(data stored in ACNUC1104 zone)

EMBL: CP001918

ID   CP001918; SV 1; circular; genomic DNA; STD; PRO; 5314581 BP.
XX
AC   CP001918;
XX
PR   Project:PRJNA45793;
XX
DT   27-APR-2010 (Rel. 104, Created)
DT   24-MAR-2017 (Rel. 132, Last updated, Version 6)
XX
DE   Enterobacter cloacae subsp. cloacae ATCC 13047, complete genome.
XX
KW   .
XX
OS   Enterobacter cloacae subsp. cloacae ATCC 13047
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
XX
RN   [1]
RP   1-5314581
RX   DOI; 10.1128/JB.00067-10.
RX   PUBMED; 20207761.
RA   Ren Y., Ren Y., Zhou Z., Guo X., Li Y., Feng L., Wang L.;
RT   "Complete genome sequence of Enterobacter cloacae subsp. cloacae type
RT   strain ATCC 13047";
RL   J. Bacteriol. 192(9):2463-2464(2010).
XX
RN   [2]
RP   1-5314581
RA   Wang L., Ren Y., Ren Y., Zhou Z., Guo X., Feng L., Wang L.;
RT   ;
RL   Submitted (03-FEB-2010) to the INSDC.
RL   TEDA School of Biological Sciences and Biotechnology, Nankai University, 23
RL   Hongda Street, TEDA, Tianjin, Tianjin 300457, China
XX
DR   MD5; fb7c9407c296acb1a324a1aece62ceb0.
DR   BioSample; SAMN02603901.
DR   EnsemblGenomes-Gn; EBG00001184962.
DR   EnsemblGenomes-Gn; EBG00001184963.
DR   EnsemblGenomes-Gn; EBG00001184964.
DR   EnsemblGenomes-Gn; EBG00001184965.
DR   EnsemblGenomes-Gn; EBG00001184966.
DR   EnsemblGenomes-Gn; EBG00001184967.
DR   EnsemblGenomes-Gn; EBG00001184968.
DR   EnsemblGenomes-Gn; EBG00001184969.
DR   EnsemblGenomes-Gn; EBG00001184970.
DR   EnsemblGenomes-Gn; EBG00001184971.
DR   EnsemblGenomes-Gn; EBG00001184972.
DR   EnsemblGenomes-Gn; EBG00001184973.
DR   EnsemblGenomes-Gn; EBG00001184974.
DR   EnsemblGenomes-Gn; EBG00001184975.
DR   EnsemblGenomes-Gn; EBG00001184976.
DR   EnsemblGenomes-Gn; EBG00001184977.
DR   EnsemblGenomes-Gn; EBG00001184978.
DR   EnsemblGenomes-Gn; EBG00001184979.
DR   EnsemblGenomes-Gn; EBG00001184980.
DR   EnsemblGenomes-Gn; EBG00001184981.
DR   EnsemblGenomes-Gn; EBG00001184982.
DR   EnsemblGenomes-Gn; EBG00001184983.
DR   EnsemblGenomes-Gn; EBG00001184984.
DR   EnsemblGenomes-Gn; EBG00001184985.
DR   EnsemblGenomes-Gn; EBG00001184986.
DR   EnsemblGenomes-Gn; EBG00001184987.
DR   EnsemblGenomes-Gn; EBG00001184988.
DR   EnsemblGenomes-Gn; EBG00001184989.
DR   EnsemblGenomes-Gn; EBG00001184990.
DR   EnsemblGenomes-Gn; EBG00001184991.
DR   EnsemblGenomes-Gn; EBG00001184992.
DR   EnsemblGenomes-Gn; EBG00001184993.
DR   EnsemblGenomes-Gn; EBG00001184994.
DR   EnsemblGenomes-Gn; EBG00001184995.
DR   EnsemblGenomes-Gn; EBG00001184996.
DR   EnsemblGenomes-Gn; EBG00001184997.
DR   EnsemblGenomes-Gn; EBG00001184998.
DR   EnsemblGenomes-Gn; EBG00001184999.
DR   EnsemblGenomes-Gn; EBG00001185000.
DR   EnsemblGenomes-Gn; EBG00001185001.
DR   EnsemblGenomes-Gn; EBG00001185002.
DR   EnsemblGenomes-Gn; EBG00001185003.
DR   EnsemblGenomes-Gn; EBG00001185004.
DR   EnsemblGenomes-Gn; EBG00001185005.
DR   EnsemblGenomes-Gn; EBG00001185006.
DR   EnsemblGenomes-Gn; EBG00001185007.
DR   EnsemblGenomes-Gn; EBG00001185008.
DR   EnsemblGenomes-Gn; EBG00001185009.
DR   EnsemblGenomes-Gn; EBG00001185010.
DR   EnsemblGenomes-Gn; EBG00001185011.
DR   EnsemblGenomes-Gn; EBG00001185012.
DR   EnsemblGenomes-Gn; EBG00001185013.
DR   EnsemblGenomes-Gn; EBG00001185014.
DR   EnsemblGenomes-Gn; EBG00001185015.
DR   EnsemblGenomes-Gn; EBG00001185016.
DR   EnsemblGenomes-Gn; EBG00001185017.
DR   EnsemblGenomes-Gn; EBG00001185018.
DR   EnsemblGenomes-Gn; EBG00001185019.
DR   EnsemblGenomes-Gn; EBG00001185020.
DR   EnsemblGenomes-Gn; EBG00001185021.
DR   EnsemblGenomes-Gn; EBG00001185022.
DR   EnsemblGenomes-Gn; EBG00001185023.
DR   EnsemblGenomes-Gn; EBG00001185024.
DR   EnsemblGenomes-Gn; EBG00001185025.
DR   EnsemblGenomes-Gn; EBG00001185026.
DR   EnsemblGenomes-Gn; EBG00001185027.
DR   EnsemblGenomes-Gn; EBG00001185028.
DR   EnsemblGenomes-Gn; EBG00001185029.
DR   EnsemblGenomes-Gn; EBG00001185030.
DR   EnsemblGenomes-Gn; EBG00001185031.
DR   EnsemblGenomes-Gn; EBG00001185032.
DR   EnsemblGenomes-Gn; EBG00001185033.
DR   EnsemblGenomes-Gn; EBG00001185034.
DR   EnsemblGenomes-Gn; EBG00001185035.
DR   EnsemblGenomes-Gn; EBG00001185036.
DR   EnsemblGenomes-Gn; EBG00001185037.
DR   EnsemblGenomes-Gn; EBG00001185038.
DR   EnsemblGenomes-Gn; EBG00001185039.
DR   EnsemblGenomes-Gn; EBG00001185040.
DR   EnsemblGenomes-Gn; EBG00001185041.
DR   EnsemblGenomes-Gn; EBG00001185042.
DR   EnsemblGenomes-Gn; EBG00001185043.
DR   EnsemblGenomes-Gn; EBG00001185044.
DR   EnsemblGenomes-Gn; EBG00001185045.
DR   EnsemblGenomes-Gn; EBG00001185046.
DR   EnsemblGenomes-Gn; EBG00001185047.
DR   EnsemblGenomes-Gn; EBG00001185048.
DR   EnsemblGenomes-Gn; EBG00001185049.
DR   EnsemblGenomes-Gn; EBG00001185050.
DR   EnsemblGenomes-Gn; EBG00001185051.
DR   EnsemblGenomes-Gn; EBG00001185052.
DR   EnsemblGenomes-Gn; EBG00001185053.
DR   EnsemblGenomes-Gn; EBG00001185054.
DR   EnsemblGenomes-Gn; EBG00001185055.
DR   EnsemblGenomes-Gn; EBG00001185056.
DR   EnsemblGenomes-Gn; EBG00001185057.
DR   EnsemblGenomes-Gn; EBG00001185058.
DR   EnsemblGenomes-Gn; EBG00001185059.
DR   EnsemblGenomes-Gn; EBG00001185060.
DR   EnsemblGenomes-Gn; EBG00001185061.
DR   EnsemblGenomes-Gn; EBG00001185062.
DR   EnsemblGenomes-Gn; EBG00001185063.
DR   EnsemblGenomes-Gn; EBG00001185064.
DR   EnsemblGenomes-Gn; EBG00001185065.
DR   EnsemblGenomes-Gn; EBG00001185066.
DR   EnsemblGenomes-Gn; EBG00001185067.
DR   EnsemblGenomes-Gn; EBG00001185068.
DR   EnsemblGenomes-Gn; EBG00001185069.
DR   EnsemblGenomes-Gn; EBG00001185070.
DR   EnsemblGenomes-Gn; EBG00001185071.
DR   EnsemblGenomes-Gn; EBG00001185072.
DR   EnsemblGenomes-Gn; EBG00001185073.
DR   EnsemblGenomes-Gn; EBG00001185074.
DR   EnsemblGenomes-Gn; EBG00001185075.
DR   EnsemblGenomes-Gn; EBG00001185076.
DR   EnsemblGenomes-Gn; EBG00001185077.
DR   EnsemblGenomes-Gn; EBG00001185078.
DR   EnsemblGenomes-Gn; EBG00001185079.
DR   EnsemblGenomes-Gn; EBG00001185080.
DR   EnsemblGenomes-Gn; EBG00001185081.
DR   EnsemblGenomes-Gn; EBG00001185082.
DR   EnsemblGenomes-Gn; EBG00001185083.
DR   EnsemblGenomes-Gn; EBG00001185084.
DR   EnsemblGenomes-Gn; EBG00001185085.
DR   EnsemblGenomes-Gn; EBG00001185086.
DR   EnsemblGenomes-Gn; EBG00001185087.
DR   EnsemblGenomes-Gn; EBG00001185088.
DR   EnsemblGenomes-Gn; EBG00001185089.
DR   EnsemblGenomes-Gn; EBG00001185090.
DR   EnsemblGenomes-Gn; EBG00001185091.
DR   EnsemblGenomes-Gn; EBG00001185092.
DR   EnsemblGenomes-Gn; EBG00001185093.
DR   EnsemblGenomes-Gn; EBG00001185094.
DR   EnsemblGenomes-Gn; EBG00001185095.
DR   EnsemblGenomes-Gn; EBG00001185096.
DR   EnsemblGenomes-Gn; EBG00001185097.
DR   EnsemblGenomes-Gn; EBG00001185098.
DR   EnsemblGenomes-Gn; EBG00001185099.
DR   EnsemblGenomes-Gn; EBG00001185100.
DR   EnsemblGenomes-Gn; EBG00001185101.
DR   EnsemblGenomes-Gn; EBG00001185102.
DR   EnsemblGenomes-Gn; EBG00001185103.
DR   EnsemblGenomes-Gn; EBG00001185104.
DR   EnsemblGenomes-Gn; EBG00001185105.
DR   EnsemblGenomes-Gn; EBG00001185106.
DR   EnsemblGenomes-Gn; EBG00001185107.
DR   EnsemblGenomes-Gn; EBG00001185108.
DR   EnsemblGenomes-Gn; EBG00001185109.
DR   EnsemblGenomes-Gn; EBG00001185110.
DR   EnsemblGenomes-Gn; EBG00001185111.
DR   EnsemblGenomes-Gn; EBG00001185112.
DR   EnsemblGenomes-Gn; EBG00001185113.
DR   EnsemblGenomes-Gn; EBG00001185114.
DR   EnsemblGenomes-Gn; EBG00001185115.
DR   EnsemblGenomes-Gn; EBG00001185116.
DR   EnsemblGenomes-Gn; EBG00001185117.
DR   EnsemblGenomes-Gn; EBG00001185118.
DR   EnsemblGenomes-Gn; EBG00001185119.
DR   EnsemblGenomes-Gn; EBG00001185120.
DR   EnsemblGenomes-Gn; EBG00001185121.
DR   EnsemblGenomes-Gn; EBG00001185122.
DR   EnsemblGenomes-Gn; EBG00001185123.
DR   EnsemblGenomes-Gn; EBG00001185124.
DR   EnsemblGenomes-Gn; EBG00001185125.
DR   EnsemblGenomes-Gn; EBG00001185126.
DR   EnsemblGenomes-Gn; EBG00001185127.
DR   EnsemblGenomes-Gn; EBG00001185128.
DR   EnsemblGenomes-Gn; EBG00001185129.
DR   EnsemblGenomes-Gn; EBG00001185130.
DR   EnsemblGenomes-Gn; EBG00001185131.
DR   EnsemblGenomes-Gn; EBG00001185132.
DR   EnsemblGenomes-Gn; EBG00001185133.
DR   EnsemblGenomes-Gn; EBG00001185134.
DR   EnsemblGenomes-Gn; EBG00001185135.
DR   EnsemblGenomes-Gn; EBG00001185136.
DR   EnsemblGenomes-Gn; EBG00001185137.
DR   EnsemblGenomes-Gn; EBG00001185138.
DR   EnsemblGenomes-Gn; EBG00001185139.
DR   EnsemblGenomes-Gn; EBG00001185140.
DR   EnsemblGenomes-Gn; EBG00001185141.
DR   EnsemblGenomes-Gn; EBG00001185142.
DR   EnsemblGenomes-Gn; EBG00001185143.
DR   EnsemblGenomes-Gn; EBG00001185144.
DR   EnsemblGenomes-Gn; EBG00001185145.
DR   EnsemblGenomes-Gn; EBG00001185146.
DR   EnsemblGenomes-Gn; EBG00001185147.
DR   EnsemblGenomes-Gn; EBG00001185148.
DR   EnsemblGenomes-Gn; EBG00001185149.
DR   EnsemblGenomes-Gn; EBG00001185150.
DR   EnsemblGenomes-Gn; EBG00001185151.
DR   EnsemblGenomes-Gn; EBG00001185152.
DR   EnsemblGenomes-Gn; EBG00001185153.
DR   EnsemblGenomes-Gn; EBG00001185154.
DR   EnsemblGenomes-Gn; EBG00001185155.
DR   EnsemblGenomes-Gn; EBG00001185156.
DR   EnsemblGenomes-Gn; EBG00001185157.
DR   EnsemblGenomes-Gn; EBG00001185158.
DR   EnsemblGenomes-Gn; EBG00001185159.
DR   EnsemblGenomes-Gn; EBG00001185160.
DR   EnsemblGenomes-Gn; EBG00001185161.
DR   EnsemblGenomes-Gn; EBG00001185162.
DR   EnsemblGenomes-Gn; EBG00001185163.
DR   EnsemblGenomes-Gn; EBG00001185164.
DR   EnsemblGenomes-Gn; ECL_16S01.
DR   EnsemblGenomes-Gn; ECL_16S02.
DR   EnsemblGenomes-Gn; ECL_16S03.
DR   EnsemblGenomes-Gn; ECL_16S04.
DR   EnsemblGenomes-Gn; ECL_16S05.
DR   EnsemblGenomes-Gn; ECL_16S06.
DR   EnsemblGenomes-Gn; ECL_16S07.
DR   EnsemblGenomes-Gn; ECL_16S08.
DR   EnsemblGenomes-Gn; ECL_23S01.
DR   EnsemblGenomes-Gn; ECL_23S02.
DR   EnsemblGenomes-Gn; ECL_23S03.
DR   EnsemblGenomes-Gn; ECL_23S04.
DR   EnsemblGenomes-Gn; ECL_23S05.
DR   EnsemblGenomes-Gn; ECL_23S06.
DR   EnsemblGenomes-Gn; ECL_23S07.
DR   EnsemblGenomes-Gn; ECL_23S08.
DR   EnsemblGenomes-Gn; ECL_5S01.
DR   EnsemblGenomes-Gn; ECL_5S02.
DR   EnsemblGenomes-Gn; ECL_5S03.
DR   EnsemblGenomes-Gn; ECL_5S04.
DR   EnsemblGenomes-Gn; ECL_5S05.
DR   EnsemblGenomes-Gn; ECL_5S06.
DR   EnsemblGenomes-Gn; ECL_5S07.
DR   EnsemblGenomes-Gn; ECL_5S08.
DR   EnsemblGenomes-Gn; ECL_5S09.
DR   EnsemblGenomes-Gn; ECL_tRNA001.
DR   EnsemblGenomes-Gn; ECL_tRNA002.
DR   EnsemblGenomes-Gn; ECL_tRNA003.
DR   EnsemblGenomes-Gn; ECL_tRNA004.
DR   EnsemblGenomes-Gn; ECL_tRNA005.
DR   EnsemblGenomes-Gn; ECL_tRNA006.
DR   EnsemblGenomes-Gn; ECL_tRNA007.
DR   EnsemblGenomes-Gn; ECL_tRNA008.
DR   EnsemblGenomes-Gn; ECL_tRNA009.
DR   EnsemblGenomes-Gn; ECL_tRNA010.
DR   EnsemblGenomes-Gn; ECL_tRNA011.
DR   EnsemblGenomes-Gn; ECL_tRNA012.
DR   EnsemblGenomes-Gn; ECL_tRNA013.
DR   EnsemblGenomes-Gn; ECL_tRNA014.
DR   EnsemblGenomes-Gn; ECL_tRNA015.
DR   EnsemblGenomes-Gn; ECL_tRNA016.
DR   EnsemblGenomes-Gn; ECL_tRNA017.
DR   EnsemblGenomes-Gn; ECL_tRNA018.
DR   EnsemblGenomes-Gn; ECL_tRNA019.
DR   EnsemblGenomes-Gn; ECL_tRNA020.
DR   EnsemblGenomes-Gn; ECL_tRNA021.
DR   EnsemblGenomes-Gn; ECL_tRNA022.
DR   EnsemblGenomes-Gn; ECL_tRNA023.
DR   EnsemblGenomes-Gn; ECL_tRNA024.
DR   EnsemblGenomes-Gn; ECL_tRNA025.
DR   EnsemblGenomes-Gn; ECL_tRNA026.
DR   EnsemblGenomes-Gn; ECL_tRNA027.
DR   EnsemblGenomes-Gn; ECL_tRNA028.
DR   EnsemblGenomes-Gn; ECL_tRNA029.
DR   EnsemblGenomes-Gn; ECL_tRNA030.
DR   EnsemblGenomes-Gn; ECL_tRNA031.
DR   EnsemblGenomes-Gn; ECL_tRNA032.
DR   EnsemblGenomes-Gn; ECL_tRNA033.
DR   EnsemblGenomes-Gn; ECL_tRNA034.
DR   EnsemblGenomes-Gn; ECL_tRNA035.
DR   EnsemblGenomes-Gn; ECL_tRNA036.
DR   EnsemblGenomes-Gn; ECL_tRNA037.
DR   EnsemblGenomes-Gn; ECL_tRNA038.
DR   EnsemblGenomes-Gn; ECL_tRNA039.
DR   EnsemblGenomes-Gn; ECL_tRNA040.
DR   EnsemblGenomes-Gn; ECL_tRNA041.
DR   EnsemblGenomes-Gn; ECL_tRNA042.
DR   EnsemblGenomes-Gn; ECL_tRNA043.
DR   EnsemblGenomes-Gn; ECL_tRNA044.
DR   EnsemblGenomes-Gn; ECL_tRNA045.
DR   EnsemblGenomes-Gn; ECL_tRNA046.
DR   EnsemblGenomes-Gn; ECL_tRNA047.
DR   EnsemblGenomes-Gn; ECL_tRNA048.
DR   EnsemblGenomes-Gn; ECL_tRNA049.
DR   EnsemblGenomes-Gn; ECL_tRNA050.
DR   EnsemblGenomes-Gn; ECL_tRNA051.
DR   EnsemblGenomes-Gn; ECL_tRNA052.
DR   EnsemblGenomes-Gn; ECL_tRNA053.
DR   EnsemblGenomes-Gn; ECL_tRNA054.
DR   EnsemblGenomes-Gn; ECL_tRNA055.
DR   EnsemblGenomes-Gn; ECL_tRNA056.
DR   EnsemblGenomes-Gn; ECL_tRNA057.
DR   EnsemblGenomes-Gn; ECL_tRNA058.
DR   EnsemblGenomes-Gn; ECL_tRNA059.
DR   EnsemblGenomes-Gn; ECL_tRNA060.
DR   EnsemblGenomes-Gn; ECL_tRNA061.
DR   EnsemblGenomes-Gn; ECL_tRNA062.
DR   EnsemblGenomes-Gn; ECL_tRNA063.
DR   EnsemblGenomes-Gn; ECL_tRNA064.
DR   EnsemblGenomes-Gn; ECL_tRNA065.
DR   EnsemblGenomes-Gn; ECL_tRNA066.
DR   EnsemblGenomes-Gn; ECL_tRNA067.
DR   EnsemblGenomes-Gn; ECL_tRNA068.
DR   EnsemblGenomes-Gn; ECL_tRNA069.
DR   EnsemblGenomes-Gn; ECL_tRNA070.
DR   EnsemblGenomes-Gn; ECL_tRNA071.
DR   EnsemblGenomes-Gn; ECL_tRNA072.
DR   EnsemblGenomes-Gn; ECL_tRNA073.
DR   EnsemblGenomes-Gn; ECL_tRNA074.
DR   EnsemblGenomes-Gn; ECL_tRNA075.
DR   EnsemblGenomes-Gn; ECL_tRNA076.
DR   EnsemblGenomes-Gn; ECL_tRNA077.
DR   EnsemblGenomes-Gn; ECL_tRNA078.
DR   EnsemblGenomes-Gn; ECL_tRNA079.
DR   EnsemblGenomes-Gn; ECL_tRNA080.
DR   EnsemblGenomes-Gn; ECL_tRNA081.
DR   EnsemblGenomes-Gn; ECL_tRNA082.
DR   EnsemblGenomes-Gn; ECL_tRNA083.
DR   EnsemblGenomes-Gn; ECL_tRNA084.
DR   EnsemblGenomes-Tr; EBT00001763269.
DR   EnsemblGenomes-Tr; EBT00001763270.
DR   EnsemblGenomes-Tr; EBT00001763271.
DR   EnsemblGenomes-Tr; EBT00001763272.
DR   EnsemblGenomes-Tr; EBT00001763273.
DR   EnsemblGenomes-Tr; EBT00001763274.
DR   EnsemblGenomes-Tr; EBT00001763275.
DR   EnsemblGenomes-Tr; EBT00001763276.
DR   EnsemblGenomes-Tr; EBT00001763277.
DR   EnsemblGenomes-Tr; EBT00001763278.
DR   EnsemblGenomes-Tr; EBT00001763279.
DR   EnsemblGenomes-Tr; EBT00001763280.
DR   EnsemblGenomes-Tr; EBT00001763281.
DR   EnsemblGenomes-Tr; EBT00001763282.
DR   EnsemblGenomes-Tr; EBT00001763285.
DR   EnsemblGenomes-Tr; EBT00001763286.
DR   EnsemblGenomes-Tr; EBT00001763289.
DR   EnsemblGenomes-Tr; EBT00001763291.
DR   EnsemblGenomes-Tr; EBT00001763292.
DR   EnsemblGenomes-Tr; EBT00001763294.
DR   EnsemblGenomes-Tr; EBT00001763297.
DR   EnsemblGenomes-Tr; EBT00001763298.
DR   EnsemblGenomes-Tr; EBT00001763301.
DR   EnsemblGenomes-Tr; EBT00001763303.
DR   EnsemblGenomes-Tr; EBT00001763305.
DR   EnsemblGenomes-Tr; EBT00001763307.
DR   EnsemblGenomes-Tr; EBT00001763309.
DR   EnsemblGenomes-Tr; EBT00001763311.
DR   EnsemblGenomes-Tr; EBT00001763313.
DR   EnsemblGenomes-Tr; EBT00001763315.
DR   EnsemblGenomes-Tr; EBT00001763317.
DR   EnsemblGenomes-Tr; EBT00001763319.
DR   EnsemblGenomes-Tr; EBT00001763321.
DR   EnsemblGenomes-Tr; EBT00001763323.
DR   EnsemblGenomes-Tr; EBT00001763324.
DR   EnsemblGenomes-Tr; EBT00001763326.
DR   EnsemblGenomes-Tr; EBT00001763328.
DR   EnsemblGenomes-Tr; EBT00001763330.
DR   EnsemblGenomes-Tr; EBT00001763332.
DR   EnsemblGenomes-Tr; EBT00001763334.
DR   EnsemblGenomes-Tr; EBT00001763336.
DR   EnsemblGenomes-Tr; EBT00001763337.
DR   EnsemblGenomes-Tr; EBT00001763338.
DR   EnsemblGenomes-Tr; EBT00001763340.
DR   EnsemblGenomes-Tr; EBT00001763341.
DR   EnsemblGenomes-Tr; EBT00001763344.
DR   EnsemblGenomes-Tr; EBT00001763346.
DR   EnsemblGenomes-Tr; EBT00001763348.
DR   EnsemblGenomes-Tr; EBT00001763350.
DR   EnsemblGenomes-Tr; EBT00001763351.
DR   EnsemblGenomes-Tr; EBT00001763353.
DR   EnsemblGenomes-Tr; EBT00001763355.
DR   EnsemblGenomes-Tr; EBT00001763357.
DR   EnsemblGenomes-Tr; EBT00001763359.
DR   EnsemblGenomes-Tr; EBT00001763361.
DR   EnsemblGenomes-Tr; EBT00001763363.
DR   EnsemblGenomes-Tr; EBT00001763364.
DR   EnsemblGenomes-Tr; EBT00001763366.
DR   EnsemblGenomes-Tr; EBT00001763369.
DR   EnsemblGenomes-Tr; EBT00001763371.
DR   EnsemblGenomes-Tr; EBT00001763373.
DR   EnsemblGenomes-Tr; EBT00001763375.
DR   EnsemblGenomes-Tr; EBT00001763377.
DR   EnsemblGenomes-Tr; EBT00001763379.
DR   EnsemblGenomes-Tr; EBT00001763381.
DR   EnsemblGenomes-Tr; EBT00001763382.
DR   EnsemblGenomes-Tr; EBT00001763384.
DR   EnsemblGenomes-Tr; EBT00001763386.
DR   EnsemblGenomes-Tr; EBT00001763387.
DR   EnsemblGenomes-Tr; EBT00001763389.
DR   EnsemblGenomes-Tr; EBT00001763392.
DR   EnsemblGenomes-Tr; EBT00001763395.
DR   EnsemblGenomes-Tr; EBT00001763396.
DR   EnsemblGenomes-Tr; EBT00001763398.
DR   EnsemblGenomes-Tr; EBT00001763399.
DR   EnsemblGenomes-Tr; EBT00001763401.
DR   EnsemblGenomes-Tr; EBT00001763403.
DR   EnsemblGenomes-Tr; EBT00001763405.
DR   EnsemblGenomes-Tr; EBT00001763407.
DR   EnsemblGenomes-Tr; EBT00001763408.
DR   EnsemblGenomes-Tr; EBT00001763411.
DR   EnsemblGenomes-Tr; EBT00001763412.
DR   EnsemblGenomes-Tr; EBT00001763415.
DR   EnsemblGenomes-Tr; EBT00001763417.
DR   EnsemblGenomes-Tr; EBT00001763418.
DR   EnsemblGenomes-Tr; EBT00001763419.
DR   EnsemblGenomes-Tr; EBT00001763420.
DR   EnsemblGenomes-Tr; EBT00001763421.
DR   EnsemblGenomes-Tr; EBT00001763422.
DR   EnsemblGenomes-Tr; EBT00001763423.
DR   EnsemblGenomes-Tr; EBT00001763424.
DR   EnsemblGenomes-Tr; EBT00001763425.
DR   EnsemblGenomes-Tr; EBT00001763426.
DR   EnsemblGenomes-Tr; EBT00001763427.
DR   EnsemblGenomes-Tr; EBT00001763428.
DR   EnsemblGenomes-Tr; EBT00001763429.
DR   EnsemblGenomes-Tr; EBT00001763430.
DR   EnsemblGenomes-Tr; EBT00001763431.
DR   EnsemblGenomes-Tr; EBT00001763432.
DR   EnsemblGenomes-Tr; EBT00001763433.
DR   EnsemblGenomes-Tr; EBT00001763434.
DR   EnsemblGenomes-Tr; EBT00001763435.
DR   EnsemblGenomes-Tr; EBT00001763436.
DR   EnsemblGenomes-Tr; EBT00001763437.
DR   EnsemblGenomes-Tr; EBT00001763438.
DR   EnsemblGenomes-Tr; EBT00001763439.
DR   EnsemblGenomes-Tr; EBT00001763440.
DR   EnsemblGenomes-Tr; EBT00001763441.
DR   EnsemblGenomes-Tr; EBT00001763442.
DR   EnsemblGenomes-Tr; EBT00001763443.
DR   EnsemblGenomes-Tr; EBT00001763444.
DR   EnsemblGenomes-Tr; EBT00001763445.
DR   EnsemblGenomes-Tr; EBT00001763446.
DR   EnsemblGenomes-Tr; EBT00001763447.
DR   EnsemblGenomes-Tr; EBT00001763448.
DR   EnsemblGenomes-Tr; EBT00001763449.
DR   EnsemblGenomes-Tr; EBT00001763450.
DR   EnsemblGenomes-Tr; EBT00001763451.
DR   EnsemblGenomes-Tr; EBT00001763452.
DR   EnsemblGenomes-Tr; EBT00001763453.
DR   EnsemblGenomes-Tr; EBT00001763454.
DR   EnsemblGenomes-Tr; EBT00001763455.
DR   EnsemblGenomes-Tr; EBT00001763456.
DR   EnsemblGenomes-Tr; EBT00001763457.
DR   EnsemblGenomes-Tr; EBT00001763458.
DR   EnsemblGenomes-Tr; EBT00001763459.
DR   EnsemblGenomes-Tr; EBT00001763460.
DR   EnsemblGenomes-Tr; EBT00001763461.
DR   EnsemblGenomes-Tr; EBT00001763462.
DR   EnsemblGenomes-Tr; EBT00001763463.
DR   EnsemblGenomes-Tr; EBT00001763464.
DR   EnsemblGenomes-Tr; EBT00001763465.
DR   EnsemblGenomes-Tr; EBT00001763466.
DR   EnsemblGenomes-Tr; EBT00001763467.
DR   EnsemblGenomes-Tr; EBT00001763468.
DR   EnsemblGenomes-Tr; EBT00001763469.
DR   EnsemblGenomes-Tr; EBT00001763470.
DR   EnsemblGenomes-Tr; EBT00001763471.
DR   EnsemblGenomes-Tr; EBT00001763472.
DR   EnsemblGenomes-Tr; EBT00001763473.
DR   EnsemblGenomes-Tr; EBT00001763474.
DR   EnsemblGenomes-Tr; EBT00001763475.
DR   EnsemblGenomes-Tr; EBT00001763476.
DR   EnsemblGenomes-Tr; EBT00001763477.
DR   EnsemblGenomes-Tr; EBT00001763478.
DR   EnsemblGenomes-Tr; EBT00001763479.
DR   EnsemblGenomes-Tr; EBT00001763480.
DR   EnsemblGenomes-Tr; EBT00001763481.
DR   EnsemblGenomes-Tr; EBT00001763482.
DR   EnsemblGenomes-Tr; EBT00001763483.
DR   EnsemblGenomes-Tr; EBT00001763484.
DR   EnsemblGenomes-Tr; EBT00001763485.
DR   EnsemblGenomes-Tr; EBT00001763486.
DR   EnsemblGenomes-Tr; EBT00001763487.
DR   EnsemblGenomes-Tr; EBT00001763488.
DR   EnsemblGenomes-Tr; EBT00001763489.
DR   EnsemblGenomes-Tr; EBT00001763490.
DR   EnsemblGenomes-Tr; EBT00001763491.
DR   EnsemblGenomes-Tr; EBT00001763492.
DR   EnsemblGenomes-Tr; EBT00001763493.
DR   EnsemblGenomes-Tr; EBT00001763494.
DR   EnsemblGenomes-Tr; EBT00001763495.
DR   EnsemblGenomes-Tr; EBT00001763496.
DR   EnsemblGenomes-Tr; EBT00001763497.
DR   EnsemblGenomes-Tr; EBT00001763498.
DR   EnsemblGenomes-Tr; EBT00001763499.
DR   EnsemblGenomes-Tr; EBT00001763500.
DR   EnsemblGenomes-Tr; EBT00001763501.
DR   EnsemblGenomes-Tr; EBT00001763502.
DR   EnsemblGenomes-Tr; EBT00001763503.
DR   EnsemblGenomes-Tr; EBT00001763504.
DR   EnsemblGenomes-Tr; EBT00001763505.
DR   EnsemblGenomes-Tr; EBT00001763506.
DR   EnsemblGenomes-Tr; EBT00001763507.
DR   EnsemblGenomes-Tr; EBT00001763508.
DR   EnsemblGenomes-Tr; EBT00001763509.
DR   EnsemblGenomes-Tr; EBT00001763510.
DR   EnsemblGenomes-Tr; EBT00001763511.
DR   EnsemblGenomes-Tr; EBT00001763512.
DR   EnsemblGenomes-Tr; EBT00001763513.
DR   EnsemblGenomes-Tr; EBT00001763514.
DR   EnsemblGenomes-Tr; EBT00001763515.
DR   EnsemblGenomes-Tr; EBT00001763516.
DR   EnsemblGenomes-Tr; EBT00001763517.
DR   EnsemblGenomes-Tr; EBT00001763518.
DR   EnsemblGenomes-Tr; EBT00001763519.
DR   EnsemblGenomes-Tr; EBT00001763520.
DR   EnsemblGenomes-Tr; EBT00001763521.
DR   EnsemblGenomes-Tr; EBT00001763522.
DR   EnsemblGenomes-Tr; EBT00001763523.
DR   EnsemblGenomes-Tr; EBT00001763524.
DR   EnsemblGenomes-Tr; EBT00001763525.
DR   EnsemblGenomes-Tr; EBT00001763526.
DR   EnsemblGenomes-Tr; EBT00001763527.
DR   EnsemblGenomes-Tr; EBT00001763528.
DR   EnsemblGenomes-Tr; EBT00001763529.
DR   EnsemblGenomes-Tr; EBT00001763530.
DR   EnsemblGenomes-Tr; EBT00001763531.
DR   EnsemblGenomes-Tr; EBT00001763532.
DR   EnsemblGenomes-Tr; EBT00001763533.
DR   EnsemblGenomes-Tr; EBT00001763534.
DR   EnsemblGenomes-Tr; EBT00001763535.
DR   EnsemblGenomes-Tr; EBT00001763536.
DR   EnsemblGenomes-Tr; ECL_16S01-1.
DR   EnsemblGenomes-Tr; ECL_16S02-1.
DR   EnsemblGenomes-Tr; ECL_16S03-1.
DR   EnsemblGenomes-Tr; ECL_16S04-1.
DR   EnsemblGenomes-Tr; ECL_16S05-1.
DR   EnsemblGenomes-Tr; ECL_16S06-1.
DR   EnsemblGenomes-Tr; ECL_16S07-1.
DR   EnsemblGenomes-Tr; ECL_16S08-1.
DR   EnsemblGenomes-Tr; ECL_23S01-1.
DR   EnsemblGenomes-Tr; ECL_23S02-1.
DR   EnsemblGenomes-Tr; ECL_23S03-1.
DR   EnsemblGenomes-Tr; ECL_23S04-1.
DR   EnsemblGenomes-Tr; ECL_23S05-1.
DR   EnsemblGenomes-Tr; ECL_23S06-1.
DR   EnsemblGenomes-Tr; ECL_23S07-1.
DR   EnsemblGenomes-Tr; ECL_23S08-1.
DR   EnsemblGenomes-Tr; ECL_5S01-1.
DR   EnsemblGenomes-Tr; ECL_5S02-1.
DR   EnsemblGenomes-Tr; ECL_5S03-1.
DR   EnsemblGenomes-Tr; ECL_5S04-1.
DR   EnsemblGenomes-Tr; ECL_5S05-1.
DR   EnsemblGenomes-Tr; ECL_5S06-1.
DR   EnsemblGenomes-Tr; ECL_5S07-1.
DR   EnsemblGenomes-Tr; ECL_5S08-1.
DR   EnsemblGenomes-Tr; ECL_5S09-1.
DR   EnsemblGenomes-Tr; ECL_tRNA001-1.
DR   EnsemblGenomes-Tr; ECL_tRNA002-1.
DR   EnsemblGenomes-Tr; ECL_tRNA003-1.
DR   EnsemblGenomes-Tr; ECL_tRNA004-1.
DR   EnsemblGenomes-Tr; ECL_tRNA005-1.
DR   EnsemblGenomes-Tr; ECL_tRNA006-1.
DR   EnsemblGenomes-Tr; ECL_tRNA007-1.
DR   EnsemblGenomes-Tr; ECL_tRNA008-1.
DR   EnsemblGenomes-Tr; ECL_tRNA009-1.
DR   EnsemblGenomes-Tr; ECL_tRNA010-1.
DR   EnsemblGenomes-Tr; ECL_tRNA011-1.
DR   EnsemblGenomes-Tr; ECL_tRNA012-1.
DR   EnsemblGenomes-Tr; ECL_tRNA013-1.
DR   EnsemblGenomes-Tr; ECL_tRNA014-1.
DR   EnsemblGenomes-Tr; ECL_tRNA015-1.
DR   EnsemblGenomes-Tr; ECL_tRNA016-1.
DR   EnsemblGenomes-Tr; ECL_tRNA017-1.
DR   EnsemblGenomes-Tr; ECL_tRNA018-1.
DR   EnsemblGenomes-Tr; ECL_tRNA019-1.
DR   EnsemblGenomes-Tr; ECL_tRNA020-1.
DR   EnsemblGenomes-Tr; ECL_tRNA021-1.
DR   EnsemblGenomes-Tr; ECL_tRNA022-1.
DR   EnsemblGenomes-Tr; ECL_tRNA023-1.
DR   EnsemblGenomes-Tr; ECL_tRNA024-1.
DR   EnsemblGenomes-Tr; ECL_tRNA025-1.
DR   EnsemblGenomes-Tr; ECL_tRNA026-1.
DR   EnsemblGenomes-Tr; ECL_tRNA027-1.
DR   EnsemblGenomes-Tr; ECL_tRNA028-1.
DR   EnsemblGenomes-Tr; ECL_tRNA029-1.
DR   EnsemblGenomes-Tr; ECL_tRNA030-1.
DR   EnsemblGenomes-Tr; ECL_tRNA031-1.
DR   EnsemblGenomes-Tr; ECL_tRNA032-1.
DR   EnsemblGenomes-Tr; ECL_tRNA033-1.
DR   EnsemblGenomes-Tr; ECL_tRNA034-1.
DR   EnsemblGenomes-Tr; ECL_tRNA035-1.
DR   EnsemblGenomes-Tr; ECL_tRNA036-1.
DR   EnsemblGenomes-Tr; ECL_tRNA037-1.
DR   EnsemblGenomes-Tr; ECL_tRNA038-1.
DR   EnsemblGenomes-Tr; ECL_tRNA039-1.
DR   EnsemblGenomes-Tr; ECL_tRNA040-1.
DR   EnsemblGenomes-Tr; ECL_tRNA041-1.
DR   EnsemblGenomes-Tr; ECL_tRNA042-1.
DR   EnsemblGenomes-Tr; ECL_tRNA043-1.
DR   EnsemblGenomes-Tr; ECL_tRNA044-1.
DR   EnsemblGenomes-Tr; ECL_tRNA045-1.
DR   EnsemblGenomes-Tr; ECL_tRNA046-1.
DR   EnsemblGenomes-Tr; ECL_tRNA047-1.
DR   EnsemblGenomes-Tr; ECL_tRNA048-1.
DR   EnsemblGenomes-Tr; ECL_tRNA049-1.
DR   EnsemblGenomes-Tr; ECL_tRNA050-1.
DR   EnsemblGenomes-Tr; ECL_tRNA051-1.
DR   EnsemblGenomes-Tr; ECL_tRNA052-1.
