHIAIVNRYPLDETEQAAGILEIFADRAAAELERLEGEE
FT                   HIRRLAYHDPLTGLANRTQLHDALTQDLDLAHHGGQHGGLILIDLDHFKTINDALGHAV
FT                   GDTVLAAVADRLRQHAPEQALVVRLGGDEFATLIHPRRASRQAIEATVNDAAHRLLDAL
FT                   QHPIVLGERTFSVGASLGCVLFPDAGQTSSDALRHADIALYQAKRAGRGGVQFYRHALQ
FT                   DEARARLQIEEGLRQALVNREMRLSYQPQFDAQENMIGAEALLRWTHPELGPVGPALFI
FT                   PIAEETGLIHPIGTWVVEHVLENLQDWHARGLPLPPRVAINISPWQLARPDFVAQLRER
FT                   VQAAGLEAGQITLEVTESGLLRDLSDAIGKLRALREFGVQVALDDFGTGYSSLAYLRDL
FT                   PLDELKIDKSFIDELVDKGEQMLIENILDIGHNMGLRVVAEGVAKPAQRQQLLALGCTH
FT                   FQGFLYGQPIAEDEFPAWLERNATPAVQRQS"
FT   gene            complement(558364..559788)
FT                   /locus_tag="TK90_0531"
FT   CDS_pept        complement(558364..559788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0531"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: mxa:MXAN_0537
FT                   putative cardiolipin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71046"
FT                   /db_xref="GOA:D3SEK1"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK1"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ADC71046.1"
FT                   /translation="MLGTGWIASITAVAAFALAAASVMHALLQRRETGTVIAWVGLIVL
FT                   LPVGGSILYWMFGVNRIRRRAHALREGHLLVDPAARDADGPGIPPRWSRLLGCGDRLAP
FT                   FRASAGNSVRPLTDGDQAYAAMLAAIDCASHSITLATYIFDYDVVGQRFVRHLKAARDR
FT                   GVEVRVLIDGIGARYSRRNTLRFLKRVGIPAAAFMPVHHLPRTLAAFNLRNHRKMLLVD
FT                   GEHGFTGGMNIRRGHSASNPGPHPIQDLHFEVRGPICLQLQRVFAEDWQFSTHEALEGP
FT                   PWFPEEARLIGTQLCRALPDGPDEDFEVLKFTLLAAIAEAREHVTVVTPYFLPDLELLG
FT                   ALKAAALRGIEVDLLLPERNNLRLVEWAARPLHGELLTRGCRIWLTPPPFNHSKLMLVD
FT                   REWALVGSANWDPRSLRLNFECNLECVDRDLGQQLADWAEDLRSRSHPLSLEDVHARTL
FT                   PARLRDGAARLLTPYL"
FT   sig_peptide     complement(559729..559788)
FT                   /locus_tag="TK90_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.796) with cleavage site probability 0.655 at
FT                   residue 20"
FT   gene            560077..562338
FT                   /locus_tag="TK90_0532"
FT   CDS_pept        560077..562338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0532"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: hch:HCH_05404 DNA topoisomerase IV subunit A;
FT                   TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; SMART: DNA gyrase/topoisomerase IV subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71047"
FT                   /db_xref="GOA:D3SEK2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK2"
FT                   /inference="protein motif:TFAM:TIGR01062"
FT                   /protein_id="ADC71047.1"
FT                   /translation="MTDIETPSLFANSGEQLPLKDFTEKAYLDYSMYVILDRALPHIGD
FT                   GLKPVQRRIIYAMSELGLSATAKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSY
FT                   RYPFVDGQGNWGSPDDPKSFAAMRYTESRLSRYAQLLLSELGQGTVDWVPNFDGALDEP
FT                   KVLPARLPNVLLNGGSGIAVGMATDIPPHNLREVAAACVHLLEHPKATLAELCEHLPAP
FT                   DFPTEAEIISPPAELRKVYETGQGSIRARARYEREGDDIVVTALPHQVSGAKLLEQIAS
FT                   QIRAKKLPMVEDLRDESDHEHPTRLVITPRSNRVDVEALMAHLFATTDLEKTYRVNMNV
FT                   IGLDGRPQVRDLAGLLGEWLEFRIETVRRRLQWRLEKVQARLHVLEGLLIAYLNIDEVI
FT                   AIIREYDQPKPELMSRFGLSDIQAEAILELKLRHLAKLEEMKIRGEQDELATERDQLEK
FT                   TLGSERRLRTQVRREIEKDAADYGDERRSPLVQRAAAQALDESALVPTEPLTVVLSEKG
FT                   WARAAKGHDVDARGLNYKAGDAFQAAVTGRSNQPVAFIDSTGRTYTIAAHTLPSARGQG
FT                   EPLSGRVNPPEGARFVGMATGAEEDRWLLGTDHGYGFVAKLGDLLGRQKAGKNVLTVPA
FT                   GAAVLQPAPVRNPHEDHIAVVTTRGYLLLFPATELPELARGKGNKLIGIPSAALKDGSE
FT                   RVLDVAVLGPQDTLVVHAGKRFKALVPAEWAEYVGERARRGRQLPRGYQNANRLEVRSD
FT                   "
FT   gene            complement(562387..564180)
FT                   /locus_tag="TK90_0533"
FT   CDS_pept        complement(562387..564180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0533"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="KEGG: hna:Hneap_2065 response regulator receiver
FT                   modulated diguanylate cyclase/phosphodiesterase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain protein; response
FT                   regulator receiver; GGDEF domain containing protein; SMART:
FT                   EAL domain protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71048"
FT                   /db_xref="GOA:D3SEK3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADC71048.1"
FT                   /translation="MITPDDSPRDAHILIVDDNRMNVDLLGAILEEAGFRDVAAETSGE
FT                   RAVERWREESFDLLLLDIRMPGIDGHEVMRQLNSDLAEGDWLPVIILTAQIDPQTREQA