DR   EnsemblGenomes-Tr; ECL_tRNA053-1.
DR   EnsemblGenomes-Tr; ECL_tRNA054-1.
DR   EnsemblGenomes-Tr; ECL_tRNA055-1.
DR   EnsemblGenomes-Tr; ECL_tRNA056-1.
DR   EnsemblGenomes-Tr; ECL_tRNA057-1.
DR   EnsemblGenomes-Tr; ECL_tRNA058-1.
DR   EnsemblGenomes-Tr; ECL_tRNA059-1.
DR   EnsemblGenomes-Tr; ECL_tRNA060-1.
DR   EnsemblGenomes-Tr; ECL_tRNA061-1.
DR   EnsemblGenomes-Tr; ECL_tRNA062-1.
DR   EnsemblGenomes-Tr; ECL_tRNA063-1.
DR   EnsemblGenomes-Tr; ECL_tRNA064-1.
DR   EnsemblGenomes-Tr; ECL_tRNA065-1.
DR   EnsemblGenomes-Tr; ECL_tRNA066-1.
DR   EnsemblGenomes-Tr; ECL_tRNA067-1.
DR   EnsemblGenomes-Tr; ECL_tRNA068-1.
DR   EnsemblGenomes-Tr; ECL_tRNA069-1.
DR   EnsemblGenomes-Tr; ECL_tRNA070-1.
DR   EnsemblGenomes-Tr; ECL_tRNA071-1.
DR   EnsemblGenomes-Tr; ECL_tRNA072-1.
DR   EnsemblGenomes-Tr; ECL_tRNA073-1.
DR   EnsemblGenomes-Tr; ECL_tRNA074-1.
DR   EnsemblGenomes-Tr; ECL_tRNA075-1.
DR   EnsemblGenomes-Tr; ECL_tRNA076-1.
DR   EnsemblGenomes-Tr; ECL_tRNA077-1.
DR   EnsemblGenomes-Tr; ECL_tRNA078-1.
DR   EnsemblGenomes-Tr; ECL_tRNA079-1.
DR   EnsemblGenomes-Tr; ECL_tRNA080-1.
DR   EnsemblGenomes-Tr; ECL_tRNA081-1.
DR   EnsemblGenomes-Tr; ECL_tRNA082-1.
DR   EnsemblGenomes-Tr; ECL_tRNA083-1.
DR   EnsemblGenomes-Tr; ECL_tRNA084-1.
DR   EuropePMC; PMC2863489; 20207761.
DR   EuropePMC; PMC3368419; 22675579.
DR   EuropePMC; PMC3764934; 24019988.
DR   EuropePMC; PMC3771936; 24069314.
DR   EuropePMC; PMC3838098; 24088860.
DR   EuropePMC; PMC4087019; 25003758.
DR   EuropePMC; PMC4432112; 25801572.
DR   EuropePMC; PMC4549013; 26303940.
DR   EuropePMC; PMC4649179; 26438492.
DR   EuropePMC; PMC4705252; 26858542.
DR   EuropePMC; PMC5145215; 27930729.
DR   EuropePMC; PMC5404547; 28223374.
DR   EuropePMC; PMC5531050; 28553940.
DR   EuropePMC; PMC5533749; 28754999.
DR   EuropePMC; PMC5597754; 28912313.
DR   EuropePMC; PMC5834341; 29496835.
DR   EuropePMC; PMC5961450; 29796297.
DR   EuropePMC; PMC6103429; 27669519.
DR   EuropePMC; PMC6205999; 30374192.
DR   EuropePMC; PMC6325193; 30397053.
DR   InterPro; IPR040509; CdiI_C.
DR   PDB; 4NTQ; X-ray.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00014; DsrA.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00035; OxyS.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00084; CsrC.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00115; IS061.
DR   RFAM; RF00126; ryfA.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00368; sroB.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00370; sroD.
DR   RFAM; RF00371; sroE.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00383; IS1222_FSE.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01387; isrC.
DR   RFAM; RF01393; isrJ.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01395; isrL.
DR   RFAM; RF01400; istR.
DR   RFAM; RF01408; sraL.
DR   RFAM; RF01517; iscRS.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01728; STAXI.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01771; rnk_leader.
DR   RFAM; RF01794; sok.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01832; ROSE_2.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01988; SECIS_2.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02051; STnc450.
DR   RFAM; RF02053; STnc430.
DR   RFAM; RF02057; STnc40.
DR   RFAM; RF02069; STnc70.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02076; STnc100.
DR   RFAM; RF02079; STnc180.
DR   RFAM; RF02081; STnc550.
DR   RFAM; RF02084; STnc130.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP001918.
DR   SILVA-SSU; CP001918.
DR   StrainInfo; 52251; 1.
DR   UniProtKB/Swiss-Prot; A0A023GPJ0; CDII_ENTCC.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5314581
FT                   /organism="Enterobacter cloacae subsp. cloacae ATCC 13047"
FT                   /sub_species="cloacae"
FT                   /strain="ATCC 13047"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Enterobacter cloacae subsp. cloacae"
FT                   /db_xref="taxon:716541"
FT                   /culture_collection="ATCC:13047"
FT   gene            82..1410
FT                   /gene="dnaA"
FT                   /locus_tag="ECL_00001"
FT   CDS_pept        82..1410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="ECL_00001"
FT                   /product="chromosomal replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59569"
FT                   /db_xref="GOA:A0A0H3CDE3"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDE3"
FT                   /protein_id="ADF59569.1"
FT                   /translation="MWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLNDFCG
FT                   SDAPQLRFEVGTKPVTQTVRETVNVAVPAQAAPAPAPRVAPAARPGWDNVPAPAEPTYR
FT                   SNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAVGNG
FT                   IMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANKERSQ
FT                   EEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELETRVAIL
FT                   MKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFVREALRD
FT                   LLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKELTNHSLPE
FT                   IGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
FT   gene            1415..2515
FT                   /locus_tag="ECL_00002"
FT   CDS_pept        1415..2515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00002"
FT                   /product="DNA polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59570"
FT                   /db_xref="GOA:A0A0H3CEA5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA5"
FT                   /protein_id="ADF59570.1"
FT                   /translation="MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLT
FT                   GTDLEMEMIARVTLTQPHDAGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPIGDSLPNHSVIVPRKGVIELMRMLDGGDTPLRVQIGSNN
FT                   IRAHVGDFVFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDSLKQAFARAAILSNEKFRGV
FT                   RLYVSENQIKITANNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKCENVRILL
FT                   TDSVSSVQIEDAASQSAAYVVMPMRL"
FT   gene            2515..3588
FT                   /locus_tag="ECL_00003"
FT   CDS_pept        2515..3588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00003"
FT                   /product="recombination protein F"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59571"
FT                   /db_xref="GOA:A0A0H3CEL0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEL0"
FT                   /protein_id="ADF59571.1"
FT                   /translation="MSLTRLLIRDFRNIESADLALSPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSLQIGRVIRHEQESFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGTDGHK
FT                   VAELALLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEAGFFNAWSNLKRLLKQRNA
FT                   ALRQVTRYAQLRPWDMELIPLAEQISRWRAEYSAGIAEDMADTCKQFLPEFSLTFSFQR
FT                   GWEKETDYAEVLERNFERDRMLTYTAHGPHKADFRIRADGAPVEDTLSRGQLKLLMCAL
FT                   RLAQGEFLTRESGRRCLYLIDDFASELDDARRGLLASRLKATQSQVFVSAISAEHVMDM
FT                   SDENSKMFTVEKGKITD"
FT   gene            3617..6028
FT                   /gene="gyrB"
FT                   /locus_tag="ECL_00004"
FT   CDS_pept        3617..6028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="ECL_00004"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59572"
FT                   /db_xref="GOA:A0A0H3CG93"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG93"
FT                   /protein_id="ADF59572.1"
FT                   /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGHCKDIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYQHGVPEAPLAVTGDTEKT
FT                   GTMVRFWPSLETFTNVTEFEYDILAKRLRELSFLNSGVSIRLRDKRDNKEDHFHYEGGI
FT                   KAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTH
FT                   LAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDKL
FT                   VSSEVKSAVEQQMNELLSDYLQENPNDAKIVVGKIIDAARAREAARKAREMTRRKGALD
FT                   LAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARF
FT                   DKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQ
FT                   MPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDDAMDQYQIAIALDGATLHANSSAPALA
FT                   GEPLERLVSEFNATQKMIGRMERRYPKALLKELIYQPTLTEADLSNEQAVTRWVNALVS
FT                   ELNEKEQHGSQWKFDVQQNAAQQFEPIIRVRTHGVDTDYPLEHEFVTGPEYRRICTLGE
FT                   KLRGLIEDDAFIERGERRQPVASFEQALEWLVKESRRGLSIQRYKGLGEMNPDQLWETT
FT                   MDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   gene            complement(6049..6996)
FT                   /locus_tag="ECL_00005"
FT   CDS_pept        complement(6049..6996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00005"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59573"
FT                   /db_xref="GOA:A0A0H3CCQ5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCQ5"
FT                   /protein_id="ADF59573.1"
FT                   /translation="MTSTLKDIPVFVAAVEAGSFAQAAIRLHLSRSAVGKSIARLEERL
FT                   GVRLFHRTTRSQSLTDNGALFYERCLRALEEIRGAESLLETGKQQISGRLRVAMPVLFG
FT                   RQCVAPLLIELAQEHPGLELEMSFSDRVVDLVEEGFDMAVRNGTLQDSSVLVVRRLGEH
FT                   RMVLCAAPEYLQKSGQPDTVADLPHHTAINYLRAGRVLPWQLMDNEGRSHTFTPRSSLN
FT                   MDDLQAICDAALAGYGIAWLPCWMARREIQQGKLIPLLKQAPDVRFDVHAVWQQTPHLP
FT                   LRVRIAIDTLASRLPSVLSLDMPEPKKSRAKCAA"
FT   gene            7107..8132
FT                   /locus_tag="ECL_00006"
FT   CDS_pept        7107..8132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00006"
FT                   /product="alcohol dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59574"
FT                   /db_xref="GOA:A0A0H3CDE8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDE8"
FT                   /protein_id="ADF59574.1"
FT                   /translation="MAETMQRWSMNALGRENLKLTQEPVPKPGPGEVRVRVNAVALNYR
FT                   DKMVIEGMMPIPLSFPFTPASDMAGVVDSIGEGVTRFQPGARVISTFFPEWIDGRPQAD
FT                   ARHLPYKTSGGYFPGMLAEYVIVNENGLVAAPETLDDVEASTLPCAGLTAWFALVERGN
FT                   LRAGQSVLVQGTGGVAIFALQIAKALGAEVYVTSGSDEKLARAKKLGADRGINRLKGDW
FT                   AEALLTLTQDRGIDHIIETVGGENLQHSLRAVAVHGRISVIGVLAGSEITLSAGELLLK
FT                   SPVIQGIGVGHRRALEEFVRAVEVTGLKPVIEQRYRFDQLEQALEHLDRGAFGKIVLTR
FT                   E"
FT   gene            8247..9059
FT                   /locus_tag="ECL_00007"
FT   CDS_pept        8247..9059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00007"
FT                   /product="sugar phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59575"
FT                   /db_xref="GOA:A0A0H3CEA7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA7"
FT                   /protein_id="ADF59575.1"
FT                   /translation="MAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARAKGVNVVLTTGR
FT                   PYAGVHSYLKELHMNQPGDYCITYNGALVQKAADGSTVAQTALNYDDYLFLEKLSREVG
FT                   SHFHALDRTTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEPEVL
FT                   DKAIARIPAEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADALGIKPEEIMALGDQE
FT                   NDIAMIEYAGMGVAMENAIPSVKEVANFVTKSNLEDGVAYAIEKFVLS"
FT   gene            9286..9975
FT                   /locus_tag="ECL_00008"
FT   CDS_pept        9286..9975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00008"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59576"
FT                   /db_xref="GOA:A0A0H3CEL5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEL5"
FT                   /protein_id="ADF59576.1"
FT                   /translation="MTLNKTDRIVITLGTQIVGGKYVPGSPLPAEAELCEEFETSRNII
FT                   REVFRSLMAKRLIEMKRYRGAFVAPRNQWNYLDTDVLQWVLENDYDPRLIGAMSEVRNL
FT                   VEPAIARWAAERATSGDLAQIESALNDMIANNQNREAFNEADIRYHEAVLQSVHNPVLQ
FT                   QLSVAISSLQRAVFERTWMGDEANMPKTLQEHKALFDAIRHQDGDAAEQAALTMIASST
FT                   RRLKEIT"
FT   gene            9972..10850
FT                   /locus_tag="ECL_00009"
FT   CDS_pept        9972..10850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00009"
FT                   /product="2-keto-3-deoxygalactonate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59577"
FT                   /db_xref="GOA:A0A0H3CG98"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG98"
FT                   /protein_id="ADF59577.1"
FT                   /translation="MTSRYIAIDWGSTNLRAWLYQGEQCLESRQSEAGVTRLNGKSPEA
FT                   VLAEVTQNWRDSATPVVMAGMVGSNVGWKIAPYLPVPVSFSAIGKQLTSVGDNILIVPG
FT                   LCVSRDDNHNVMRGEETQLLGARTLSPSSVYVMPGTHCKWVQADAEHIHDFRTVMTGEL
FT                   HHLLLNHSLLGAGLPEQVPSPEAFAAGLARGIAFPDVLPQLFEVRASHVLGNLPREQVS
FT                   EFLSGLLIGAEVASMREFVGCEQAVTIVAGAALTSRYEQAFRAIGREVSTVSGDTAFQA
FT                   GIRSIAHAVAN"
FT   gene            10834..11451
FT                   /locus_tag="ECL_00010"
FT   CDS_pept        10834..11451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00010"
FT                   /product="2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59578"
FT                   /db_xref="GOA:A0A0H3CCQ8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCQ8"
FT                   /protein_id="ADF59578.1"
FT                   /translation="MQWQTSLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPEW
FT                   EKSIPTVVEAFGDKALIGAGTVLQPEQVERLAKMGCKLIVTPNINPEVIRRAVSHGMTV
FT                   CPGCATATEAFTALEAGAQSLKIFPSSAFGPDYIKALKAVLPASVPVFAVGGVTPENLA
FT                   QWINAGCVGAGLGSDLYRAGQSVERTAQQAAAFVKAYREAVQ"
FT   gene            11448..12596
FT                   /locus_tag="ECL_00011"
FT   CDS_pept        11448..12596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00011"
FT                   /product="galactonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59579"
FT                   /db_xref="GOA:A0A0H3CDF1"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDF1"
FT                   /protein_id="ADF59579.1"
FT                   /translation="MKITKLTTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAAV
FT                   HELGEYLIGQDPARINDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPVWQ
FT                   LMGGLVRDKIKAYSWVGGDRPAEVIDGITQLRNIGFDTFKLNGCEEMGVIDNSRAVDRA
FT                   VNTVAQIREAFGNEIEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAEYYPK
FT                   LAEQTHIPIAAGERMFSRFEFKRVLEAGGIAILQPDLSHAGGITECYKIAGMAEAYDVA
FT                   LAPHCPLGPVALAACLHVDFVSRNAVFQEQSMGIHYNKGAELLDFVKNKEDFSMEGGFF
FT                   KPLMKPGLGVDIDEAKVIELSKNAPDWRNPLWRHEDGSVAEW"
FT   gene            12758..14050
FT                   /locus_tag="ECL_00012"
FT   CDS_pept        12758..14050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00012"
FT                   /product="D-galactonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59580"
FT                   /db_xref="GOA:A0A0H3CEB0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB0"
FT                   /protein_id="ADF59580.1"
FT                   /translation="MDIPVTATKTGRRRYLTLIMIFITVVICYVDRANLAVASAHIQEE
FT                   FGITKAEMGYVFSAFAWLYTLYQIPGGWFLDRVGSRLTYFIAILGWSVATLFQGFATGL
FT                   MSLIGLRAITGVFEAPAFPTNNRMVTSWFPEHERASAVGFYTSGQFVGLAFLTPLLIWI
FT                   QELLSWHWVFIVTGGIGIIWSLIWFKVYQPPRLTKNITKAELDYIRDGGGLVDGDAPVK
FT                   KEARQPLTRADWKLVFHRKLVGVYLGQFAVTSTLWFFLTWFPNYLTQEKGITALKAGFM
FT                   TTVPFLAAFFGVLLSGWLADKLVKKGVSLGVARKTPIICGLLISTCIMGANYTNDPVWI
FT                   MTLMALAFFGNGFASITWSLVSSLAPMRLIGLTGGVFNFVGGLGGITVPLVIGYLAQDY
FT                   GFGPALVYISAVALIGALSYILLVGDVKRVG"
FT   gene            14101..15330
FT                   /locus_tag="ECL_00013"
FT   CDS_pept        14101..15330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00013"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59581"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEL8"
FT                   /protein_id="ADF59581.1"
FT                   /translation="MKQITFASRNHQLTNTNTWTPDSQWLVYDVRPSGASFTGETIERV
FT                   NVSTGEVEVIYRAKHGAHVGVVTVHPAQDKYVFIHGPKNPDADWQYDFHHRQGVIVHNG
FT                   QASNLDAMDITVPYTAGALRGGSHVHVFSPNGQFVSFTYNDHVLHERDPKLDLRNVGVA
FT                   APFGPVTPQGNHPHEYPGTFWSVLVSRTTPNPQPGSDEINRAYEEGWVGNGRLAFIGDT
FT                   LSVKGEKVPELFIVDLPKDEQGWKQAGDAPLQGTPETMPAPPAGVLQRRLTFTHQKAYP
FT                   GLVNVPRHWVRSNPQGTQIAFLMRDDNGIVQLWLISPEGGEPRQLTHTESGIQSAFNWH
FT                   PSGDSLGFVLENRIACCDAQTGEVTFLTSDHGNPPSADAVVFSPNGRAIAWMEEKEGFR
FT                   QLWLTETVQD"
FT   gene            complement(15327..15662)
FT                   /locus_tag="ECL_00014"
FT   CDS_pept        complement(15327..15662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59582"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGA3"
FT                   /protein_id="ADF59582.1"
FT                   /translation="MMMKNVLIKLTTFSGVVLLCGCSSVMSHTGGKEGTYPGTRASAAM
FT                   ISDDDTNWGTKSLVILDMPFTAVADTLLLPWDMFRTDSSVRSRVEKSEQQNLATNAVIP
FT                   PAEMPRP"
FT   gene            15974..16384
FT                   /gene="ibpA"
FT                   /locus_tag="ECL_00015"
FT   CDS_pept        15974..16384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /locus_tag="ECL_00015"
FT                   /product="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59583"
FT                   /db_xref="GOA:A0A0H3CCR1"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCR1"
FT                   /protein_id="ADF59583.1"
FT                   /translation="MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGYPPYNVELVDENH
FT                   YRIAIAVAGFAESELEITAQDNLLVVKGSHTAEQKERTYLYQGIAERNFERKFQLAENI
FT                   HVKGANLVNGLLFIELERVIPEEKKPRRIEIN"
FT   gene            16521..16949
FT                   /gene="ibpB"
FT                   /locus_tag="ECL_00016"
FT   CDS_pept        16521..16949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpB"
FT                   /locus_tag="ECL_00016"
FT                   /product="heat shock chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59584"
FT                   /db_xref="GOA:A0A0H3CDF6"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR022848"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDF6"
FT                   /protein_id="ADF59584.1"
FT                   /translation="MRNYDLSPLLRQWIGFDKLANALQSTTEHQTFPPYNIEKSDDNHY
FT                   RITLALAGFRQDDLDIQLEGTRLTVKGSPEKQETETKWLHQGLVTQPFSLSFTLADHME
FT                   VSGATFTNGLLHIDLVRNVPEAIAPQRIAISERPALNS"
FT   gene            17114..18775
FT                   /locus_tag="ECL_00017"
FT   CDS_pept        17114..18775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59585"
FT                   /db_xref="GOA:A0A0H3CEB3"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB3"
FT                   /protein_id="ADF59585.1"
FT                   /translation="MSDIALTVSVLALVAVVGLWIGNIKIRGVGFGIGGVLFGGIFVGH
FT                   FADKLGLVLSADMLHFTQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFALGIVVMG
FT                   GLVTAILHKLFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGIEPGIVDQMGMSYAMA
FT                   YPFGICGILLSMWLVRVLFRINVDKEAKDHETTLTNGHMPIKTINIRVDNPNLNNMAIQ
FT                   DVPILNSANIICSRLKRDEMLMVPAPGTIIRQGDLLHLVGQPGDLNNARLVIGQEVDTS
FT                   LSTRGTDMRVERVVVTNEHVLGKKIRDLQVKERYDVVISRLNRAGVELVASPEASLQFG
FT                   DILNLVGRPSSIDAVADMVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLYIPGFPVALK
FT                   LGLAGGPLIMALILGRIGCVGKLYWFMPPSANLALRELGIVLFLAVVGLKSGGDFVDTL
FT                   VRGEGMSWVGYGIFITAIPLLTVGILARMFAKMNYLTLCGMLAGSMTDPPALAFANSLH
FT                   ATSGAAALSYATVYPLVMFLRIITPQLLAVLFWGMS"
FT   gene            complement(18743..19489)
FT                   /locus_tag="ECL_00018"
FT   CDS_pept        complement(18743..19489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00018"
FT                   /product="GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59586"
FT                   /db_xref="GOA:A0A0H3CEM3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEM3"
FT                   /protein_id="ADF59586.1"
FT                   /translation="MIYKSIADRLRLRLNSSDYNIGSPIPGEKALAQEFGVARMTIRKA
FT                   LDLLVSWGLVERRHGSGTFVARKDVHHETTNLTGLVEVLRQQGKEVQSKVLQFEVMPAP
FT                   PAIASQLRIQVDERIYFSRRVRYVDGKPLMLEDSFMPVKLFRNLSLAHLEGSKFDYIEK
FT                   ECGITISGNYESLTPVLADKQLAGYMNLPEQTPLLRITSLSYSDSGEFLNYSVMFRNTS
FT                   DYQVDYHLRRIHPDDLLTHPPEQHRQ"
FT   gene            19712..21334
FT                   /locus_tag="ECL_00019"
FT   CDS_pept        19712..21334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00019"
FT                   /product="PTS family protein IIC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59587"
FT                   /db_xref="GOA:A0A0H3CGA8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR010975"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGA8"
FT                   /protein_id="ADF59587.1"
FT                   /translation="MLSQIQRFGGAMFTPVLLFPFAGIVVGIAIMLRNPLFVGEALTAP
FT                   DNLFAQIVHIIEEGGWAVFRNMPLIFAVGLPIGLAKQAQGRACLAVLISFLTWNYFINA
FT                   MGMTWGHFFGVDFSAEPTAGSGLAMIAGIKTLDTSIIGAIAISGIVTAIHNRFFEKPLP
FT                   VFLGIFQGTSFVVIIAFFVMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWVYTFL
FT                   ERILIPTGLHHFVYGPFIFGPAAVEGGIQVYWAQHLQAFSQSTLPLKTLFPEGGFALHG
FT                   NAKVFGSVGIALAIWYTASPENRVKVAGLLIPATLTAVLVGITEPLEFTFLFISPLLFA
FT                   IHAVLAATMATVMYTFGVVGNMGGGLLDQFLPQNWIPMFHNHASTVFTQIGIGVCFTGL
FT                   YFVVFKTLIERLNLKTPGREESEIKLYSKADYKAARGQTTAPAAASQQVGQAAGFLQAL
FT                   GGAANIESINNCATRLRIALVDMAQTQSDEVFKALGAHGVVRRGNGIQVIVGLHVPQVR
FT                   DQLESLMKTPLTNEQTTLTEAIS"
FT   gene            21331..22653
FT                   /locus_tag="ECL_00020"
FT   CDS_pept        21331..22653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00020"
FT                   /product="maltose-6'-phosphate glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59588"
FT                   /db_xref="GOA:A0A0H3CCR5"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCR5"
FT                   /protein_id="ADF59588.1"
FT                   /translation="MKKFSVVIAGGGSTFTPGIVLMLLANRDRFPLRALKFYDNDGARQ
FT                   ETIAEACKIILKEQAPEIEFSYTTDPKAAFTDVDFVMAHIRVGKYPMREKDEKIPLRHG
FT                   VLGQETCGPGGISYGMRSIGGVLELVDYMEQYSPNAWMLNYSNPAAIVAEATRRLRPHA
FT                   KILNICDMPIGIEGRMAQIVGLKDRKQMRVRYYGLNHFGWWTSIEDLNGNDLMPKLREY
FT                   VAKHGYVPPSEDAHTEASWNDTFAKAKDVQALDPDTMPNTYLKYYLFPDYVVAHANPER
FT                   TRANEVMDHREKHVFSSCRAIIEAGKSSAGELEIDEHASYIVDLATAIAFNTQERMLLI
FT                   VPNNGAIHNFDADAMVEIPCLVGHNGPEPLTVGDIPHFQKGLMSQQVAVEKLVVDAWEQ
FT                   RSYQKLWQAITLSKTVPSASVAKAILDDLIEANKDYWPELH"
FT   gene            22746..23093
FT                   /locus_tag="ECL_00021"
FT   CDS_pept        22746..23093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59589"
FT                   /db_xref="GOA:A0A0H3CDF9"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDF9"
FT                   /protein_id="ADF59589.1"
FT                   /translation="MKISRLGEAPDYRFSLANERTYLAWIRTALGFLAAGVGLDQLAPD
FT                   FATPLIREVLALLLCLFAGVLAIYGYLRWLRNEKAMRLKQDLPYTRGLLIISAILLTVA
FT                   GVVMVLVVYGG"
FT   gene            23083..23430
FT                   /locus_tag="ECL_00022"
FT   CDS_pept        23083..23430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00022"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59590"
FT                   /db_xref="GOA:A0A0H3CEB6"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB6"
FT                   /protein_id="ADF59590.1"
FT                   /translation="MADSRKARREADPGLQPERTSLAWLRTLLGYGALIALAIKHNWHR
FT                   TGLPFWISLVVLALVAIILWRYTRSRNVMDVAQDDFVQPKAVRDKFLIALAVLSLSLLF
FT                   AVTHIQQIVHL"
FT   gene            complement(23463..24749)
FT                   /locus_tag="ECL_00023"
FT   CDS_pept        complement(23463..24749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00023"
FT                   /product="D-serine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59591"
FT                   /db_xref="GOA:A0A0H3CEM9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011780"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEM9"
FT                   /protein_id="ADF59591.1"
FT                   /translation="MENATITALTAQFPLVEDLMALKETTWLNPRTTSLAEGLPYVGLT
FT                   KADVDDAHARLNRFAPYLAKAFPETAATGGIIESELVAIPAMKKRLERESGKALPGTLL
FT                   LKKDSHLPISGSIKARGGIYEVLTHAEKLALEAGLLSTEDDYSILLEPRFKDFFSQYSI
FT                   AVGSTGNLGMSIGIMSARIGFKVTVHMSADAREWKKAKLRSHGVTVVEYEQDYGVAVEQ
FT                   GRKAAENDPNCFFIDDENSRTLFLGYAVAGERLKAQFAEQGRVVDAEHPLYVYLPCGVG
FT                   GGPGGVAFGLKLAFGDNVHCFFAEPTHSPCMLLGVYTGLHDEIAVQDLGIDNVTAADGL
FT                   AVGRASGFVGRAMERLLDGFYTLSDQSMYDMLGWLAQEEGIRLEPSALAGMAGPLRVQA
FT                   DANVTHLVWATGGGMVPEDEMAKYLAKGK"
FT   gene            complement(24767..25084)
FT                   /locus_tag="ECL_00024"
FT   CDS_pept        complement(24767..25084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00024"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59592"
FT                   /db_xref="GOA:A0A0H3CGB2"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGB2"
FT                   /protein_id="ADF59592.1"
FT                   /translation="MGSPVWVVVTLLVSIVLIVLTIVKLKFHPFLAPMLPLYPNVSPEI
FT                   ITIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKYYTTATFIASVLALGGTFLLSFI
FT                   I"
FT   gene            25289..26215
FT                   /locus_tag="ECL_00025"
FT   CDS_pept        25289..26215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00025"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59593"
FT                   /db_xref="GOA:A0A0H3CCR8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR011781"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCR8"
FT                   /protein_id="ADF59593.1"
FT                   /translation="MTDANEVRNRLLNGWQLSKMYTFEVAARHESFALAAAELSLSPSA
FT                   VSHRINLLEEELGIQLFVRSHRKVELTLEGKRVYWTLKSSLDTLNQEILDIKNQALSGT
FT                   LTVYSRPSIAQCWLVPMLGDFTRRYPSISLTILTGNEYVNMQRTGIDLAIYFDDTPPNY
FT                   LSHHFLMDEEILPVCSPAYAREHALLKNPDNLSHCTLLHDRQAWSNDSGTDEWLSWAQH
FT                   FAMNMPSSSGIGFDRSDLAIVAAMNHVGVAMGRKRLVQKRLERGELIAPFGNKTLKCHQ
FT                   HYYISTLPGRQWPKIDAFIGWLRELAG"
FT   gene            26300..27388
FT                   /locus_tag="ECL_00026"
FT   CDS_pept        26300..27388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59594"
FT                   /db_xref="GOA:A0A0H3CDG3"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDG3"
FT                   /protein_id="ADF59594.1"
FT                   /translation="MLKPLIATALLLSSGWAIAAEPPLTAALYAQKLGVGMDVDWARTE
FT                   RGIREFDPLVVRDFRAKGISHVRIRVADEPTEARLIHLRKLVEACEQYGVIPIIAYQAD
FT                   SYKNDPKADNEKEVTDWWIAVAHYFGKRSPLLGFDLIYEPADKLNHNAASLNRVYEKTI
FT                   KVIHSIDADRMIFIAPRLRAAPEDLPSLKLPAHSQNFLLAEWHIFPWGPLKNNGKYPWT
FT                   SGMAAEKAAIHNRIATALRWQQKTGHVSWVGGWGVGESNRFTPTASQMAFATFMACELQ
FT                   KAKIPYAINADFQFYDGEEGAWRPAPEPLLEAMIAPACEKPGEKPGHHAVKQAARGGEH
FT                   ATPAAASTAKSVAPSASSVNPN"
FT   gene            complement(27291..28448)
FT                   /locus_tag="ECL_00027"
FT   CDS_pept        complement(27291..28448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00027"
FT                   /product="multidrug resistance protein D"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59595"
FT                   /db_xref="GOA:A0A0H3CEB9"
FT                   /db_xref="InterPro:IPR004734"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB9"
FT                   /protein_id="ADF59595.1"
FT                   /translation="MLMLVLLVAVGQMAQTIYIPAIADMAKELNVREGAVQSVMAAYLL
FT                   TYGVSQLFYGPLSDRIGRRPVILTGMCIFMVATVIAITTHSLTVLIAASALQGVGTGVG
FT                   GVMARTLPCDMYQGTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWSWRACYAFLLVLC
FT                   VIVTFSMARWMPETRPQDAPRTKLLASYKTLFGNGALTCYLLMLIGGLAGIAVFEACSG
FT                   VLLGAGLGLSSMVVSILFILPIPAAFFGAWFAGRQNKRFSTLMWQSVISCLLAGLMMWI
FT                   PGLFGVMTVWTLLIPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVGGLQNIGSGA
FT                   LAWLSAMMPQTGQASLGLLMTLMGLLILLCWLPLASRVPHHEQPV"
FT   gene            complement(28651..29484)
FT                   /locus_tag="ECL_00028"
FT   CDS_pept        complement(28651..29484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00028"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59596"
FT                   /db_xref="GOA:A0A0H3CEN4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEN4"
FT                   /protein_id="ADF59596.1"
FT                   /translation="MTLSVFCILLFAALLHASWNAIVKAGTDKLYSAISVSGSATLIAL
FT                   VLLPFSPQPSVASWPFLVVSCALQVVYTVLVAKTYQVSDMSQTYPLMRGTAPLLVALIS
FT                   VLVLGDSLSWLAWAGIGVICLSILAMAMNGRLQSRKGIWLALLNACFIAGYTLVDGTGV
FT                   RLSDTALGYTLWTFFMNGFCLLCWAMVARRREASSYLRLHWKKGLLGGVGTMGSYGLAL
FT                   WAMTQAPLAVVAALRETSILFGALIAFVLLKEKVAGLRIAAALGIAAGAILLRLA"
FT   gene            complement(29547..29993)
FT                   /locus_tag="ECL_00029"
FT   CDS_pept        complement(29547..29993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00029"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59597"
FT                   /db_xref="GOA:A0A0H3CGB7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGB7"
FT                   /protein_id="ADF59597.1"
FT                   /translation="MSRLLIEPITPEEPGYIALKAESIAANFNMLRRLEENWQRGENRF
FT                   NAPGEKLLGAFLNGKLVGVCGLNRDPFSQQPRAGRIRHLYVSEKCRGLGIGKQLLTVVM
FT                   ADASIWFDFLNTHAPDTACGFYRRAGFRLVSDEPRVTHRLFCAV"
FT   gene            30040..30222
FT                   /locus_tag="ECL_00030"
FT   CDS_pept        30040..30222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59598"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCS2"
FT                   /protein_id="ADF59598.1"
FT                   /translation="MRLEPESPKVFQDSIKQLQNSNNEFEDKYHHIHYAHTRLLLVKRS
FT                   TMLAYLSAACCQHLD"
FT   gene            30983..31477
FT                   /locus_tag="ECL_00031"
FT   CDS_pept        30983..31477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDG8"
FT                   /protein_id="ADF59599.1"
FT                   /translation="MYLSIVSIYRYRNVIAHMLYLYFESIMTDSENGNEKNRVRKTDSN
FT                   VTGLVNNIPASKAARLAIAWTLAKSLSESGLLSEIVVERLARRVPNVVMALQLMGTDQK
FT                   CALAARRLKVLDPNYYATLYAAQLEMLYYFFEPFLAEIIKKVQTGFYKDFDAIYNDLKD
FT                   K"
FT   gene            31479..31661
FT                   /locus_tag="ECL_00032"
FT   CDS_pept        31479..31661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59600"
FT                   /db_xref="GOA:A0A0H3CEC2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC2"
FT                   /protein_id="ADF59600.1"
FT                   /translation="MFKSLLSILFTDVLFPVYIFACASLFLWLVPNHWVLLTFIAIVVF
FT                   IIVHPIIFGRFDKYD"
FT   gene            31683..32162
FT                   /locus_tag="ECL_00033"
FT   CDS_pept        31683..32162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00033"
FT                   /product="hemolysin-coregulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59601"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEN9"
FT                   /protein_id="ADF59601.1"
FT                   /translation="MSNPAYLFLTDENGSPMVGPCLVSGREGAIELKSFTHNVNIPVDG
FT                   NTGKLTGTRIHMPVMFQKEFDRVTPFLFRALSTGRTLQSATIKMYQINEAGLEQEYFNI
FT                   IMENVKITSITPDLYPGANTGTHLETVLIRYEKITWKHCDGNVIYSDAWNERATY"
FT   gene            32473..34161
FT                   /locus_tag="ECL_00034"
FT   CDS_pept        32473..34161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00034"
FT                   /product="acetolactate synthase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59602"
FT                   /db_xref="GOA:A0A0H3CGC2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGC2"
FT                   /protein_id="ADF59602.1"
FT                   /translation="MASSGTTSTKTRFTGAQLIVHLLERQGITTVAGIPGGTVLPLYDA
FT                   LSQSTQIRHVLARHEQGAGFIAQGMARTQGKPAVCMACSGPGATNLVTAIADARLDSIP
FT                   LICITGQVPSSMIGTDAFQEVDTYGISIPITKHNYLVRDITELPQVISYAFRIAQSGRP
FT                   GPVWIDIPKDVQTAEIEIDVLPEPGERAPAPEFSAESVRDAAAMINAAKRPVLYLGGGA
FT                   INAADEIRQFAEKANLPTTMTLMALGMLPKAHPLSLGMLGMHGARSTNYILQEADLLIV
FT                   MGARFDDRAIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQGDVADVLAQLIPQTDA
FT                   TDRADWRQMVADLQREFPGAIPTEGDPLSHYGLINAVAACVDDSAIITTDVGQHQMWTA
FT                   QAYPLNRPRQWLTSGGLGTMGFGLPAAVGAALANPDRKVICFSGDGSLMMNIQEMATAA
FT                   ENQLDVKIILMNNEALGLVHQQQSLFYKQGVFAATYPGMINFMQIAAGFGLHTCDLNAE
FT                   EDAHAALQAAISRPGPALIHVRIDPEQKVYPMVPPGAANTEMVGE"
FT   gene            34165..34452
FT                   /locus_tag="ECL_00035"
FT   CDS_pept        34165..34452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00035"
FT                   /product="acetolactate synthase 1 regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59603"
FT                   /db_xref="GOA:A0A0H3CCS5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCS5"
FT                   /protein_id="ADF59603.1"
FT                   /translation="MQKQHENVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQG
FT                   SEHSRIWLLVNDDQRLEQMMAQIDKLEDVTRVARNQSDPTMFNKIAVFFE"
FT   gene            34535..35128
FT                   /locus_tag="ECL_00036"
FT   CDS_pept        34535..35128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00036"
FT                   /product="DNA-binding transcriptional activator UhpA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59604"
FT                   /db_xref="GOA:A0A0H3CDH2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDH2"
FT                   /protein_id="ADF59604.1"
FT                   /translation="MTTIALIDDHLIVRSGFAQLLNLEPDFQVVAEFGSGREALAGLPG
FT                   RGVQVCICDISMPDLSGLELLSQLPKGMAIIMLSVHDSPALVEQALNAGARGFLSKRCS
FT                   PDELIAAVRTVSTGGCYLTPDIALKLAAGRQDPLTRRERQVAEKLAQGMAVKEIAAELG
FT                   LSPKTVHVHRANLMEKLGVSNDVELARRMFDSWQ"
FT   gene            35125..36630
FT                   /locus_tag="ECL_00037"
FT   CDS_pept        35125..36630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00037"
FT                   /product="sensory histidine kinase UhpB"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59605"
FT                   /db_xref="GOA:A0A0H3CEC5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC5"
FT                   /protein_id="ADF59605.1"
FT                   /translation="MNPLISRLIAVVASFFIFSAAWFCLWSISLHLVERPELAVLLFPF
FT                   GLRLGLMLQCPRGYWPVLLGAEWLMLIWLSQEVALAHLPLLMTGSLLTLLPVALISRYR
FT                   HQRDWRTLLRQGAALIAAALLQSLPWVGEKEMLNALLLTLTGGLTLAPTCLVFWHYLTS
FT                   TVWQPLGPSLVSQPVNWRARHLIWYLLLFVVSLWLQLGLPAELSRFTPFCLALPIIALA
FT                   WHYGWQGALIATLMNAIALIASQTWHDHPVDLLLSLLAQSLTGLLLGAGIQRLRELNQS
FT                   LQTELSRNRRLAERLLETEESVRQEVARELHDDIGQTITAIRTQAGIVQRLAADNAGVK
FT                   QGGAHIEQLSLGVYDSVRRLLGRLRPRQLDDLSLEQAVRSLMREMELESRGIVSHLDWR
FT                   IDESLLSEGQRVTLFRVCQEGLNNIVKHANASAVTLQGWQQDESLRLVIEDDGCGLPPG
FT                   SGQQGFGLAGMRERVKALGGTLNISCTHGTRVSVSLPLRSHHV"
FT   gene            36623..37942
FT                   /locus_tag="ECL_00038"
FT   CDS_pept        36623..37942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00038"
FT                   /product="regulatory protein UhpC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59606"
FT                   /db_xref="GOA:A0A0H3CEP4"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEP4"
FT                   /protein_id="ADF59606.1"
FT                   /translation="MFKTPANAAPIGNKAEIDARYRYWRRHILITIWLGYALFYFTRKS
FT                   FNAAAPEILASGVMTRTDIGLLATLFYITYGLSKFFSGIVSDRSNARYFMGFGLIATGV
FT                   VNILFGFSTSLWAFALLWALNAFFQGWGAPVCARLLTAWYSRNERGGWWAIWNTAHNVG
FT                   GALIPMVVGAAALHYGWRAGMMIAGGLAILAGLFLCWRLRDRPQTVGLPAVGDWRHDEM
FT                   EVAQQLEGAGLTRKEILTKYVLLNPYIWLLSLCYVLVYVVRAAINDWGNLYMSETLGVD
FT                   LVTANSAVTMFELGGFIGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLWLMPFAS
FT                   YVMQAACFFTIGFFVFGPQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASLSGWPLAR
FT                   VIDIWHWSGFFAVIAIAAGISALLLLPFLHAQAPREASVM"
FT   gene            38083..39474
FT                   /locus_tag="ECL_00039"
FT   CDS_pept        38083..39474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00039"
FT                   /product="sugar phosphate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59607"
FT                   /db_xref="GOA:A0A0H3CGC7"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGC7"
FT                   /protein_id="ADF59607.1"
FT                   /translation="MLAFLNQVRKPTLDLPLDVRRKMWFKPFMQSYLVVFIGYLTMYLI
FT                   RKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVGKTVVSYYADGKNTKQFLPFMLIL
FT                   SAICMLGFSASMGAGSVSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGSYLGM
FT                   WNISHNLGGAGAAGVALFGANYLFDGHVIGMFIFPSIIALIVGFIGLRFGSDSPESYGL
FT                   GKAEELFGEAISEEDKETEENEMTKWQIFVEYVLKNKVIWLLCFSNIFLYVVRIGIDQW
FT                   STVYAFQELKLSKEVAIQGFTLFEVGALVGTLLWGWLSDLANGRRALVACVALALIIAT
FT                   LGVYQHASNQYVYLASLFALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKGTFAYLIG
FT                   DSFAKLGLGMIADGTPIFGLTGWAGTFAALDAAAIGCIVLMAMVAVLEERKIRRENRVQ
FT                   KLKAA"
FT   gene            39636..40640
FT                   /locus_tag="ECL_00040"
FT   CDS_pept        39636..40640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59608"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCS7"
FT                   /protein_id="ADF59608.1"
FT                   /translation="MLTRRLSCLALLMALATHAMATDAPTYGEKLEGFDYGWPVKHFTF
FT                   TSQEQSLDMAYLDVKPEKPNGRTVVLMHGKNFCAGTWDGTIRALSASGYRVIAPDQIGF
FT                   CKSTKPEHYQYTFQQLADNTHALLKTLGLDRVTVIGHSTGGMLATRYALMWPQQVEQLV
FT                   MVNPIGLEDWKARGVPHITVDQWYQRELKVSADGIRQYEKNTYYAGAWKPEYERWVTML
FT                   AGLNNGPGKERVAWNSALLYDMIYTQPVIYEFSELKMPVLLMIGTKDNTAIGKDLAPPE
FT                   IRKTLGNYAVLGKETAKRIPHATLVEFNDMGHAPQMQDPARFHEALLKGLQAR"
FT   gene            complement(40628..41530)
FT                   /locus_tag="ECL_00041"
FT   CDS_pept        complement(40628..41530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00041"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59609"
FT                   /db_xref="GOA:A0A0H3CDH6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDH6"
FT                   /protein_id="ADF59609.1"
FT                   /translation="MKTDLRTLDLNLLKTLDALLDERSVTRAATRLALTQPAVSGMLNR
FT                   LRDYFDDPLFIRAPHGIVPTTRAEELAAPVKRILADIDLLLQPVAFDPRQATLTFTLAA
FT                   TDYALRAIAVPFIAALKVRAPAIRVRVIPVDSERMMNQLERGNVDVALITPHTTPDDLH
FT                   SRALYDERYVCMMRADHPDAGKPLSLARFCALEHVLVSYEGDSFRGVTDGALEKMGRTR
FT                   HVGLSVSNFLVLPDVLAISDMIAVVPSRIAENQTGMFVCDTPVPVPGFTKCMAWHTRTH
FT                   RNPAQMWLRGLLLETSQRA"
FT   gene            41630..42082
FT                   /locus_tag="ECL_00042"
FT   CDS_pept        41630..42082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59610"
FT                   /db_xref="InterPro:IPR009587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC9"
FT                   /protein_id="ADF59610.1"
FT                   /translation="MVWIMLATLAVVFVVGFRVLTSDSRRAIKRLSERLGITPMPVESM
FT                   IDQFGKTPGNEFIRYLERPDEAHLQNVAQVLLIWQVCIVDGSEENLHTWHRMLRKARLA
FT                   APITDAQIRLALGFMREMEPDPQELNAFQLRYNQLFLPEEGVFYLH"
FT   gene            42179..42706
FT                   /locus_tag="ECL_00043"
FT   CDS_pept        42179..42706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59611"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEP8"
FT                   /protein_id="ADF59611.1"
FT                   /translation="MKQSAIIWPDDYLPGTTDNFASNEIIVAGLSAKAIWAQLNDTTLW
FT                   PNYYSNAEDIRFHDGSGPELSANARFRFTTFGFPVEAQVTEYVPPVDGEAARIAWHGWV
FT                   EGEESARLDVIHAWLFEDLPGNRVRILTQESQKGVPAQELARTLPNPMINGHQEWIVGL
FT                   AKAAMQEKLSKR"
FT   gene            42771..43961
FT                   /locus_tag="ECL_00044"
FT   CDS_pept        42771..43961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00044"
FT                   /product="ribonucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59612"
FT                   /db_xref="GOA:A0A0H3CGD2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR023680"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGD2"
FT                   /protein_id="ADF59612.1"
FT                   /translation="MTEHIQPTTRPQTKEVSRPNWSAVFSVAFCVACLITVEFLPVSLL
FT                   TPMAQDLGISEGVAGQSVTVTAFVAMFASLFITQVIGAIDRRKVVILFSVLLTLSCLLV
FT                   SFAESFTLLLLGRACLGLGLGGFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVIAA
FT                   PLGSFLGGIIGWRNVFNAAAVMGFLCILWVWKALPSLPGEAAHHKQNMFSLLKRPGVLA
FT                   GMTAIFMAFAGQFAFFTYIRPVFMTMAGFDVDGLTLVLLSFGIASFVGTSLSSQFLKRS
FT                   LKVALAGAPLVLAVSAVVLILWGSDKWVASAIAIIWGFAFALVPVGWSTWITRSLADQA
FT                   EKAGSIQVAVIQLANTCGAAVGGVALDHLGLTSPLVISGTLMLLTALLVAGKVKAK"
FT   gene            complement(44010..44915)
FT                   /locus_tag="ECL_00045"
FT   CDS_pept        complement(44010..44915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00045"
FT                   /product="carboxylate/amino acid/amine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59613"
FT                   /db_xref="GOA:A0A0H3CCT1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCT1"
FT                   /protein_id="ADF59613.1"
FT                   /translation="MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEKSQISSPYLTMVRLL
FT                   FTGLILLTLSFVHGDKIFSVIKHRKDALSLLFFSLAGALTVQLTFLVTIEKSNAATATV
FT                   LQFLSPTIIVAWFALARKKRPGLFVLSAILTSLVGTFLLVTHGDPTSLSISPAALFFGI
FT                   ASAFAAAFYTTYPSTLIARYGTLPIVGWSMLIAGLTLTPFYAGRGTAFVIDGSLLLAFF
FT                   YLVVIGTALTFSLYLKGAQMIGGPKASILSCAEPLSSALLSVILLGVAFTLPDWLGTLL
FT                   IVSSVVLISMDSRKRVKAPE"
FT   gene            complement(45060..46439)
FT                   /locus_tag="ECL_00046"
FT   CDS_pept        complement(45060..46439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00046"
FT                   /product="putative maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59614"
FT                   /db_xref="GOA:A0A0H3CDH8"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDH8"
FT                   /protein_id="ADF59614.1"
FT                   /translation="MTTLKKLPLTMAVIAALCPISVLAQEFTQEQIDAIVAKAVDKALA
FT                   ERQAKMDAAVAKKADVVTEPQSAAQSPDMAIPFGIKFTGYARYGAHFQAADQKYVAVDG
FT                   SYNGASAIGRLGNEGNGGEFQLSKAFKGDNGAIWDINVMIDHWGDEVNLKKAYAGVTNI
FT                   MASNPNAYFWAGRDFHQRPQQGINDYFWMNHDGQGAGVKNFDIGGVQFDVAAVAAVESC
FT                   SPEVMEDEANPSRITCTGGSGTGDKGNYAATSKIHGMKVGPLDLELYANYGFDSKAVES
FT                   DERLNAWQGGVVLSHTNDSGVNKVIARYSDNADNSVFNKTEDLTTVYASFEGLYKFTQA
FT                   TQVEYILAFHDYDNSRDKTDNRKNYNAIVRPMHWWNDVHSTWLEAGWQHVDYDNGGDNK
FT                   GWKLTLSQNMSIAMGPEFRPMLRFYVTGGKVDNERTARVNNTKDETLDDFNVGAMWEAW
FT                   F"
FT   gene            complement(46574..46876)
FT                   /locus_tag="ECL_00047"
FT   CDS_pept        complement(46574..46876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00047"
FT                   /product="phosphotransferase system PTS,
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59615"
FT                   /db_xref="GOA:A0A0H3CED4"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CED4"
FT                   /protein_id="ADF59615.1"
FT                   /translation="MIALEEAVMEIIVNAGQSRSLCFEALHAARQGNIDEAKSLLREAD
FT                   GYARQAHKMQTKLIEQDAGEARQPMTLIMVHAQDHLMNSLLARELSEEIIHLYQR"
FT   gene            complement(46888..48261)
FT                   /locus_tag="ECL_00048"
FT   CDS_pept        complement(46888..48261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00048"
FT                   /product="Beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59616"
FT                   /db_xref="GOA:A0A0H3CEQ3"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEQ3"
FT                   /protein_id="ADF59616.1"
FT                   /translation="MKYTFPDNFWWGSASSALQTEGTREGETTWDYWFAREPNRFHNGV
FT                   GPQHTSTFYQHWKTDIQLLKQLNHNSFRTSISWARLIPDGIGEVNPKAVEFYNQVIDEL
FT                   IEQGITPFITLFHFDMPMAMQEIGGWENREVVDAYARYAQICFDLFGDRVLHWFTFNEP
FT                   IVPVEGGYLYDFHYPNVVDFRRAATVAYHTVLAHAKAVQAYRAGHYAGEIGIVLNLTPS
FT                   YPRSQNPADVKAAHIADLMFNRSFLDPVLRGEYPADLVALLKSYDQLPACKPEDSFLIA
FT                   EGKIDLLGINYYQPRRVKCRDSAVNPQAPFMPEWFFDNYEMPGRKMNPYRGWEIYEPGI
FT                   YDILVNLRDNYGNPRCFISENGMGVENEQRFIENGQINDQYRIDFISGHLAWLHKGISE
FT                   GCHCLGYHMWTFIDNWSWCNAYKNRYGFIQLDLTTQQRTIKKSGEWFAATSLHNSFEK"
FT   gene            complement(48279..49604)
FT                   /locus_tag="ECL_00049"
FT   CDS_pept        complement(48279..49604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00049"
FT                   /product="PTS system lactose/cellobiose family IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59617"
FT                   /db_xref="GOA:A0A0H3CGD8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGD8"
FT                   /protein_id="ADF59617.1"
FT                   /translation="MSSLYQSMVAVIEQSITPLAAKLGQQKYVIAIRDGFTAALPFMII
FT                   GSFMLVFIFPPFSADTTNSFARGWLDFSQTYREQLMLPFNLSMGVMTFFISVGIGASLG
FT                   RQFNLDPVMSGLLAFMAFLLVAAPYADGKISTQYLSGQGIFTALITAIYATRVYAWLKQ
FT                   NNVTIRLPKEVPTGVARSFEILIPVMVVIGTLHPLNLFIEAQTGMIIPQAIMHLLEPLV
FT                   SASDSLPAILLSVLLCQIFWFAGIHGSLIVTGIMNPFWMANLSANQAALAAGAALPHVY
FT                   LQGFWDHYLLIGGVGSTLPLAFLLLRSRVTHLRTIGKMGVVPSFFNINEPILFGAPIIM
FT                   NPMLFIPFVCVPLVNACLAYAATKLGWLAQVVSLTPWTTPAPIGASWAANWALSPVVMC
FT                   LICMVMSALMYLPFLRAYERTLMKNEEQKAQATVGTAETASN"
FT   gene            complement(49616..49930)
FT                   /locus_tag="ECL_00050"
FT   CDS_pept        complement(49616..49930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00050"
FT                   /product="phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59618"
FT                   /db_xref="GOA:A0A0H3CCT5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCT5"
FT                   /protein_id="ADF59618.1"
FT                   /translation="MFKIMLCCSAGMSTSLLVSKMVDVAKERGLAVKIDAYGVSEFDTQ
FT                   FPQYQVVLLGPQVKYMLQTLSDKAATKGIPVQPIDMMDYGMQRGDKVLDYALSLIEAAH
FT                   "
FT   gene            50224..51174
FT                   /locus_tag="ECL_00051"
FT   CDS_pept        50224..51174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00051"
FT                   /product="LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59619"
FT                   /db_xref="GOA:A0A0H3CDI3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDI3"
FT                   /protein_id="ADF59619.1"
FT                   /translation="MSTINDVSRLAGVSKATVSRVLSGSRGVKEASRQAVLKAVDELNY
FT                   RPNVIAQSLLSQSTGCIGVICAQENINQTTGYLYALEKQLSQHQKHLLLRFAHSKADVL
FT                   HALEELSCGLCDDILVIGARFPLDIDMDNVILVDCMGSENPNSIQFDHAFAAETACNYL
FT                   TSQGRRQIALIHPHGSGFADQVLLGYKHALEKNFLPFNRNLVFMDATSSSVALQELLNN
FT                   ASTLNFNALLVADEQEAQRVIPQLQAFNKSVPEDIMVFSLAGSLHLPGIPVIPAIEYSM
FT                   DAMAARIVSWLTEKTQMLGSYVLRGDLIIPDVRKR"
FT   gene            complement(51236..51532)
FT                   /locus_tag="ECL_00052"
FT   CDS_pept        complement(51236..51532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CED9"
FT                   /protein_id="ADF59620.1"
FT                   /translation="MKSAHLVCLLVCLLFAAFAHAQEKDDPAREAQIKQQVLKDVKKAC
FT                   TPQKKQSDKAWQAMILSSEANQLLIKNAITAVKRDNLEAYWDAVSQVDCMEDY"
FT   gene            complement(51652..53016)
FT                   /gene="eefC"
FT                   /locus_tag="ECL_00053"
FT   CDS_pept        complement(51652..53016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eefC"
FT                   /locus_tag="ECL_00053"
FT                   /product="multidrug efflux transport outer membrane protein
FT                   EefC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59621"
FT                   /db_xref="GOA:A0A0H3CEQ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEQ8"
FT                   /protein_id="ADF59621.1"
FT                   /translation="MFRLSVFVLALMSAGCVSLDPTYQRPAAPVPATLPGAHGEATAMV
FT                   SQWQQVMNDARLKGVVTMALNSNRDLQKAIADIDAARAQYGETRSSLFPTVDAELSHTR
FT                   SRTLASGVATSDEANGTVSSFELDLFGRNQSLSRAARETWLASEFTAQNTRLTMVSELT
FT                   TAWVTLAADNSNLALAKSTMESAASSLRIVKRQQQVGVAAATDVSEAMAVYQQARASVA
FT                   SYQTQVMQDKNALNLLAGDTVPDTLLPGTLESLSDNAITLIPAGVSSSALLRRPDIKEA
FT                   EHNLLSANANIGAARANFFPTISLTASAGVGSDSLSSLFSHGMKVWSFAPSITLPLFSG
FT                   GNNLAQLRYAEAEKKGLIATYEKTIQSAFKDVADALARRETLSEQLDAQREYVAAEQKT
FT                   LDVATRSYQAGAGDYLTVLTAQRSLWSAQESLISLQQTDLENRITLWQSLGGGIE"
FT   gene            complement(53016..56126)
FT                   /gene="eefB"
FT                   /locus_tag="ECL_00054"
FT   CDS_pept        complement(53016..56126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eefB"
FT                   /locus_tag="ECL_00054"
FT                   /product="multidrug efflux transport protein EefB"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59622"
FT                   /db_xref="GOA:A0A0H3CGE3"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGE3"
FT                   /protein_id="ADF59622.1"
FT                   /translation="MFSRFFVRRPVFAWVIAILIMLAGILAIRTLPVAQYPDVAPPSIK
FT                   ISATYTGASAQTLENSVTQVIEQQLTGLDNLLYFTSTSSSDGSVSITVTFEQGTDPDTA
FT                   QVQVQNKVQQAESRLPTEVQQSGITVEKSQSNFLLIMGVYDKTDTASSSDIADWLVSNM
FT                   QDPLARVDGVGSLQVFGAEYAMRIWLDPAKLASYSLMPSDVQSAIEAQNVQVSAGKIGA
FT                   LPSSNAQQLTATVRAQSRLQTVDQFKNIIVKSQSNGAVVHISDVARVEMGSEDYTSTAK
FT                   LNGHPAAGMAVMLSPGANALNTATAVKEKIAEFKKSMPEGYDVAYPKDSTEFIKISVED
FT                   VIQTLFEAIILVVVVMYLFLQNIRATLIPALAVPVVLLGTFGVLALFGYSINTLTLFAM
FT                   VLAIGLLVDDAIVVVENVERIMRDEGLPAREATEKSMGEISGALVAIALVLSAVFLPMA
FT                   FFGGSTGVIYRQFSVTIISAMLLSVVVALTLTPALCGSILSHTAPHKKGFFGAFNRFYS
FT                   KTEHGYQNKVLRALRRSGGMLVIYVLLCGAMGFAMLKLPGSFLPTEDQGEIMVQYTLPA
FT                   GATSTRTAEVSRQVREWFLTKEKANTNVIFTIEGFSFSGSGQNAGMAFVSLKNWSERKG
FT                   DENTAQAIALRATQELSTIRDATIFAMTPPAVDGLGQSNGFTFELMASGGTDRDTLLKL
FT                   RNQLIGEANQDASLHAVRANDLPQMPQLQVDIDNNKAVSLGLSLSDVTDTLSSAWGGTY
FT                   VNDFIDRGRVKKVYIQGDSDYRAVPSDLNKWYVRGSDSTMTPFSAFATTRWEYGPESLV
FT                   RYNGSAAYEIQGENASGASSGTAMSKMEQLANNLPSGSTWAWSGLSLQEKLASGQAMSL
FT                   YALSILVVFLCLAALYESWSVPISVILVIPLGVLGAAIAASLRGLNNDVYFQVALLTTI
FT                   GLSSKNAILIVEFAEAKVAEGYSLTRAALRAAQTRLRPIIMTSLAFIAGVTPLAIATGA
FT                   GANSRVAIGTGIIGGTLAATLLAIFFVPLFFVLVKRLFSGKHSNRRS"
FT   gene            complement(56126..57250)
FT                   /gene="eefA"
FT                   /locus_tag="ECL_00055"
FT   CDS_pept        complement(56126..57250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eefA"
FT                   /locus_tag="ECL_00055"
FT                   /product="multidrug efflux periplasmic linker protein EefA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59623"
FT                   /db_xref="GOA:A0A0H3CCT9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCT9"
FT                   /protein_id="ADF59623.1"
FT                   /translation="MMKKITTSIAALLLLTGCDNAQTSAPQRPLPEVGIVTLMSQPVSV
FT                   VSELTGRTTAAMSAEVRPQVGGIIQKRLFTEGDTVKAGQALYQIDPSSYRAAFDEAAAA
FT                   LKQAQALVQADCQKARRYAQLVKDDGVSRQDAEDAKSTCAQDKASVESKKAAQESARIN
FT                   LNWTTVTAPIAGRIGISSVTPGALVTAQQDTALATIRGLDTMYVDLTRSSADLLRLRKQ
FT                   TLASNSDTLSVTLQLEDGSTYSEKGRLALTEVAVDESTGSVTLRAVFPNPQHQLLPGMF
FT                   VRARVDEGIMNDAILAPQQGITRDAKGKATALVVNASNKVEQRQLETGDTYGDKWLVLS
FT                   GLKAGDRLIVEGTDKVTAGQQVKAEEMKSSGGNA"
FT   gene            complement(57396..57965)
FT                   /locus_tag="ECL_00056"
FT   CDS_pept        complement(57396..57965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00056"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59624"
FT                   /db_xref="GOA:A0A0H3CDI8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDI8"
FT                   /protein_id="ADF59624.1"
FT                   /translation="MSTKLEERQKQRQDEIITAARRCFRASGFHAASMSQIASEAKLSV
FT                   GQIYRYFSNKDAIIEEMIRRIIDSRIEGMQDKTVVEGMPQALAWRQTINEDDDALMLEM
FT                   SAEATRNPQVAAMLTAAEARMFSNACAHLKKQFPHLSDEHIRCCVEITAVMIEGTIYRR
FT                   LTPLNVPSEQLEPIYQNILNMLFTAK"
FT   gene            58152..58571
FT                   /locus_tag="ECL_00057"
FT   CDS_pept        58152..58571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00057"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59625"
FT                   /db_xref="GOA:A0A0H3CEE3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEE3"
FT                   /protein_id="ADF59625.1"
FT                   /translation="MHLSITEKVTPAEKEELFVGLRAYNAQFLDMTNFSGDIGVYMRDE
FT                   KGVMLGGLIGVRKGEWLNIDYLWVSDTVRGTGVGSQLIKTAEEEARRKGCTHALVDTAS
FT                   FQARPFYEKQGYQLQMSLQDYPYPGMQRHYLTKAL"
FT   gene            58777..59577
FT                   /locus_tag="ECL_00058"
FT   CDS_pept        58777..59577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00058"
FT                   /product="cytoplasmic membrane lipoprotein-28"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59626"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CER0"
FT                   /protein_id="ADF59626.1"
FT                   /translation="MKLRLGALVLAGLLLAGCDQSGSDAKHIKVGVINGAEQDVAEVAK
FT                   KVAKEKHGLDVELVGFSGSLLPNDATNQGELDANVFQHRPFLAEDNKAHNYKLVAVANT
FT                   FVFPMAGYSRKIKSVSDLKDGATIAIPNDPTNLGRALLLLQKEKLITLKPDVGLLPTAL
FT                   DITANPKKLNIMELEGAQLPRVLDDPKVDVAIISTTYIQQTGLSPVHDSVFIEDKNSPY
FT                   VNIVVTREDNKDAENVKEFIQSYQSPEVAKAAETIFNGGAVPGW"
FT   gene            complement(59590..60270)
FT                   /locus_tag="ECL_00059"
FT   CDS_pept        complement(59590..60270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59627"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGE8"
FT                   /protein_id="ADF59627.1"
FT                   /translation="MYTVLPSPLLHAITGLRFQPLVDLHSGQAVAHEVLVEIHNVNLDA
FT                   LFASLPTRSALQIFFWQANTLLQMPDKGQYWLNLPADQLLDAKAIDLLLALRHQQRLTI
FT                   EIQDPLTVTRMSAAEQRGIHHALLQLKGAGWKIWLDDLTQELADDYARLALPVDGIKLD
FT                   RSELSSPARFDTLVHFVREKIARAVVVEGIETAQDLQRACASGARFGQGFLWPESRIDA
FT                   SVTV"
FT   gene            complement(60340..60951)
FT                   /locus_tag="ECL_00060"
FT   CDS_pept        complement(60340..60951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59628"
FT                   /db_xref="GOA:A0A0H3CCU3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCU3"
FT                   /protein_id="ADF59628.1"
FT                   /translation="MKETIHVAVIDSCEFTMIGLQYLGNREPDAHRDVIFHGFSNIEDF
FT                   LLSERTWDIVIYDPLNIGSFMITPNEDILRIKEKQPAARIYIYSLSVGFLKFKHVDGVI
FT                   NKRVSLGDIKAMWQILMSQTPKALNHYNVSITTRQRPARLSNEEASVLRGYSCNLKTKQ
FT                   IARQLGCNVRLVYFYKNNAMNKLKAVRGPSFYQSIRWILN"
FT   gene            61069..61239
FT                   /locus_tag="ECL_00061"
FT   CDS_pept        61069..61239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59629"
FT                   /db_xref="GOA:A0A0H3CDJ2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDJ2"
FT                   /protein_id="ADF59629.1"
FT                   /translation="MRKANPFYYRKIKFKKYFKVRSNIFNLLIILEIDFYPEKWRLLRF
FT                   DMDNTLFLWGF"
FT   gene            61399..62064
FT                   /locus_tag="ECL_00062"
FT   CDS_pept        61399..62064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59630"
FT                   /db_xref="GOA:A0A0H3CEE7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEE7"
FT                   /protein_id="ADF59630.1"
FT                   /translation="MIFSEFTFRIIVFYRVNILQEMISDALRKLLPEYSLQISIVESTE
FT                   QLFDAISDGQVDIVMAEFSYLFNHKSWSVQTSNRLNMLCHTHHVKRVLFVPELQYGLLK
FT                   RVLEMKYELTLSLQDEPGELKRELQALLRAEEARPRVSSYLKGMMRAGARSRSVLSARE
FT                   WEVLHLLVEGYTVTEIAQLRSRSASTIATQKHNAMKKLNLTNHSELIKYLQMAGRIGS"
FT   gene            complement(62106..63170)
FT                   /locus_tag="ECL_00063"
FT   CDS_pept        complement(62106..63170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59631"
FT                   /db_xref="GOA:A0A0H3CER8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CER8"
FT                   /protein_id="ADF59631.1"
FT                   /translation="MIRLLTFLFLACVSGASYATCSGGSISYGPPISVDLSDKLTPATP
FT                   TWTGSFSTQYSGSFNCSTGNSEFSYTPILSTDSKYATILGFSNDKYRVRAEITSTHPNK
FT                   TLSASGNHTASELNTPFTVRFTLVDQSGTTLSGDTATMSDVLFVSDMSGMSFWEIITWP
FT                   INQLVKIVQWLFNGFKWPYDNRDMFGQPMTIKYAPKLTTCSFDNAGLTVHLPTLGIPQL
FT                   SASAQPGLTPFTLNMSCQNLGTNGTSDRAIEMFLSSTQLLSTDSSVLVDTSSGAAQGVG
FT                   LRLIQRNNPQQPVIFSTSTTSRGNATLLFNVAAGGALSKTFTLPMAASYYVWAPAKVSQ
FT                   GKLNTTATLNIIYP"
FT   gene            complement(63183..65678)
FT                   /locus_tag="ECL_00064"
FT   CDS_pept        complement(63183..65678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00064"
FT                   /product="putative outer membrane usher protein FimD"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59632"
FT                   /db_xref="GOA:A0A0H3CGF3"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGF3"
FT                   /protein_id="ADF59632.1"
FT                   /translation="MKMKQNRLCMLAVCSLLLSHKSGAVTFDTSLLAGASGESDLSRFN
FT                   ENNAMPAGPQEMDIYVNGDWKGRYTVTYGEQQDDVRLAWKDALMLGINTKAIPAPAITD
FT                   GQVQLHDLVQGGEVKTDTSTLSLALTVPQAAVLRTEEGYVAPQFWDEGIPALMLSWNTT
FT                   WYNTRTKGSAKETNDDFYAGLDSGANLLGWQFRDSSTWRKSASGDSSWQNNTRYLRRPL
FT                   AALKSNLTLGDFYIPGDLFDSLRVRGVSLASDMKMRPNSQQGFSPVVHGVARTNALVKV
FT                   MQNGNVIYQENVPPGQFTLDSIQPTGSAGDLLVVVREADGSQQSFTVPFSAVPGMLKEG
FT                   VSEYSVVAGKVHQNTLEADPAFLQATLRYGFNNLMTGYTGTIVSDNYQAGLIGTGWNLP
FT                   FGAVSVDVTHAKTTLQDRTDSGQSFRVSYSKFIDTTATNFTLAAYRYSTKGYYSFSDAL
FT                   YSREGYQRLKAQYDEYEDRFGVAPEMTMSTWDALRAAQPKNTFTLNLNQRLPDNWGTVF
FT                   VSGTQRDYWNSRQTSREYQAGYSNAIGRASYTVSASRVRNSEREEETRFYLSLSLPFSL
FT                   FDNNAWVTSSLTASDSHYEQSNISMSGNALASNRLSYTLSGSNARGGNNTASVNTAYRA
FT                   NFATLGGSYSESSDYRQMGLNGRGSLVAVPWHLLASNETGSTMTIVDAPQAEGLMVNGD
FT                   ESIVTNRDGVALVPYATPYRKNAITLSETANSRGAEVLGNIANVAPYDGAVNYIRFDTD
FT                   QRQSWMLRATRPDGAPLPFGTEVLNERGESVGYVGQASVLYIRAEQPPRELSVHLRGGN
FT                   CTIAAPAWGLESPSSVCHY"
FT   gene            complement(65694..66386)
FT                   /locus_tag="ECL_00065"
FT   CDS_pept        complement(65694..66386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00065"
FT                   /product="putative pili assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59633"
FT                   /db_xref="GOA:A0A0H3CCU7"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCU7"
FT                   /protein_id="ADF59633.1"
FT                   /translation="MRKIIMLASLLLSAGNAWANIVINGTRVLYPENNKEVIVQLINTG
FT                   DAPALVQSWIDDGDINSTPETANVPFLLSPPVVKVSEHNGQQLRIKKLPANLPGDRESV
FT                   FFLNVLDIPPKPENIQNQNTVQLAIKSRIKMFYRPASLTGTLDNATGKLTLIASGKQFR
FT                   IVNDSPFHITVANISEGKTKLLQESPMVAPFGQLTVATKNAVKRGQTYQLMYVDDLGAY
FT                   KTRTLTSQ"
FT   gene            complement(66439..67023)
FT                   /locus_tag="ECL_00066"
FT   CDS_pept        complement(66439..67023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00066"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59634"
FT                   /db_xref="GOA:A0A0H3CDJ5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDJ5"
FT                   /protein_id="ADF59634.1"
FT                   /translation="MFKTIMTVSVLGAAIASTHAIAADNSAGGVINFTGAITDTTCTIN
FT                   GGKSADMTVALSPISVKDAGTTVGLITKNKKSISLTFSGCTPAAGTTGTPLKVYFSSAD
FT                   NISTDGKYLLNNSVNENDASVARNVGFALVEPGKSTPVTLNQAYTTSIMGTSAAPDSET
FT                   LTLDVYYYKTNAAAATVGALSSNVTYTISYL"
FT   gene            67364..68332
FT                   /locus_tag="ECL_00067"
FT   CDS_pept        67364..68332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00067"
FT                   /product="IS903 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59635"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGV8"
FT                   /protein_id="ADF59635.1"
FT                   /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLR
FT                   CPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRK
FT                   LHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHDELRR
FT                   KKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVK
FT                   QLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
FT   gene            68464..69264
FT                   /locus_tag="ECL_00068"
FT   CDS_pept        68464..69264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00068"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59636"
FT                   /db_xref="GOA:A0A0H3CES0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CES0"
FT                   /protein_id="ADF59636.1"
FT                   /translation="MKYLIDLAMLYEVDSGVIMINGEEESSIKLSNQAARLLYELIINN
FT                   GKTLDRDDLIKKVWEDRGFSGSSVSLNVAISEIRKAFRSLGRDPLLIKTIRGKGFSLAA
FT                   HIEHHTVRPPVAAPEKMVAETVDIVTQQRDPPEGLRRRDSGFTTLFVMALVAIMGIAAL
FT                   LFYQNMRVADRPKESDIYRLGKIDRCTVYLIDKNMYQPQQVYLNRAKDAIARQHIDCEH
FT                   QAADAYYSKFKKSQLENDFLAVCYLQDGADSYKNCISYRSLTGS"
FT   gene            69269..69754
FT                   /locus_tag="ECL_00069"
FT   CDS_pept        69269..69754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGF8"
FT                   /protein_id="ADF59637.1"
FT                   /translation="MSKRQMGILLGVVLLLSVIVIAVLYPKRTQEVGFGCQSDTVSRKN
FT                   YSTGESTALSLTTLFLFNGSDIVTVIHKGVFTRGDKRYLIDRNYVLNVEKVAGSDIYYI
FT                   KGKKLQKSDDDIAPDGIVNELLMDSIDFFYVTRVKGHAWLIKGLVLPIMMCVAVPTS"
FT   gene            69984..70607
FT                   /locus_tag="ECL_00070"
FT   CDS_pept        69984..70607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59638"
FT                   /db_xref="InterPro:IPR016514"
FT                   /db_xref="InterPro:IPR038478"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCV0"
FT                   /protein_id="ADF59638.1"
FT                   /translation="MNKLNAIVLGSLLSLSALSVAHAAETTASATWQASATKDSDSDLV
FT                   VTPTRALNFVYSANTKAFNTDTGLFDVAIRGDHSSATSFKLEAIVDDSDNTLFSVGGEA
FT                   TKLKVGARFGGTDLGSIGGTVGTKSTAWTTLVDSSNNTGVSSGLWNLTTSAGATANTEV
FT                   TGQDKFVFYVDSAQDSTGAAKEFKDLTNSLWEGTVSVAFRATWG"
FT   gene            70653..71330
FT                   /locus_tag="ECL_00071"
FT   CDS_pept        70653..71330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00071"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59639"
FT                   /db_xref="GOA:A0A0H3CDJ9"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR040695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDJ9"
FT                   /protein_id="ADF59639.1"
FT                   /translation="MFSLKPIFFSLLFISSSALAINVGKVTTIIPADADSTAKELKNEA
FT                   DSVRIISISAQRISSPMDEGVVINPEQTDELLLTPTRMVMPAGTSNIVKFYYHGKADDR
FT                   ERYYRITFIDEGVSEDLDNGTKKNGKGMTRAVVSTILVVQPRKKNVDFVYVAGKITNKG
FT                   NTAFRVNASGTCLKPNPESPTTPCVKNFYLMPGTSRAIDDINVTDSHFHLGIWDLKQFI
FT                   PVK"
FT   gene            71337..73931
FT                   /locus_tag="ECL_00072"
FT   CDS_pept        71337..73931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59640"
FT                   /db_xref="InterPro:IPR031917"
FT                   /db_xref="InterPro:IPR032636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEF4"
FT                   /protein_id="ADF59640.1"
FT                   /translation="MVKNKLVLPVMMACTSGLLPAYAHAASSSVVIANYRFPDSLYALL
FT                   EQGIKIPVYLVNTRPGAAQQAGSTGDVSEYVRIGDVTIYAEDRQLGLRDVQVQESDNGI
FT                   RLSKEMRTLLQSINGKQFDDHMRIPVSAGSAFELDQKKMRLLLNLSQRDYGVNIRPREV
FT                   DIDAPESDDLSGTLSYNLGAYHTESGYGDSWSSGYLNAKSWVSMGVDHLLVDGSGYVNE
FT                   NSSDTQMNAVMWERDYQGMRYAAGMLNGWAMQSLASVSGISGGEVYGVSVGNQANSRKR
FT                   DNTLSLTPIVVYFPTAGEARIRRDGQLIGIQRFDVGNHEIDTSALPYGIYSVEVEVVSG
FT                   SRTVSRSMYTVNKPFTNNVSESLRWQTWGGIYSRDKSVVNYKKYAKRKNEQDNSYYYDY
FT                   DTKHKDTMSLVGASFSKRSGMVDWNASGYMMREHVVSELWASLNLTGYFSVNTQTMAAS
FT                   DGTYRANYGANVSLPWNIGSVWYSHEQLSSGKFLDIYENKGNTWGASFSLPSFGLPSAG
FT                   NLSLMRQEDDVYRYKRYQVDYSQGLYAGRYGTARLRVGMSRNKYEGYYEEKDRYVMLDF
FT                   SIPLGNTVSVGVSHNRDTGTALNVSASRQFEGDYLKSVTANVSRAFSSNQDRTVSGGGS
FT                   VSFDTPWNSNILSVQSGTSKGWNSTLTSDGSVGWSKEAVAAGKGTHSAGVIVSTGLKSD
FT                   ESLTLKLNGRTERIKGDKTWLSLPAYQAYDLEVMNSETGTESYDIGANARRHITVYPGN
FT                   TVVMKPQVKKIVTLFGRLVDANGNPVSATQIKNHVGLTRTENDGRFVIDVDKNNPVLSI
FT                   ATPDDSVCEVRLDIASNRGALWLGDISCDKGDFVWQEAKGTRERDDEKDIRS"
FT   gene            73903..75507
FT                   /locus_tag="ECL_00073"
FT   CDS_pept        73903..75507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59641"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CES6"
FT                   /protein_id="ADF59641.1"
FT                   /translation="MTMKKIFALNLLLISAAAQAQQMPYFAINNPDNNGTGNTAALFSL
FT                   NSTSTAFLHGSREWPTLSAKTNNGIATYIPDNSFNGPAGSPLTINFSVTGSSASPFFKG
FT                   TACSSSCGTTGYTATTSYTDTSMVVKPPVIEPGTAYGRWVLGDPFFDYLLNAAPGNEVT
FT                   ITSTPQISSIGKVITTNTLHKVGTLTMTNSRALDLGIDPISGEVTIVDGSTGATCTKYT
FT                   RNTVSGVLCELLEYTFVGEDITGYNPGLALTSSRVNGVLQSHMNGGTGLAAEITFDESN
FT                   WYSISGGILSDTRVLANTFLAAPQKNGGKAYLKIFLPKALILSVAQAGDGNNIGNIVSL
FT                   CLTPGNSSLAADFCFQPGGGLVIDPIQPGLAIVPDNPDYTLDPNGLGGSGKGTIGEGPI
FT                   EIPYTITYSGAQKDAAIAVTVKVTGPTQSLNGVDYCAFSGNGFTVPVPGNVLLGKSQTL
FT                   KAHNCKGEALSIPAPATHAEEWDKISSGVTDMWLWKTPLVLQFVMNNPVSKTTYDGNTW
FT                   FGEVTAQGRIDVSASWN"
FT   gene            75514..76167
FT                   /locus_tag="ECL_00074"
FT   CDS_pept        75514..76167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59642"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGG2"
FT                   /protein_id="ADF59642.1"
FT                   /translation="MTGKFLAIFAINCFISASANALIIENLNIDFLPEKEVVFQPIKND
FT                   TSVRQNYTVSLIQVDVPKEHGKETEIKDGEVMFSPKQLTLESGERAGFKFYYTGPHDSK
FT                   ERYYRVKFTETPLQARVVMSKGQRIQSDVVVSLEAILIVRPWTRHFDYTFSNGVVSNTG
FT                   NTWFKYVSSQGCSSQYNDSKYLPPGQRLEIDNYAQPARRMIIYGNKIIPLTRCP"
FT   gene            76240..76434
FT                   /locus_tag="ECL_00075"
FT   CDS_pept        76240..76434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59643"
FT                   /db_xref="GOA:A0A0H3CCV5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCV5"
FT                   /protein_id="ADF59643.1"
FT                   /translation="MKAISFVEAKDIIGGALNPFAGLVKGAQLGYDTGASIMGMVGGVV
FT                   GGILGGAMGFLGALVGSYN"
FT   gene            76457..76642
FT                   /locus_tag="ECL_00076"
FT   CDS_pept        76457..76642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59644"
FT                   /db_xref="GOA:A0A0H3CDK3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDK3"
FT                   /protein_id="ADF59644.1"
FT                   /translation="MQVIDFKKAQAIIGGWDPFAAALQGASAGYNAGSQMLGALGGTIG
FT                   GVFGLVGGFIGGFFSA"
FT   gene            76707..78803
FT                   /locus_tag="ECL_00077"
FT   CDS_pept        76707..78803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59645"
FT                   /db_xref="GOA:A0A0H3CEF8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEF8"
FT                   /protein_id="ADF59645.1"
FT                   /translation="MFSLFQYKKKGKTPVIRQHEYTECGLACLAMVLGHYEHHVSVSQL
FT                   RRELTVSADAGTSMAELMTLASDKNMTGRVLKGEITEIESAELPLIAFWRGNHFVVIVK
FT                   VDGRSVTVHDPASGVRRYSLKEAQKLFSGYVLELKPTPRFDKKSPDETLTLGRLANKSP
FT                   SLFQRQVLLFVLSIFTLITMLASPTYVQLIMEEAISRNDNDLVILLTAIFAIVFIFEVI
FT                   GKFLKQLLEILMRNIAYDDLSQSVRRYMLRTQTGWFRSRPPGIVLAIEKSLHACAEFIS
FT                   NGYVQILFSSLIAFTSLLFMLLYNVKIAVLTMLLMGVFFLIRFSLIGPYQRAVDDSIER
FT                   TAKYESLLVETQKGIITLKANNMEQARDAVMDKSQREHIAGLMRKERLLARFDVASLLV
FT                   INAEQLLVVCFGAWLILEGQMSIGMLYAYISYKRYFSDAMVQVAQKLLDKNALKGPLDR
FT                   VGDLLFAPSEASQFGRKIVTSPVSLAFEDVSFAYPGREATLQHINMTLKQGEEAVIVGQ
FT                   SGSGKTTLLRLISGMLLSTSGSLRINAIPITECDLSSLRQHIRIVHADDILFTGSILDN
FT                   LSCFDSAPDKERVIAACRLAEIDHVVARLPHGYETELLPGNTFFSAGEMQRLVLARALY
FT                   SQPKLLLCDEVTANLDKTTAQKVLANLRGLGIGLVFVTHSPEVVGCHGRLYTMENGTLR
FT                   ESEQ"
FT   gene            78800..79549
FT                   /locus_tag="ECL_00078"
FT   CDS_pept        78800..79549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00078"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CET1"
FT                   /protein_id="ADF59646.1"
FT                   /translation="MMFLPRLYARLCARQAGRTLLASRITQNYSQFMRCPEADVPPDFL
FT                   RQNALEMSGFHFVEQIFPPALWRRNVRFDLHARVAAFTREQEFYSQPRTLLLGMRWAGF
FT                   GLIADALLATAPDDVRFQFVTRLPALHKLMAAHEERRAGAFFSPHRLVTVLLVDERLPD
FT                   APLFITQAGDQKAWLTDVSTRFLTRYGYVIRTLLPGCSLHSAEFALESQTYAPAEYRQA
FT                   ATATLNALRKTPTLWSAWDDLSVIYHG"
FT   gene            79556..80806