FT                   LAAGALDFITKPFNATEVVQRIDNLLRVRALHNAAHGRAEDLSRSLADRARTLQRTEQD
FT                   LEHLAHHDPATGLPNRHSLLRFIDEAIETGSALDLVMVHVRGHEAVERLEGYAAADLML
FT                   REIGQRLRLALEDQTPGRVQCGIWGGSTLLLAVASRESIATSTLQDCMDASLAHLRLGR
FT                   YEIAPSASAGHVRAPDHGRNAEELIRRVSLTLAKGERRGSEWLSFDPVLEQDARRRHQL
FT                   EYGLTVAREQDQLHLLYQPKIELASGCLVGFEALMRWEHPRLGLISPGEFIPLAENTGR
FT                   IAELGEWALHEALAAARRWREASGHCPPIAVNVSTQQFAALTRSGRSLVDAVQSALKAS
FT                   GLNGNALEIEITETAVMHDVAATVEELRALRALGVSIAIDDFGTGYSSLAYLRRLPATT
FT                   IKIDRSLIDGVSANPSMDTLARAILSVSRGFGLTTVAEGIETEADARHLAALGCPIGQG
FT                   YLYHRPLPETDASGLLARVCA"
FT   gene            complement(564164..566257)
FT                   /locus_tag="TK90_0534"
FT   CDS_pept        complement(564164..566257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0534"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: hha:Hhal_2149 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; response regulator receiver;
FT                   PAS fold domain protein; histidine kinase A domain protein;
FT                   GAF domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; response
FT                   regulator receiver; PAS domain containing protein; PAC
FT                   repeat-containing protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71049"
FT                   /db_xref="GOA:D3SEK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADC71049.1"
FT                   /translation="MPSAPLPDNEQARLEAVHRLPLEPSDHDLFSPLTRLVARHFDVPM
FT                   ATVTLVDEKCQCFIAPQGPLGAGTERSISFCAHGLTRPNELLVVEDARQDARFSDNPLV
FT                   LGETDVRFYAGIPLAPEAGLAVGNLCIIDTRPRRLDEQEVTALREFGEIATSLLREYLA
FT                   RRDLGHSRSALDAQGQRLAAVLETAAAGIIQIDHTGHIEQFNSAAERLFDYPAEQVLGH
FT                   NVSMLMPARWAHEHDDYLRHYRETGQARVIGSGREVEGLRRDGSTFPMQLAVSEVRIEE
FT                   QPHYIGIVTDLTDLHESQRRELAEAERANRAKSEFLSSMSHELRTPLNSILGFSQLMRA
FT                   DRTHPLPERQQRQVEHIERSGQHLLALINDILDLSRIEAGRMAMSLEPTDPAMTLAECH
FT                   GMIEGEARERGIQLDFPPPEPALPAVQADHTRLKQVLLNLVSNAIKYNRDKGIVRVRVT
FT                   PMPEGRMEFRVRDTGLGIPEDRRAELFRPFSRLGHETGAIQGSGIGLVISRELVRHMGG
FT                   ELEYQSREGEGTDFFFTLPMSCTAERLTTQDHATRSLDDAPQPNRCRRVLYVEDNPANV
FT                   SLMQEILALRDGIELQTAGSADEGLRLARETPPDLVIMDIHLPGMSGTAAARLLRARPE
FT                   TREVPIIALSADATREAIDDGNQNPDFVTYFTKPLDIARFLAALDPLLEPPADRTDADD
FT                   HTR"
FT   gene            566487..567374
FT                   /locus_tag="TK90_0535"
FT   CDS_pept        566487..567374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0535"
FT                   /product="HtpX domain protein"
FT                   /note="PFAM: HtpX domain protein; peptidase M48 Ste24p;
FT                   KEGG: tbd:Tbd_2603 heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71050"
FT                   /db_xref="GOA:D3SEK5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK5"
FT                   /inference="protein motif:PFAM:PF06509"
FT                   /protein_id="ADC71050.1"
FT                   /translation="MKRIALFLATNFAIIIVLSITLRLLGVERILDEEGVNLDLNALLI
FT                   FAAVFGFGGSFISLAISKWMAKKTMKVHVIDKPRNATEQWLLETVQRQARESGIGMPEV
FT                   GIYDSPDPNAFATGMSKNNALVAVSTGLMQNMSQGEVEAVLGHEVGHVANGDMVTLALI
FT                   QGVVNTFVIFLARVAGHFVDRVVFKNESGHGPAFWITTIVTEIILAILASIIVMWFSRQ
FT                   REFRADEAGAKLAGREKMIGALESLARASGRPVDMPDQMAAFGIRGGMAQGLKKLFMSH
FT                   PPIEQRIASLRANS"
FT   gene            complement(567495..568175)
FT                   /locus_tag="TK90_0536"
FT   CDS_pept        complement(567495..568175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0536"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   noc:Noc_1713 metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71051"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK6"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADC71051.1"
FT                   /translation="MLQHLSHPVTALAQNATLIWCDQTRVAAWVDPGAEPDTLIAIARQ
FT                   QDVRLDCILLTHGHLDHVGAAAEMARRCDIPILGPQVEDAFWLDQLPMQCQMFGFPELP
FT                   ALVPDRWLQDGEQLPLGKVTLEVLHCPGHTPGHVAFFDRESRLALVGDVLFHGAIGRSD
FT                   FPRGNGPQLIESITRRLWPLGDDVRFVPGHGPESTFGEERRSNPFVGDAALAAGGQPGR
FT                   GRYY"
FT   gene            568540..570075
FT                   /locus_tag="TK90_0537"
FT   CDS_pept        568540..570075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0537"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   hna:Hneap_2101 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71052"
FT                   /db_xref="GOA:D3SEK7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADC71052.1"