FT                   /locus_tag="ECL_00079"
FT   CDS_pept        79556..80806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59647"
FT                   /db_xref="GOA:A0A0H3CGG7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGG7"
FT                   /protein_id="ADF59647.1"
FT                   /translation="MKLRNRNRQRRALIPHHFSKSYEINAPRLKGVLTLFISFFLCLLV
FT                   FSIVFNFSETTLARGVLIPAQGDVEVRARESGTIVDFAVRPGQYVKENDPLFTVSQDYG
FT                   GKQGSVVQFDRQQMEAEKKRSEQRVQTIEDSIATYRKNLAQQLDIADRQIVVSRDKVKK
FT                   LRALLKNSTDTYEAWKAISGKGYVSKVDLDKSHNDVLNAQLNLTLEESSILDLEARKTS
FT                   LTDSTQSQIDSLSQELLYVKNRISEIDRNLSSRGSSTMAMLAPADGYVVAINFPPGRAI
FT                   TQNSEVVVVIRKNTAASMEGYLYVPATGVGRVAKGDKVKLRFDSWPVDKYGSVEATLSD
FT                   FYEVNIDAHSALIPLQEGQNYYLAKVRVPSWFTDPDNKKRLLMGGMTVNADIVIDRKPL
FT                   INLLIAPLERVRKRFID"
FT   gene            80896..81675
FT                   /locus_tag="ECL_00080"
FT   CDS_pept        80896..81675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00080"
FT                   /product="putative beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59648"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCW0"
FT                   /protein_id="ADF59648.1"
FT                   /translation="MNITHIRNATQLITYAGKRFLIDPMLAAKDAYPGFPGTARAEIRN
FT                   PMVELPVDVSTLLDADAVIVTHTHDDHWDRAAVELIAKDKPIYVQNDRDAALLRSQGFH
FT                   NLTVMTDETTFGDIRIAKTHGGQHGTDRAYAVPELAERLGEACGVVLRHPDEKTLYIAG
FT                   DTVWRDAVAADLQKHQPDVVVLNAGYAHVIGFGPIIMGEQDLLNVHFLLPQAKIVAVHM
FT                   EAINHCLLSRRALREYVEANQIGDAVSIPQDGETVIF"
FT   gene            81701..82678
FT                   /locus_tag="ECL_00081"
FT   CDS_pept        81701..82678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00081"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59649"
FT                   /db_xref="GOA:A0A0H3CDK6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDK6"
FT                   /protein_id="ADF59649.1"
FT                   /translation="MPLINVAIVAVDGFSPFHYSVPCILFGDAVSGEKRFNVTICAEKP
FT                   GVLTSKEGFALNATQDFSAIAQADIVVVPYWQHVLDRPPQVLLDSLVQARDNGAEIVGL
FT                   CLGSFVLAYAGILDGKRAATHWEFEHHFQSLFPRVQLDINALYVDDDNIITSAGTAAAL
FT                   DCCLYIIRQRFGSVVANQIARRMIVPPHREGGQAQFIAQPVPKDTRDARINCLIDYLQQ
FT                   HITEPHNLDSLAKVVSMSRRTLTRHFVNATGMTVADWLTAERLRRSQILLEAGNMPVER
FT                   VAELVGFNSAVTWRQQFKARFGVSPTEWRKTFRIQPSVARHDAT"
FT   gene            complement(82739..83470)
FT                   /locus_tag="ECL_00082"
FT   CDS_pept        complement(82739..83470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00082"
FT                   /product="Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59650"
FT                   /db_xref="GOA:A0A0H3CEG2"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEG2"
FT                   /protein_id="ADF59650.1"
FT                   /translation="MKHILTASLFALSASVFAGSAPHWTYEGKSGPENWGELSDEFATC
FT                   KTGKFQSPIDIRNAYNATLPPLEMNFHTAAEKLVNNGHTLQVTASDEDEFRLDDQIFTL
FT                   RQYHFHTPSENRINGKSFPLEAHFVHASKEGDVAVLAVMFEVGPENSALNPLLARLPKE
FT                   KDHEISIDKHLDLRPLFPADLHYYRFSGSLTTPPCTEGLRWLVMKNTVTLSEKQLEMFK
FT                   QALEHSNNRPLQPLNGRVIVQ"
FT   gene            complement(83586..84674)
FT                   /locus_tag="ECL_00083"
FT   CDS_pept        complement(83586..84674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00083"
FT                   /product="putative RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59651"
FT                   /db_xref="GOA:A0A0H3CET6"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CET6"
FT                   /protein_id="ADF59651.1"
FT                   /translation="MINTLHIQNYRSIRDMSLELEQLNIVFGPNGTGKSNIYKAIHLMH
FT                   SAAQGQFSQALANEGGILKVFWAGKTRSDQLRRMNLAVETETYEYELQVGFVEKLPYPS
FT                   QFQLDPVIKEESLWLSGQHRRPSAQLMKRRNQAVFLNNVHHEKVTHSGTLYENESVFGQ
FT                   LGEPHLYPEVSQMRESLRNWRFYHEFSVASGSMMRAPQVGFRSPVLASDGANLAAAFQT
FT                   IVEIGDELLLMRILDQAFPGCVFYSDNTGGRFRMMMQREGLSRPLEPAEFSDGTLRFLC
FT                   LAVALLSPRPPAFIALNEPENSLHPQMLPALASLIAEASRYSQIWLTSHSPELATLIEK
FT                   HRSFSLYQLSMTEGETKMEKLG"
FT   gene            complement(84820..85701)
FT                   /locus_tag="ECL_00084"
FT   CDS_pept        complement(84820..85701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59652"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGH1"
FT                   /protein_id="ADF59652.1"
FT                   /translation="MDFVMDELAQWVNFRPVCPEMAIGLPTPRPALRLIMTTGGDTQMR
FT                   FSHPPHDDVTQKMADFTASYLPKIGDLAGFIVCAKSPSCGMERVRVYDENGNRGRKEGV
FT                   GLFTAALLETWPWLPVEEDGRLHDPVLRENFVERVFALHELNTLRKNGLTRRALLDFHS
FT                   RYKLQLLAHHQAGYREIGPFVASLHEWDDLDAFFEAYREKLMTILKKPASRKNHTNVLM
FT                   HIQGYFRNQLNSRQRGELRDVILHYREGLLPILAPITLLKHYLAEYPDQYLMTQNYFDP
FT                   YPDDLGLRLAVK"
FT   gene            85708..85869
FT                   /locus_tag="ECL_00085"
FT   CDS_pept        85708..85869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCW4"
FT                   /protein_id="ADF59653.1"
FT                   /translation="MPAVKANGGPGQAAANTQHRFRCHGMFLQSQYLKLTQSCLFVQVL
FT                   AEVFFIAF"
FT   gene            complement(85882..86292)
FT                   /locus_tag="ECL_00086"
FT   CDS_pept        complement(85882..86292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00086"
FT                   /product="putative hydroxyisourate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59654"
FT                   /db_xref="GOA:A0A0H3CDK8"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDK8"
FT                   /protein_id="ADF59654.1"
FT                   /translation="MKKTAPLLILASMAFAPAAFSAPAGTLSVHVLDQQTGMPPSDVTV
FT                   TLEKQQQDKWIPVASGKTDHDGRIKSLYPQEQDMQPGVYKVTFKTADYFHAKKLETFFP
FT                   EVPVLFTVTRTNEKLHIPLLLSQYGYSTYKGS"
FT   gene            complement(86392..87123)
FT                   /locus_tag="ECL_00087"
FT   CDS_pept        complement(86392..87123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00087"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59655"
FT                   /db_xref="GOA:A0A0H3CEG6"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEG6"
FT                   /protein_id="ADF59655.1"
FT                   /translation="MDMAYSIGEFARLSGITATTLRAWQRRYGLLKPQRTEGGHRQYSD
FT                   EDVQQALKILDWVKKGVPIGQVKPLLERPVPRRTNNWQTLQQNMLERLQGGKIESLRQM
FT                   IYDAGREYPRPELVTNVLRPLRSQVSANVAAAMTLRAILDGILIAYTSFCLEGDKKAPG
FT                   DNILLSGWYLNDPCEIWLEALSRTGQGHRIDVLPTPPATLAPEIFPDRKWLLVTSGKMT
FT                   AARKKQVAQWQQQLSLEVIIL"
FT   gene            87235..87759
FT                   /gene="blc"
FT                   /locus_tag="ECL_00088"
FT   CDS_pept        87235..87759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blc"
FT                   /locus_tag="ECL_00088"
FT                   /product="outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59656"
FT                   /db_xref="GOA:A0A0H3CEU1"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEU1"
FT                   /protein_id="ADF59656.1"
FT                   /translation="MKLWPVVTGVAIALTLVACKSPTPPKGVQPISGFDASRYLGKWYE
FT                   VARLENRFERGLEQVTATYGQRSDGGISVLNRGYDPVKNKWNESEGKAYFTGASTTAAL
FT                   KVSFFGPFYGGYNVIKLDDKYQYALVSGPNRDYLWILSRTPTVPDAVKQDYLNTARSLG
FT                   FRVDQLVWVKH"
FT   gene            complement(87763..88776)
FT                   /locus_tag="ECL_00089"
FT   CDS_pept        complement(87763..88776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00089"
FT                   /product="P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59657"
FT                   /db_xref="GOA:A0A0H3CGH5"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGH5"
FT                   /protein_id="ADF59657.1"
FT                   /translation="MMRLFLFISGLLLCASAQAMEWKSDITLSPQPMTYSGPADSVMPG
FT                   SIIGSTWSASVSVQQVFWCGFVFHCTKSTLEPSSSAISSGMTVTVDGVNYTIFETGVPG
FT                   VGYIIGLKDFNGTKYIPLQTGVTQSYPAEGTSTSTQDLGWSAKVTFIKTGVALKSGVYQ
FT                   IPTINAAVLTAYNNEVKTAKVIINPTTITVTASGCTVGTKSANVDLGTIDIRTLTTVGS
FT                   TSPSGAFNVSLTCDANVAVSAVMTDQTTPSNTSSVVTLTGDSTASGVGVQFFYNGTGPL
FT                   MMGPDSSAAGTTNQFFIQSTTAAQTLSLPFQAQYIRTGELVPGSANALASITFSYQ"
FT   gene            complement(88773..89288)
FT                   /locus_tag="ECL_00090"
FT   CDS_pept        complement(88773..89288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00090"
FT                   /product="P pilus assembly protein, pilin FimA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59658"
FT                   /db_xref="GOA:A0A0H3CCW9"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCW9"
FT                   /protein_id="ADF59658.1"
FT                   /translation="MSVTLRTFSIALLIFTFPVRSYDVLVSVTGNLIGNTCVVAADSKE
FT                   QDVPLGTIGIKQFPRAGAVSNIKTPFTIRLEACGPTFAGVKIRFSGTPDNDNPQLVKIA
FT                   DGGATGVAVQILDKDGGLIPLDTQTTARGTPGDDSVEMTFYARLAATGAPVNAGDVSAF
FT                   ATWTTEYQ"
FT   gene            complement(89279..91801)
FT                   /locus_tag="ECL_00091"
FT   CDS_pept        complement(89279..91801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00091"
FT                   /product="P pilus assembly protein, porin PapC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59659"
FT                   /db_xref="GOA:A0A0H3CDL1"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDL1"
FT                   /protein_id="ADF59659.1"
FT                   /translation="MKRKILCATVISLVIRQAMAAESALQFNPAFLNGESANSADLAWI
FT                   NAGSALPPGDHNLNVYINNNYAFTGNITFRTAENTGEALPCLTPEQIAALGIDSQQAKG
FT                   GALPLAQRCIFLTEAFADTRFDFDQQTLSLSFTVPQSAMRNLPRGYVSPESWEAGIPAA
FT                   WLNYVVNGSNNDYQGETRTRDQQLFASLNSGINLGAWRLRDFTTWTKDTNELTHVQTWL
FT                   QRDIPALNAQVYAGETYTSAQVFDAVGLRGIALKTDDNMLPASLSGYAPEVHGIARSNA
FT                   TVTVRQNGNIIYQTSVPPGAFVLKDLYPTSSGGDLAVTIQENDGSQTQYTLPYASVPNL
FT                   VRNGQLKYALGAGKYRPMGHQDAPSFAQGELFYGWRYGLTFYGGAQFADRYNGLAFGIG
FT                   QNLGRFGAYSIDLTHARSQLADDQHYTGDSVRLRYSKLLNDIGTRVNFFSLRYSTKRFY
FT                   TLSDTTYKGMAGGSPKQIVEDDGTVTTHYDTVYNLRMSRKAKNQLLLSQPMGQYGSLSL
FT                   SWDQQTYWNTSKTTQSLQFAWNATFRHVSLGVSVQRSSSLYDDKKDNVLAMSLSVPLGN
FT                   PALSTRARFTTTHADSTGTTASTGVSGYLPGQENLFYSVNQRYSAQQHYGGDATLQYEG
FT                   AKGDYNLGYSYTRDSRNLSYGMSGGAVLHEDGLTLSQPLGNTNILVKAPGASDVAVLNH
FT                   KGIKTDSRGYAVIPYATPYRVNQVALDVTTAGNDVELENAIVNKTPTDGALVRATLVTR
FT                   QGKKAMFVVRRGNDVLPFGTLISLNDDKTSGIVGDGGSLYLSGLTEQGTLSAVWGRNSD
FT                   QRCTINYALNKQSYNARTGLYSQEVVCQ"
FT   gene            complement(91825..92502)
FT                   /locus_tag="ECL_00092"
FT   CDS_pept        complement(91825..92502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00092"
FT                   /product="P pilus assembly protein, chaperone PapD"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59660"
FT                   /db_xref="GOA:A0A0H3CEH1"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEH1"
FT                   /protein_id="ADF59660.1"
FT                   /translation="MRAKAGICLAISLCSSAAYAGGVGLGATRMVYSSTTNQSMLQVRN
FT                   THPDATFLIQSWMENEEGQKTNDFVITPPLFVMKPASESAVKIMFNGKALPEDRETLYW
FT                   MTVKAIPQQTKSGSGNSLQFASANRIKVFYRPESLGQGAGDAWKSLTGAYRGGKVTLSN
FT                   PTPYYLTTINLKIDGMPVQPVMVPPKSSVTLGETFSHASSVSYQTINDYGAWTPATRAA
FT                   LSQ"
FT   gene            complement(92556..93140)
FT                   /locus_tag="ECL_00093"
FT   CDS_pept        complement(92556..93140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00093"
FT                   /product="fimbrial protein FimI"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59661"
FT                   /db_xref="GOA:A0A0H3CEU5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEU5"
FT                   /protein_id="ADF59661.1"
FT                   /translation="MKAQFKTKTLLAVAVAAVLPAGSAFAATTSGGTVNFSGKVVTSAC
FT                   AISAGSANIDVDMGEVRTATLAAAGSEASTAKAFSITLEDCEIADTSASTEDNPIAATT
FT                   VAVTFTGTPDAADANSLAVGANGGANSAQHVAIRLYDEQGKVVKLGEPAAAIPLRAGAN
FT                   TLNFSAKYYSPQGNATAGDASAVATYTVTYS"
FT   gene            complement(93193..93795)
FT                   /locus_tag="ECL_00094"
FT   CDS_pept        complement(93193..93795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00094"
FT                   /product="two-component system, NarL family, response
FT                   regulator, fimbrial Z"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59662"
FT                   /db_xref="GOA:A0A0H3CGH9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGH9"
FT                   /protein_id="ADF59662.1"
FT                   /translation="MANKTGNKRHLTTALLGGDHFSRQGIAAVLKNMVPEMQVIASSDD
FT                   YSLMETVFLTTPVDVIFLSGTEKYHAGFDCLKYIKNIKSRQPDVLICMYSAPANSWLWI
FT                   RGDIDAYISLQEPLYHWRASLLKMVDSRYRPKKKPTALSLTPGEWRVLKDLRKGLDMRY
FT                   IAETEQLSYRRVSALKSSAIRKLGLRNKTDLLVFLTS"
FT   gene            94506..95297
FT                   /locus_tag="ECL_00095"
FT   CDS_pept        94506..95297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00095"
FT                   /product="putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59663"
FT                   /db_xref="GOA:A0A0H3CCX4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCX4"
FT                   /protein_id="ADF59663.1"
FT                   /translation="MHKYYIINGIVEFHPAASTLRDLNNPEQVVVLNSPAGRCLLLLIE
FT                   RAGSIVTQQECMDIVWQRRGMMVSPNTYYQNISILRKGLKKAGFETDPIVTIPRIGLTL
FT                   ASDTQITIKEAQLPLAEPEAPVQTVQEEAGVPQPVASVTPVAPVAKRRFWLVGALLALL
FT                   LIVSVSVISYSRPHDSYFVDGYRFTTMMGECRLYFARDIETPQDREKALAYAAPFKDEC
FT                   SSYPWIYISGYSLLPRASVIRCDRAMTEPNRCMSDYFIQDH"
FT   gene            95299..95781
FT                   /locus_tag="ECL_00096"
FT   CDS_pept        95299..95781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDL4"
FT                   /protein_id="ADF59664.1"
FT                   /translation="MARYRQTLLTLCLCLLVGALAAGYYLWQRYYIHPFACQVNFIQHH
FT                   PEETLTLWLNYTVDGNNGTLSMNGRVKSDPGKTFNRKIFFQVERKDNVYYMRSVRNIKF
FT                   PDDDVSDSWLEKYEPLFFIYPNESIYMRIKKQQNDNYLFILGTLPTYVCHPSKTEG"
FT   gene            96020..96907
FT                   /locus_tag="ECL_00097"
FT   CDS_pept        96020..96907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00097"
FT                   /product="putative transcriptional regulator containing an
FT                   amidase domain and an AraC-type DNA-binding HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59665"
FT                   /db_xref="GOA:A0A0H3CEH5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEH5"
FT                   /protein_id="ADF59665.1"
FT                   /translation="MEALRTASCVQKTRQKIAFKLSLISTRAELPITSNAGISVQPEAA
FT                   HLTPGEYDYIAVIGGSLEDLDKGLPDDRAFLAEAHHNAIPLIGIGTGSFILAEEGILNE
FT                   RRASIHPYHHDVFTQRFPQVYAEQGLDFIDEGDVLTCPGGISTLTLTTALIRAHAGDDI
FT                   AATTSRRLSLSPHAVTTPRPANIALIPDSRLRRAVMIIEQYLTRPLSAAGLAQDVKLSE
FT                   RQLNRLFHAEFGKTAREFIRSARLRYACWLLKNSQQSVTDIARRMGFSDCAHFIRHFQL
FT                   EYGCTPGVWRTSQS"
FT   gene            96993..97991
FT                   /locus_tag="ECL_00098"
FT   CDS_pept        96993..97991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59666"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEV0"
FT                   /protein_id="ADF59666.1"
FT                   /translation="MNWQPFRGSAPGNMTIFSASFPDVSDQWPMKDETAREINALNQAL
FT                   KADPALRPPLIEYEEGGHAVLVPQNRYSEQAFRNRPALLAWRARLVPTALALFVVQNPL
FT                   EERLPEGTKMDSDSRQWFIHANDAIGVRSRAKVLAALVEKYIHNESENNWVSLASGAAI
FT                   PVLEALRNAKLDGQQVYLTLVDKDPVALSWAETMAAQEGLVVGEQLTLLRRNLLHTLVR
FT                   NDDLLLELGEHQAELVDALGIFEYFNDTDAVTFLQRALRLVKPGGAVIVSNMLTSSPQI
FT                   DFVLRGIGWEDIHPRSLQQLQDIHLAAGVPVENVTVVVPKDGVYAVMEVKV"
FT   gene            98522..98962
FT                   /locus_tag="ECL_00099"
FT   CDS_pept        98522..98962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59667"
FT                   /db_xref="GOA:A0A0H3CGI3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGI3"
FT                   /protein_id="ADF59667.1"
FT                   /translation="MKIETAHSSHFERLVAIWESSVRATHHFLQESDIAALRPLLLNAY
FT                   LPNLTVVMARDDAGVIHGFLGVDENRIEMLFVDDASRGKGVGKLLLHYAIAEFGVNEVD
FT                   VNEQNPQGVAFYRHMGFVQVGRSEVDGQGNPFPLLHMRLNRD"
FT   gene            complement(98959..99330)
FT                   /locus_tag="ECL_00100"
FT   CDS_pept        complement(98959..99330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00100"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59668"
FT                   /db_xref="GOA:A0A0H3CCX9"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCX9"
FT                   /protein_id="ADF59668.1"
FT                   /translation="MGLTSYKGEEVRKSDVTTAKNYLSQDEVSELNRVVNMWLDFAEDQ
FT                   AKRRKQVFLRDWQTKLDQFLQFNDRDVLEGAGKISKKAADEKACSEYIEYEKKQRLLKE
FT                   AEGEKDIVGLLKWDKQAKR"
FT   gene            complement(99427..99987)
FT                   /locus_tag="ECL_00101"
FT   CDS_pept        complement(99427..99987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00101"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59669"
FT                   /db_xref="GOA:A0A0H3CDL7"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDL7"
FT                   /protein_id="ADF59669.1"
FT                   /translation="MTYEELINSPADEFVMFASKDGKVRIECRFESDTLWLSQATICEL
FT                   YGKAKATISGHIKNIFDEGELVENSVVRFYRTTANDGKVYNVQYFSLPVILAIGYRVRS
FT                   TRGTQFRQWATQTLQEYLVKGFVMDDERLKNPPVGSSAVPDYFDEMLERIRDIRASERR
FT                   VYLRVREIFALAADYQPSLKETT"
FT   gene            complement(100046..100387)
FT                   /locus_tag="ECL_00102"
FT   CDS_pept        complement(100046..100387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59670"
FT                   /db_xref="GOA:A0A0H3CEH9"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEH9"
FT                   /protein_id="ADF59670.1"
FT                   /translation="MADSHSTPDTDQSGTERSLIVGYRPNVFDKSTPNIILSGKWLRTA
FT                   GFETGHQVTVKVMKGCIVLVAYNEQEQRLQDDYKRTKAKLIEIENALTAIQTPRAGKRL
FT                   AKTNTNHLA"
FT   gene            complement(100747..101040)
FT                   /locus_tag="ECL_00103"
FT   CDS_pept        complement(100747..101040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59671"
FT                   /db_xref="InterPro:IPR041129"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEV4"
FT                   /protein_id="ADF59671.1"
FT                   /translation="MQNFYHLDQLIHGYFNQDYDLINDGEDTIEGIIGLFKKTAPGWLL
FT                   KELAEEIDTFIECYGDKLDDEFKSRYGFDFSPELWETTSYDFLMTVRRLALA"
FT   gene            complement(101748..101838)
FT                   /locus_tag="ECL_tRNA001"
FT   tRNA            complement(101748..101838)
FT                   /locus_tag="ECL_tRNA001"
FT                   /product="tRNA-Sec"
FT   gene            102167..104485
FT                   /locus_tag="ECL_00104"
FT   CDS_pept        102167..104485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00104"
FT                   /product="alpha-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59672"
FT                   /db_xref="GOA:A0A0H3CGI7"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGI7"
FT                   /protein_id="ADF59672.1"
FT                   /translation="MKISDGNWLIQPGLTVTYPVQVFDVEQQGNDLVVYVAPRDVRERA
FT                   WQLDTLMFTVRLFAPQEGIVGVRIEHFQGAQDKGPHYPLNVLKDVRVETVNNAEYAELK
FT                   SGNLSVRVTKGEFWALDFLRNGQRITGSELKNNGYVQDSNTNRNYLFERLDLGVGETVY
FT                   GLGERFTALVRNGQQVDTWNRDGGTSTEQSYKNIPFYLTNRGYGVLVNHPENVSFEIGS
FT                   EKVSKVQFSVEGEYLEYFVIDGPTPKAVLDRYTQFTGRPALPPAWSFGLWLTTSFTTNY
FT                   DEATVNSFIDGMAERDLPLHVFHFDCFWMKAFQWCDFEWDPVTFPDPEGMIRRLKEKGL
FT                   KVCVWINPYIGQKSPVFNELKEKGYLLKRPDGSVWQWDKWQPGLAIYDFTNPDACRWYA
FT                   DKLKGLVEIGVDCFKTDFGERIPTDVQWFDGSDPQKMHNHYAFIYNALVWNVLKETVGE
FT                   EEAVLFARSASVGAQQFPVHWGGDCYANYESMAESLRGGLSIGLSGFGFWSHDIGGFEN
FT                   TAPAHVYKRWCAFGLFSSHSRLHGSKSYRVPWAYDDESCDVVRHFTQLKCQLMPYLYRQ
FT                   AALARECGTPMLRAMMLEFPDDPACDYLDRQYMLGDALMVAPVFSEAGEVQFYLPEGRW
FT                   THLWHNDEVQGCRWHKQQHDFMSLPVYVRDNTLLALGNNKHKPDYAWNEGTAFQLFNLD
FT                   EGATAVSEVPAADGSVAFTLKASRKGDTVTLTGAGDARNWSVCLRNVQKVSGVKGGSYA
FT                   GSEWGVVVDAEGDEVVVHL"
FT   gene            complement(104534..106237)
FT                   /locus_tag="ECL_00105"
FT   CDS_pept        complement(104534..106237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59673"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCY6"
FT                   /protein_id="ADF59673.1"
FT                   /translation="MKFIGKLLVYLLVALLLVLLALYFLLQTRWGASQVSSWVTVNTDY
FT                   ELSFDLMDHRFSSPSHILLENVTFGRDGQPATLVAKKVDIGLGSRQLTDPLHMDTITLV
FT                   DGTLNLSPQTAPMPFQADRLQLNNMAFNSPNTEWDLSAQKVTGGVSPWQPEAGNVLGKN
FT                   AQIQMSAGSLTLNGVPATNVLIQGQLNGKEVVLNTIGADMARGSLTGSALRNADGSWVI
FT                   DTMRLNEIRLQSDKTLLDFFSPLNTIPSLQIGRLEVTDARLQGPDWAVTDLDLSLRNLT
FT                   LSKGDWQSLDGRLSMNASEFIYGSLHLFDPILNAEFSPQGVALRQFTSRWEGGMVRTSG
FT                   NWLRDGKALVLDDVAVAGLEYTLPQNWKTLWMDPLPEWLNSVTLKKFGLSRNLVIDIDP
FT                   AFPWQITSLDGYGANLQLAQDHKWGVWGGSATLNGAAATFNRVDVRRPSLALNANAATV
FT                   NITDLSAFTEKGILEATATVSQLAQRQTTVSLNGRGVPLNILQQWGWPALPVSGDGNIQ
FT                   LTASGSVQANTPLKPTVNGKLSAVNMDKQQVQQTMTGGVVSTPPSPQPSP"
FT   gene            complement(106357..107748)
FT                   /locus_tag="ECL_00106"
FT   CDS_pept        complement(106357..107748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00106"
FT                   /product="uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59674"
FT                   /db_xref="GOA:A0A0H3CDM2"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDM2"
FT                   /protein_id="ADF59674.1"
FT                   /translation="MSVNSIESPDAQPIAQKQNSELIYRLEDRPPLPQTLFAACQHLLA
FT                   MFVAVITPALLICQALGLPAQDTQHIISMSLFASGVASIIQIKAWGPVGSGLLSIQGTS
FT                   FNFVAPLIMGGTALKTGGADVPTMMAALFGTLMLASCTEMVISRVLHLARRVITPLVSG
FT                   VVVMIIGLSLIQVGLTSIGGGYAAMSDHTFGAPKNLLLAGVVLAIIILLNRQRNPYLRV
FT                   ASLVIAMAAGYLLAWALGMLPENTAPTNSALITVPTPLYYGLGIDWGLLLPLMLVFMIT
FT                   SLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSFVSAVFNTFPNSCFGQNNGV
FT                   IQLTGVASRYVGFVVALMLIILGLFPAVSGFVQHIPEPVLGGATLVMFGTIAASGVRIV
FT                   SREPLNRRAIMIIALSLAVGLGVSQQPLILQFAPDWVKNLLSSGIAAGGITAIVLNLVF
FT                   PPEKN"
FT   gene            107974..109176
FT                   /locus_tag="ECL_00107"
FT   CDS_pept        107974..109176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00107"
FT                   /product="glutamate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59675"
FT                   /db_xref="GOA:A0A0H3CEI5"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEI5"
FT                   /protein_id="ADF59675.1"
FT                   /translation="MIHLDTLSTLVAATLVLLLGRKLVHSVSFLKKYTIPEPVAGGLLV
FT                   ALALLVLKKSMGWEIDFDMSLKDPLMLAFFATIGLNANLASLRSGGKVLGVFLIVVVGL
FT                   LLMQNAIGIGMASLLGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFENATEVAMA
FT                   CATFGLVLGGLIGGPVARYLVKHSTTPDGRPDDELVPTAFEKPDVGRTITSLVMIETIA
FT                   MIAICLTLGKVVAQWLAGTAFELPTFVCVLFIGVILSNGLALMGFYRVFERAVSVLGNV
FT                   CLSLFLAMALMSLKLWELASLALPMVAILAVQALFMALYAMFVTWRMMGKNYDAAVLAA
FT                   GHCGFGLGATPTAIANMQAITERFGPSHMAFLVVPMVGAFFIDIVNALVIKLYLMLPMF
FT                   A"
FT   gene            complement(109179..111260)
FT                   /gene="recG"
FT                   /locus_tag="ECL_00108"
FT   CDS_pept        complement(109179..111260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="ECL_00108"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59676"
FT                   /db_xref="GOA:A0A0H3CEV9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEV9"
FT                   /protein_id="ADF59676.1"
FT                   /translation="MKGRLLDAIPLNSLTGVGAAQSSKLGKIGLHTVQDLLLHLPLRYE
FT                   DRTQLYKIGDLLPAIYATVEGEVLNCNITFGGRRMMTCQISDGTGILTMRFFNFNAAMK
FT                   NSLATGRRVLAYGEAKRGKYGAEMIHPEYRVQGDLSTPELQETLTPVYPTTEGIKQATL
FT                   RKLTDQALELLDTCAITELLAPELAQGMMSLPEALRTLHRPPPTLQLSDLESGKHPAQR
FT                   RLILEELLAHNLSMLALRAGAQHFHAQPLSPRDELKDKLLASLPFKPTGAQARVTAEIE
FT                   RDMALDVPMMRLVQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRAW
FT                   FAPLGIEVGWLAGKQKGKARLAQQDAIARGEVQMIVGTHAIFQEQVQFNGLALVIIDEQ
FT                   HRFGVHQRLALWEKGLQQGFHPHQLIMTATPIPRTLAMTAYADLDTSTIDELPPGRTPV
FT                   TTVAIPDTRRSDIIDRVRNACTHEGRQAYWVCTLIEESDLLEAQAAEATWEELKLALPE
FT                   LKVGLVHGRMKPAEKQAVMQSFKQGELHLLVATTVIEVGVDVPNSSLMIIENPERLGLA
FT                   QLHQLRGRVGRGAVASHCVLLYKAPLSKTAQMRLQVLRDSNDGFVIAQKDLEIRGPGEL
FT                   LGTRQTGNAEFKVADLLRDQAMIPEVQRLARHIHERYPEQAAALIERWMPETERYSNA"
FT   gene            complement(111264..111884)
FT                   /locus_tag="ECL_00109"
FT   CDS_pept        complement(111264..111884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00109"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59677"
FT                   /db_xref="GOA:A0A0H3CGJ1"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR022724"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGJ1"
FT                   /protein_id="ADF59677.1"
FT                   /translation="MEQVHKPHNVSAIVRTADAVGVHEVHAVWPGARMRTMASTAAGSN
FT                   SWVSVKTHQTIGEAVSHLKGRGMQILATNLSAKAVDFREIDYTRPTCILMGQEKTGITQ
FT                   EALDLADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMYERSNSMLPEDEQQRL
FT                   LFEGGYPVLARVAKQKKLPYPHVNAQGEIEADAGWWATMQYAG"
FT   gene            111861..111977
FT                   /locus_tag="ECL_00110"
FT   CDS_pept        111861..111977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCZ4"
FT                   /protein_id="ADF59678.1"
FT                   /translation="MRFMDLLHADRQIRLTPGEHFADTCITLCIHKTSFGFG"
FT   gene            complement(111958..114072)
FT                   /locus_tag="ECL_00111"
FT   CDS_pept        complement(111958..114072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59679"
FT                   /db_xref="GOA:A0A0H3CDM6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDM6"
FT                   /protein_id="ADF59679.1"
FT                   /translation="MYLFESLNQLIQTYLPEDQIKRLQQAYLVARDAHEGQTRSSGEPY
FT                   ITHPVAVACILAEMKLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSKLD
FT                   KLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIARETL
FT                   EIYSPLAHRLGIHHIKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILSEIEG
FT                   RLQEAGIPCRVSGREKHLYSIYCKMVLKEQRFHSIMDIYAFRVIVHDADTCYRVLGQMH
FT                   SLYKPRPGRMKDYIAIPKANGYQSLHTSMIGPHGVPVEVQIRTEDMDQMAEMGVAAHWA
FT                   YKEHGGESSTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVFTPEGRIV
FT                   ELPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQPLASGQTVEIITAPGARPNAAW
FT                   LNFVVSSKARAKIRQLLKNLKRDDSVSLGRRLLNHALGGSRKLAEIPPEHIQRELDRMK
FT                   LTSLDDLLAEIGLGNAMSVVVAKNLQQGEAIPSAPGASGHAHLPIKGADGVLITFAKCC
FT                   RPIPGDPIIAHVSPGKGLVIHHESCRNIRGYQKEAEKFMAVEWDKETAQEFITEIKVDM
FT                   FNHQGALANLTAAINTASSNIQSLNTEEKDGRVYSAFIRLTARDRVHLANIMRKIRVMP
FT                   DVIKVTRNRN"
FT   gene            complement(114092..114367)
FT                   /locus_tag="ECL_00112"
FT   CDS_pept        complement(114092..114367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00112"
FT                   /product="DNA-directed RNA polymerase subunit omega"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59680"
FT                   /db_xref="GOA:A0A0H3CEJ0"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEJ0"
FT                   /protein_id="ADF59680.1"
FT                   /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDK
FT                   TTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR"
FT   gene            complement(114422..115045)
FT                   /locus_tag="ECL_00113"
FT   CDS_pept        complement(114422..115045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00113"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59681"
FT                   /db_xref="GOA:A0A0H3CEW4"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEW4"
FT                   /protein_id="ADF59681.1"
FT                   /translation="MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRKPR
FT                   PGEVHGEHYFFVDHDEFKAMIGRDAFLEHAEVFGNYYGTSRETIEQVLATGVNVFLDID
FT                   WQGAQQIRKKMPDSRSIFILPPSKDELDRRLRGRGQDSEEVIAKRMEQAVAEMSHYAEY
FT                   DYLIVNDDFDAALSDLKTILRAERLRMSRQKQRHDALITKLLAD"
FT   gene            115160..115294
FT                   /locus_tag="ECL_00114"
FT   CDS_pept        115160..115294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59682"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGJ6"
FT                   /protein_id="ADF59682.1"
FT                   /translation="MSFSGFTCVLQQHKFTLDSASQSAMLPLAWFSSPGYTSSNVKEG"
FT   gene            115297..116967
FT                   /gene="ligB"
FT                   /locus_tag="ECL_00115"
FT   CDS_pept        115297..116967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligB"
FT                   /locus_tag="ECL_00115"
FT                   /product="NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59683"
FT                   /db_xref="GOA:A0A0H3CCZ9"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CCZ9"
FT                   /protein_id="ADF59683.1"
FT                   /translation="MWRWISGFMLLWCGSAAAVCPVWSQARAEKEIATLSAQIKRWDDA
FT                   YWQQGISEVNDEVYDQLNGRLKQWQHCFGHASPDAALPALTGRIKHPVAHTGVHKVSSK
FT                   EELGQWMHARRNLWMQPKVDGVAVTLVYRGGTLAQAISRGDGLKGEDWTSQVRLIPSVP
FT                   QHLYGALANSVLQGELFWQRENHIQQQMGGMNARAKVAGAMMRQQDNAFLREVGVFIWA
FT                   WPDGPKEMKTALAELSDAGFTLTARYTLPVEHIEAVEKQRSAWHTAALPFATDGIVVRS
FT                   ADELPGENWLPGEGSWVVAWKYPPVAQVAEVRDIHFTVGRTGKIAVVAGLEPVRLDDKQ
FT                   VQRVSLGSVGRWQRLDIAPGDQIQVSLAGQGIPRFDKVVWRGTDRQKPEPPVPQYHSLS
FT                   CFYASPECMEQFFARLTWLSSKQGLDIAGLGESGWRALWQAHRFEHIFSWLLLTQAQLQ
FT                   TTPGFSAARGLALWHQFNLVRERPFIRWIMAMGVPLAQATLKAAGELSWQTMHQRSAMD
FT                   WQTLPGTGEEKARQIVNWLHAPEVDVLAKWLAEQHIKGF"
FT   gene            complement(116970..117587)
FT                   /locus_tag="ECL_00116"
FT   CDS_pept        complement(116970..117587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59684"
FT                   /db_xref="GOA:A0A0H3CDM9"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDM9"
FT                   /protein_id="ADF59684.1"
FT                   /translation="MLLHTLYLIGITAEAMTGALAAGRRRMDTFGVIIIATATALGGGS
FT                   VRDILLGHYPLGWVKNPEYVIIVATAAVVTTIVAPVMTHLRRLFLVLDALGLIVFSIIG
FT                   AQIALDMGEGPVIATIAAVVTGVFGGVLRDMFCKRIPLVFQKELYAGISFAAAVLYIAL
FT                   QHYVSNHDVVVISTLLFGFTARMLALRLKLGLPVFHYKHSAH"
FT   gene            complement(117793..118656)
FT                   /locus_tag="ECL_00117"
FT   CDS_pept        complement(117793..118656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59685"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEJ5"
FT                   /protein_id="ADF59685.1"
FT                   /translation="MIRSMTAYARREIKGSWGSATWEMRSVNQRYLETYFRMPEQFRSL
FT                   EPVVRERIRTRLTRGKVECNLRFEPDASAQGELILNEKLAKQLVNAANWVKMQSDEGEI
FT                   NPVDILRWPGVMAAGEQDLDAIAAEILAALDSTLDDFIVARETEGQALKAMIEQRLEGV
FT                   SAEVAKVRTHMPEVLQWQRERLVAKLEEAEVQLENNRLEQELVLMAQRVDVAEELDRLE
FT                   AHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINADVTNSAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            118782..119498
FT                   /locus_tag="ECL_00118"
FT   CDS_pept        118782..119498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00118"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59686"
FT                   /db_xref="GOA:A0A0H3CEW9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEW9"
FT                   /protein_id="ADF59686.1"
FT                   /translation="MRPAGRSANQVRPVTLTRNYTKHAEGSVLVEFGDTKVLCTASIEE
FT                   GVPRFLKGQGQGWITAEYGMLPRATHTRNAREAAKGKQGGRTMEIQRLIARALRAAVDL
FT                   KTLGEFTITLDCDVIQADGGTRTASITGACVALADALNKLVAAGKLKTNPMKGMVAAVS
FT                   VGIVNGEALCDLEYVEDSAAETDMNVVMTEDGRIIEVQGTAEGEPFTHEELLTLLALAR
FT                   GGIESIVTTQKAALEN"
FT   gene            119566..120207
FT                   /locus_tag="ECL_00119"
FT   CDS_pept        119566..120207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00119"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59687"
FT                   /db_xref="GOA:A0A0H3CGJ9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGJ9"
FT                   /protein_id="ADF59687.1"
FT                   /translation="MKPYQRQFIEFALNKQVLKFGEFTLKSGRKSPYFFNAGLFNTGRD
FT                   LALLGRFYAEALVDSGIDFDLLFGPAYKGIPIATTTAVALAEHHDRDVPYCFNRKEAKT
FT                   HGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIIQANGATLAGVLISLDRQERGRGE
FT                   ISAIQEVERDYSCKVTSIINLKDLIAYLEEKPEMADHLAAVRAYREEFGV"
FT   gene            complement(120291..120887)
FT                   /locus_tag="ECL_00120"
FT   CDS_pept        complement(120291..120887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59688"
FT                   /db_xref="GOA:A0A0H3CD05"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD05"
FT                   /protein_id="ADF59688.1"
FT                   /translation="MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVQLILGFGERNPG
FT                   LTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKKMREGEGYSTDETLLASQIL
FT                   AFCEGMLSRFVRSEFKYSPTDDFDARWPLVAAQLQ"
FT   gene            complement(121008..121463)
FT                   /locus_tag="ECL_00121"
FT   CDS_pept        complement(121008..121463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00121"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59689"
FT                   /db_xref="GOA:A0A0H3CDN4"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDN4"
FT                   /protein_id="ADF59689.1"
FT                   /translation="MKKIDVKILDPRVGEQFPLPTYATSGSAGLDLRACLDDAVELAPG
FT                   ATTLIPTGLAIHIADPSLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNRG
FT                   QDSFTIEPGERIAQMVFVPVVQAEFNLVADFDATDRGEGGFGHSGRK"
FT   gene            complement(121444..122658)
FT                   /locus_tag="ECL_00122"
FT   CDS_pept        complement(121444..122658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00122"
FT                   /product="bifunctional phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59690"
FT                   /db_xref="GOA:A0A0H3CEK0"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEK0"
FT                   /protein_id="ADF59690.1"
FT                   /translation="MMSLAGKKIVLGVSGGIAAYKTPELVRRLRERGADVRVAITEGGK
FT                   AFITPLSLQAVSGYPVSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAGMA
FT                   NDLVSTICLATPAPVAVVPAMNQQMYRNAATQHNLQTLTSRGLLIWGPDSGSQACGDVG
FT                   PGRMLDPLTIVDMAAAHFSPVNDLQHLNIMITAGPTREPLDPVRYITNHSSGKMGFAIA
FT                   AAAAKRGANVTLVSGPVSLPTPPFVQRIDVTTALEMEAAVQARAQNQQIFIGCAAVADY
FT                   RAETISDAKIKKQGDELTLKMVKNPDIVAGVAALKTHRPYVVGFAAETNNVEEYARQKR
FT                   TRKNLDLICANDVSLATQGFNSDSNALHLFWQDGDKILPLERKELLGQQLLDEIVTRYD
FT                   EKNRR"
FT   gene            122828..123496
FT                   /gene="radC"
FT                   /locus_tag="ECL_00123"
FT   CDS_pept        122828..123496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="ECL_00123"
FT                   /product="DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59691"
FT                   /db_xref="GOA:A0A0H3CEX5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEX5"
FT                   /protein_id="ADF59691.1"
FT                   /translation="MEDEDELLLPREKLLRYGVTLLKDEELLALFLRTGTPGKTVFTLA
FT                   KDLIGHFGSLYGLMTAELAEFAHVEGIGVAKYAQLKGIAELARRFQCVRMQEEDPILTP
FT                   AMTREFLQSQLTDIEREIFMVIFLDNRNRVLKHSHLFSGTLSHVEVHPREIVREAIKLN
FT                   AAGVILAHNHPSGCAEPSRADKEITDRIVKCCQFMDIRVLDHLIIGRGEYLSFAEHGWI
FT                   "
FT   gene            123750..123950
FT                   /locus_tag="ECL_00124"
FT   CDS_pept        123750..123950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00124"
FT                   /product="ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59692"
FT                   /db_xref="GOA:A0A0H3CGK5"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGK5"
FT                   /protein_id="ADF59692.1"
FT                   /translation="MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGMR
FT                   VIDKKGIDTVLSELRARGEKY"
FT   gene            123973..124140
FT                   /locus_tag="ECL_00125"
FT   CDS_pept        123973..124140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00125"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59693"
FT                   /db_xref="GOA:A0A0H3CD09"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD09"
FT                   /protein_id="ADF59693.1"
FT                   /translation="MAKGIREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVRQ
FT                   HVMYKEAKIK"
FT   gene            124215..125024
FT                   /locus_tag="ECL_00126"
FT   CDS_pept        124215..125024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00126"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59694"
FT                   /db_xref="GOA:A0A0H3CDN7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDN7"
FT                   /protein_id="ADF59694.1"
FT                   /translation="MPELPEVETSRRGIEPHLVGATILHATVRNGRLRWPVSDEIHALS
FT                   DKPILSVQRRAKYLLLELPDGWIIIHLGMSGSLRILTEELPAEKHDHVDLVMSNGKVLR
FT                   YTDPRRFGAWLWTKELEGHSVLAHLGPEPLSEAFNAEYLKAKCAKKKTPIKPWLMDNKL
FT                   VVGVGNIYASESLFAAGIHPDRLASSLSAQECELLVRVIKAVLLRSIEQGGTTLKDFLQ
FT                   SDGKPGYFAQELQVYGRKGEPCRVCGTPIIATKHAQRATFYCRQCQK"
FT   gene            complement(125027..125506)
FT                   /locus_tag="ECL_00127"
FT   CDS_pept        complement(125027..125506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00127"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59695"
FT                   /db_xref="GOA:A0A0H3CEK3"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEK3"
FT                   /protein_id="ADF59695.1"
FT                   /translation="MSTKAIYPGTFDPITNGHLDIITRAACMFDKVILAIAASPSKKPM
FT                   FDLNERVALATEAIAHLPNVEVVGFSDLMANFARAQQATILIRGLRAVADFEYEMQLAH
FT                   MNRHLMPELESVFLMPSKEWSFISSTLVKEVARHHGDVTHFLPVNVHQALMDKLK"
FT   gene            complement(125510..126280)
FT                   /locus_tag="ECL_00128"
FT   CDS_pept        complement(125510..126280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00128"
FT                   /product="glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59696"
FT                   /db_xref="GOA:A0A0H3CEX9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEX9"
FT                   /protein_id="ADF59696.1"
FT                   /translation="MSTRLSVVLIAKNAADLTPDCLASVAWADEIILLDSGSEDNTADV
FT                   ARAAGAKVYTNTDWQGYGIQRQRAQGYATGDYVLMLDTDERITPELRQAIQAVLAAPTP
FT                   GTVYSIARRNYFLGRFMRHSGWYPDRVTRLYERERYQYNDNLVHESLACDSAPVVPLTG
FT                   DLLHLTCRDFASFQRKQLNYATAWAQERHQRGKKATLTGIFTHTLGAFLKTLLLRGGVL
FT                   DGKQGWLLAVVNAQYTFNKYTELWALSRGYSEKT"
FT   gene            complement(126280..127554)
FT                   /locus_tag="ECL_00129"
FT   CDS_pept        complement(126280..127554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00129"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59697"
FT                   /db_xref="GOA:A0A0H3CGL2"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGL2"
FT                   /protein_id="ADF59697.1"
FT                   /translation="MELLYTALLYIIQPLVWLRLLLRSRKAPAYRKRWAERYGFCRNKV
FT                   APDGILLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVMSAFGKDVHHVY
FT                   LPYDLPCAMNRFLETVRPKLVIVMETELWPNMISALHARKIPLVIANARLSERSAKGYG
FT                   KLGKFMRRLLSKITLIAAQNEEDAARFISLGLKRNQLAVTGSLKFDISVTPELAARAIT
FT                   LRRQWAPRRQVWIATSTHDGEEAIILQAHRKLLEKFPDLLLILVPRHPERFKDAREMVQ
FT                   KGGFSFTLRSSGEIPSTSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHNPLEPAA
FT                   HAIPVLMGPHTFNFKDICAKLQQAEGLITVTDADSVVKEVSTLLTDEDYRLWYGRHAVE
FT                   VLHQNQGALTRLLQLLQPYLPQRSH"
FT   gene            complement(127621..128610)
FT                   /locus_tag="ECL_00130"
FT   CDS_pept        complement(127621..128610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00130"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59698"
FT                   /db_xref="GOA:A0A0H3CD13"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD13"
FT                   /protein_id="ADF59698.1"
FT                   /translation="MQNSAPLLSVVVAVYNGEAFLDQFFTCLVDQRIDSMEVIIVNDGS
FT                   TDRSMQIVENWREKLPQMQVIEQQNQGVSIARNTGLAVATGQYLSFPDIDDVFKPGMYQ
FT                   HLLDMAVTQRLDVATCNGNYVWENNKKPSRPIFPEDKLASTGVMSGPAWLKMALDSRKF
FT                   LHVTWLNIYRHDFIREHGFHFEPGLRHQDIPWTTEVLLAAERVQYTSERYYDYYIHSAS
FT                   VSHMPDNDDTLIRSARHYMKILQMLDAINQRYPDKVKGIPACHWQIAKEGLGIIHTFDN
FT                   MKDEQKKAFIIKEFFDKGIWKLIWKNAKSPRLRWRLGRRYFRLKRYVA"
FT   gene            complement(128622..129710)
FT                   /locus_tag="ECL_00131"
FT   CDS_pept        complement(128622..129710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00131"
FT                   /product="putative lipopolysaccharide glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59699"
FT                   /db_xref="GOA:A0A0H3CDP1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDP1"
FT                   /protein_id="ADF59699.1"
FT                   /translation="MIIDGLPGGGAEKTVLTLSSGLTEMGHQVSLFSLRKVCDYAIPEG
FT                   IDYQVVQDTCKKPWRKLTEIPRRARLLDQAIERAERSGKFDVVFSHLHKTDRIVAHCRA
FT                   LERDKVWFCVHGMFSFSYLRHRRGLSRWFKHTKIRHTYEKRNVVAVSGAVLKDLSETLA
FT                   LNLRRTAVIHNPFDIPEIQRLADAPFEMQGKDYIIHVGRFHEHKRHDRLLRAFALSQLN
FT                   TTLVMMGNGSEAKIQKLKLLARELGIEDKTVFRPFEPNPYPWIKGARLLVLSSDCEGFG
FT                   NVLVESIICQTPPVSTHCPGGPAEILKGDLSRGLAEMNDESLAKTLADIYTSPPVVDRA
FT                   TIASFGIKAICQQYIALVDNQK"
FT   gene            complement(129725..130852)
FT                   /locus_tag="ECL_00132"
FT   CDS_pept        complement(129725..130852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00132"
FT                   /product="glycosyltransferase family 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59700"
FT                   /db_xref="GOA:A0A0H3CEK8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEK8"
FT                   /protein_id="ADF59700.1"
FT                   /translation="MKHHRLAIVRQKYRPDGGAERFVSRALTALSNQNLELNVITREWQ
FT                   GEKQDDWHIHICDPRKWGRISRERGFAHAARALWQQQQFDIVQSHERIPGCDIYRAGDG
FT                   VHRRWLLQRARILPAWRAKLLMHDRYHRYVMNAEREMYQAPELKAVICNAEMIKREIVE
FT                   DFDIDAKKIHVIYNSIDSTRFVPAEEAQRIALRQQFGLPTDAVIFCFVGSGFERKGLAS
FT                   AIRAVAGTAAWLIVVGQDKAERRYRDLARSLGCEGQIRFLGMQKETLPFYQLSDGLLLP
FT                   TLYDPFPNVILEAMACGLPVITSESCGGAEFIQQGQNGFYCDALDISTLKEAVAATPSL
FT                   EKNNDMGRAARERVKDATPEKLSSQLISLYQKLLD"
FT   gene            complement(130849..131919)
FT                   /locus_tag="ECL_00133"
FT   CDS_pept        complement(130849..131919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00133"
FT                   /product="putative lipopolysaccharide heptosyltransferase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59701"
FT                   /db_xref="GOA:A0A0H3CEY4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEY4"
FT                   /protein_id="ADF59701.1"
FT                   /translation="MMMNNLPDTPDLRILLIKLRHHGDMLLTTPVIDSLRQKWPQAQID
FT                   VLLYEETRDMLAAHPAIGTVYGIDRKWKQLGTLKHLQKEWQLLCALRKQHYHLVINLAD
FT                   QWRSAIVTRFTGAPVRLGFAFNKRNNAFWRFCHSDLVSVAGHNALHTVEQNLSILSPLP
FT                   VTAQPAVTMAYHAEDWHEAHQKLMQNGVGDNYIVIQPTSRWFFKCWDEGKMAQTITALQ
FT                   QDGHTVVLTAGPDKKELAMIDRILAASPETGVVSLAGQLTLRQLASLIDHASLFIGVDS
FT                   VPMHMAAALQTPCVALFGPSKLTFWSPWQVNGEVIWAGDYGPLPDPDAIDTKTKERYLD
FT                   AIPVDAVVSAARRYLS"
FT   gene            132070..133026
FT                   /locus_tag="ECL_00134"
FT   CDS_pept        132070..133026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00134"
FT                   /product="lipopolysaccharide biosynthesis protein WalW"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59702"
FT                   /db_xref="GOA:A0A0H3CGL7"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGL7"
FT                   /protein_id="ADF59702.1"
FT                   /translation="MKKPAFIITIDTEGDNLWQNHRVIKTENARYLARFQTLCERFGFK
FT                   PVWLTNYEMAIEPVFIEFAKDVIARGQGEVGMHLHAWNSPPEHDLTGDDWRWQPYLIEF
FT                   SDEVMREKVLFMTRLLEETFQTKMLSHRAGRWAFDSRYARLLIELGYQVDCSVTPRVNW
FT                   RNAKGAPQGNGGTNYQHFPDHAYFIDTDDISRAGNSPLLEVPMSIQYKHPAWLNTVKQG
FT                   YDRLRGKYRSPSVNWLRPSGGNASQMIQVAQQCLSQGHDYVEFMLHSSEFMPGGSPTFK
FT                   DEAAIEGLYQDLEVLFSWLSDKTVGMTLAEFYQYKKN"
FT   gene            complement(133050..134261)
FT                   /locus_tag="ECL_00135"
FT   CDS_pept        complement(133050..134261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59703"
FT                   /db_xref="GOA:A0A0H3CD16"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD16"
FT                   /protein_id="ADF59703.1"
FT                   /translation="MEKVKLRLYQLTLTLSLVSLALVLVSSGKQREFFYIAIYASILGL
FT                   AVEYKKITWRPFSIAYPVLLVGILNLIWYFSYEFHNEGLNAYSDYLGASKKLILASFLI
FT                   FYLDRFKSHVTKQNFQKYFLIATSVGFVLATGYGLFQAIQGIDRVEMAINRPTIAAYIY
FT                   SVLSLAFVYSLYLQQNVKLYLLAGFVVLLSYFVILLTATRAAMGLYLILAIVLTLYQFR
FT                   KIHLKSLMIFLCIVAGIIIVSYKPLISPKIQQTQNEITKYQKGHDATSLGARFSMWNVG
FT                   IMTGLAHPLGQSIESREIWAKQYVKEGHAHVAAALGYMRIHLHNEFIEKYSLQGIPGLA
FT                   VLLFFYVSMIVYAMTNRNGLLLTAMLLLLLYGLTDVMLLSSEALIFFMTLFALSTSFSQ
FT                   TKRQ"
FT   gene            complement(134249..135157)
FT                   /locus_tag="ECL_00136"
FT   CDS_pept        complement(134249..135157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59704"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDP6"
FT                   /protein_id="ADF59704.1"
FT                   /translation="MAFLSIIIAAHNAEDTLHTTLESLHNAIDNAGDDVEVIIFNDSSD
FT                   DSTQDIIETWLPAFPNVHSRHVQFRNVGLVRNSAFSLASGDYITMLDSDDRLKPGSIRD
FT                   AVAFLKTERPDMLLTRLLEIRDIKKITPNWQGFSPVALSQREAIKRFLLHKDFQAHLIG
FT                   QFIHRKLYESNPIPSMVCYEDFAVFPGMLMQSSKIAYQRRGHYYYIKRSDSLSSKLDAS
FT                   KIKTLVECTLLMEKTFQQPFQHLINCHWFDIYSNHRQHLTDQHFQLVKQRVKALYSLSF
FT                   FLSSDVRFSYKKRVIEALWKK"
FT   gene            complement(135163..136272)
FT                   /locus_tag="ECL_00137"
FT   CDS_pept        complement(135163..136272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59705"
FT                   /db_xref="GOA:A0A0H3CEL4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEL4"
FT                   /protein_id="ADF59705.1"
FT                   /translation="MSYVFLLILLLPVKLIRKLFRKDTGKNLVIQTAKIGDFVNATPLL
FT                   AYLQKSDVLISRSVGALAKHDETIEEIFFIEQHKRSLWRKLSFACRIMNRYDNVYLLQP
FT                   NSVNLFFAAVCNAKNKQFLSIYTRRWYHGIFYLTADGTVEHGKKTLSVTNYLKLADRSL
FT                   TWQDSPKHATKPLFKPATYPAILDKPDVIRIGISIAAGNKAKTVPPVIWKRIIDRLADL
FT                   PCEFYVFGAPDEQSWLDDITRAYGDIPNVVNLIGKIPLEDLPWAISRMDCYIASDSGNV
FT                   YIADAVDVPVVLLFGPCCHYEQRPLGNVMLIGNDDNICSYVFETKYYFSQDREELFAVT
FT                   DESLNELERFICALPKATATPYTFDALGN"
FT   gene            complement(136276..137259)
FT                   /locus_tag="ECL_00138"
FT   CDS_pept        complement(136276..137259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00138"
FT                   /product="ADP-heptose:LPS heptosyl transferase I"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59706"
FT                   /db_xref="GOA:A0A0H3CEY8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEY8"
FT                   /protein_id="ADF59706.1"
FT                   /translation="MRVLIVKTSSMGDVLHTLPSLTDAMRAIPGIRFDWVVEEGFAQIP
FT                   TWHEAVDRVIPVAIRRWRKAWFSTPIKAERKAFRDAVQAQRYDSIIDAQGLVKSAALVT
FT                   RLAHGVKHGMDWQTAREPLASLFYNRRHHIAKQQHAVERTRELFAKSLGYTKPETQGDY
FT                   AISQHFLRDAEKPAQPWLVFLHATTRDDKHWPETHWRRLIELMQPAGIHIKLPWGAEHE
FT                   RQRAERLAAGFSHVEVLPKLTLAQVAAELAGAKAVVSVDTGLSHLTAALDRPNITIFGP
FT                   TDPGLIGGYGKNQHQMVSPTQQTRDISADAIFSFLQDSHWLSDRDI"
FT   gene            complement(137263..138309)
FT                   /locus_tag="ECL_00139"
FT   CDS_pept        complement(137263..138309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00139"
FT                   /product="ADP-heptose:LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59707"
FT                   /db_xref="GOA:A0A0H3CGM2"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGM2"
FT                   /protein_id="ADF59707.1"
FT                   /translation="MRILVIGPSWVGDMMMSQSLYRTLKARYPQAIIDVMAPAWCRPLL
FT                   SRMPEVNEAIPMPLGHGALEIGERRKLGHSLREKRYDRAYVLPNSFKSALVPFFAGVPH
FT                   RTGWRGEMRYGLLNDARVLDKEAWPLMVERYVALAYDKGVMRSAKDLPQPLLWPQLQVS
FT                   EGEKSQTCNAFGLSSERPMIGFCPGAEFGPAKRWPHYHYAELAKQLIDEGYQIVLFGSA
FT                   KDHEAGNEILAALSTEQQAWCRNLAGETQLEQAVILLAACKAVVTNDSGLMHVAAALNR
FT                   PLVALYGPSSPDFTPPLSNKARVIRLITGYHKVRKGDAAQGYHQSLIDITPQRVLEELN
FT                   ELLLSEEG"
FT   gene            complement(138312..139244)
FT                   /locus_tag="ECL_00140"
FT   CDS_pept        complement(138312..139244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00140"
FT                   /product="ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59708"
FT                   /db_xref="GOA:A0A0H3CD21"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD21"
FT                   /protein_id="ADF59708.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVDL
FT                   NIADYMDKEDFLIQIMAGEEFGEIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLHYC
FT                   LEREIPFLYASSAATYGGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQVLPEANSQIV
FT                   GFRYFNVYGPREGHKGSMASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVAAVNL
FT                   WFWENGVSGIFNLGTGRAESFQAVADATLAYHKKGSIEYIPFPDKLKGRYQAFTQADLT
FT                   NLRAAGYDKPFKTVAEGVTEYMAWLNRDA"
FT   gene            139460..140656
FT                   /locus_tag="ECL_00141"
FT   CDS_pept        139460..140656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00141"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59709"
FT                   /db_xref="GOA:A0A0H3CDP9"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDP9"
FT                   /protein_id="ADF59709.1"
FT                   /translation="MRGDFYKQLNSDLETARAEGLFKEERIITSAQQADITVADGSHVI
FT                   NFCANNYLGLANHPELIAAAKSGMDTHGFGMASVRFICGTQDSHKQLEKKLANFLGMED
FT                   AILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMVELEA
FT                   RLKEAREAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENG
FT                   RGSHEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAI
FT                   VAASIKVLEMVESGAELRDRLWSNARLFREKMSAAGFTLAGADHAIIPVMLGDAVVAQN
FT                   FARELQKEGIYVTGFFFPVVPKGQARIRTQMSAAHSPEQIERAVEAFTRIGKQLGVIA"
FT   gene            140666..141694
FT                   /locus_tag="ECL_00142"
FT   CDS_pept        140666..141694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00142"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59710"
FT                   /db_xref="GOA:A0A0H3CEM0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEM0"
FT                   /protein_id="ADF59710.1"
FT                   /translation="MKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHIY
FT                   NWDQWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFNIGDRVSGEGHITCGHCRNCRGGRT
FT                   HLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGIMAAAVAKHVGARNVVITDVNEYRLSLARKMGVTRAVDVSKESLAD
FT                   VMEELGMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWNKVIFKGL
FT                   FIKGIYGREMFETWYKMAALIQSGLDLSPIITHRFSVDDFQKGFDAMRSGQSGKVILSW
FT                   DK"
FT   gene            complement(141723..142382)
FT                   /locus_tag="ECL_00143"
FT   CDS_pept        complement(141723..142382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59711"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEZ3"
FT                   /protein_id="ADF59711.1"
FT                   /translation="MTLSLPVREENYRYKQIYLSRLMKLNAPLQARGEGVLMIDSDLNL
FT                   LKMPEIKIADMHLYSSFRQGKMIAKLDGAPVEKVPAYYKDMVRPYLVDHVNSAFLAATK
FT                   KTWRRICPLWLALFQDTWELMDDSQPPTDQLPLTALLDMLDLKTVNLGDWVNWPVSKKI
FT                   GGQEAVIPKEVIGAHGGFPLSEWQKYIKSADNKLLFKGQDYTRKVRYLTDEEKKNQ"
FT   gene            complement(142501..143316)
FT                   /locus_tag="ECL_00144"
FT   CDS_pept        complement(142501..143316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00144"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59712"
FT                   /db_xref="GOA:A0A0H3CGM7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGM7"
FT                   /protein_id="ADF59712.1"
FT                   /translation="MSRAQLSLRINRSADWQDRRCNRRNEEADAEILSAILNIISDMPS
FT                   YGYRRVWGILRKQRRTEGQPPVNAKRLYRIMSEHNLLLLHHKPERPKREHKGKIAVAES
FT                   DMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAASTGGYDSSTVQDVMLRSVEKRF
FT                   GDRLPDTAVQWLTDNGSAYTAHETRRFAKELNLEPCTTAVSSPQSNGMAERFVKTMKED
FT                   YIAFMPKPDVRTALRNLAAAFTHYNENHPHSALGYHSPREYRRQRASLT"
FT   gene            complement(143341..143736)
FT                   /locus_tag="ECL_00145"
FT   CDS_pept        complement(143341..143736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59713"
FT                   /db_xref="GOA:A0A0H3CNJ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CNJ0"
FT                   /protein_id="ADF59713.1"
FT                   /translation="MSNTNTNFEMTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSHV
FT                   ARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEV
FT                   EILKEAVEYGQSRKWIAHAPLLPKDGE"
FT   gene            complement(143798..143989)
FT                   /locus_tag="ECL_00146"
FT   CDS_pept        complement(143798..143989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDQ4"
FT                   /protein_id="ADF59714.1"
FT                   /translation="MFKFLNTRYRHITGRHNIPYSSLHLTGELATVDSIVIPCTGADFV
FT                   EEALLSATFAERYATGIS"
FT   gene            complement(144005..145222)
FT                   /locus_tag="ECL_00147"
FT   CDS_pept        complement(144005..145222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00147"
FT                   /product="glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59715"
FT                   /db_xref="GOA:A0A0H3CEM5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEM5"
FT                   /protein_id="ADF59715.1"
FT                   /translation="MDSDMPQKRKILLLDTGKEWGGGTNSMLELLKRIDRDKFDITCCF
FT                   YNDYSRAGGQTIGQVLNSIGIPLIVIPQHKQPAWAKLLKEAGRGLLFFSRNARKAFTRH
FT                   VDTLWRIRPNVSKIETLFSHGGFDTLYMNNQPGSNEEGYLAAAKLQARLIQHCRIEPVL
FT                   SPPLVKLVNAHATKIIAVSHGVEQVLLQHGIRPDLCTTVNNAIDIYQPLPDRRAMRQRL
FT                   GIDDETFVFGSIGSLIPRKANHHTLEALAQFSLKHPEAKWKMVLVGEGPERDALAAQAQ
FT                   NLGIASHVIFTGFQNTPFDYLATFDAFILASKSEGLPRVVLEAMLLNIPVIGSQVTGTA
FT                   ELIDHASTGLLFPWSDVSQLAQHLDSIWTDADLRARLATAARQNVCRNYAIEKYVSGVE
FT                   AVLGAQ"
FT   gene            complement(145398..145514)
FT                   /locus_tag="ECL_00148"
FT   CDS_pept        complement(145398..145514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59716"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEZ9"
FT                   /protein_id="ADF59716.1"
FT                   /translation="MTISSAIFKRGGITSRNNLSELKVNKQTVILNIFPLTQ"
FT   gene            146023..146217
FT                   /locus_tag="ECL_00149"
FT   CDS_pept        146023..146217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59717"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGN2"
FT                   /protein_id="ADF59717.1"
FT                   /translation="MISAIGAFFKWYLFSGAWRQGRVGAATGLYATAYSFLKYFKAWYQ
FT                   YQERKEPVTKEHTDSHITE"
FT   gene            complement(146229..147161)
FT                   /locus_tag="ECL_00150"
FT   CDS_pept        complement(146229..147161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59718"
FT                   /db_xref="GOA:A0A0H3CD30"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD30"
FT                   /protein_id="ADF59718.1"
FT                   /translation="MLQFRRIVLSVASALALVAPVYAGKLAIVIDDFGYRPHYENQVLA
FT                   MPAAISVAVLPNAPHAREMATKAHNSGHQVLIHLPMAPISKQPLEKDTLRPEMSSDEID
FT                   RIIRDAYNKVPYAVGLNNHMGSAMTSSLYGMLKVMQALERYNLYFLDSMTIGNSQAMRA
FT                   AQGTGVKVIKRKVFLDDTQNEADIRVQFNRAVQLARRNGSAIAIGHPHPSTVRVLQQML
FT                   PTLPSDITLVRPSDLLNEPQVDTSTPNQGKPGSSTPRNPFRGVKRCVPKHAPEPVYATR
FT                   FFSVIGESMSQSTLVQYFQHQWQGWGKKA"
FT   gene            complement(147165..148448)
FT                   /locus_tag="ECL_00151"
FT   CDS_pept        complement(147165..148448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59719"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDQ8"
FT                   /protein_id="ADF59719.1"
FT                   /translation="MRGKAIFSITWVVKPLRLSVRPLFYASALSAGVLLCAASAHADDR
FT                   DQLKSIQADIAAKERAVRQQQQQRASLLAQLKQQEEAISAAARELRETQNTLSQLNKQI
FT                   DEMNASIAKLERQRDAQERNLAAQLDAAFRQGEHTGLQLILSGEESQRGQRLQAYFGYL
FT                   NQARQETIAQLKQTREEVTTQKAELEEKQSQQQTLLYEQQAQQAKLEQARNERKKTLSG
FT                   LESSIQAGQSQLSEMRANESKLRNSIARAEAAAKARAEKEAREAQAVRDKQQEASRKGT
FT                   TYKPSESERSLMSRTGGLGSPRGQAYWPVRGTILHRYGEQLQGELRWKGIVIGASEGSE
FT                   VKAIADGRVILADWLQGYGLVVVVEHGKGDMSLYGYNQSALVSVGTQVRAGQPIALVGS
FT                   SGGQGRPSLYFEIRRQGQAVNPQPWLGR"
FT   gene            complement(148458..150002)
FT                   /locus_tag="ECL_00152"
FT   CDS_pept        complement(148458..150002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00152"
FT                   /product="phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59720"
FT                   /db_xref="GOA:A0A0H3CEN0"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEN0"
FT                   /protein_id="ADF59720.1"
FT                   /translation="MSVSKKPMVLVILDGYGYREDQQDNAIFNAKTPVMDALWAKRPHT
FT                   LIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKERTFFANPVLCGAVD
FT                   KAVAAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAK
FT                   GSLEAFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEQAYDLMTLAKGEFQFATAVEG
FT                   LEAAYARDENDEFVKATVIRAEGQADAAMEDGDALIFMNFRADRAREITRAFVNSDFDG
FT                   FARKKAVNINFIQLTEYAADIDAPCAYPPASLANTFGEWMAKNDKTQLRISETEKYAHV
FT                   TFFFNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIVSGKYDTIICNY
FT                   PNGDMVGHTGVMEAAIKAVEALDHCVEQVAKAVESVGGQLLITADHGNAEQMRDPATGQ
FT                   AHTAHTNLPVPLIYVGDKALKAVEGGKLSDVAPTMLSLMGMPIPEEMTGKPLFIVE"
FT   gene            150251..150682
FT                   /locus_tag="ECL_00153"
FT   CDS_pept        150251..150682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00153"
FT                   /product="rhodanese domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59721"
FT                   /db_xref="GOA:A0A0H3CF04"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF04"
FT                   /protein_id="ADF59721.1"
FT                   /translation="MQEIMQFVSRHPVLSIAWIGLLAAVLFTTFKGLTSKIKVITRGEA
FT                   TRLINKEDAVVVDLRQRDDFRKGHIAGAINLLPAEIKANNVGELEKHKAQPIIVVDGTG
FT                   MQAQESASLLHKAGFENVSVLKEGISGWSGENLPLVRGK"
FT   gene            150694..150945
FT                   /locus_tag="ECL_00154"
FT   CDS_pept        150694..150945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59722"
FT                   /db_xref="GOA:A0A0H3CGN6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGN6"
FT                   /protein_id="ADF59722.1"
FT                   /translation="MANIEIYTKATCPFCHRAKALLNSKGVTFQELPIDGDAIKREEMI
FT                   QRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLS"
FT   gene            150979..151446
FT                   /gene="secB"
FT                   /locus_tag="ECL_00155"
FT   CDS_pept        150979..151446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="ECL_00155"
FT                   /product="preprotein translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59723"
FT                   /db_xref="GOA:A0A0H3CD34"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD34"
FT                   /protein_id="ADF59723.1"
FT                   /translation="MSEQNNTEMTFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDLD
FT                   TASTQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIGGIEGNQMAHCLGAYCPN
FT                   ILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGAEQHQDA"
FT   gene            151446..152465
FT                   /locus_tag="ECL_00156"
FT   CDS_pept        151446..152465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00156"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59724"
FT                   /db_xref="GOA:A0A0H3CDR2"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDR2"
FT                   /protein_id="ADF59724.1"
FT                   /translation="MSTVNASMTVIGAGSYGTALAITLARNGHEVVLWGHDPKHIATLQ
FT                   HDRCNVAFLPDVPFPDSLHLESDLATALAASRNILIVVPSHVFGDVLQQIKPLMRPDAR
FT                   IVWATKGLEAETGRLLQDVAREVLGTEIPLAVISGPTFAKELAAGLPTAISLASTDQAF
FT                   SDDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTALITRG
FT                   LTEMSRLGAALGADPATFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQGMDVKGAQEKIG
FT                   QVVEGYRNTKEVRELAHRFGVEMPITEEIYQVLYCGKNAREAALTLLGRARKDERSSN"
FT   gene            152541..153362
FT                   /locus_tag="ECL_00157"
FT   CDS_pept        152541..153362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00157"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59725"
FT                   /db_xref="GOA:A0A0H3CEN5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEN5"
FT                   /protein_id="ADF59725.1"
FT                   /translation="MPCEELDIVWNNIKAEARALADCEPMLASFYHATLLKHENLGSAL
FT                   SYMLANKLASSIMPAIAIREVVEEAYAADPEMIASAACDIQAVRTRDPAVDKYSTPLLY
FT                   LKGFHALQAYRIGHWLWKEGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHATGIV
FT                   VGETAVIEDDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGAKIGA
FT                   GSVVLQPVPPHTTAAGVPARIVGKPDSDKPSMDMDQHFNGIHHTFEYGDGI"
FT   gene            complement(153359..153832)
FT                   /locus_tag="ECL_00158"
FT   CDS_pept        complement(153359..153832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00158"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59726"
FT                   /db_xref="GOA:A0A0H3CF09"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF09"
FT                   /protein_id="ADF59726.1"
FT                   /translation="MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRLR
FT                   RAGLDYHEFTAVVRHHDYAAFLESEKPERMFALTTKGTPAHSAVSYQAGDYLMFGPETR
FT                   GLPATILDALPAEQKIRIPMMPDSRSMNLSNAVSVVVYEAWRQLGYPGAILRS"
FT   gene            complement(153878..155218)
FT                   /locus_tag="ECL_00159"
FT   CDS_pept        complement(153878..155218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00159"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59727"
FT                   /db_xref="GOA:A0A0H3CGP2"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGP2"
FT                   /protein_id="ADF59727.1"
FT                   /translation="MAYSGKVDIQQVIDDSSFSWFHWLLIVLGFLVLAIDGFDTAAMGY
FT                   IAPTLSAEWGIHKQDLGPVLSAALLGLSLGALIAGPVSDRMGRKRVLVFSCLFFGLASL
FT                   GAAWAQTLNTLTLWRFLTGLGLGAAMPNAITLISEFAPKRCRAMAINTMYCGFPLGAAG
FT                   GGAISSWLIPHHGWRSVLLTGAIAPLILTLLLALFLPESVKFLVQRGRDMMQIRRIASR
FT                   FARDTLDGVTGFFLAEERVASKKGSVAQLFSMPWLPGTLMLWVTYFMGLVIYYVLLSWM
FT                   PTLMLGMGYPLAESAWLTSLFTFGGTAGILLAGWMMDRWEAHRVVAGGFMLTMALILLL
FT                   GMEHNHIALFGGLIFLMGIAMNGAQSGMQTLAATFYPTECRATGIAWMQGIGRFGGVAG
FT                   TMTSAQLLSMQWQADSILMILSLPALVAAGATVYKMLRCRPQEPGVA"
FT   gene            complement(155400..156587)
FT                   /locus_tag="ECL_00160"
FT   CDS_pept        complement(155400..156587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00160"
FT                   /product="L-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59728"
FT                   /db_xref="GOA:A0A0H3CD38"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD38"
FT                   /protein_id="ADF59728.1"
FT                   /translation="MIISAASDYRAAAQRILPPFLFHYIDGGAYAEYTLRRNVEDLSEV
FT                   ALRQRVLKNMSDLSLETKLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIPFT
FT                   LSTVSVCPIEEVAPTIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPTPGA
FT                   RYRDAHSGMSGPNAAMRRYWQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLEDYIG
FT                   WLANNFDPSISWKDLEWIREFWDGPMVIKGILDPDDARDAVRFGADGIVVSNHGGRQLD
FT                   GVLSSARALPAIADAVKGDIAILADSGIRNGLDVVRMIALGADSVLLGRAYLYALATSG
FT                   QAGVANLLNLIEKEMKVAMTLTGAKTIGEISKDSLVQELSKIPAALAPLTHGDAA"
FT   gene            complement(156584..157348)
FT                   /locus_tag="ECL_00161"
FT   CDS_pept        complement(156584..157348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00161"
FT                   /product="DNA-binding transcriptional repressor LldR"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59729"
FT                   /db_xref="GOA:A0A0H3CDR7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDR7"
FT                   /protein_id="ADF59729.1"
FT                   /translation="MPRRLSDEIASRVRALIEEQQLEAGMKLPAERQLAAQLGVSRNSL
FT                   REALATLVSEGVLVSRRGGGTFVRWQHDDWSEQNIVQPLKTLMENDPDYSFDILEARHA
FT                   IETSTAWHAAMRATEADKEKLRACFDATQSSDPDIASQADVRFHLAIAEASHNVVLLQT
FT                   MRGFFDLLQSSVKQSRQRMYLVPPVFAQLTEQHEAVLNAILAGDAEAARKAMMAHLGFV
FT                   HTTIKRFDEDQARQARITRLPGDSDISRENKA"
FT   gene            complement(157354..159009)
FT                   /locus_tag="ECL_00162"
FT   CDS_pept        complement(157354..159009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00162"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59730"
FT                   /db_xref="GOA:A0A0H3CEP2"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEP2"
FT                   /protein_id="ADF59730.1"
FT                   /translation="MSLWQQNYDPAGNIWLSSLIASLPILFFFFALIKLKLKGYLAATY
FT                   TVAIALLVALFFYKMPIDRALASVVYGFFYGLWPIAWIIIAAVFVYKISVKTGQFDIIR
FT                   SSILSITPDQRLQMLIVGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLCLIV
FT                   NTAPVAFGAMGIPILVAGQVTGLDSFEIGQMVGRQLPFLTIIVLFWIMAIMDGWRGVKE
FT                   TWPAVMVAGGSFAIAQYLSSNFLGPELPDIISSLVSLVCLTLFLKRWQPVRIFRFADMG
FT                   ASHVDQTLARTGYTAGQIVRAWSPFLFLTATVTLWSIPPFKALFAPGGALYDMVINISV
FT                   PFLDKMVARMPPVVHDATPYAAVFKFDWFSATGTAILFAALLSVVWLRMKSAAAVQTFA
FT                   ATIKELMLPIYSIGMVLAFAFISNYSGLSSTLALALAHTGHAFTFFSPFLGWLGVFLTG
FT                   SDTSSNALFAALQATAAQQIGVSDVLLVAANTTGGVTGKMISPQSIAIACAAVGLVGKE
FT                   SDLFRFTVKHSLIFTCMVGVITTLQAYVLTWMIP"
FT   gene            complement(159287..160738)
FT                   /locus_tag="ECL_00163"
FT   CDS_pept        complement(159287..160738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00163"
FT                   /product="putative superfamily I DNA and RNA helicase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59731"
FT                   /db_xref="GOA:A0A0H3CF13"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR021754"
FT                   /db_xref="InterPro:IPR026851"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF13"
FT                   /protein_id="ADF59731.1"
FT                   /translation="MGAGQGVATFSVSQRKAIQDELEILRRLNPQYEDFFNSHPAEPFF
FT                   IKNLENIQGDERDVIMISVGYARNKQGYLAMRFGPLGSQGGERRLNVLISRAKRRCEVF
FT                   ASITDEDIDLERAKGVGVLAFKLFLQYARTGRLSMSTVSGRPMDSVFEEQVASALQKRG
FT                   YQVHPQVGIAGFFIDLAIADPDLPGRYLLGIECDGSAYHSSRSARERDRLRQAVLEDHG
FT                   WIIHRIWSTDWFQRPEEQLQKVIYAIENAKRELNNRAEHTYGRSRAVPVDIVTVEREDV
FT                   VEIGLDRTDSANDQSIIYEEAQPEANLSYALHETPTGILADMVEKIVFTESPIHLNEVI
FT                   TRLRSAWGLQRAGARIESVVSQAAQIACKRGKIYKEQEFFIHKEVAIRIRNRQHVLSAG
FT                   VRKPELIAPIEIASGVFDIVSASLGATEDEIITSVSRMLGFKSTSSLLRKVISEVIEQE
FT                   IKDNRLKQQDGLIVIGDASSAQKAI"
FT   gene            complement(160754..161587)
FT                   /locus_tag="ECL_00164"
FT   CDS_pept        complement(160754..161587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59732"
FT                   /db_xref="GOA:A0A0H3CNX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CNX5"
FT                   /protein_id="ADF59732.1"