FT                   /translation="MPTRLNSLRNAVLLFVLLPLLLVVGGTVTLGLQEFQTQMENRMQA
FT                   DIELVARSIRLPVATAMIDQDVTTVQQSLDSLFQIDQVFGVYVYDAQGDMVATSGPPSP
FT                   TIRHPGEAQAISETGSLGAFDEHQGREVFSFFLPLSDSAGRIVGLLQVTRDVSPFRAYV
FT                   SQLRWQGGLVMLAVSVLFLLVVLIGHHRAVGRHVARLIGAMRDIGDGQRGLRAPEKGPW
FT                   ELRRLAITMNGMLERREASEAALQAQREEQARLEEKLRHSEKLAAIGQLAAGVAHELGT
FT                   PLGIIAGRAQRASRRLPADDPAHKEMKELQAELERVETIVRQLLDFARRNPLQQRPLEL
FT                   QGLVREIVARVQERGKGREQVRFDLDGGALTVAADRLRLGQALENLIDNAAQAAAECVQ
FT                   VNWRCQGDTLECVIADDGPRAGRGISDEQAERLFEPFFTTKPTGEGTGLGLAVAQVALE
FT                   DHGGQVRLDRDDPQLTRFVVTLPLASGACRDRQPEPSAAEPVQDGQATGGGAA"
FT   gene            570078..571499
FT                   /locus_tag="TK90_0538"
FT   CDS_pept        570078..571499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0538"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; response regulator receiver; helix-turn-helix
FT                   Fis-type; SMART: response regulator receiver; AAA ATPase;
FT                   KEGG: psa:PST_0364 mutant NtrC-like activator"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71053"
FT                   /db_xref="GOA:D3SEK8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK8"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADC71053.1"
FT                   /translation="MSPSDGLNDRVLVVEDDRGHRELLAEELAEVGYAVTAVETAEEAE
FT                   QVLRQQTVSLVVSDLRLPGADGFHVLEVARDTVPVPGFIMLTGFGTIDQAVTALKAGAD
FT                   DFLTKPVDLEHLRLAAERVAEARRLRAEVRQYREALAGDESFHGMQGKSPAMLKLHDLI
FT                   RRIAAADGSVLITGESGTGKELVARALHAESARAEGPFIALNCAGIPETLLESELLGHV
FT                   AGAFSGAKGARRGLFTEADGGTLFLDEIAEMPVAMQSKLLRLLQDGRVRPVGSNEEIET
FT                   DVRIVAATHQDLQERIRHEQFREDLYYRLETFRIEIPPLRDRGDDIERLAQQFLREQAL
FT                   ARGLPVRELSPEAMRALLRYGFPGNVRELASLMERAATLASGEVIELRDLPERVRQSGT
FT                   AGGSGVSPGNVAGTDLPIPGTGDDSHWPSLAEVEQAYLHRVLEHVEGNKQRAARILGIG
FT                   RKTLYRKLGESESDS"
FT   gene            571812..572273
FT                   /locus_tag="TK90_0539"
FT   CDS_pept        571812..572273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sth:STH980 putative beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71054"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC71054.1"
FT                   /translation="MSTFRKSALAIAMSSLFALGGLSAAQAMGEGAEAPDEEEAQEEQG
FT                   GMPPQMMVQAGEPAAPPADDDDEDRDGGGMPPQMAQAGEPAAPPADDDEDEGNGGMPPQ
FT                   MTQAGEPAAPPADDDDEDREGGMPQMAQAGGAEAPAGDDDDDEDDAPDW"
FT   sig_peptide     571812..571895
FT                   /locus_tag="TK90_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.424 at
FT                   residue 28"
FT   gene            572372..572899
FT                   /locus_tag="TK90_0540"
FT   CDS_pept        572372..572899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71055"
FT                   /db_xref="InterPro:IPR025433"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL0"
FT                   /inference="similar to AA sequence:KEGG:Mlg_1375"
FT                   /protein_id="ADC71055.1"
FT                   /translation="MSFRKTALAFALTSMFAIGGVATAQTGDMGGAQGGAEGAPPQGGA
FT                   EGAPPQGGQPPEGGAQGGQPPEGGAPPEGGAAGAPPAQQAPEVDLSEEDIDTFVGAFVA
FT                   VQEVREDFANRLQEAEDETEAQSMQQEAQDEMVSAVEDAGMTVEEYNEVAMALQNDPEL
FT                   MQEVQERAEAEM"
FT   sig_peptide     572372..572446
FT                   /locus_tag="TK90_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            573159..573587
FT                   /locus_tag="TK90_0541"
FT   CDS_pept        573159..573587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0541"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: mmw:Mmwyl1_2400 50S ribosomal protein
FT                   L13"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71056"
FT                   /db_xref="GOA:D3SEL1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL1"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ADC71056.1"
FT                   /translation="MSTISAKPAEVERDWFLVDAADKTLGRLATEIARRLRGKHKPVYT
FT                   PHVDTGDYIVVINAEKIRVSGNKASDKKYFRHTGYPGGIKEANFNQMIDRHPEKVLELA
FT                   VKGMLPRNPLGRAMFKKLKVYSGTEHRHTAQQPQPLDI"
FT   gene            573617..574009
FT                   /locus_tag="TK90_0542"
FT   CDS_pept        573617..574009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0542"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: xac:XAC0488 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71057"
FT                   /db_xref="GOA:D3SEL2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL2"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ADC71057.1"