FT                   /translation="MMLMCDATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITE
FT                   LALERRRFGYRRIWQLLRREGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRP
FT                   AAPNLTWSMDFVMDALSTGRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALF
FT                   RGYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNE
FT                   HWFSDIVHARKIINDWRQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
FT   gene            complement(161611..161874)
FT                   /locus_tag="ECL_00165"
FT   CDS_pept        complement(161611..161874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00165"
FT                   /product="IS3/IS911 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59733"
FT                   /db_xref="GOA:A0A0H3CRT3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CRT3"
FT                   /protein_id="ADF59733.1"
FT                   /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKYG
FT                   SMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKY"
FT   gene            complement(162035..162235)
FT                   /locus_tag="ECL_00166"
FT   CDS_pept        complement(162035..162235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59734"
FT                   /db_xref="InterPro:IPR021230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDS1"
FT                   /protein_id="ADF59734.1"
FT                   /translation="MKSQKLSKEAQKLMNMPHRRAITKKEQADMGKLKKSVRGLVVVHP
FT                   MTELGREMGLKEMTGFCKTAF"
FT   gene            complement(162260..162397)
FT                   /locus_tag="ECL_00167"
FT   CDS_pept        complement(162260..162397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEP6"
FT                   /protein_id="ADF59735.1"
FT                   /translation="MKEVEKNEIKRLSDRLDLIRHQMAGLSLVDSAEKYAELEKETAKL
FT                   "
FT   gene            complement(162456..163046)
FT                   /locus_tag="ECL_00168"
FT   CDS_pept        complement(162456..163046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00168"
FT                   /product="mannitol repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59736"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF16"
FT                   /protein_id="ADF59736.1"
FT                   /translation="MMHSEAQVILRPDYRLSDMQAIMEQTQAFENRVLERLNAGKTVRS
FT                   FLITAVELLTEAVNILVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVLN
FT                   RQEYEDAELLMALREELNHDGNEYTFTDDEILGPFGELHCVTALPPAPHFDNSDPELYA
FT                   MQKLRYQQVVRSTMVLSLTELISRISLKKAFQK"
FT   gene            complement(163043..164191)
FT                   /locus_tag="ECL_00169"
FT   CDS_pept        complement(163043..164191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00169"
FT                   /product="mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59737"
FT                   /db_xref="GOA:A0A0H3CGQ1"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGQ1"
FT                   /protein_id="ADF59737.1"
FT                   /translation="MKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARHS
FT                   YQVHVVGENEQVETVSGVNAVSSIGDDVIDLIASVDLVTTAVGPVVLERIAPAVAKGLA
FT                   KRKAQGIDTPLNIIACENMVRGTTQLKGHVLAAVADEDKAWVEAHVGFVDSAVDRIVPP
FT                   SESATNDPLEVTVETFSEWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAI
FT                   TAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRF
FT                   ENPYLKDDVERVGRQPLRKLSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHYRSEQDP
FT                   QAQELAQLIDDQGAQAALAQISGLDANSDVVAEAVNAYNATK"
FT   gene            complement(164292..166199)
FT                   /locus_tag="ECL_00170"
FT   CDS_pept        complement(164292..166199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00170"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59738"
FT                   /db_xref="GOA:A0A0H3CD47"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD47"
FT                   /protein_id="ADF59738.1"
FT                   /translation="MSSDFKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLPN
FT                   ETLAKLVGPMITYLLPLLIGYTGGRLVGGDRGGVVGAITTMGVIVGADMPMFLGAMIAG
FT                   PLGGWAIKKFDVWVDGKIKSGFEMLVNNFSAGIIGMILAILAFLGIGPAVEVLSKILAA
FT                   GVNFMVAHDMLPLASIFVEPAKILFLNNAINHGIFSPLGIQQSHDLGKSIFFLIEANPG
FT                   PGMGVLLAYMFFGRGSAKQSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILGGMTGV
FT                   FTLSVLNGGLVSPASPGSILAVLAMTPKGAYFANIAAICAAMAVSFVVASILLKTSKVK
FT                   EDDDIEAATRRMHDMKAESKGATPLSAGDVSNDLSHVRKIIVACDAGMGSSAMGAGVLR
FT                   KKVQDAGLTNISVTNSAINSLPPDVDLVITHRDLTERAMRQVPQAQHISLTNFLDSGLY
FT                   TSLTERLVAAQRHEDNEVKVRTSLQDSFDESNAHLFKLGAENIFLGRTASTKEEAIRFA
FT                   GEQLVKGGYVQPEYVDAMLEREKLTPTYLGESIAVPHGTVEAKDRVLKTGVVFCQYPDG
FT                   VRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAQTESVEEVLALLNK
FT                   "
FT   gene            166545..166673
FT                   /locus_tag="ECL_00171"
FT   CDS_pept        166545..166673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDS4"
FT                   /protein_id="ADF59739.1"
FT                   /translation="MIGGKFCLTNERHDGSGQHAKLKNHFSCVVWRKAKTWITLIM"
FT   gene            166859..167215
FT                   /locus_tag="ECL_00172"
FT   CDS_pept        166859..167215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59740"
FT                   /db_xref="GOA:A0A0H3CEQ1"
FT                   /db_xref="InterPro:IPR011223"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEQ1"
FT                   /protein_id="ADF59740.1"
FT                   /translation="MFLNYFALGVLIFVFLVLFYGIIAIHDIPYNMAKKRNHPHADAIH
FT                   TAGWISLFTLHAIWPFLWIWATLYREDRGWGMQNHITKPDEVPGMDALAKRVAELEQKL
FT                   AAVQPTADTKTLER"
FT   gene            167218..168354
FT                   /locus_tag="ECL_00173"
FT   CDS_pept        167218..168354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00173"
FT                   /product="secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59741"
FT                   /db_xref="GOA:A0A0H3CF22"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF22"
FT                   /protein_id="ADF59741.1"
FT                   /translation="MDLLIILTYVAFAWAIFKIFRIPVNQWTLATATLGGVFIVAGLIL
FT                   LMNYNHPYTFTAQKAVISIPITPQVTGVVSEVTDKNNQLIKKGEVLFKLDPGRYQARVD
FT                   RLQADLVTATHNIDVLKAQLSEAVANTTRVSAERDRLYKDYQRYLKGSQAKVNPFSESD
FT                   IDNARQNYLAQDALVKGSVAEQTQIKSQLDSMVNGEQSQIASLRAQLAEAKYNLDQTVV
FT                   RAPSNGYITQVLIRPGTYAAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGDEAEVV
FT                   FNALPGQVFSGKLTSILPVVPGGSYQAQGALQSLTVTPGTDGVQALIELEPNADVDALP
FT                   DGIYAQVAVYSDHFAHVSVMRKVLLRMTSWMHYLYLDH"
FT   gene            168444..169052
FT                   /locus_tag="ECL_00174"
FT   CDS_pept        168444..169052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00174"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59742"
FT                   /db_xref="GOA:A0A0H3CGQ7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGQ7"
FT                   /protein_id="ADF59742.1"
FT                   /translation="MKLIGSYTSPFVRKISILLLEKGIEFEFVNEQPYNAENGVAQYNP
FT                   LGKVPALVTDEGEYWFDSPIIAEYIELLGVAPAMLPADPKAALAVKQIEALADGIMDAA
FT                   LTSVREQARPVAQQSETELLRQREKISRSLDRCEQLIQEGKIATDSLNLATIAIACAIG
FT                   YLNFRRVSPGWCVDRPLLVKLAETLFQRESFARTEPPKA"
FT   gene            169156..170541
FT                   /locus_tag="ECL_00175"
FT   CDS_pept        169156..170541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00175"
FT                   /product="selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59743"
FT                   /db_xref="GOA:A0A0H3CD49"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD49"
FT                   /protein_id="ADF59743.1"
FT                   /translation="MTTHHSLYSQIPATDRLLREPLIHSAVERFGHTATVEMLRLLQDE
FT                   ARRHIQAENALPGWCVAWEQELEQRLVDKGQSALRPVINLTGTVLHTNLGRAQQAEEAV
FT                   DAVTQAMRSPVTLEYDLDGAGRGHRDRALADLLCQLTGAEDACIVNNNAAAVLLMLAAT
FT                   ASGKEVVVSRGELVEIGGAFRIPDVMRQAGCTLHEVGTTNRTHAKDYRAAVNENTALLM
FT                   KVHTSNYHIEGFTKAVEEAELAAIGQELNVPVVADLGSGSLVDLSQYGLPKEPMVQEMI
FT                   AAGVSLVSFSGDKLLGGPQAGIIVGKRELIAKLQQHPLKRALRADKMTLAALDATLRLY
FT                   LHPEKLAERLPTLRLLTRDAASIRAQAELLLPNVASHYADFDVRIESCQSQIGSGSLPV
FT                   DRLPSAALTFTPRDGRGSRLDALSTRWRALPTPVIGRIYDGRMWLDLRCLEDEERFLEM
FT                   LLK"
FT   gene            170538..172385
FT                   /locus_tag="ECL_00176"
FT   CDS_pept        170538..172385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00176"
FT                   /product="selenocysteinyl-tRNA-specific translation factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59744"
FT                   /db_xref="GOA:A0A0H3CDS7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDS7"
FT                   /protein_id="ADF59744.1"
FT                   /translation="MIIATAGHVDHGKTTLLQAITGVNADRLPEEKKRGMTIDLGYAYW
FT                   PQPDGRVLGFIDVPGHEKFLSNMLAGVGGIDHALLVVACDDGVMAQTREHLAILQLTGN
FT                   PQLTVALTKADRVDATRINEVREAVQATLREYGFTDAALFETVATEGRGIDALRHHLQQ
FT                   LSSREHASHHRFRLAIDRAFTVKGAGLVVTGTALSGEVKVGDTVWLTGINKPMRVRGLH
FT                   AQNQPVDHAHAGQRIALNIAGDAEKAQLNRGDWLLSEAPPEPSERVIVSLQTHIPLSQW
FT                   QPLHIHHAASHITGRVSLLENDLAELVFDTPLWLADNDRLVLRDISARETLAGARVVTL
FT                   NPPRRGKRKPEYLQWLSALAQASNDKAALEVHLERGAVNLTDFAWARQLSNEGLLPLTQ
FT                   QPGFIQAGNNLLNAPVAACWQRKVLNTLATYHEQHQDEPGPGRERLRRMALPMEDDALV
FT                   LLLIENMRESGVIKSHHGWLHLPDHKAGFTAEQEAIWQKAAPLFGDEPWWVRDLARETN
FT                   TDEQVMRQVLRHAAQQGLIVAIVKDRYYRNDRIVAFASLIRELDQARGSTCAADFRDRL
FT                   NVGRKLAIQILEYFNRIGFTRRRGNDHLLRDSLLFPETA"
FT   gene            172472..174010
FT                   /locus_tag="ECL_00177"
FT   CDS_pept        172472..174010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00177"
FT                   /product="aldehyde dehydrogenase B"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59745"
FT                   /db_xref="GOA:A0A0H3CEQ6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEQ6"
FT                   /protein_id="ADF59745.1"
FT                   /translation="MTNNPPSSRIQPGEYGFPLKLKPRYDNFIGGDWVAPVDGEYYSNL
FT                   TPVTGQPLCEIASSGKRDIDLALDAAHKAKDKWGQTSVQDRAAILFKIADRMEQNLELL
FT                   ATAETWDNGKPIRETMAADVPLAIDHFRYFASCIRAQEGGISEVDSDTVAYHFHEPLGV
FT                   VGQIIPWNFPLLMASWKMAPALAAGNCIVLKPARLTPLSVLLLMDIIGDLLPPGVINVV
FT                   NGAGGEIGEYLATSKRIAKVAFTGSTEVGQQIMQYATQNIIPVTLELGGKSPNIFFEDV
FT                   MAEEDAFFDKALEGFALFAFNQGEVCTCPSRALVQESIYERFMERAIRRVESIRSGNPL
FT                   DNVTQMGAQVSHGQLETILNYIDIGKKEGADVLTGGRRKVLGGDLQEGYYLEPTILSGK
FT                   NNMRVFQEEIFGPVLAVTTFKTLEEALEIANDTPYGLGAGVWSRNGNLAYKMGRGIQAG
FT                   RVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLEHYQQTKCLLVSYSDKPLGLF"
FT   gene            complement(174007..174972)
FT                   /locus_tag="ECL_00178"
FT   CDS_pept        complement(174007..174972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00178"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59746"
FT                   /db_xref="GOA:A0A0H3CF27"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF27"
FT                   /protein_id="ADF59746.1"
FT                   /translation="MMNKLQLKPRELKIISVIAATHSIGDAAALLGMAQANVSKYLSDF
FT                   ETRVGLKVFERTTRQLALTQFGEALLPYVNATLDKNSQLINFIADYKHEKRGKVTIYAP
FT                   TGIVTYLSRHVIHQIKDIGDIRISLKTYNLDRNEFSEGVTFPDDCDILITYAQPKDESL
FT                   VASVLTQYSVTAFATEEYLNQHPLNGPEDLIHHSCILIDSMLVDDANIWRFRVHGSDDV
FT                   QDYRVTGNYISDNTQTALELARNNLGIVFAPKESLRKELKNGSLVPCFPHQEEWWLDLT
FT                   AIFRKREYQPWRVQYVLDGVLNNLRQQIAQAAHGRPELDD"
FT   gene            175090..175830
FT                   /locus_tag="ECL_00179"
FT   CDS_pept        175090..175830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59747"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGR2"
FT                   /protein_id="ADF59747.1"
FT                   /translation="MTIKNNLLIAATLFATSSAMAGDFSLGAGAVFNESPYKGYNENTT
FT                   AVPLISYEGDRFYVRQTTGGWILWKDEKNEFSLTASWMPLHFDPDDNDDPQMKHLDERK
FT                   ASAFLGGAYYRHENWGSLKVAVSGDAMDESGGVVGEISYFRPIRMERLTLTPSVGIFYS
FT                   DESYNDYYYGVSGSESRRSGLNEYAAGDSWTPYVGLAAKYQLTQNLFLNASAVYTVLPD
FT                   DVKNSPMIDRDDSFALMTGLSWRF"
FT   gene            176241..176645
FT                   /locus_tag="ECL_00180"
FT   CDS_pept        176241..176645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59748"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD53"
FT                   /protein_id="ADF59748.1"
FT                   /translation="MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTA
FT                   HFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWLLVDINMKQFDGKAERINITLPRRL
FT                   LVKIDSFVNEHPQFSNRSAFLAEAARRVLP"
FT   gene            complement(176699..178654)
FT                   /locus_tag="ECL_00181"
FT   CDS_pept        complement(176699..178654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59749"
FT                   /db_xref="GOA:A0A0H3CDT1"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDT1"
FT                   /protein_id="ADF59749.1"
FT                   /translation="MSIMEADLHNLKINDPFLGQYQRLVRDVVIPYQWDALNDRVAEAE
FT                   PSHAITNFRIAAGLEEGEFYGMVFQDSDVAKWLEAVAWSLCQKPDAELEKTADEVIELI
FT                   AAAQCEDGYLNTYFTVKAPDERWTNLAECHELYCAGHMIEAGVAYFQGTGKRRLLEVVC
FT                   KLADHIDTVFGPREGQLHGYPGHPEIELALMRLYDVTEEPRYLNLVKYFIEARGTQPHF
FT                   YDIEYEKRGRTSYWHTYGPAWMVKDKAYSQAHQPLAEQQTAIGHAVRFVYLMAGMAHLA
FT                   RLSKDDAKRQDCLRLWSNMAQRQLYITGGIGSQSSGEAFSSDYDLPNDTVYAESCASIG
FT                   LMMFARRMLEMEADSRYADVMERALYNTVLGGMALDGKHFFYVNPLEVHPRTLAFNHIY
FT                   DHVKPVRQRWFGCACCPPNIARVLTSLGHYIYTVRPDALFINLYVGNEVTIPVGDETLK
FT                   LRISGNYPWQEEVNIEIASPVPVTHTLALRLPDWCANPHVSLNGEGMTGEVSRGYLHLT
FT                   RRWQEGDTLTLTLPMPVRRVYGHPQVRQQAGKVALQRGPLVYCLEEADNGANLHNLALP
FT                   ADSEFRVFEGKGIFAHKMLIQAEGVTHDAAEAGSEALWQYDRPAVQRQPKTLTFIPWFS
FT                   WANRGEGEMRIWVDED"
FT   gene            complement(178665..180017)
FT                   /locus_tag="ECL_00182"
FT   CDS_pept        complement(178665..180017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59750"
FT                   /db_xref="GOA:A0A0H3CER2"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CER2"
FT                   /protein_id="ADF59750.1"
FT                   /translation="MTSTPITESDVAQRVREERLSVREKIGYGLGDAGGTVITCLIMNF
FT                   LTFFYTDIFGLTPALVGTLFIADRTQSRWGRFRPWQLWVAFPIGIIGVLTFTVPEASMG
FT                   VKIAWAFGTYLLLSVGYTAINVPYCALINTMTTRHSEVISCQSWRFVLCGVAGFLVSVG
FT                   LPWLVAALGQGNAARGYQLGVGVLCTLAVVMFLCCFFWVRERVPLALMGKFTLREHLAG
FT                   LRKNDQLLLMLVMSFLLINVFNIRGGGYMYFITYVLQGSTAYTSLFFTMVTFAAILGAV
FT                   IVSPLSRRVDTVKLYYYTNLVLAAIAAGMWFLPGGPAHQTLWLIVILSNGVILGFTLPL
FT                   HFSLMAFADDYGEWKTGVRSSGMNFAFNLFFIKLAWASSAGIISLVFIAVAYQPGAGNQ
FT                   TPASLQGITAMETLLPALFHLLLAVSIRWCRLNNPMMSRIATDLRQRHVPS"
FT   gene            180242..181060
FT                   /locus_tag="ECL_00183"
FT   CDS_pept        180242..181060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00183"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59751"
FT                   /db_xref="GOA:A0A0H3CF31"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF31"
FT                   /protein_id="ADF59751.1"
FT                   /translation="MLELSIVLPIKVQNGGLFISRGVGRHPARKLTSWEIIFVEKGTLT
FT                   IQEENRLFEVKAGESLLLWPKRRHVGTEDFPADLRFYWLHFEVKPGPSALPEASPLTIE
FT                   QHCCVRDVPSVIALFRQFLSEQEKLQRSVALEMLLLLILQKISLSAGYEDRPDEAGAAL
FT                   AWKAKQLIRTQFHLPLSTSLLAKSLHCNADYLGRVFRRTFHLTLTEAIHRQRVRAAEKM
FT                   LLNDSASLTEVATRCGFNDVGYFRQIFSKHTGLTPAVWKRRYCKEHINSG"
FT   gene            complement(181061..181756)
FT                   /locus_tag="ECL_00184"
FT   CDS_pept        complement(181061..181756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59752"
FT                   /db_xref="GOA:A0A0H3CGR5"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR004661"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGR5"
FT                   /protein_id="ADF59752.1"
FT                   /translation="MLEQLKAEVLAANLALPAHQLVTFTWGNVSAVDRDSGLMVIKPSG
FT                   VEYDVMTADDMVVVNIATGEVVEGSMKPSSDTPTHLALYRRYPEIGGIVHTHSRHATIW
FT                   SQAGQDLPAWGTTHADYFYGAIPCTRRMTTAEIAGDYEYQTGEVIIKTFEERDISPMQI
FT                   PAVLVHSHGPFAWGKDAADAVHNAVVLEECAYMGLFSRQLAPQLPVMQQELLDKHYLRK
FT                   HGAHAYYGQ"
FT   gene            complement(181750..182610)
FT                   /locus_tag="ECL_00185"
FT   CDS_pept        complement(181750..182610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00185"
FT                   /product="putative hexulose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59753"
FT                   /db_xref="GOA:A0A0H3CD56"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD56"
FT                   /protein_id="ADF59753.1"
FT                   /translation="MRQHPLGIYEKALPKSLTWPERLVLAKSCGFDFVEMSVDETDERL
FT                   SRLAWSTTQRASLVEAMLETGVSIPSMCLSAHRRFPFGSRDETVRARAREIMSSAIKLA
FT                   RDLGIRTIQLAGYDVYYEEHDEGTRQRFAEGLAWAVEQAAAAQVMVAVEIMDTAFMNSI
FT                   SKWKKWDEMLASPWFSVYPDVGNLSAWGNNVAAELTLGIDRIAAIHLKDTQPVTAQSPG
FT                   QFRDVPFGEGCVDFVGVFNTLNKLNYRGAFLIEMWTEKAKEPVLEIIQARRWIEARMQE
FT                   GGMTC"
FT   gene            complement(182613..183266)
FT                   /locus_tag="ECL_00186"
FT   CDS_pept        complement(182613..183266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00186"
FT                   /product="3-keto-L-gulonate-6-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59754"
FT                   /db_xref="GOA:A0A0H3CDT4"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDT4"
FT                   /protein_id="ADF59754.1"
FT                   /translation="MSRPLLQLALDHTSLQAAQRDVARLSDHVDIIEAGTILCLTEGLN
FT                   AVRALREQCPGKTLVADWKVADAGETLAEQAFGAGANWMTIICAAPLATVEKGHAVALR
FT                   CGGEIQMELFGYWTLDDARAWHRIGVKQAIYHRGRDAQASGQQWGEADLARMKALSDIG
FT                   LQLSVTGGITPADLPLFKQINVKAFIAGRALADAANPPQVAEAFHSQIRDIWGA"
FT   gene            complement(183263..184768)
FT                   /locus_tag="ECL_00187"
FT   CDS_pept        complement(183263..184768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59755"
FT                   /db_xref="GOA:A0A0H3CER5"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CER5"
FT                   /protein_id="ADF59755.1"
FT                   /translation="MSEKEPFWLGIDCGGTYLKAGLYTREGKEVCIERRTVATLSPRAG
FT                   YAERDMNQLWQQCHTTVALLLNNARVSGEQIKGVGISAQGKGLFLLDKQDRPLGNAMLS
FT                   SDRRALDIVQRWQQDGIPEKLYPHTRQTLWTGHPASLLRWVKENEPQRYQQIGCVMMAH
FT                   DYLRWCLTGVKGCEESNISESNLYNMNTGQYDPQLTRWLGISEIDNALPPVVGSAEICG
FT                   EITAQAAALTGLATGTPVVGGLFDVVSTAICAGLHDEHTLNAVMGTWAVTSGIANALRD
FT                   NEPHPYVYGRYVHPQQYIVHEASPTSSGNLEWLTAQWGEMSFSEINRAVASLPKAESDL
FT                   LFLPFLYGSNAGLEMTSGFYGMQALHTRAHLLQAVYEGVVFSHMTHLNRMLERFTYVQA
FT                   LRVTGGPTHSDVWMQMLADVSGLAIALPQVEETGCSGAALAALVGTGVYPDFYAAQHAL
FT                   RHDIRVIEPDMHAHAAYQRKYQRYQLLISALQGYHARVKEHDL"
FT   gene            complement(184905..186224)
FT                   /locus_tag="ECL_00188"
FT   CDS_pept        complement(184905..186224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00188"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59756"
FT                   /db_xref="GOA:A0A0H3CF36"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF36"
FT                   /protein_id="ADF59756.1"
FT                   /translation="MNTSTQALHADIPRQRWLRIIPPILIACIISYMDRVNIAFAMPGG
FT                   MDEELGISATMAGLAGGIFFIGYLFLQVPGGKIAVHGSGKKFIGWSLVAWAVISVLTGL
FT                   VTSQYQLLVLRFLLGVAEGGMLPVVLTMISNWFPDAERGRANAIVIMFVPIAGIITAPL
FT                   SGWIITALDWRWLFIIEGLMSIVVLVLWAFTVYDRPQEARWISEAEKNYLVKTLAAEQQ
FT                   AIAGKEVKNASLSAVLSDKTMWQLIALNFFYQTGIYGYTLWLPTILKELTHTSIGQVGV
FT                   LAILPYIGAIAGMFLFSSLSDRTGKRKLFVSLPLIGFALCMFLSVALKEHTWLAYAALV
FT                   GCGFFLQSAAGVFWTIPARLFSAEMAGGARGVINALGNLGGFCGPYAVGVLITLYSKDA
FT                   GVYCLAVSLALASLLALLLPAKCDAGAEPNPTVNSHKRAA"
FT   gene            complement(186270..187196)
FT                   /locus_tag="ECL_00189"
FT   CDS_pept        complement(186270..187196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59757"
FT                   /db_xref="InterPro:IPR032344"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGS2"
FT                   /protein_id="ADF59757.1"
FT                   /translation="MTNTGFIIGAYPCAPSFHQKGEQEEQTFWRELSDTPHIRGLEQPC
FT                   LEHLHPYGDEWLFRHTPGEWQIVVTAVMETMRRRGTNGAFGLASADEDQRKASVEFYRH
FT                   LCQKIAAVNARFPGKVIALEMQAAPQAGNASVEQAIEAFARSIREIAGWDWSCDLVLEH
FT                   CDAMTGPAPRKGFLPLEQVLEVIKETDISICINWARSAIEGRNTTLPVEHVQTALQAGK
FT                   LAALMFSGTTIRGEYGEWQDLHAPFSSYCADSLMTTEHAKALFTAASAATLKFSGIKLL
FT                   EINANADISHRIAILRDGISQMKKATQ"
FT   gene            complement(187348..187815)
FT                   /locus_tag="ECL_00190"
FT   CDS_pept        complement(187348..187815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59758"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD60"
FT                   /protein_id="ADF59758.1"
FT                   /translation="MIFGHISQPNPCRLPRAIEKALDFLRTTDFSMLKPGVVEIEGRNL
FT                   FAQILDLTTKEPHENRPEVHRHYLDIQFLAWGEEKIGIAIDTGNNNISESLLEQRDIIF
FT                   YHNSENESFIEMVPGSYAIFFPQDVHRPACIKNKETAIRKIVVKVALSELD"
FT   gene            complement(187826..188824)
FT                   /locus_tag="ECL_00191"
FT   CDS_pept        complement(187826..188824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00191"
FT                   /product="2,3-diketo-L-gulonate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59759"
FT                   /db_xref="GOA:A0A0H3CDT6"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR023689"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDT6"
FT                   /protein_id="ADF59759.1"
FT                   /translation="MKVTFEELKAAFNRVLLDRGVKAETADACAEMFARTTESGVYSHG
FT                   VNRFPRFIQQLDAGDIIPDAQPKRVTTLGAIEQWDAQRAIGNLTAKKMMDRATELASDH
FT                   GIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPAWGSKECCIGTNPLIVAI
FT                   PSSPITMVDMSMSMFSYGMLEVNRLAGRTLPVDGGFDDEGNLTKEPGVIEKNRRILPMG
FT                   YWKGSGLSIVLDMIATLLSNGSSVAEVTQDNSDEYGVSQIFIAIEVDRLIDGPTRDAKL
FT                   QRIMDFITTAERADENVAVRLPGHEFTRLLEENRRNGITIDDSVWAKIQAL"
FT   gene            189050..189868
FT                   /locus_tag="ECL_00192"
FT   CDS_pept        189050..189868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00192"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59760"
FT                   /db_xref="GOA:A0A0H3CES1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CES1"
FT                   /protein_id="ADF59760.1"
FT                   /translation="MSMKESDMTQEKERPAGSQSLFRGLMLIEILSNYPNGCPLAHLSE
FT                   LAGLNKSTVHRLLQGLQSCGYVTPAPAAGSYRLTTKFIAVGQKALSSLNIIHVAAPHLE
FT                   SLNIATGETVNFSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMAFGH
FT                   QDYVASYWESHQDQIQPLTRNTITELSAMYDELAEIREHSMAMDKEENELGVSCIAVPV
FT                   FDIHGRVPYAISISLSTSRMKQIGEKNLLTPLRETADAISRELGFNVREG"
FT   gene            189872..190327
FT                   /locus_tag="ECL_00193"
FT   CDS_pept        189872..190327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00193"
FT                   /product="putative hydrogenase, 4Fe-4S ferredoxin-type
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59761"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF40"
FT                   /protein_id="ADF59761.1"
FT                   /translation="MNRFIMADSAKCIGCRTCEVACVVSHQDAISTDAFTPRIRVVKGD
FT                   AFTTAVGCHQCEDAPCANVCPTQAIRRGEGAWQVEQARCIGCKRCMVACPFGAMQVQWA
FT                   GDTLQALKCDLCAHRADGPACVEACPTHALSCVDPARLRTERLRHLA"
FT   gene            complement(190332..191588)
FT                   /locus_tag="ECL_00194"
FT   CDS_pept        complement(190332..191588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00194"
FT                   /product="valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59762"
FT                   /db_xref="GOA:A0A0H3CGS5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGS5"
FT                   /protein_id="ADF59762.1"
FT                   /translation="MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAQIPE
FT                   MNTYFQTLLAQMLENGKATDALCNYDGPQGKTELLKLLADMLREELGWDIEPQNIALTN
FT                   GSQSAFFYLFNLFAGRRADGTTKKVLFPLAPEYIGYADSGLEEDLFVSARPNIELLPEG
FT                   QFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDDELMKLDALANQHGIPLVIDNAYG
FT                   VPFPGIIFSEARPLWNPNIVLCMSLSKLGLPGSRCGIIVANEKIITAITNMNGIISLSP
FT                   GGIGPAMMCEMIKRNDLLRLSNDVIKPFYYQRVQETIAILRRYLPEERCLIHKPEGAIF
FT                   LWLWFKDLPITTELLYQRLKKRGVLMVPGDYFFPGLDKPWPHTHQCMRMNYVPDPEKIE
FT                   AGVKILAEEIEFAWREDVQ"
FT   gene            complement(191683..193812)
FT                   /locus_tag="ECL_00195"
FT   CDS_pept        complement(191683..193812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00195"
FT                   /product="periplasmic alpha-amylase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59763"
FT                   /db_xref="GOA:A0A0H3CD64"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR014635"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD64"
FT                   /protein_id="ADF59763.1"
FT                   /translation="MKRTAVAFLMLPALAHADWSSPGFNAFSAEGTGMFTSQAKLAKGT
FT                   RPLTVSFDNTCWQPTEAIKLNEMLSLKPCDGTPPQWRLFRDGEYQMRVDTRSGTPTLML
FT                   TIKSAAEQPVANVIRQCPKWDGKPLTLEVGNTFPEGSVVRDFYSKQTATVQQGKITLQP
FT                   AANSNGLLLLERAETDKPAPFSWQNATVYFVLTDRFVNGDPTNDNSYGRHKDGMQEIGT
FT                   FHGGDLKGLASKLDYLQQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYYTQDWT
FT                   RLDANMGTEDDLRHLVDEAHKRGIRILFDIVMNHVGYATLADMQEYQFGALYLQGDELK
FT                   KTLGARWTDWKPGTGQSWHSFNDYINFSDKAAWEKWWGNKWIRTDIGDYDNPGFDDLTM
FT                   SLAFLPDLKTESTTPSGLPNFYQHKPDTQAKAIPGYTPRDYLTHWLSQWVREYGIDGFR
FT                   VDTAKHVELAAWQQLKDQASQALAAWKGAHPDKKLDNAPFWMTGESWGHGVMQSDYYRH
FT                   GFDAMINFDYQEQAAKAVNCLADIDLTWQQMAEKLQSFNVLSYLSSHDTRLFREGGQRA
FT                   AELLLLAPGSVQIYYGDESERPFGPTGSDPLQGTRSDMNWQDVTGKQALTVAHWQTLGQ
FT                   FRARHPAIGEGKQTTLSLKEGYGFVREHDGDKVMVVWAGTNSPLIAVFSLSHGERAGVR
FT                   GTHQNYSLQKSTPAT"
FT   gene            194379..194951
FT                   /locus_tag="ECL_00196"
FT   CDS_pept        194379..194951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00196"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59764"
FT                   /db_xref="GOA:A0A0H3CDU0"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDU0"
FT                   /protein_id="ADF59764.1"
FT                   /translation="MPYITSQNAAITADRNWLIAKQYDSRWTPSERARLKDIAKRYKVS
FT                   WNGNTRRVPWNSLLERVDIIPGSMVATMAAAESGWGTSKLARNNNNLFGMKCVKGRCKN
FT                   APGKVKGYSQFESVKDSVNAYVVNLNTHPAYSSFRKSRAQLRKADQEVTASTMIHKLKG
FT                   YSTQGQRYNNYLFAMYQDNQRLIAAHM"
FT   gene            complement(194989..196167)
FT                   /locus_tag="ECL_00197"
FT   CDS_pept        complement(194989..196167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00197"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59765"
FT                   /db_xref="GOA:A0A0H3CES5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CES5"
FT                   /protein_id="ADF59765.1"
FT                   /translation="MFEKRHRITLLFNANKAYDRQVVEGVGEYLQASQSEWDIFIKEDF
FT                   RTRLENIKDWLGDGVIADYDDPVIEQLLTDVDVPIVGVGGSYHSPEHYPPVHYIATDNH
FT                   ALVESAFLHLKEKGVHRFAFYGLPASSGKRWAVEREHAFCQLVAQEKYRGVVYQGLETA
FT                   PENWQHAQNRLADWLQTLPPQTGIIAVTDARARHVLQVCEHLHIPVPEKLCVIGIDNEE
FT                   LTRYLSRVALSSVAQGTRQMGYQAAKLLHRLLDNESLPLQRLLVPPVRVVERRSTDYRS
FT                   LNDPAVIQAMHFIRNHACKGIKVDQVLDSVGISRSNLEKRFKEEVGETIHAVIHAEKLE
FT                   KARSLLISTSLSINEISQMCGYPSLQYFYSVFRKEYDNTPKEYRERHSEVMM"
FT   gene            complement(196201..197382)
FT                   /locus_tag="ECL_00198"
FT   CDS_pept        complement(196201..197382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00198"
FT                   /product="inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59766"
FT                   /db_xref="GOA:A0A0H3CF43"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF43"
FT                   /protein_id="ADF59766.1"
FT                   /translation="MSKSNPSDIKVAVQTPGAFAGLKALNLQVFVMIAAIIAIMLFFTW
FT                   MTDGSYLSARNVSNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGVAAIFDVW
FT                   LGWPLPLTVAVTLVLGLVLGAWNGWWVAYRKVPSFIVTLAGMLAFRGVLIGITNGTTVS
FT                   PTSAAMSQIGQSYLSDSMGFTIGVVGLLAFVVWQWRGRMRRQSLGLASSPSTSVVGRQA
FT                   LTAVIVLGAIWLLNDYRGVPTPVLLLALLLLGGMFMATRTAFGRRIYAIGGNLEAARLS
FT                   GINVERTKLAVFAINGLMVAIAGLILSSRLGAGSPSAGNIAELDAIAACVIGGTSLAGG
FT                   VGSVAGAVMGAFIMASLDNGMSMMDVPTFWQYIVKGAILLLAVWMDSATKRRT"
FT   gene            complement(197360..198901)
FT                   /locus_tag="ECL_00199"
FT   CDS_pept        complement(197360..198901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00199"
FT                   /product="xylose transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59767"
FT                   /db_xref="GOA:A0A0H3CGT0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGT0"
FT                   /protein_id="ADF59767.1"
FT                   /translation="MPYLLEMKSITKRFGAVKAVDNVSLRLNPGEVVSLCGENGSGKST
FT                   LMKVLCGIYPHGSYEGEIVFAGEVIQATHIRDTERKGIAIIHQELALVKHLTVLENIFL
FT                   GAEISRHGVLDYDTMTLRCEKLLAQVSLAISPDTRVGDLGLGQQQLVEIAKALNKQVRL
FT                   LILDEPTASLTEQETAVLLDIIRDLQNHGIACIYISHKLNEVKAISDTICVIRDGQHIG
FT                   TREAEGMSEDDIITMMVGRELTALYPNEPHTTGDEVLRVENLTAWHPVNRHIKRVNNIS
FT                   FSLHRGEILGVAGLVGAGRTEAVQCLFGVWPGRWEGTVYIDGKPVKIDNCQQAIAHGIA
FT                   MVPEDRKKDGIVPVMAVGKNITLAALDQFSGALSSLDDAAEQQCILQSLARLKVKTSSP
FT                   ELAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLINQLVQQGIAV
FT                   IVISSELPEVLGLSDRVLVMHEGKLKANLINQNLTQEQVMEAALRSERHVEKQSV"
FT   gene            complement(198974..199966)
FT                   /locus_tag="ECL_00200"
FT   CDS_pept        complement(198974..199966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00200"
FT                   /product="D-xylose transporter subunit XylF"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59768"
FT                   /db_xref="GOA:A0A0H3CD69"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD69"
FT                   /protein_id="ADF59768.1"
FT                   /translation="MKIKNLTLTLCTTLLLASFAGHAKEVKIGMAIDDLRLERWQKDRD
FT                   IFVKKAESLGASVFVQSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQ
FT                   EGIKVLAYDRMINNADIDYYISFDNEKVGELQAKSLVDKVPQGNYFLMGGSPVDNNAKL
FT                   FREGQMKVLKPYIDSGKIKVVGDQWADGWLPENALKIMENALTANNNKIDAVVASNDAT
FT                   AGGAIQALSAQGLAGKVAISGQDADLAGVKRIIAGTQTMTVYKPITELANTAAEIAVEL
FT                   GNGKQPKADATLNNGLKDVPARLLTPIEVNKENIDATVIKDGFHKKSEL"
FT   gene            200274..201659
FT                   /locus_tag="ECL_00201"
FT   CDS_pept        200274..201659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00201"
FT                   /product="xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59769"
FT                   /db_xref="GOA:A0A0H3CDU4"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDU4"
FT                   /protein_id="ADF59769.1"
FT                   /translation="MSIHYYSCINDSPHTLIMELNMQAYFDQLDRVRYEGPKTTNPLAF
FT                   RHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMFGVGSFDRPWQQPGEAIELAKRKA
FT                   DVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFAQMVDVLAAKQQQSGVKLLWGTA
FT                   NCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHQLGGENYVLWGGREGYETLLNTD
FT                   LRQEREQIGRFMQMVVEHKHKIGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLE
FT                   KEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDAQLGWDTDQFPNSVEENA
FT                   LVMYEIIKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKVAARMIEDGE
FT                   LDKRVAKRYSGWNSELGQQILKGQLSLAEIAKYAEQHQLAPQHQSGHQELLENLVNHYL
FT                   FDK"
FT   gene            201719..203173
FT                   /locus_tag="ECL_00202"
FT   CDS_pept        201719..203173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59770"
FT                   /db_xref="GOA:A0A0H3CET0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CET0"
FT                   /protein_id="ADF59770.1"
FT                   /translation="MYIGIDLGTSGVKAILLSEQGDVLATQTEKLQVSRPHPLWSEQDP
FT                   EQWWQATDRAIKGLGAQHSLREVTALGIAGQMHGATLLDSQHRVLRPAILWNDGRCAEE
FT                   CALLEERVPASRDITGNLMMPGFTAPKLLWVQRHEPEIFRQVAKVLLPKDYLRFRMTGD
FT                   FASDMSDAAGTMWLDVAKRDWSEAMLDACHLTREHMPALFEGSEITGTLQSAVAERWNM
FT                   PAVPVVAGGGDNAAGAVGVGMVDAGQAMLSLGTSGVYFAVSDGYRSNPESAVHSFCHAL
FT                   PGKWHLMSVMLSAASCLDWAAKLTGMADVPALITAAQQADENAGTVWFLPYLSGERTPH
FT                   NNPEAKGVFFGLTHQHGPAELARAVLEGVGYALADGMDVVHDCGLNPASITLIGGGARS
FT                   SYWRQMLSDISGLQLDYRTGGDVGPALGAARLAQIAMNPEKPLSQLLPQLTLEQAHLPD
FT                   ATRHARYAERRDVFRKIYQQLLPLMS"
FT   gene            203277..203816
FT                   /locus_tag="ECL_00203"
FT   CDS_pept        203277..203816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00203"
FT                   /product="isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59771"
FT                   /db_xref="GOA:A0A0H3CF47"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF47"
FT                   /protein_id="ADF59771.1"
FT                   /translation="MSRIALINIDTQQSFHHRDYWQEQDVPAFEQAMLGLTEGCQSRGI
FT                   PVVDIFHVDEKGPFSLQSGYVKPMAFLRHQPDVVFQKHVHNAFTDTGLDRWLRERDINQ
FT                   LILCGIRTEQCCETTARVASDLGYAVTFVSEAMLTFPMTYKGVTLSAAEIRHRTETVLS
FT                   GRFAAIKTVAETLESL"
FT   gene            203816..204736
FT                   /locus_tag="ECL_00204"
FT   CDS_pept        203816..204736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00204"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59772"
FT                   /db_xref="GOA:A0A0H3CGT4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGT4"
FT                   /protein_id="ADF59772.1"
FT                   /translation="MRIDVWFVMLPGVLSLDMTGPAETFVLAGDAFRLHYIGPQPEVQT
FT                   SIGLMMSGIAPLPERLPEGSLLVLPGVSDSRVQFSTPQAMQIQHWLMRLQPAIQRQDIT
FT                   VMCVCSGALLAAKSGLLNNRQCTTHHEVIGRLRAAVPTATIKENRIFVQDENVWTSAGI
FT                   TSGIDLALHMINRLCGPEKALAVAREMVVWFRRSGDDPQLSPWLRYRNHLHPAIHRAQD
FT                   ALTADPQKAWNVPDIAALAHVSPRHLTRLFQTHLGISVRDYLEQLRLAVAEQWLLQGRG
FT                   VEQSSLAAGFSSPRQFHRARQRVVN"
FT   gene            complement(204729..205724)
FT                   /locus_tag="ECL_00205"
FT   CDS_pept        complement(204729..205724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00205"
FT                   /product="acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59773"
FT                   /db_xref="GOA:A0A0H3CD73"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="InterPro:IPR032905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD73"
FT                   /protein_id="ADF59773.1"
FT                   /translation="MQSKISWIDNLRGIACLMVVMIHTTTWYVTNAHSISPVNWDVANI
FT                   LNSASRVSVPLFFMISGFLFFGERSAQPRHFIRIAACLGFYSAVALIYITLFTSISPGL
FT                   SLKYLLQKPVFYHLWFFFAIIVIYLVSPLIQVKNVSGKMLLALMVVIGIIANPNTVSQK
FT                   IDGFEWLPVNLYINGDTFYYVLYGMLGRAIGMMDTQKRGISWLCGALFIIGVIIISRGT
FT                   LHELQWRGNFADTWYLYCGPMVFICAVSLLTLVKNTLNARPLPVLGFISRHSLGIYGFH
FT                   ALVIHALRTRGVELKSWPVLDIVWIFSVTLVVSLLLSMLLQKLDTRRFVS"
FT   gene            205908..206213
FT                   /locus_tag="ECL_00206"
FT   CDS_pept        205908..206213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59774"
FT                   /db_xref="InterPro:IPR025728"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDU9"
FT                   /protein_id="ADF59774.1"
FT                   /translation="MMMKRVGSLFLLVVLAGCSTPQEAPAQKAQQGKMSPERSLNMEQL
FT                   CKDQAAHRYNLDTQKIDVTGSERFQGSYELRGHTSRKEGFVCSFDADGQFLHLSMR"
FT   gene            206374..207285
FT                   /locus_tag="ECL_00207"
FT   CDS_pept        206374..207285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00207"
FT                   /product="glycyl-tRNA synthetase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59775"
FT                   /db_xref="GOA:A0A0H3CET5"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CET5"
FT                   /protein_id="ADF59775.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTS
FT                   LRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLKE
FT                   LGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPITGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTC
FT                   FEQYEKEAQQLLALETPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCNRNK"
FT   gene            207295..209364
FT                   /locus_tag="ECL_00208"
FT   CDS_pept        207295..209364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00208"
FT                   /product="glycyl-tRNA synthetase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59776"
FT                   /db_xref="GOA:A0A0H3CF52"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF52"
FT                   /protein_id="ADF59776.1"
FT                   /translation="MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGKI
FT                   EWFAAPRRLALKVANLAASQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITVDQ
FT                   AERLTTDKGEWLLYRAHVKGERAEALLPNMIATSLAKLPIPKLMRWGASDVHFVRPVHT
FT                   VTLLLGDTVIPATILGVASDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIADYEQR
FT                   KAKIKADAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYANDGKLLPNFIFVANIESKDPQQIISGNEKVVRPRLADAEFFFNTDRKK
FT                   RLEDNLPRLQTVLFQQQLGTLRDKTDRIAELSGWIAREIGADVNHATRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPSNPVACAVAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAVRLYGDKLTN
FT                   ANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMKAVSHFRTLEAA
FT                   SALAAANKRVSNILAKSDETLNERVNAATLKEPEEIALAMQVVVLRDKLEPYFAEGRYQ
FT                   EALVELAELRDVIDAFFEKVMVNVEDKDLRINRLSMLEKLRELFLRVADISLLQ"
FT   gene            209597..211216
FT                   /locus_tag="ECL_00209"
FT   CDS_pept        209597..211216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00209"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59777"
FT                   /db_xref="GOA:A0A0H3CGT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGT8"
FT                   /protein_id="ADF59777.1"
FT                   /translation="MAHFAQSPSFILHQVTCQFATGNILFGPLNLSLETSLCALVGRNG
FT                   SGKTRLLRMLAGLDEPASGHIERFASHVYVAQQQDISPQTTLAELLGYDAIFAARKRID
FT                   RGDYQPDDLEMLDGYWDLAERLNEAFLQAKLPPFDPDKPAAEFSGGERIRALLCGAFTA
FT                   EADFLLLDEPTNHLDRQGRAWFYDQLRRYQGGVLVASHDRELLAQVPRILELSPSGLRS
FT                   YGGNYADYKQQRDAEQQAARAALEHAATERKRTRARMQKEHDDSQRRSAKTIRTVDTLN
FT                   IASFERVKYKAAAKERIGSWKKQHSDQNDVLNAAVNKARERVEEDAPIMFTLPGSQIAE
FT                   GKQVLVLEELQLPHVSLPPMNWRMDGPMRVALRGPNGCGKSTLLKVILGETAPRAGSCK
FT                   VSVTCAYLDQHLSQLDLTQSVMAHLNLSNTPLEEGTLRTRLAQLQLGADKVSLPLAELS
FT                   GGERLKAALACVLWREHATQLLLLDEPTNHLDLASVQAIEAALAGFPGALLVVSHDESF
FT                   LQGLALTHELVWEETGWHCEGL"
FT   gene            complement(211263..211550)
FT                   /locus_tag="ECL_00210"
FT   CDS_pept        complement(211263..211550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59778"
FT                   /db_xref="GOA:A0A0H3CD79"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD79"
FT                   /protein_id="ADF59778.1"
FT                   /translation="MEYKDPEFELLSSLEQIIFKDVPQTVTLQQKSNPFTEYEQLRKGT
FT                   GLKTDEFARAMGVSVAMVLEWESKREKPTPTELKLMRLIQANPALSKQIA"
FT   gene            complement(211615..211785)
FT                   /locus_tag="ECL_00211"
FT   CDS_pept        complement(211615..211785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDV5"
FT                   /protein_id="ADF59779.1"
FT                   /translation="MQNGYCHFISYSLQKNTWRSRHMVNQVISITIRIAETDKAIVTAR
FT                   LITSVMILRLY"
FT   gene            211882..212592
FT                   /locus_tag="ECL_00212"
FT   CDS_pept        211882..212592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00212"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59780"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEU0"
FT                   /protein_id="ADF59780.1"
FT                   /translation="MATGKSCSRWFAPIAALLMVVSLSGCFDKEGDQRKAFIDFLQNTV
FT                   MRSGERLPTLTADQKKQFGPFVSDYAILYGYSQQVSQAMDSGIRPVVDSVNAIRVPQDY
FT                   VTQREPLRQSNGALGVLSQQLQNAKMQADASRSALKQGDDLKPVFDKVYEKVVTKPSDA
FT                   LQPLIPAAQIFTQQLVQVGDFISQQGTQVSFVANGIQFPTSQQASQYNTLIGPLASQHQ
FT                   AFSQAWSAAVAATE"
FT   gene            212839..213051
FT                   /locus_tag="ECL_00213"
FT   CDS_pept        212839..213051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00213"
FT                   /product="major cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59781"
FT                   /db_xref="GOA:A0A0H3CF56"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF56"
FT                   /protein_id="ADF59781.1"
FT                   /translation="MSAKMTGLVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSL
FT                   DEGQKVSFTIESGAKGPAAGNVVSL"
FT   gene            complement(213110..214084)
FT                   /locus_tag="ECL_00214"
FT   CDS_pept        complement(213110..214084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00214"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59782"
FT                   /db_xref="GOA:A0A0H3CGU2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGU2"
FT                   /protein_id="ADF59782.1"
FT                   /translation="MKPSVILYKALPDDLQKRLEEHFTVTQVKNLSPETVAQHAGAFAR
FT                   AEGLLGSSEKVDVALLEKMPKLRATSTVSVGYDNFDVDALNARNILLMHTPHALTETVA
FT                   DTLMALMLSTARRVVEVAERVKAGEWTKSIGPDWFGVDVHGKTLGIVGMGRIGLALAQR
FT                   AHFGFNMPILYNARRHHSEAEERFNARYCELDTLLQEADFVCLILPLTDETRHLIGKAA
FT                   FAKMKKSAIFINAGRGPVVDEKALIEALQNGEIHAAGLDVFEQEPLPVDSPLLSLPNVV
FT                   ALPHIGSATHETRYNMAATAVDNLIAALNGNVEKNCVNPQVQQ"
FT   gene            complement(214111..215391)
FT                   /locus_tag="ECL_00215"
FT   CDS_pept        complement(214111..215391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00215"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59783"
FT                   /db_xref="GOA:A0A0H3CD84"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD84"
FT                   /protein_id="ADF59783.1"
FT                   /translation="MNSSTNAVKRWWYIMPIVFITYSLAYLDRANFSFASAAGITEDLG
FT                   ITKGISSLLGALFFLGYFFFQIPGAIYAERRSVRKLIFVCLILWGACASLTGVVNNIPA
FT                   LAAIRFILGVVEAAVMPAMLIYISNWFTKSERSRANTFLILGNPVTVLWMSVVSGYLIQ
FT                   SFGWREMFIIEGVPAIIWAFCWWVLVKDKPAQAKWLSEDEKAALQAQLDKEQQGLKAVR
FT                   NYGEAFRSRNVILLCAQYFTWSIGVYGFVLWLPSIIRSGGENLGMVEVGWLSSVPYLAA
FT                   TIAMIIVSWASDKLQNRKLFVWPLLLIAAFAFIGSWAVGANHFWVSYTLLVIAGAAMYA
FT                   PYGPFFAIIPEMLPRNVAGGAMALINSMGALGSFCGSWFVGYLNGATGSPSASYIFMGV
FT                   ALFASVWLTLIVKPANNQQLPVGARHA"
FT   gene            complement(215508..216446)
FT                   /locus_tag="ECL_00216"
FT   CDS_pept        complement(215508..216446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00216"
FT                   /product="ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59784"
FT                   /db_xref="GOA:A0A0H3CDW0"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDW0"
FT                   /protein_id="ADF59784.1"
FT                   /translation="MHKTLDVITIGEAMAMFVATETGELSTVEHFIKRVAGAELNVATG
FT                   LARLGLKTGWVSRVGDDSFGHFVLDSLKKEGIDAAGVTLDGRFPTGFQLKSKVENGTDP
FT                   IVEYFRKGSAASHLSVEDYHADYFASARHLHLSGVAAALSASSYELLDHAATTMKAQGK
FT                   TISFDPNLRPVLWKSEAEMVEKLNRLAFQADWVLPGVKEGVILTGENTPEGIADFYLNK
FT                   GVKAVVLKTGADGAWFKTADGEQGAVAAVKVENVVDTVGAGDGFAVGVISALLEGKPLP
FT                   QAIARGNWIGSLAIQVQGDSEGLPTRAQLNE"
FT   gene            complement(216450..217199)
FT                   /locus_tag="ECL_00218"
FT   CDS_pept        complement(216450..217199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00218"
FT                   /product="xylose isomerase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59785"
FT                   /db_xref="GOA:A0A0H3CEU7"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEU7"
FT                   /protein_id="ADF59785.1"
FT                   /translation="MGRKIMVVTAAYGADQVRQAGGQRAMLPVIAGAGADGVEIRRELF
FT                   NSEELQALPALGESIELLGLLACYSAPAPLFMPDGALNPDLPRYLSEASTLNALWLKVS
FT                   LGHFSGTRPLTALRALLNESGMALVVENDQTDCGQLAPMQRFQAACREMALPVTLTFDM
FT                   GNWLWVGDSPEEAATRLAPAVSYIHVKAAVPHKAQFRAVAPDRADARWLALLSQLPADA
FT                   PRGIEFPLEGADLTAVTRHYVNLLREE"
FT   gene            complement(217304..218320)
FT                   /locus_tag="ECL_00219"
FT   CDS_pept        complement(217304..218320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00219"
FT                   /product="LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59786"
FT                   /db_xref="GOA:A0A0H3CF59"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF59"
FT                   /protein_id="ADF59786.1"
FT                   /translation="MSKPTRATISDVAKAARTGKTSISRYLNGEKHLLSDALLARIEQA
FT                   IADLDYRPSIMARGLKRGRTRLIGLIIADITNPYSVNVLSGIEAACREKGFTPLVCNTN
FT                   NEVDQELHYLDLLRSYQVEGIVVNAVGMREEGLNRLQQSSLPMVLIDRKIPEFACDVVG
FT                   LDNTQAATTATEHLIEQGFEAILFLSEPLGMVNTRRERLNAFRATLERYPGVIAENAET
FT                   PLHEADQLDNTLRQFHTRHRGMRKAVISANGALTLQVARSLKRIGLHWGSDIGLLGFDE
FT                   LEWAELAGVGITTLKQPTWQIGYAAVEQVVRRIEGISDAVREQVFSGELIVRGSTAR"
FT   gene            complement(218450..219112)
FT                   /gene="ompA"
FT                   /locus_tag="ECL_00220"
FT   CDS_pept        complement(218450..219112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ompA"
FT                   /locus_tag="ECL_00220"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59787"
FT                   /db_xref="GOA:A0A0H3CGU6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGU6"
FT                   /protein_id="ADF59787.1"
FT                   /translation="MKKRVLVIAALVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSLV
FT                   GAGVGALSSSKKDRGKGALIGAAAGAALGGGVGYYMDVQEAKLRDKMKGTGVSVTRSGD
FT                   NIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYNKTAVNVIGYTDSTGSQELNMR
FT                   LSQQRADSVASSLITQGVEANRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPIQ"
FT   gene            complement(219132..219257)
FT                   /locus_tag="ECL_00221"
FT   CDS_pept        complement(219132..219257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59788"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD90"
FT                   /protein_id="ADF59788.1"
FT                   /translation="MQVYGLVIEAVYGLSQISELSPEFSPYPDVIINCHVRRGKE"
FT   gene            219277..221598
FT                   /locus_tag="ECL_00222"
FT   CDS_pept        219277..221598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00222"
FT                   /product="molybdopterin guanine dinucleotide-containing
FT                   S/N-oxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59789"
FT                   /db_xref="GOA:A0A0H3CDW5"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDW5"
FT                   /protein_id="ADF59789.1"
FT                   /translation="MSTSTKTILTAAHWGPMLVETDGENVLSSRGALPTQHPNSLQTVV
FT                   RDQVHSKTRVRWPMVRKGFLASPDKPQGIRGQDEFVRVSWDDALALIHAQHKRIRDSYG
FT                   PASIFAGSYGWRSNGVLHKASTLLQRYMSLAGGYTGHLGDYSTGAAQAIMPYVVGGNEV
FT                   YQQQTSWPLVLEHTEVVVLWSANPLNTLKIAWNASDEQGIGYFDALRKSGKRIICIDPM
FT                   RSETMDFFGDSAEWLAPHMGTDVAMMLGIAHTLVEKGWHDADFLARCTSGFDKFADYLT
FT                   GKTDGVAKTAAWAADICGIPADKLRELAALFHENTTMLMSGWGMQRQQFGEQKHWMLVT
FT                   LAAMLGQIGTPGGGFGLSYHFANGGNPTRKAAVLASMQGSVKGGVDAVDKIPVARIVEA
FT                   LENPGGFYQHNGLDRHFPDIKFVWWAGGANFTHHQDTNRLIRAWQKPELVVISECFWTA
FT                   SAKHADIVLPATTSYERNDLTMTGDYSNQHMVPMKRVVAPRDEARDDFDVFAELSERWE
FT                   AGGRERFTEGKTDLEWLETFYQIAAQRGAAQGVTLPPFAEFWEANAIFEMPESEQNAQF
FT                   VRFADFRRDPENHPLKTESGKIVIYSERIARFGYADCPAHPTWLEPDEWHGNAQPEQLQ
FT                   VLSAHPAHRLHSQLNYSSLREQYAVAGREPITLHAEDAKARGIADGDLVRVWNHRGQVL
FT                   AGAVVSDGIKPGVICIHQGAWPDLDESGICKNGAVNVLTKDLPSSKLGNGCAGNTALAW
FT                   VEKYQGPELTLTAFDPPASS"
FT   gene            complement(221561..222007)
FT                   /locus_tag="ECL_00223"
FT   CDS_pept        complement(221561..222007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59790"
FT                   /db_xref="GOA:A0A0H3CEV2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEV2"
FT                   /protein_id="ADF59790.1"
FT                   /translation="MIRKWQSENTASLLSLWLESTTEAHPFIEASYWKENEAMVRDVYL
FT                   PSAETWVWEQDGEPYGFISVMQSQFVGALFVAPAYIGKGIGRALLNHVQQRFPHLSLEV
FT                   YQKNVRAVNFYHAQGFRIEDSAWQDDTQHPTWIMSWQADQTPSE"
FT   gene            complement(221985..222566)
FT                   /locus_tag="ECL_00224"
FT   CDS_pept        complement(221985..222566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00224"
FT                   /product="3-methyl-adenine DNA glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59791"
FT                   /db_xref="GOA:A0A0H3CF64"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF64"
FT                   /protein_id="ADF59791.1"
FT                   /translation="MQRCGWVSQDQLYIDYHDREWGVPETDGKKLFEMICLEGQQAGLS
FT                   WITVLKKRENYRNAFHQFDPVRVAAMTDDDVERLVQDAGIIRHRGKIQAIIGNARAYLA
FT                   MEQNGEPFSEFVWTFVNNDPQITQAATLAEIPASTPASDALSKALKKRGFKFVGSTICY
FT                   AFMQACGLVNDHVTGCFCHPGGHHDPQMAK"
FT   gene            222729..223424
FT                   /locus_tag="ECL_00225"
FT   CDS_pept        222729..223424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00225"
FT                   /product="putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59792"
FT                   /db_xref="GOA:A0A0H3CGV0"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGV0"
FT                   /protein_id="ADF59792.1"
FT                   /translation="MIKKISGRHAVSGLVGISACLLSGHSAFAWQQEYIVSDPQSNTAE
FT                   RYTWDADHQPRYDDILAERIQSSQNAPGLALNLPSGSTSAGAMSVGWNFPLAGHVTTGP
FT                   VVAWRYDGTTPMMINEFGDSVTTQALTDPLWHASVSTLGWRVDTQYGELRPWAQISYNQ
FT                   QYGENQWKSQFGMPQTPAPAQNGNWMDVTVGTDIPFTSHMAAYASLAQGEDSTTGEQFL
FT                   YTLGVSANF"
FT   gene            223663..224865
FT                   /locus_tag="ECL_00226"
FT   CDS_pept        223663..224865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00226"
FT                   /product="oxalate/formate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59793"
FT                   /db_xref="GOA:A0A0H3CD93"
FT                   /db_xref="InterPro:IPR004741"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD93"
FT                   /protein_id="ADF59793.1"
FT                   /translation="MNTSSYNRTRWLTLFGTIVTQFALGSVYTWSLFNSALSDKLGAPI
FT                   SQVAFSFGLLSLGLALSSSVAGKLQERFGVKRVTMASGILLGLGFFLTAYSNNLLMLWL
FT                   SAGVLVGLADGAGYLLTLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDSHLLASVG
FT                   LEKTFMIWGAIVLVMILFGATLMKDAPQQEVKTVNGVMENDFTLAQSMRKPQYWMLAVM
FT                   FLTACMSGLYVIGVAKDIAQGMVKLDAMTAANAVTVISIANLSGRLVLGILSDKIARIR
FT                   VITLGQVVSLVGMAALLFAPLNEATFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAK
FT                   NYGVIYLGFGIGSICGSLIASLFGGFYVTFCVIFALLIISLALSTTIRQPQREVFNEAH
FT                   A"
FT   gene            complement(224867..225034)
FT                   /locus_tag="ECL_00227"
FT   CDS_pept        complement(224867..225034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDW9"
FT                   /protein_id="ADF59794.1"
FT                   /translation="MRKKALSETSTSAVSRPQRERKVAAENVIGANFYKITSLEAYQIK
FT                   VKEAVKASLI"
FT   gene            225147..226799
FT                   /locus_tag="ECL_00228"
FT   CDS_pept        225147..226799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00228"
FT                   /product="phosphoethanolamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59795"
FT                   /db_xref="GOA:A0A0H3CEV6"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEV6"
FT                   /protein_id="ADF59795.1"
FT                   /translation="MLAVYIGLFLNGAVLFRRVEGYFEDLTVRNGIFAAIEVFGSVLAT
FT                   FFLLRLLSLFGRRTWQILASLVVIISAAASYYMTFMNVVIGYGIVASVMTTDIDLSKEV
FT                   VGKGFIVWTILTCLLPLFFIWSNTCRYTLLRQLRTRGQRIRTVAVVLLAGLLVWAPIRL
FT                   MEKQQKRIEKATGVDMPSYGGVVANSYLPSNWLSALGLYAWAQADESSDVKSLMNPTKK
FT                   FHYEAPADGLDDTYVVFVIGETTRWDHMGILGYDRDTTPKLAQEKNLVAYRGYSCDTAT
FT                   KLSLRCMFVREGGASDNPQRTLKEQNVFAVLKQLGFSSDLFAMQSEMWFYTNTLADNIA
FT                   YREQIGAEPRNRGKTVDDMLLLSEMEQSLKNHPQGKHLIVLHTKGSHYSYYQRYTRDFA
FT                   KWQPECIGINKYCSKQELINAYDNSVLYVDTFLSRVIDQLRDKKAIVIYAADHGESINE
FT                   QEHLHGTPRKLAPPEQFRVPMIMWMSDKYLENPDKAKMFAHLKQQAEIKVPRRHVELYD
FT                   TIMGCLGYTSPDGGINENNNWCKLPESSQKAAQ"
FT   gene            226891..226967
FT                   /locus_tag="ECL_tRNA002"
FT   tRNA            226891..226967
FT                   /locus_tag="ECL_tRNA002"
FT                   /product="tRNA-Pro"
FT   gene            227615..229195
FT                   /locus_tag="ECL_00229"
FT   CDS_pept        227615..229195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00229"
FT                   /product="extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59796"
FT                   /db_xref="GOA:A0A0H3CF69"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF69"
FT                   /protein_id="ADF59796.1"
FT                   /translation="MLKLGLSLVAMTVAASVQAKTLVYCSEGSPEGFNPQLFTSGTTYD
FT                   ASSVPIYNRLVEFKTGTTEVIPGLAEKWDVSEDGKTYTFHLRQGVKWQDSKEFKPTRDF
FT                   NADDVVFSFDRQKNAQNPYHKVSGGSYEYFEGMGLPDLIAEVKKVDDKTVQFVLTRPEA
FT                   PFLADLAMDFASILSKEYADNMLKAGTPEKVDLNPIGTGPFQLLQYQKDSRILYKAFPG
FT                   YWGTKPQIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADIARMKQDKNINLMEQAGL
FT                   NVGYLSFNTEKKPFDDVKVRQALTYAVNKEAIIKAVYQGAGVAAKNLIPPTMWGYNDDV
FT                   KDYTYDPEKAKALLKEAGQDKGFTVELWAMPVQRPYNPNARRMAEMVQADWAKIGVQAK
FT                   IVTYEWGEYLKRAKAGEHQAVMMGWTGDNGDPDNFFATLFSCAAAKDGSNYSRWCYKPF
FT                   EDLIQPARATDDHNKRIELYKQAQVVMHDQAPALIVAHSTVYEPVRKEVKGYVVDPLGK
FT                   HHFENVSVE"
FT   gene            complement(229339..229503)
FT                   /locus_tag="ECL_00230"
FT   CDS_pept        complement(229339..229503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGV7"
FT                   /protein_id="ADF59797.1"
FT                   /translation="MTFRGNTTLARHNHYRVAGDHMDEGKSEKGDTDKRGDDKSQTSED
FT                   ELQHNPDSL"
FT   gene            229462..230376
FT                   /locus_tag="ECL_00231"
FT   CDS_pept        229462..230376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59798"
FT                   /db_xref="GOA:A0A0H3CD97"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CD97"
FT                   /protein_id="ADF59798.1"
FT                   /translation="MIMAGERGISPERHAQLLAELGLDKPMWQQYLHYIWGVMHGDLGI
FT                   SLKSRLPVWDEFVPRFKATLELGICAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLALT
FT                   GYSMPIFWWGMMLIMLVSVQLNLTPVSGRVSDMVFLDDSNPLTGFMLIDTAIWGEEGNF
FT                   IDAVAHMILPAMVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIVHALR
FT                   NAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATM
FT                   IILVNLLVDLLYGVVNPRIRHKK"
FT   gene            230386..230640
FT                   /locus_tag="ECL_00232"
FT   CDS_pept        230386..230640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00232"
FT                   /product="dipeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59799"
FT                   /db_xref="GOA:A0A0H3CDX3"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDX3"
FT                   /protein_id="ADF59799.1"
FT                   /translation="MSHVSENKVVAAPVPMTPLQEFWHYFKRNKGAVVGLVYVSVMILI
FT                   AVFANVLAPYNPADQFRDALLAPPAWQDGGSPGSPVGYR"
FT   gene            230627..231289
FT                   /locus_tag="ECL_00233"
FT   CDS_pept        230627..231289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00233"
FT                   /product="dipeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59800"
FT                   /db_xref="GOA:A0A0H3CEW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEW1"
FT                   /protein_id="ADF59800.1"
FT                   /translation="MGTDDVGRDVLSRLMYGARLSLLVGCLVVVLSLIMGIILGLVAGY
FT                   FGGIVDNIIMRIVDIMLALPSLLLALVLVAIFGPSIGNAALALTFVALPHYVRLTRAAV
FT                   LVEVNRDYVTASRVAGAGAMRQMFVNIFPNCLAPLIVQASLGFSNAILDMAALGFLGMG
FT                   AQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKLKQ"
FT   gene            231300..232283
FT                   /locus_tag="ECL_00234"
FT   CDS_pept        231300..232283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00234"
FT                   /product="dipeptide transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59801"
FT                   /db_xref="GOA:A0A0H3CF74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF74"
FT                   /protein_id="ADF59801.1"
FT                   /translation="MALLNVDKLSVHFGDEGTPFRAVDRISYSVNQGEVVGIVGESGSG
FT                   KSVSSLAIMGLIDYPGRVMAENLQFNGQDLKRISEKQRRQLVGAEVAMIFQDPMTSLNP
FT                   CYTVGFQIMEAIKVHQGGNKKTRRQRAIDLLNQVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALVLITHDLALVAEAAH
FT                   KIIVMYAGQVVETGSSHDIFRAPRHPYTQALLRALPEFAQDKARLASLPGVVPGKYDRP
FT                   QGCLLNPRCPYATDKCRAEEPELNQLADGRQSKCHYPLDDAGRPTL"
FT   gene            232280..233293
FT                   /locus_tag="ECL_00235"
FT   CDS_pept        232280..233293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00235"
FT                   /product="dipeptide ABC transporter, ATP-binding protein
FT                   DppF"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59802"
FT                   /db_xref="GOA:A0A0H3CGW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGW1"
FT                   /protein_id="ADF59802.1"
FT                   /translation="MSTQQATTQQPLLQAIDLKKHYPVKKGIFAPERLVKALDGVSFTL
FT                   ERGKTLAVVGESGCGKSTLGRLLTMIETPTGGELYYQGQDLLKHDPQAQKLRRQKIQIV
FT                   FQNPYGSLNPRKKVGQILEEPLLINSNLSKEQRREKALAMMAKVGLKTEHYDRYPHMFS
FT                   GGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFISHDL
FT                   SVVEHIADEVMVMYLGRCVEKGTKDQIFNNPRHPYTQALLSATPRLNPDDRRERIKLTG
FT                   ELPSPLNPPPGCAFNARCIRRFGPCTQLQPQLKDYRGQLVACFAVDQDENGEKPQA"
FT   gene            complement(233337..234287)
FT                   /locus_tag="ECL_00236"
FT   CDS_pept        complement(233337..234287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00236"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59803"
FT                   /db_xref="GOA:A0A0H3CDA1"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDA1"
FT                   /protein_id="ADF59803.1"
FT                   /translation="MSKKEQTLMTPYLHFNRSQWAALRDSVPMTLTEGEIARLKGINED
FT                   LSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKSTT
FT                   ARVLQALLSRWPEHRSVELITTDGFLHPNEVLKERGLMKKKGFPLSYDMHRLVKFVSDL
FT                   KSGVPNVTAPVYSHLIYDRIPGGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVFVSDF
FT                   VDFSIYVDAPEDLLQSWYINRFLKFREGAFTDPDSYFHHYAQLSEEEAVKVATGLWNEI
FT                   NYVNLKENILPTRERASLILTKSEKHAVDQIRLRK"
FT   gene            234605..234680
FT                   /locus_tag="ECL_tRNA003"
FT   tRNA            234605..234680
FT                   /locus_tag="ECL_tRNA003"
FT                   /product="tRNA-Thr"
FT   gene            234689..234773
FT                   /locus_tag="ECL_tRNA004"
FT   tRNA            234689..234773
FT                   /locus_tag="ECL_tRNA004"
FT                   /product="tRNA-Tyr"
FT   gene            234891..234965
FT                   /locus_tag="ECL_tRNA005"
FT   tRNA            234891..234965
FT                   /locus_tag="ECL_tRNA005"
FT                   /product="tRNA-Gly"
FT   gene            234972..235047
FT                   /locus_tag="ECL_tRNA006"
FT   tRNA            234972..235047
FT                   /locus_tag="ECL_tRNA006"
FT                   /product="tRNA-Thr"
FT   gene            235166..236350
FT                   /locus_tag="ECL_00237"
FT   CDS_pept        235166..236350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00237"
FT                   /product="elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59804"
FT                   /db_xref="GOA:A0A0H3CDX8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDX8"
FT                   /protein_id="ADF59804.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALKALEGDAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIKVGEEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREEIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG"
FT   gene            complement(236390..236512)
FT                   /locus_tag="ECL_00238"
FT   CDS_pept        complement(236390..236512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEW6"
FT                   /protein_id="ADF59805.1"
FT                   /translation="MLIRFSNYTLSAEPVSAMIMTKIITDEPGSGVKACKKGIK"
FT   gene            236580..236963
FT                   /gene="secE"
FT                   /locus_tag="ECL_00239"
FT   CDS_pept        236580..236963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="ECL_00239"
FT                   /product="preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59806"
FT                   /db_xref="GOA:A0A0H3CF79"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF79"
FT                   /protein_id="ADF59806.1"
FT                   /translation="MSANTEAQGSGRGLEAMKWVVVAVLLIVAIVGNYLYRDIMLPLRA
FT                   LAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   gene            236965..237510
FT                   /locus_tag="ECL_00240"
FT   CDS_pept        236965..237510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00240"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59807"
FT                   /db_xref="GOA:A0A0H3CGW7"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGW7"
FT                   /protein_id="ADF59807.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFAQVEKA"
FT   gene            237771..238094
FT                   /locus_tag="ECL_00241"
FT   CDS_pept        237771..238094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00241"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59808"
FT                   /db_xref="GOA:A0A0H3CDA7"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDA7"
FT                   /protein_id="ADF59808.1"
FT                   /translation="MEFCKAFNAKTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLL
FT                   KKAAGIKSGSGKPNKDKVGKISRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLV
FT                   VED"
FT   gene            238098..238802
FT                   /locus_tag="ECL_00242"
FT   CDS_pept        238098..238802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00242"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59809"
FT                   /db_xref="GOA:A0A0H3CDY4"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDY4"
FT                   /protein_id="ADF59809.1"
FT                   /translation="MAKLTKRMSVIRDKVDATKQYDINEAIALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLADQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTMGAGV
FT                   AVDQAGLSAAAN"
FT   gene            239095..239592
FT                   /locus_tag="ECL_00243"
FT   CDS_pept        239095..239592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00243"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59810"
FT                   /db_xref="GOA:A0A0H3CEX1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEX1"
FT                   /protein_id="ADF59810.1"
FT                   /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLLRRAVEGTSFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANA
FT                   KFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRDAKE
FT                   AA"
FT   gene            239659..240027
FT                   /locus_tag="ECL_00244"
FT   CDS_pept        239659..240027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00244"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59811"
FT                   /db_xref="GOA:A0A0H3CF84"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF84"
FT                   /protein_id="ADF59811.1"
FT                   /translation="MSITKDQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGP
FT                   AADAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDD
FT                   AEALKKSLEEAGAEVEVK"
FT   gene            240347..244375
FT                   /gene="rpoB"
FT                   /locus_tag="ECL_00245"
FT   CDS_pept        240347..244375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="ECL_00245"
FT                   /product="DNA-directed RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59812"
FT                   /db_xref="GOA:A0A0H3CGX1"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGX1"
FT                   /protein_id="ADF59812.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILD
FT                   LFFEKVIFEIRDNKLQMELVPERLRGETASFDIEADGKVYVEKGRRITARHIRQLEKDD
FT                   IKHIEVPVEYIAGKVAAKDYVDESTGELICPANMELSLDLLAKLSQAGHKRIETLFTND
FT                   LDHGPYISETVRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLDDEGHFVEDLVT
FT                   CRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIKVNEDEMYPGEAGIDIYNL
FT                   TKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIYAVLVAGGVEAEKL
FT                   DKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPHDANGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQRAYDLGTDVRQKVDLNTFSD
FT                   EEVLRLAENLRKGMPIATPVFDGAKEAEIKELLQLGGLPTSGQITLFDGRTGEQFERPV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEDE"
FT   gene            244452..248675
FT                   /gene="rpoC"
FT                   /locus_tag="ECL_00246"
FT   CDS_pept        244452..248675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="ECL_00246"
FT                   /product="DNA-directed RNA polymerase subunit beta'"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59813"
FT                   /db_xref="GOA:A0A0H3CDB2"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDB2"
FT                   /protein_id="ADF59813.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERHQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEYEKDANGEFVAKTSLKDTTIGR
FT                   AILWMIVPKGLPFSIVNQALGKKAISKMLNTCYRILGLKPTVIFADQTMYTGFAYAARS
FT                   GASVGIDDMVIPEKKHEIISEAEAEVAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVS
FT                   KAMMDNLQTETVINRDGVEEQQVSFNSIYMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTLEGITMTPVIEGGDVKEPLRDRVLGRVTAEDILKPGTADILVPRNTLLHEQWCDL
FT                   LEANSVDSVKVRSVVSCDTDFGVCAHCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGSIKLSNAKSVVNSSGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGAVMAKGDGEQVAGGETVANWDPHTMPVITEVSGFIRFTDMIDGQTITR
FT                   QTDELTGLSSLVVLDSAERTTGGKDLRPALKIVDAQGNDVLIPGTDMPAQYFLPGKAIV
FT                   QLEDGVQISSGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIISFG
FT                   KETKGKRRLVITPVDGSEPYEEMIPKWRQLNVFEGERVERGDVVSDGPEAPHDILRLRG
FT                   VHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKATIENAGSSEFLEGEQVEYSR
FT                   VKIANRELEANGKIGATFSRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGELPAAPQVTAEDASASLAELLNAGLG
FT                   GSDNE"
FT   gene            complement(248733..249050)
FT                   /locus_tag="ECL_00247"
FT   CDS_pept        complement(248733..249050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00247"
FT                   /product="phosphotransferase system PTS,
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59814"
FT                   /db_xref="GOA:A0A0H3CDY9"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDY9"
FT                   /protein_id="ADF59814.1"
FT                   /translation="MEDLETTIMELLVNAGAARSAALTALQMARKGDFDEAEKAMEESR
FT                   EYVKHAHTIQTQLIGLDEGTGKLPVNLITVHSQDHLMNAMVIQDLAGDMIELYRRIPLL
FT                   N"
FT   gene            complement(249050..249313)
FT                   /locus_tag="ECL_00248"
FT   CDS_pept        complement(249050..249313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00248"
FT                   /product="phosphotransferase system PTS,
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59815"