FT                   /translation="MATNQYYGTGRRKTSSARVFLRPGTGNITVNDKPLDEFFGRQTSR
FT                   MVVRQPLEATESTENFDVIATVEGGGGNGQAGAIRLGIARALVQYNEDMRSPLRRGGHL
FT                   TRDAREVERKKVGLRKARRATQYSKR"
FT   gene            574049..574122
FT                   /locus_tag="TK90_R0012"
FT                   /note="tRNA-Gln5"
FT   tRNA            574049..574122
FT                   /locus_tag="TK90_R0012"
FT                   /product="tRNA-Gln"
FT   gene            575148..576065
FT                   /locus_tag="TK90_0543"
FT   CDS_pept        575148..576065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0543"
FT                   /product="beta-lactamase domain protein"
FT                   /note="SMART: beta-lactamase domain protein; KEGG:
FT                   oca:OCAR_5178 beta lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71058"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL3"
FT                   /inference="protein motif:SMART:SM00849"
FT                   /protein_id="ADC71058.1"
FT                   /translation="MSVPDNPYEPVSVDTTAHEVEGADTWYMIGISGIPDPDNEGHTSN
FT                   AGFVVTDEGVVVYDALGTPPLGFEMIRRIKEVTDQPIKYVIAGHYHADHIYGLQAFADH
FT                   TDAKIIGQSRAKDYLDSPGAAARLEQRRGVLTPWVDEDTQIIPPDEFFDDEYVIELGGK
FT                   TFRCVHAGPAHSPDDIIMVVEETGVVFAGDIVFDGRIPFMGDDALDSENWVNRLEELME
FT                   MDLKFLVPGHGDATDEAARAVKFTRDYIAYLREHMGAAVENMDSFDEAYAAMDWSDYED
FT                   LPAFEETNRSNTNAVYLEMEEKLF"
FT   gene            576119..576268
FT                   /locus_tag="TK90_0544"
FT   CDS_pept        576119..576268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rru:Rru_A0424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71059"
FT                   /db_xref="GOA:D3SEL4"
FT                   /db_xref="InterPro:IPR021446"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL4"
FT                   /inference="similar to AA sequence:KEGG:Rru_A0424"
FT                   /protein_id="ADC71059.1"
FT                   /translation="MTLHIDPGLLTAILSLGAGILILIWPRLLNYIVAIYLIVIGAVGL
FT                   LAYL"
FT   gene            576419..580261
FT                   /locus_tag="TK90_0545"
FT   CDS_pept        576419..580261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0545"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   aeh:Mlg_1638 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71060"
FT                   /db_xref="GOA:D3SEL5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL5"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ADC71060.1"
FT                   /translation="MTAERVREIPYNYTSFSDREIVIRFLGSDTWDLLNELRGERQTGV
FT                   SARMLFEVLGDMWVVARNPYIQDDLLDDKKRRKSLIDAMQHRLDQIRKRADGNEKALTL
FT                   ARRAQAAVTAFADEFQQTLELRERVRKRLKGLTHKDNIQFGGLARVSHVTDATDWRVEL
FT                   PFVVLTPDSEEEMGPLVAACIELGLTVIPRGGGTGYTGSAVPLSKRSAVINTEKLEGIG
FT                   PVERRPLPGVDQDVAVVRVEAGVVTKRVSELAAENGLVFAVDPTSQDASTIGGNVAMNA
FT                   GGKKAVLWGTALDNLASWTMVTPEADWMRVERLDHNLGKIHDAEIVRFRITRYGPDGRT
FT                   PRGEPETLEMPGARFRKVGLGKDVTDKTLMGVPGIQKEGCDGLITSAEFILHRMPDNIR
FT                   TVCLEFYGTDLHQAVPAIVEIKDAVDAEDGVLLAGLEHLDERYVRAVKYTPKGARGEQP
FT                   KMVLIADIVSDNEDALGKLAAKMVRAANARNGEGFIAVSPEARKRFWADRARTAAIAHH
FT                   TNAFKINEDVVIPLERLAEYTEGVETLNVRESLKNKLAMVDEVLECMRGDHPELRELLE
FT                   DTGGEGQQWFEAKRERAVEKLEAVQKRWKAIADNFFTLASECDELLDEPARADRRDHDK
FT                   LINLLLRRSLRISYRAEVERPLFEIFDGHQMESVRKRLAAIHDRVLTSRLFIALHMHAG
FT                   DGNVHTNIPVNSNDYQMMHQAERLVDDVMRLARELNGVISGEHGIGLTKMQYLEPERIE
FT                   SFAKYKQQVDPNGVFNAGKLLEGSGLSNAYTPSLRLVKQEALILEQSELGDLNDEIKDC
FT                   LRCGKCKPECNTHVPRANLLYSPRNKILATGLIVEAFLYEEQTRRGLSLHHFDEMNDVA
FT                   DHCTICHKCLNPCPVDIDFGDVTMHMRSILKKKGKRKATPATMMSMAFLNTKDPSRIKG
FT                   IRKGAIQLGYAAQRLGHYTFKKLNLLGEGKRPRSTTGKAPMHEQVVHFVKKPMPAGLPS
FT                   QTTRQMLGLEDSRYVPILRDPVKTDLDSDAVFYFPGCGSERLFSQVGLATLAMLYDVGA
FT                   QTVLPPGYLCCGYPQNSNGDFDKGSQITTENRVLFHRVATTLNYLDIKTVVVSCGTCMD
FT                   QLLKYEFERIFPGCRLLDIHEYLMEKGVKLEGLKGVQYMYHDPCHSPMKSHKPTDVAGK
FT                   LLGQEVLQSNRCCGEAGTFAVSRPDIATQVRFRKQEELHKGIRQLTGEDKAENGNVKLL
FT                   TSCPACQQGLSRYRDDTGLDTDYIVVEMANRLMGEGWQKGFIDRAREGGIEKVLL"
FT   gene            580462..581298
FT                   /locus_tag="TK90_0546"
FT   CDS_pept        580462..581298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0546"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG:
FT                   hna:Hneap_1819 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71061"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL6"
FT                   /inference="protein motif:SMART:SM00450"
FT                   /protein_id="ADC71061.1"
FT                   /translation="MIVRFARPRVALVALCLSLAGAPIVASAQQPFVEFPGRPLYERFG
FT                   VEAVDLFDLRGQLSGSTVVDVRPRLEYDILHIEGAHHVDLDSEDFDQQILALEEEHGSP
FT                   LVFYCNGRQSYAGYRAAARANELGVAAAQAYDAGMQDWVERYPGLARFRGEPANEVEDE
FT                   LISEDAFEARVLAADAFSRRARQGEDVVVVDIRSRGERDEISLFGGREVGAPLSDISAL
FT                   DRIVDQARRNEQTLLIFDQYGQQVRWLQYHLEELGVDDYYFLEGGLQRFYDEVMAR"
FT   sig_peptide     580462..580548
FT                   /locus_tag="TK90_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.835 at
FT                   residue 29"
FT   gene            complement(581375..581584)
FT                   /locus_tag="TK90_0547"
FT   CDS_pept        complement(581375..581584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csa:Csal_2317 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71062"
FT                   /db_xref="GOA:D3SEL7"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL7"
FT                   /inference="similar to AA sequence:KEGG:Csal_2317"
FT                   /protein_id="ADC71062.1"
FT                   /translation="MSETGKWLIVISGLIVVIGLLWPWLGKMPWGRLPGDIVIERENAR
FT                   FYFPITTMIIISVVISIVLAIFRR"
FT   gene            complement(581597..582259)
FT                   /locus_tag="TK90_0548"
FT   CDS_pept        complement(581597..582259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0548"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: nmu:Nmul_A0436 ribose-5-phosphate isomerase A;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71063"
FT                   /db_xref="GOA:D3SEL8"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL8"
FT                   /inference="protein motif:TFAM:TIGR00021"
FT                   /protein_id="ADC71063.1"
FT                   /translation="MTQDEMKKAVAEAALERIESGWIVGVGTGSTANYFIDALARIKGK
FT                   IDGAVASSEASAERLRGHGIEVLDLNSAGPLPIYVDGADEATRHLHLTKGGGGALTREK
FT                   IVAAASKTFVCVVDETKVVDYLGAFPLPVEVIPMARSHVARALSKLGGNPELREGFKTD
FT                   NGNVILDVHNLRIMNPVELESELDHIAGVVTNGLFARRPADVMLVGSPAGVEEMTAK"
FT   gene            582356..583870
FT                   /locus_tag="TK90_0549"
FT   CDS_pept        582356..583870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0549"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain protein; KEGG: aeh:Mlg_0087
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71064"
FT                   /db_xref="GOA:D3SEL9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEL9"
FT                   /inference="protein motif:TFAM:TIGR01124"
FT                   /protein_id="ADC71064.1"
FT                   /translation="MTVPYLEKILTARVYDVARETPLEVMPTLSQRLGSSIWLKREDLQ
FT                   PVFSFKLRGAYNKIAQLTPEQRKKGVIAASAGNHAQGVALGASHLGIKAVIVMPVTTPS
FT                   IKIDAVRRFGGKAVLHGDSFDEAAAHARTLQEKHGYTFIHPFDDPDVIAGQGTVAMELL
FT                   RQHSAPLDAVFVCIGGGGLAAGMAAYIKRLRPEIKVIGVEPDDAPSMYKALQQNRRVTL
FT                   KQVGIFADGAAVRQVGKETFRLVRELVDEVLLVDTDSICAAIKDIFDDTRVLAEPAGAL
FT                   AVAGMKQYIAREGITGGDFAAVLSGANINFDRLRHVAERAEIGEHREALFAVTIPERPG
FT                   SFRQFCQAIGKRGITEFNYRYADDERAHVFAGIKLEGGDAEREAIRETLEAQGYEVMDM
FT                   TENEVAKLHLRHMVGGHGGEVRNERLYRFEFPERPGALLNFLTHMGQTWNISLFHYRNH
FT                   GAAYGRVLVGMQIPAEDRARFREFLKEVGYPWHEETGNPAYSLFLR"
FT   gene            complement(583926..585332)
FT                   /locus_tag="TK90_0550"
FT   CDS_pept        complement(583926..585332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0550"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: afr:AFE_0958
FT                   pyridine nucleotide-disulfide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71065"
FT                   /db_xref="GOA:D3SEM0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEM0"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADC71065.1"
FT                   /translation="MSETFDLAIIGSGPGGYRAAVLGALRGLNVVIVEKGDWGGCCLNR
FT                   GCVPKKDWYHTARTVAAQRHFEGRGISGRLKADMARAWDHQKEVVTTVRDSYLGYMKHL
FT                   KIQYRHGTARFRDAETLEVATEDGTETVQARHTIIATGATATVPAPFAVEPGRVLTTDM
FT                   LFNDKPPAGERVAIIGSGVVATEFAWIFHHLGKKVTWLSRSKPLSTQKFSPQALGTLKE
FT                   QLAADGIEPVRVKGYDKVETSEAGVVITDAEGNTFEVDWVLLGTGRTPHTEGLNLDEIG
FT                   VKTDARGFVKRRPTLQTDIDTIYAIGDVASEWQTANHALADATIAVENIQNGNTREQDE
FT                   RFVPIAIYSAVEMARLGLDEDDAEDEELEPAVGFAAFETSPRALGQDEPEGFVRLIGDM
FT                   DTGALLGGEVIGADAGELIHILSLAPDRDTALSWIARGQWNHPTRAEEFLNATETLASK
FT                   WNLKSEIFGL"
FT   gene            complement(585338..586138)
FT                   /locus_tag="TK90_0551"
FT   CDS_pept        complement(585338..586138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aeh:Mlg_0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71066"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADC71066.1"
FT                   /translation="MLKLPRNGALCRATRTSLLAALLLLGQALLASAAANEPQEGPRLP
FT                   PFTASYEAQAMGNTLNARITLNHEDVQTRMAMDAHVSGFLRILGRFELSREALMNANDV
FT                   GLQLVTSRSREVTPRRERKVETRFDWEEDRAIGHVDNERFEIEVPPHTLDFLGSLYFMM
FT                   QRLEAGDLAGEGDGETVQTLERDRLRQYRFEYADTETIESPMGRIETVRVVRKSQDSDI
FT                   ELSAWFAPDLSHLPVRFDYEADGRVFELKLTRLEWHDPIIDLTE"
FT   sig_peptide     complement(586037..586138)
FT                   /locus_tag="TK90_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.726 at
FT                   residue 34"
FT   gene            complement(586089..586826)
FT                   /locus_tag="TK90_0552"
FT   CDS_pept        complement(586089..586826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0552"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein;
FT                   KEGG: reu:Reut_A2741 phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71067"
FT                   /db_xref="GOA:D3SEM2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D3SEM2"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADC71067.1"
FT                   /translation="MSSTTGPANPESLPRLVILISGRGSNLGALIKACNSGHIQARIVG
FT                   VISNRPDAGGLAYAKQHAIPARVLNHRDYPSREAFDADLAETIEAFDPDLVILAGFMRI
FT                   LTPGFVDRFTGRLLNIHPSLLPKYRGLDTHARALADGEDEHGASVHFVTPELDGGPVIM
FT                   QARVPVLPDDTPESLATRVQRAEHRLYPEVVRRLCSGEIQWRDRIVTGDDTPLTVPLQL
FT                   ETNEVVPDVEAPEERSPVPRDAD"
FT   gene            complement(586823..587881)
FT                   /locus_tag="TK90_0553"
FT   CDS_pept        complement(586823..587881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0553"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="KEGG: aeh:Mlg_0516 phosphoribosylformylglycinamidine
FT                   cyclo-ligase; TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71068"
FT                   /db_xref="GOA:D3SF01"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF01"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADC71068.1"
FT                   /translation="MSETRSGLTYREAGVDIEAGAELVERIKPHAARTQRPGVMAGLGG
FT                   FGALFELPMDRYRQPVLVSGTDGVGTKLRLAQETGRHDSIGIDLVAMCVNDIVVQGAEP
FT                   LFFLDYYATGHLDVDIAADVVTGIATGCEQAGCALIGGETAEMPGMYQGEDYDVAGFAV
FT                   GIAEKEALIDGTRVSAGDVVLGLASSGPHSNGYSLIRRVLEHAGAALDAPLPGAEGTTL
FT                   GDALMAPTTIYVRPLLDLMQQFPVHAAAHITGGGLTENLPRVLPDQLCARIDPQAWQWP
FT                   PVFDWLQQAGDIAPEEMLRTFNCGIGMTVILPEDRVEAASSTLARAGIPSWPIGVIEDC
FT                   EDTAPGVVYAAR"
FT   gene            588198..589295
FT                   /locus_tag="TK90_0554"
FT   CDS_pept        588198..589295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0554"
FT                   /product="Protein of unknown function DUF2066"
FT                   /note="PFAM: Protein of unknown function DUF2066; KEGG:
FT                   hha:Hhal_0709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71069"
FT                   /db_xref="InterPro:IPR018642"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF02"
FT                   /inference="protein motif:PFAM:PF09839"
FT                   /protein_id="ADC71069.1"
FT                   /translation="MDRCFPGALWYFGRLSKTPFNLMLRLFRPSRALAACLLLCLLVGV
FT                   SPLLADDAVVVNVHAEDETAALAQGLEQALVRVAGQRSPELSELVQVLLLELDEEGRIE
FT                   ALRRRQEVDDGEYRLEFDRDRLRSALRAADVPVVLGARPQLLVWAVYEEGGRRHLLGST
FT                   QDEADVLAGIDALGRDRGTPFVLPLGDLEDRRAAQAGDVIGGVTEPLQEAARRYGSTGI
FT                   VALHVRPVGGGAEARAITVHGGREYRSEGRGESPAAAARAAVEDGLDQVVAPLARVAAE
FT                   PDWVKLGFVGVEGFPAFEALRRELAQIEAIESARLDSLGGNAVTLEVRTGLAPDDLVDL
FT                   LHASGYGVAEDPHGDSEAKAWLRRE"
FT   sig_peptide     588198..588350
FT                   /locus_tag="TK90_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.997 at
FT                   residue 51"
FT   gene            589277..590371
FT                   /locus_tag="TK90_0555"
FT   CDS_pept        589277..590371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0555"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   sml:Smlt1128 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71070"
FT                   /db_xref="GOA:D3SF03"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF03"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ADC71070.1"
FT                   /translation="MAAPRVNSPAPFSTATLAALVGLVILGVALYLLAPILTPFLIALL
FT                   IGYLFNPLVTRLAVRTGGSRTLATLVIFVLVMLGLAGLVLVLIPLAMAQFERLMLLLPE
FT                   VIAWFDEQVRPWIEQQAGDRLPALEPAALQELLAEHWREAGGLAGGLLHWLGSSTSALV
FT                   LGVLNLVLIPVVSFYLLRDWPRLVAGLHDLLPRAWRDPVTRFAVESDNTLGAFLRGQLL
FT                   VMLALGLFYAITLSVAGVQMGLAIGLIAGLVSFVPYVGVIVGIVLATAAVLFQGDGWTL
FT                   LLAVLVIFAVAQVLESVVLTPWLVGDRTGLHPVAVIFAVLAGGQLFGFFGVLLALPVAA
FT                   VLAVAVRQALARYRGMNAAEADTP"
FT   gene            590368..591099
FT                   /locus_tag="TK90_0556"
FT   CDS_pept        590368..591099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0556"
FT                   /product="DnaA regulatory inactivator Hda"
FT                   /note="TIGRFAM: DnaA regulatory inactivator Hda; PFAM:
FT                   Chromosomal replication initiator DnaA; KEGG: hha:Hhal_0707
FT                   chromosomal replication initiator, DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71071"
FT                   /db_xref="GOA:D3SF04"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF04"
FT                   /inference="protein motif:TFAM:TIGR03420"
FT                   /protein_id="ADC71071.1"
FT                   /translation="MRSEGNSPLERQLPLDLRLRDASRFSGFYARGNALARDAVQALSV
FT                   GTGIQEPQILLHGPSGSGKTHLLQAACYQGHERGDPVSYLPLGEVAEAPPMAVLDGLER
FT                   SCLVALDDLEAVVGRGDWDEALFGLVNRLRDAGCRVLLAAAAPPEGLPVRLPDLASRLA
FT                   WGPVFRMQRPDDVACKEILAQRAALRGLELPEPVADYLLRRCSRDLSTLLALLDRLDLA
FT                   ALAQQRRLTIPFVREQLARMG"
FT   gene            complement(591112..591474)
FT                   /locus_tag="TK90_0557"
FT   CDS_pept        complement(591112..591474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0557"
FT                   /product="Protein of unknown function DUF2069, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2069, membrane;
FT                   KEGG: aeh:Mlg_0519 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71072"
FT                   /db_xref="GOA:D3SF05"
FT                   /db_xref="InterPro:IPR018643"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF05"
FT                   /inference="protein motif:PFAM:PF09842"
FT                   /protein_id="ADC71072.1"
FT                   /translation="MIALSRALALAGFLGLLLLILIWTTWIAPPEIVPVWLALIVLVMP
FT                   LLFPLRGMLHGRRYTHAWSSLLALAYITLGITIGAAAEDRLYGLLMTGTSLAWFAGSLL
FT                   FVKLDARRARAAAEQP"
FT   gene            complement(591471..592088)
FT                   /locus_tag="TK90_0558"
FT   CDS_pept        complement(591471..592088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0558"
FT                   /product="flavoprotein WrbA"
FT                   /note="TIGRFAM: flavoprotein WrbA; PFAM: flavodoxin/nitric
FT                   oxide synthase; KEGG: pst:PSPTO_1686 trp repressor binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71073"
FT                   /db_xref="GOA:D3SF06"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF06"
FT                   /inference="protein motif:TFAM:TIGR01755"
FT                   /protein_id="ADC71073.1"
FT                   /translation="MSSTTEILVLYYSRYGATAELARQVATGVEKAGASARVRTVAPVS
FT                   TNIGEDRPAVPEDGPPYAELRDLEECAGLVMGSPTRFGNMAAPLKYFLDGTSGLWASGG
FT                   LVDRPFGVFTSTATQHGGQETTLLSMALPLIHQGMLWVGVPYTVPELNSTTSGGTPYGA
FT                   SHVAGTQGDQAVTRDEQRIATALGERVARIALRLDAAPGAPA"
FT   gene            complement(592085..592441)
FT                   /locus_tag="TK90_0559"
FT   CDS_pept        complement(592085..592441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0559"
FT                   /product="arsenate reductase"
FT                   /note="TIGRFAM: arsenate reductase; PFAM: arsenate
FT                   reductase and related; KEGG: ppg:PputGB1_1247 arsenate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71074"
FT                   /db_xref="GOA:D3SF07"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF07"
FT                   /inference="protein motif:TFAM:TIGR00014"
FT                   /protein_id="ADC71074.1"
FT                   /translation="MSDAPTLYHNPRCSKSRAALALLREQGVEPEIVEYLKTPPDAATL
FT                   KSVIEKLGIRPRDLLRTGEAEYRELGLKDAEMDDEALIQTMIQHPKLIERPILVAGGQA
FT                   RIGRPPEQVLEILS"
FT   gene            592464..592754
FT                   /locus_tag="TK90_0560"
FT   CDS_pept        592464..592754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0560"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: aeh:Mlg_0522
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71075"
FT                   /db_xref="GOA:D3SF08"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF08"
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /protein_id="ADC71075.1"
FT                   /translation="MAKAHDTHARRWHVRGRVQGVFFRASTREQAQALGLTGYARNLPD
FT                   GRVEVLAVGSPDALDRLETWLREGPRMARVEGLEAQAVPSPEPLPTGFRTD"
FT   gene            592836..593882
FT                   /locus_tag="TK90_0561"
FT   CDS_pept        592836..593882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0561"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: aeh:Mlg_2777 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   Holliday junction DNA helicase RuvB domain; AAA ATPase
FT                   central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71076"
FT                   /db_xref="GOA:D3SF09"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF09"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ADC71076.1"
FT                   /translation="MESRLVDMQSQSEDPRVEVSLRPKRLDDYTGQPRVVEQLGLFIEA
FT                   ARGRGEALDHTLVAGPPGLGKTTLAHIVANELGVGLRQTSGPVLERAGDLAAILTALEP
FT                   QDVLFVDEIHRLPTVVEEILYPALEDGQLDIVIGEGPAARSIKVDLPPFTLVGATTRAG
FT                   LLSAPLRDRFGIVQRLDHYTVTDLAHIVGRAAGLLGVGIEPEGAAEIARRGRGTPRLAN
FT                   RLLRRVRDYAEVRASGVITAEVAAQALDLLAIDASGLDAQDRRLLEVLVEKFDGGPVGV
FT                   ESLATALNEDRGTLEDVVEPFLIQQGYLQRTPRGRQATRRTLAMFGLAGSVEPDLLAPV
FT                   DSQGGDRR"
FT   gene            593879..594331
FT                   /locus_tag="TK90_0562"
FT   CDS_pept        593879..594331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0562"
FT                   /product="tol-pal system-associated acyl-CoA thioesterase"
FT                   /note="TIGRFAM: tol-pal system-associated acyl-CoA
FT                   thioesterase; PFAM: thioesterase superfamily protein; KEGG:
FT                   bxe:Bxe_A3916 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71077"
FT                   /db_xref="GOA:D3SF10"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF10"
FT                   /inference="protein motif:TFAM:TIGR02799"
FT                   /protein_id="ADC71077.1"
FT                   /translation="MTDSDAPFEWPVRVYYEDTDAGGVVYHANYLKFMERARTEWLRAL
FT                   GFEQDALREEYGIVFAVRRCCVDMRRPARFNDALTVTCRLHSLRRASLEFHQGVERDGE
FT                   TLASGEVGIACVEVARQAPAAIPGPVLEALRRHHDHGPVARAAGTK"
FT   gene            594354..595046
FT                   /locus_tag="TK90_0563"
FT   CDS_pept        594354..595046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0563"
FT                   /product="protein TolQ"
FT                   /note="TIGRFAM: protein TolQ; PFAM: MotA/TolQ/ExbB proton
FT                   channel; KEGG: lhk:LHK_00053 TolQ"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71078"
FT                   /db_xref="GOA:D3SF11"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF11"
FT                   /inference="protein motif:TFAM:TIGR02796"
FT                   /protein_id="ADC71078.1"
FT                   /translation="MAVDFSMYQLVMEATLVVQLVMVILVLASVLSWLAIIVKARSLNA
FT                   AHRACDDFEERFWSGADLSHLYEGVRRKQEMTGMEHVFSSGFKEFLRARQHGIPAGEPA
FT                   QRAMRVAIAREIDEMERYLQFLATVGSTSPYIGLFGTVWGIMHAFLGLSGVQQATLAMV
FT                   APGIAEALIATALGLFAAIPAVIAYNRFAGDVDRVAVRLENFNDEFVALLNRQVHAKST
FT                   DTASEATA"
FT   gene            595050..595502
FT                   /locus_tag="TK90_0564"
FT   CDS_pept        595050..595502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0564"
FT                   /product="protein TolR"
FT                   /note="TIGRFAM: protein TolR; PFAM: Biopolymer transport
FT                   protein ExbD/TolR; KEGG: mca:MCA1227 TolR protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71079"
FT                   /db_xref="GOA:D3SF12"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014168"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF12"
FT                   /inference="protein motif:TFAM:TIGR02801"
FT                   /protein_id="ADC71079.1"
FT                   /translation="MSEQRRNSRRLRRPMSQINVVPFIDVMLVLLIIFMITAPMLQQGV
FT                   EVDLPEADAEALDRDEQAAEPLVVTVDASGAMSLNQGPIIDEPLAPQEMTEIVREFLAE
FT                   HPGTQTFVRGDRNVDYGRVIDAMIALQRAGGGRVGLITEPPRENSD"
FT   gene            595514..596527
FT                   /locus_tag="TK90_0565"
FT   CDS_pept        595514..596527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TK90_0565"
FT                   /product="protein TolA"
FT                   /note="TIGRFAM: protein TolA; TonB family protein; PFAM:
FT                   Tol-Pal system TolA; KEGG: aeh:Mlg_0243 TonB family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TK90_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADC71080"
FT                   /db_xref="GOA:D3SF13"
FT                   /db_xref="InterPro:IPR014161"
FT                   /db_xref="UniProtKB/TrEMBL:D3SF13"
FT                   /inference="protein motif:TFAM:TIGR02794"
FT                   /protein_id="ADC71080.1"
F