FT                   /db_xref="GOA:A0A0H3CEX6"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEX6"
FT                   /protein_id="ADF59815.1"
FT                   /translation="MLVQRMKDAAQKKGVEVTIKAVPVAEFKDNIATADIVLLGPQVKY
FT                   EQAKLQAQAEPLGKKVAVIDMMDYGMMKGDAVLEKALKLLES"
FT   gene            complement(249505..251103)
FT                   /locus_tag="ECL_00249"
FT   CDS_pept        complement(249505..251103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59816"
FT                   /db_xref="GOA:A0A0H3CF91"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF91"
FT                   /protein_id="ADF59816.1"
FT                   /translation="MLRGYRQTKKLTIRIDVQLMALHSRKLSFTRPIMLSFAGILCSFA
FT                   LIAVVVTLSQQKDFLEDYHKINGNFTHNLAVNYTESILRENDYILGRSALYFARNDTLN
FT                   EMLNVNPSQGLQMLMHLQNLMPTVSSISLTDTQGRYLRAPEVLPTEKSKTFDPRTRPWF
FT                   IAQAEASIFSHYTRPYMDYFTGHPTVTLYKPLISPEGRLKGTIAFHLDLTSMGFTLRQM
FT                   VAPVQGEFFVVERDGAVVLHPDPGALFKQYVSEALMDKMTSSEGHLYDKKTKAWYYYYS
FT                   FTNPDWFVIYRVSGATLTDITRHETTIVGWGFALAAIIIILFGLYLRHESRTVLMTIIN
FT                   AIKTGDVNQAPRLEAMLSHTIQSNKAREMAYVRQATHDALTGCKNRRAFDSDVDELLSA
FT                   HQPFALALIDIDNFKSINDTWGHLSGDIVLRNVAREGIQIMQPHNVSVYRYGGEEFAVI
FT                   FQADQIASAFSLLDAWRTAVEKRLWREENLRVTFSAGLGEWHFEPLEELVGSVDNALYS
FT                   AKQQGKNRIIRTSVG"
FT   gene            complement(251374..252507)
FT                   /gene="thiH"
FT                   /locus_tag="ECL_00250"
FT   CDS_pept        complement(251374..252507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiH"
FT                   /locus_tag="ECL_00250"
FT                   /product="thiamine biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59817"
FT                   /db_xref="GOA:A0A0H3CGX9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGX9"
FT                   /protein_id="ADF59817.1"
FT                   /translation="MTTFTDRWRQLNWDDIALRINSKTQADVERALQARHLSRDDMMAL
FT                   LSPAASTFLEPMAQRAQRLTRQRFGNTVSFYVPLYLSNLCANNCTYCGFSMSNRIKRKT
FT                   LDESEIARECAAIREMGFEHLLLVTGEHQSKVGMDYFRQHLPAIRRQFASLQMEVQPLS
FT                   QEEYAELKTLGLDGVMVYQETYHEATYARHHLKGKKQDFFFRLETPDRLGRAGIDKIGL
FT                   GALIGLSDSWRVDCYMVAEHLLWLQQHYWQSRYSISFPRLRPCTGGVEPASVMDERQLV
FT                   QAICAFRLLAPEVELSLSTRESPAFRDRVIPLAINNVSAFSKTQPGGYADDHPELEQFA
FT                   PHDSRRPEAVAAALTAQGLQPVWKDWDSWLGRASQMR"
FT   gene            complement(252504..253274)
FT                   /gene="thiG"
FT                   /locus_tag="ECL_00251"
FT   CDS_pept        complement(252504..253274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="ECL_00251"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59818"
FT                   /db_xref="GOA:A0A0H3CDB7"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDB7"
FT                   /protein_id="ADF59818.1"
FT                   /translation="MLRIADKVFDSHLFTGTGKFASPQLMVDAIRESGSQLVTLALKRV
FT                   DLRHHSDAILAPLLDAGVTLLPNTSGAKTAEEAIFAAQLAREALGTHWLKLEIHPDARW
FT                   LLPDPIETLKAAEKLVQQGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLET
FT                   RAMLEIIIEQATVPVVVDAGIGVPSHAAQALEMGASAVLVNTAIAVADDPIRMARAFRM
FT                   AVEAGLLARESGPGTRSFQAQATSPLTGFLEALS"
FT   gene            complement(253276..253476)
FT                   /gene="thiS"
FT                   /locus_tag="ECL_00252"
FT   CDS_pept        complement(253276..253476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="ECL_00252"
FT                   /product="sulfur carrier protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59819"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDZ3"
FT                   /protein_id="ADF59819.1"
FT                   /translation="MRILFNDEPMKCDDGLTVAALLEKLRQLKPGTALALNQQILPREQ
FT                   WEHQQVSEGDQILLFQVIAGG"
FT   gene            complement(253460..254215)
FT                   /locus_tag="ECL_00253"
FT   CDS_pept        complement(253460..254215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59820"
FT                   /db_xref="GOA:A0A0H3CEY1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEY1"
FT                   /protein_id="ADF59820.1"
FT                   /translation="MNDRDFMRYSRQILLEDIAIDGQQKLLASRVLIVGLGGLGAPAAL
FT                   YLAGAGVGTLVLADDDEVHISNLQRQILFTTEDVNQPKAQITRKRLKQLNPDITLIAHQ
FT                   ERLHGDTLQREVALADAVLDCTDNMATRQAINAACVAQNTPLITASAVGFGGQMMVLTP
FT                   PWAQGCYRCLWPDDAEPERNCRTAGILGPVVGVMGTLQALEAIKLLSGMETERNTLRLF
FT                   DARSSGWRHLALHRASHCPVCGGRNAHSV"
FT   gene            complement(254208..254843)
FT                   /locus_tag="ECL_00254"
FT   CDS_pept        complement(254208..254843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00254"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59821"
FT                   /db_xref="GOA:A0A0H3CF95"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF95"
FT                   /protein_id="ADF59821.1"
FT                   /translation="MYQPDFPCVPFRLGLYPVVDSVAWIERLLACGVRTIQLRIKDKRD
FT                   DEVEADVVAAIALGRRYDARLFINDYWRLAVKHQAYGVHLGQEDLETTDLSAIRDAGLR
FT                   LGVSTHDDMEIDVALAARPSYIALGHVFPTQTKQMPSAPQGLTQLAAHVKRLADYPTVA
FT                   IGGISLERAPAVLDTGVGSIAVVSAITQAADWQAATAQLLKLAGAGDE"
FT   gene            complement(254843..256738)
FT                   /gene="thiC"
FT                   /locus_tag="ECL_00255"
FT   CDS_pept        complement(254843..256738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="ECL_00255"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59822"
FT                   /db_xref="GOA:A0A0H3CGY3"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGY3"
FT                   /protein_id="ADF59822.1"
FT                   /translation="MSTTKLTRREQRAQAQHFIDTLEGTAFPNSKRIYITGSQADIRVP
FT                   MREIQLSPTLIGGSKAHPQYEDNEAVPVYDTSGPYGDPAVAINVQQGLPKLRQPWIDAR
FT                   NDCEELSDRSSAYTKARLADDGLDELRFAGLLTPKRAKAGKCVTQLHYARQGIVTPEME
FT                   FIAIRENMGRERIRSEVLRHQHPGEGFGARLPENITPQFVRDEVAAGRAIIPANINHPE
FT                   SEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYIHETRE
FT                   WILRNSPVPIGTVPVYQALEKVNGIAEDLTWEAFRDTLLEQAEQGVDYFTIHAGVLLRY
FT                   VPMTAKRLTGIVSRGGSIMAKWCLSHHKENFLYEHFREICEICAAYDVSLSLGDGLRPG
FT                   SIRDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHEAP
FT                   FYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLITY
FT                   KIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPFTARAYHDETLPQESGK
FT                   VAHFCSMCGPKFCSMKISQEVRDYAATQTIEVGMADMSKTFRAKGGEIYLKKEEA"
FT   gene            complement(256982..257479)
FT                   /locus_tag="ECL_00256"
FT   CDS_pept        complement(256982..257479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00256"
FT                   /product="anti-RNA polymerase sigma 70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59823"
FT                   /db_xref="GOA:A0A0H3CDC2"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDC2"
FT                   /protein_id="ADF59823.1"
FT                   /translation="MLNQLESLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKES
FT                   FMRLNEKALDDFCQSLVDYLSDGHFNIYERIIREMEGTTPYLAASKLYPLLEANTQQIM
FT                   DYYDSTLENAIDHDNYLEFQQALSDLGEALEERFTLEDKLIALALDHGLDVSHEDNVAR
FT                   PA"
FT   gene            257575..258348
FT                   /locus_tag="ECL_00257"
FT   CDS_pept        257575..258348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00257"
FT                   /product="NADH pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59824"
FT                   /db_xref="GOA:A0A0H3CDZ8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDZ8"
FT                   /protein_id="ADF59824.1"
FT                   /translation="MDRIIEKSDLGWWIVSHEQKLWLPAGEIPYGAAEKFDLVGLPALK
FT                   IGEWQGEPVWLIQQPRRNDMGSVRQVLDQDVGLFQLAGRGVQLAEFYRSHKYCGYCGHT
FT                   MHPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGIHTVLAGFVEV
FT                   GETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMADYDSGEIVIDQKELLE
FT                   ANWYRYDDLPLLPPPGTVARRLIEDTVAMCRADAE"
FT   gene            258389..259453
FT                   /locus_tag="ECL_00258"
FT   CDS_pept        258389..259453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00258"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59825"
FT                   /db_xref="GOA:A0A0H3CEY5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEY5"
FT                   /protein_id="ADF59825.1"
FT                   /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNAELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFTSTIK
FT                   SKADVDKLPVPDPEQELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTVIKKMMYAEPLALHALLDKLAKSVTLYLNAQIKAGAQSVMIFDTWGGVLTGRDYQQF
FT                   SLYYMHKIVDGLLRENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIADARRR
FT                   VGDKVALQGNMDPSMLYAQPARIEEEVASILAGFGQGEGHVFNLGHGIHQDVPPEHAGA
FT                   FVEAVHRLSAQYHK"
FT   gene            259463..260131
FT                   /locus_tag="ECL_00259"
FT   CDS_pept        259463..260131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00259"
FT                   /product="endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59826"
FT                   /db_xref="GOA:A0A0H3CFA1"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFA1"
FT                   /protein_id="ADF59826.1"
FT                   /translation="MDLASLRAQQIELASSVIREDRLDKDPPQYIGGADVGFEQGGEVT
FT                   RAAMVLLKYPSLELVEYKVARIATTMPYIPGFLSFREYPALLAAWEQLSQKPDLLFVDG
FT                   HGISHPRRLGVASHFGLLVDVPTIGVAKKRLCGAFEPLSAEPGALAPLIDKGEQLAWVW
FT                   RSKARCNPLFIATGHRVSMDSALAWVQRCMKGYRLPEPTRWADAVASARPAFVRWQEIQ
FT                   "
FT   gene            260176..260766
FT                   /locus_tag="ECL_00260"
FT   CDS_pept        260176..260766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59827"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGY8"
FT                   /protein_id="ADF59827.1"
FT                   /translation="MLQNPIHLRLEKLESWQHVTFMACLCERMYPNYAAFCKQTEFGDG
FT                   HIYRRILDLIWETLTVKDAKVNFDSQLEKLEEAIPVADDFDLYGVYPAIDACVALSELI
FT                   HSRLSGETLEHAIEVSKASITTVAMLEMTQAGREMTDEELRANPAVEQEWDIQWEIFRL
FT                   LAECEERDIELIKGLRADLREAGESNIGIIFNQ"
FT   gene            260953..261225
FT                   /locus_tag="ECL_00261"
FT   CDS_pept        260953..261225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00261"
FT                   /product="transcriptional regulator HU subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59828"
FT                   /db_xref="GOA:A0A0H3CDC6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDC6"
FT                   /protein_id="ADF59828.1"
FT                   /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDAVQLV
FT                   GFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
FT   gene            261231..261929
FT                   /locus_tag="ECL_00262"
FT   CDS_pept        261231..261929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59829"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE01"
FT                   /protein_id="ADF59829.1"
FT                   /translation="MAVNSFNEGAATPLLSFWRGALALAGVLLLSACSHDTSLPPFTAS
FT                   GYADNQGAVRIWRKDSGGEVHLLSAFSPWHNGNTSTAEYRWQGDDLSFIELNIYGKTPE
FT                   HVKVRFDDHGELSFMQREVNAQKQQLSSDQVALYRYRAGQIRQTSDALRQGRVVLRQGR
FT                   WHTDGTVTTCEGQTVKPDLESWATEHIQRRQRHSSMEVSVAWLEAPEGSQLLLVANEDF
FT                   CTWQPTEKSF"
FT   gene            complement(261977..263269)
FT                   /locus_tag="ECL_00263"
FT   CDS_pept        complement(261977..263269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00263"
FT                   /product="phosphoribosylglycineamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59830"
FT                   /db_xref="GOA:A0A0H3CEZ0"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEZ0"
FT                   /protein_id="ADF59830.1"
FT                   /translation="MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQN
FT                   VAIGVTDIPALLSFAQNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLEGS
FT                   KAFTKDFLARHNIPTAEYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMTLEE
FT                   AEAAVQDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRVGNAD
FT                   TGPNTGGMGAYSPAPVVTDEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMIDKQGN
FT                   PKVIEFNCRFGDPETQPIMLRMKSDLVELCLAACDGKLDEKTSEWDERASLGVVIAAGG
FT                   YPGHYNTGDEIHGLPLEETEGAKVFHAGTKLADDDRVLTNGGRVLCATALGHTVAEAQK
FT                   RAYALMADIHWNGSFSRQDIGYRAIAREQGE"
FT   gene            complement(263285..264874)
FT                   /locus_tag="ECL_00264"
FT   CDS_pept        complement(263285..264874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00264"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59831"
FT                   /db_xref="GOA:A0A0H3CFA6"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFA6"
FT                   /protein_id="ADF59831.1"
FT                   /translation="MQQRRPVRRALLSVSDKAGIVEFAQALSARGVELLSTGGTARLLA
FT                   DKGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMEQHDIAPIDMVVVN
FT                   LYPFAQTVAREGCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYSAIINEMDAN
FT                   EGSLTLDTRFDLAIKAFEHTAAYDSMIANYFGSLVPAYHGESKDPSGRFPRTLNLNFIK
FT                   KQDMRYGENSHQQAAFYIEEEVKEASVATAQQVQGKALSYNNIADTDAALECVKEFNEP
FT                   ACVIVKHANPCGVAVSTSILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAIISRQFV
FT                   EVIIAPSASEEALKITAAKQNVRVLVCGQWAERVPGLDFKRVNGGLLVQDRDLGMVTAA
FT                   DLRVVTKRQPTEQELRDALFCWKVAKFVKSNAIVYAKENMTIGIGAGQMSRVYSAKIAG
FT                   IKAGDEGLEVKGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEVIAAADEHGI
FT                   AMIFTDMRHFRH"
FT   gene            265437..266982
FT                   /locus_tag="ECL_16S01"
FT   rRNA            265437..266982
FT                   /locus_tag="ECL_16S01"
FT                   /product="16S ribosomal RNA"
FT   gene            267179..270085
FT                   /locus_tag="ECL_23S01"
FT   rRNA            267179..270085
FT                   /locus_tag="ECL_23S01"
FT                   /product="23S ribosomal RNA"
FT   gene            270143..270263
FT                   /locus_tag="ECL_5S01"
FT   rRNA            270143..270263
FT                   /locus_tag="ECL_5S01"
FT                   /product="5S ribosomal RNA"
FT   gene            270437..271366
FT                   /locus_tag="ECL_00265"
FT   CDS_pept        270437..271366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00265"
FT                   /product="homoserine O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59832"
FT                   /db_xref="GOA:A0A0H3CGZ4"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGZ4"
FT                   /protein_id="ADF59832.1"
FT                   /translation="MPIRVQDELPAVNFLREENVFVMTTSRATGQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQVDIQLLRIDARESRNTPSEHLNNFYCNFDDIREENFDGLI
FT                   VTGAPLGLVEFNDVAYWPQIKQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTRTEK
FT                   LSGVYEHHILHPHALLTRGFDDSFLAPHSRYADFPAQLIRDYTDLEILAETEDGDAYLF
FT                   ASKDKRIAFVTGHPEYDPHTLAAEYFRDVEAGLNPDVPYNYFPKNDPQNKPRATWRSHG
FT                   NLLFTNWLNYYVYQITPYDLRHMNPTLE"
FT   gene            271637..273238
FT                   /locus_tag="ECL_00266"
FT   CDS_pept        271637..273238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00266"
FT                   /product="malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59833"
FT                   /db_xref="GOA:A0A0H3CDD1"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDD1"
FT                   /protein_id="ADF59833.1"
FT                   /translation="MTQQATTVDELAFTQPYGEQEQQILTAEAVEFLTELVTRFTPQRN
FT                   KLLAARIHQQQEIDNGKLPGFISETASIRRGDWKIRGIPEDLQDRRVEITGPVERKMVI
FT                   NAMNANVKVFMADFEDSLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVL
FT                   ICRVRGLHLPEKHVTWRGEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQAWQEA
FT                   AWWSEVFSYAEDRFNLPRGTIKATLLIETLPAVFQMHEILHALRDHIVGLNCGRWDYIF
FT                   SYIKTLKNHPDRVLPDRQVVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAE
FT                   RNNQVLNKVKADKELEARNGHDGTWIAHPGLADTAMEVFNHVLGDNKNQLFVTRDDDAP
FT                   IAEEQLLAPCSGERTEEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSI
FT                   WQWIHHQKTLSNGKPVTKSLFRQMLAEEMRVIQDELGEHRFSSGRFDDAARLMEQITTS
FT                   DDLIDFLTLPGYRLLA"
FT   gene            273271..274575
FT                   /locus_tag="ECL_00267"
FT   CDS_pept        273271..274575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00267"
FT                   /product="isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59834"
FT                   /db_xref="GOA:A0A0H3CE06"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE06"
FT                   /protein_id="ADF59834.1"
FT                   /translation="MKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTL
FT                   AQNGAVKMWHLLHGGSKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASS
FT                   MYPDQSLYPANSVPSVVDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEAGFG
FT                   GVLNAFELMKSMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADV
FT                   LGVPTLVIARTDADAADLITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAP
FT                   YADLVWCETSTPDLALAKRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQL
FT                   SDMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKEGYTFVSH
FT                   QQEVGTGYFDNVTTIIQGGASSVTALTGSTEEAQF"
FT   gene            274626..276365
FT                   /locus_tag="ECL_00268"
FT   CDS_pept        274626..276365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00268"
FT                   /product="isocitrate dehydrogenase kinase/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59835"
FT                   /db_xref="GOA:A0A0H3CEZ6"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEZ6"
FT                   /protein_id="ADF59835.1"
FT                   /translation="MSRGLELLIAQTILQGFDAQYGRFLEVTSGAQQRFEHADWHAVQQ
FT                   AMKQRIHLYDHHVGLVVEQLRCITDGKNPDAAFLLRVKEHYTHLLPDYPRFEIAESFFN
FT                   SVYCRLFDHRSLSPERLFIFSSQPERRFRTIPRPLAKDFFPDHGWEKLLHRVLTDLPLR
FT                   LPWENKARDIGFIIAHLHESFGEEALSHCHLQVANELFYRNKAAWLVGKLVTPSATVPF
FT                   LLPIHRTDDGELFVDTCLTTSAEASIVFGFARSYFMVYAPLPAALVEWLREILPGKTTA
FT                   ELYMAIGCQKHAKTESYREYLRYVTTADEQFIEAPGIRGMVMLVFTLPGFDRVFKVIKD
FT                   TFAPQKEMTAAHVRACYQLVKEHDRVGRMADTQEFENFVLDKRQIDPALMALLLQEAPA
FT                   KITDLGDKIAISHLYIERRMVPLNIWLEQADGQALKDAIEEYGNAIRQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELSGEPWYSVSPGDVFPEE
FT                   FRHWLCADPRIGPLFEEMHADLFRASYWRGLQTRIKNGHVEDVYAYRRKQRFCIRFSPY
FT                   HAG"
FT   gene            complement(276434..277261)
FT                   /locus_tag="ECL_00269"
FT   CDS_pept        complement(276434..277261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00269"
FT                   /product="transcriptional repressor IclR"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59836"
FT                   /db_xref="GOA:A0A0H3CFB4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFB4"
FT                   /protein_id="ADF59836.1"
FT                   /translation="MVTTVPAKRGRKPAATPAAQQGGQVQSLTRGLKLLEWIAESHSSV
FT                   ALTELAQQAGLPNSTTHRLLTTMQQLGFVRQVGELGHWAVGAHAFIVGSSFLQSRNLLA
FT                   IVHPILRKLMEESGETVNLAVLDQSDHQAIIIDQVQCTQLMRMSAPIGGKLPMHASGAG
FT                   KAFLSQLSEEQVTGLLHRKGLHAYTHATLVSPVHLKEDLALTRKRGYSFDDEEHALGLR
FT                   CIAACIFDEHREPFAAISISGPISRMTDDRVTELGALVIKAAKEVTLAYGGIR"
FT   gene            277455..281138
FT                   /locus_tag="ECL_00270"
FT   CDS_pept        277455..281138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00270"
FT                   /product="B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59837"
FT                   /db_xref="GOA:A0A0H3CGZ9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGZ9"
FT                   /protein_id="ADF59837.1"
FT                   /translation="MSSKVEQLRAQLNERILVLDGGMGTMIQSYRLSEDDFRGERFADW
FT                   PCDLKGNNDLLVLSKPQVIADIHNAYFEAGADIVETNTFNSTTIAMADYQMESLSAEIN
FT                   YEAAKLARACADAWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDQLVAAY
FT                   RESTKALVEGGSDLILIETVFDTLNAKAAIYAVKEEFEALGVELPIMISGTITDASGRT
FT                   LSGQTTEAFYNSLRHAEALSFGLNCALGPDELRQYVQELSRIAECYVTAHPNAGLPNAF
FT                   GEYDLDADTMAAQIREWAESGFLNIVGGCCGTTPEHIAAMSNAVAGLPPRKLPELPVAC
FT                   RLSGLEPLTIGDDSLFVNVGERTNVTGSAKFKRLIKEEKYSEALDVARQQVESGAQIID
FT                   INMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWEVIEKGLKCIQGKGIVNSIS
FT                   MKEGVDIFIHHAKMVRRYGAAVVVMAFDEVGQADTRERKIEICRRAYKILTEEVGFPPE
FT                   DIIFDPNIFAVATGIEEHNNYAQDFIGACEDIKRELPHALISGGVSNVSFSFRGNDPVR
FT                   EAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVILNRRDDATERLLDLA
FT                   EKYRGSKSDDAANVQQAEWRSWDVKKRLEYSLVKGITEFIEQDTEEARQQAARPIEVIE
FT                   GPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASKEQGSSNGKMVIAT
FT                   VKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPADKILRTAREVNADLIGLSGLITPSLD
FT                   EMVNVAKEMERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRTVGVVSALL
FT                   SDTQRDDFVARTRKEYETVRIQHARKKPRTPPVTLQAARDNDLAFDWASYTPPVAHRLG
FT                   VQEVTANIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEEAKRLFKDANDMLDKLSA
FT                   EKALNPRGVVGLFPANRVGDDIEIYRDETRTHVLTVSHHLRQQTEKVGFANYCLADFVA
FT                   PKLSGKADYIGAFAVTGGLEEDALADAFEAQHDDYNKIMVKAIADRLAEAFAEYLHERV
FT                   RKVYWGYAANENLSNEELIRENYQGIRPAPGYPACPEHTEKGTIWQLLDVEAHTGMKLT
FT                   ESFAMWPGASVSGWYFSHPDSKYFAVAQLQRDQIEDYALRKGMSVSEVERWLAPNLGYD
FT                   AD"
FT   gene            281255..282886
FT                   /locus_tag="ECL_00271"
FT   CDS_pept        281255..282886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00271"
FT                   /product="sodium-dependent inorganic phosphate (Pi)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59838"
FT                   /db_xref="GOA:A0A0H3CDD4"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDD4"
FT                   /protein_id="ADF59838.1"
FT                   /translation="MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSSSVEKKP
FT                   LAFCAGIGVTALVQSSNATTLLVTSFVAQDLVALAPALVIVLGADVGTALMARILTFDL
FT                   SWLSPLLIFIGVIFFLGRKQTRAGQLGRVGIGLGLILLALELIVQAVTPITEANGVQVI
FT                   FASLTGDIMLDALIGAVFAIVSYSSLAAVLLTATLTAAGAISFPVALCLVIGANLGSGL
FT                   LAMLNNSAANAAARRVALGSLLFKLVGSLIILPFVHPLANLMDNLSLPKAELVIYFHVF
FT                   YNLVRCLAMVPFAEPMARFCERLIRDEPELDARLKPKHLDTSALDTPALALANAARETL
FT                   RMGDAMETMLEGLQKVMHGEPREEKELRRLADDINVLYTAIKLYLARIPQDELAEEESR
FT                   RWAEIIEMSLNLEQASDIVERMGSEIADKSLAARRAFSVEGLKELEALHEQLLSNLKLA
FT                   MLVFFSSDVPSARRLRRNKHRFRILNRRYSHAHVERLHQQNVQSIETSSLHLGLLGDMK
FT                   RLNSLFCAVAYSVMEQPDEDDERDEY"
FT   gene            complement(282883..283170)
FT                   /locus_tag="ECL_00272"
FT   CDS_pept        complement(282883..283170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00272"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59839"
FT                   /db_xref="GOA:A0A0H3CE11"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE11"
FT                   /protein_id="ADF59839.1"
FT                   /translation="MHKLTPYDPAIALVDDEEIAVFMADALETGDSAYIAKALGVIARA
FT                   KGMSTISQQTGLSREQLYRSFSDKGNPTLKTTLAVMKALGLGLTIKPAGD"
FT   gene            283165..283371
FT                   /locus_tag="ECL_00273"
FT   CDS_pept        283165..283371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00273"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59840"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF01"
FT                   /protein_id="ADF59840.1"
FT                   /translation="MHAHSLLPLGYIAQHFCHKYVSGLAAFVTTTQQHDDAIALVFKID
FT                   SVARTKVDPQLAYTFPHGFYVAR"
FT   gene            283677..284546
FT                   /locus_tag="ECL_00274"
FT   CDS_pept        283677..284546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00274"
FT                   /product="23S rRNA pseudouridine synthase F"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59841"
FT                   /db_xref="GOA:A0A0H3CFB8"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFB8"
FT                   /protein_id="ADF59841.1"
FT                   /translation="MLPTQSIRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGDQ
FT                   VMPGDVVKVNGQLIEPRDAEDLVFIALNKPVGIVSTTEDGERDNIVDFVNHSSRIFPIG
FT                   RLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYIVTVNKPVTDEFIRGMGAGVPILGTV
FT                   TKKCKVKKEAPFAFRITLVQGLNRQIRRMCEYFGYEVTKLERTRIMNVSLSGIPLGEWR
FT                   DLTDDELIELFKLIENSSSEAKPKAKAKPKTQAIKRPVVKAPQSEEKGRGKPAGKRFTQ
FT                   PGRKKKGR"
FT   gene            complement(284614..285558)
FT                   /locus_tag="ECL_00275"
FT   CDS_pept        complement(284614..285558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00275"
FT                   /product="bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59842"
FT                   /db_xref="GOA:A0A0H3CH03"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH03"
FT                   /protein_id="ADF59842.1"
FT                   /translation="MLSAITRLFPLWALLLSILAYYTPTTFTGIGPWVTTLLMLIMFGM
FT                   GVHLKIDDFKRVLSRPAPVAAGIFLHYLVMPLAAWLLAMAFKMPPDLSAGMVLVGSVAS
FT                   GTASNVMIYLAKGDVALSVTISSVSTLVGVIATPLLTRLYVDAHIQVDVMGMLLSILQI
FT                   VVIPIALGLVIHHLFPRVVKAVEPYLPAFSMVCILAIISAVVAGSASHIASVGFVVIIA
FT                   IVLHNTIGLLGGYWGGKLFGFDESTCRTLAIEVGMQNSGLAAALGKIYFSPLAALPGAL
FT                   FSVWHNLSGSLLAGYWSGKPIEEKPQKTDEYRL"
FT   gene            complement(285651..287000)
FT                   /locus_tag="ECL_00276"
FT   CDS_pept        complement(285651..287000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00276"
FT                   /product="aspartate kinase III"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59843"
FT                   /db_xref="GOA:A0A0H3CDD9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041745"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDD9"
FT                   /protein_id="ADF59843.1"
FT                   /translation="MTSFVVAKFGGTSVADYDAMNRSADVVLADPNTRLVVLSASAGVT
FT                   NLLVSLSEGLEATERFVKLDALRKIQFDILERLQNPNVIREEVERLLENITTLAEAASL
FT                   ATSTALTDELVSHGELMSTLLFVEIMRERNVQAQWFDVRKIMRTSDRFGRAEPDVEALA
FT                   ELTNQQLVPRLDEGIVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALHATRVDIWTD
FT                   VPGIYTTDPRVVSAAKRIDVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKD
FT                   PKAGGTLVCKKTENPPLFRALALRRKQTLVTLHSHNMLHSRGFLAEVFGILARHNISVD
FT                   LITTSEVSIALTLDTTGSTSTGDTLLTQSLLIELSELCRVEVEENLALVAIIGNKLSRA
FT                   CGVGKEVFGVLDPFNIRMICYGASSYNLCFLVPAEQAEQVVQKLHQNLFE"
FT   gene            287376..289025
FT                   /locus_tag="ECL_00277"
FT   CDS_pept        287376..289025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00277"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59844"
FT                   /db_xref="GOA:A0A0H3CE15"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE15"
FT                   /protein_id="ADF59844.1"
FT                   /translation="MKNINPTQTAAWQALQKHFDEMKDVTIAELFAKDADRFNKFSATF
FT                   DDLMLVDFSKNRITEETLAKLQDLAKETELADAIKSMFSGEKINRTEDRAVLHVALRNR
FT                   SNTPIIVDGKDVMPEVNAVLEKMKAFSEAIISGSWKGYTGKAITDVVNIGIGGSDLGPF
FT                   MVTEALRPYKNHLNMHFVSNVDGTHIAEVLKNVNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLKIAGDNKHVAKHFAALSTNGKAVGEFGIDTANMFEFWDWVGGRYSLWSAIGLSI
FT                   ILSVGFDNFVELLSGAHAMDKHFSTTAPEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFAAYFQQGNMESNGKYVDRNGNAVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKMV
FT                   PCDFIAPAITHNPLSDHHPKLLSNFFAQTEALAFGKSREVVEQEYRDQGKDPATLEHVV
FT                   PFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGAILNIFTFDQWGVELGKQLA
FT                   NRILPELGDDKAISSHDSSTNGLINRYKAWRA"
FT   gene            289393..289635
FT                   /locus_tag="ECL_00278"
FT   CDS_pept        289393..289635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59845"
FT                   /db_xref="InterPro:IPR025858"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF05"
FT                   /protein_id="ADF59845.1"
FT                   /translation="MKKVLYGIFAISALAATSVYAAPVQVGEAAGSAATSASAGSSTAA
FT                   STSTVSSAVGVALAATGGGDGSNTGTTTTTTTSTQ"
FT   gene            289699..290337
FT                   /locus_tag="ECL_00279"
FT   CDS_pept        289699..290337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00279"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59846"
FT                   /db_xref="InterPro:IPR021308"
FT                   /db_xref="InterPro:IPR023373"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFC4"
FT                   /protein_id="ADF59846.1"
FT                   /translation="MKRPAIILICLLLQACSATTKGLGNSLWDSIFGTPGVHLTDDELQ
FT                   NMPYASQYMQLNDGPQLFVVLAFDENGQQKWVTQDQATIVTQHSRIVKTLLGGDNLLEV
FT                   NNLAADPLSKPNQITDGASWTRTMGWTEHKQVRYATARSTFRWDGTDSVRVGSDETRVR
FT                   VLDEEVTTDRATWHNRFWVDDEGQIRQSLQYLGAGFFPVKTTLIKAAKS"
FT   gene            290334..291071
FT                   /locus_tag="ECL_00280"
FT   CDS_pept        290334..291071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59847"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH08"
FT                   /protein_id="ADF59847.1"
FT                   /translation="MKTLIRVALIASFATPLAWSAGTVKVYTPDSTQPKTLTNAGNLID
FT                   LVGQPRLANSWWTGAVIAERQATVAAEQKHKALLARLTGLAEQEDGDDAAAINSLRQQL
FT                   LALKVTGRQNINLDPDEVRVTEKGNPALEGDYTLWLPAQPSTITVMGLISSPGKKPFTP
FT                   GRDVASYLDEQSLLSGADNSYAWVIYPDGNTQKAPVAYWNKRHVEPMPGSIIFVGFADH
FT                   FWTKAYDGLNADILHSLTQRIPE"
FT   gene            291071..293167
FT                   /locus_tag="ECL_00281"
FT   CDS_pept        291071..293167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00281"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59848"
FT                   /db_xref="InterPro:IPR010344"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDE2"
FT                   /protein_id="ADF59848.1"
FT                   /translation="MKKTYLYSMLALCVSAACHAETYPAPIGPSQSDFGGVGLLQTPTA
FT                   RMAREGEISLNYRDNDQYRYYSASVQLFPWLETTLRYTDVRTKQYSSVDAFSGDQTYKD
FT                   KAFDLKLRLWEESYWMPQVSVGAKDIGGTGLFDAEYIVASKAWGPFDFSLGLGWGYLGT
FT                   SGNVKNPFCTYSDKFCYRDNSYQKAGSINGDQMFHGPAALFGGVEYQTPWQPLRLKLEY
FT                   EGNDYSQEFAGKIEQKSKFNVGAIYRVTDWADVNLSYERGNTVMFGFTLRTNFNDMRPH
FT                   YNDNARPAYQPEPQDAILQHSVVANQLTLLKYNAGLADPKIQVKGDTLYVTGEQVKYRD
FT                   SREGIERANRIIMNDLPEGIRTIRVTENRLNLPQVTTETDVASLKRHLEGEPLGHETEL
FT                   VQKRVEPIVPETTEQGWYIDKSRFDFHIDPVLNQSVGGPENFYMYQLGVMATADLWVTD
FT                   HLLTTGSLFGNIANNYDKFNYTNPPNDTKLPRVRTRVREYVQNDAYVNNLQANYFQYFG
FT                   NGFYGQVYGGYLETMYGGAGAEVLYRPVDSNWAFGIDANYVKQRDWRSAQDMMKFTDYS
FT                   VKTGHLTAYWTPSFAQDVLVKASVGQYLAGDKGGTLDISKHFDSGVVVGGYATITNVSP
FT                   DEYGEGDFTKGVYVSIPLDLFSSGPTRSRAAIGWTPLTRDGGQQLGRKFQLYDMTSDKN
FT                   INFR"
FT   gene            complement(293223..293675)
FT                   /locus_tag="ECL_00282"
FT   CDS_pept        complement(293223..293675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00282"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59849"
FT                   /db_xref="GOA:A0A0H3CE18"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE18"
FT                   /protein_id="ADF59849.1"
FT                   /translation="MERRPTGVRNVTCGENVTLYEPCNLYDCVLGNGVFIGPFVEIQGN
FT                   TRIGDESKIQSHTFICEYVTLGERCFIGHGVMFANDMFRDGKPNTDRNSWGRITVGNDV
FT                   SIGSGATILAVSICDGVVIGAGSVVTKSITEKGVYAGNPARLLRRL"
FT   gene            293772..294182
FT                   /locus_tag="ECL_00283"
FT   CDS_pept        293772..294182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00283"
FT                   /product="phosphate-starvation-inducible protein PsiE"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59850"
FT                   /db_xref="GOA:A0A0H3CF10"
FT                   /db_xref="InterPro:IPR009315"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF10"
FT                   /protein_id="ADF59850.1"
FT                   /translation="MTSLTRPRVEFISTILQTVLNLGLLSLGLILVVFLGKETVHLADV
FT                   LFAPEQTSKYALVEGLVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLIIVD
FT                   HKSPLDVLIYSAAILLLVITLWLCNSKRLKRE"
FT   gene            294329..296023
FT                   /locus_tag="ECL_00284"
FT   CDS_pept        294329..296023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00284"
FT                   /product="PTS system lactose/cellobiose family IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59851"
FT                   /db_xref="GOA:A0A0H3CFC8"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFC8"
FT                   /protein_id="ADF59851.1"
FT                   /translation="MAHSSILERITDVSQKLASEVHLRSLRDSFIISVPFLVLAGLFIM
FT                   LNYVFLDPKGILSGLLSTDTLVQLRNIGERVLNGTMNILSLMLVILIAYHIASKKKHPT
FT                   PVIPAMVALAVFYALMPIETVQTLADGQQARLTGMVSYGSTNAGGVFLAILTAVLSTNL
FT                   FLWISKNKKLQIRLGDDVPSMVVQSFQSMFSIMLTVAIFALVAFSVNLFLHTEIPTLIQ
FT                   HLIQAPLVHLTTNLSGFLVLTTLTNLLFSLGIHPGGIINPILEPPLLVAMQENMSAFAS
FT                   GQIPPHIIVLPFRDLYGHMGGTGSTLALLLAVFVRSHMSSHRNFSRTVIAPGIFNINEP
FT                   VIFGFPVLYNPLMMIPFILYPQINFTIAYFATAWGWVSKIVAYVPWSVPPLISGWLGSG
FT                   GDFRNVILQILLLALGVVIYLPFLTAYERSLIKRSNETIINTLASESEITLQEDNDIHR
FT                   LDGKTIILACNEGMSTSLMASKMRKYCESQNCTLNVYAVNAGKLVDEYKNAQLILLGPQ
FT                   IAYLQETILQDINHHCPVIPLDPQHFSKLDGPEVIHAALPYFKKESV"
FT   gene            296020..297063
FT                   /locus_tag="ECL_00285"
FT   CDS_pept        296020..297063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00285"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59852"
FT                   /db_xref="GOA:A0A0H3CH15"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH15"
FT                   /protein_id="ADF59852.1"
FT                   /translation="MINCAYIGFGKSATRYHLPYVLCRKDKYNVKRIYDIARKPEVEAQ
FT                   PHYQHICFTSRLQDILEDNTLQLVVICTHPDSHFEYARLCLAHGKNVLVEKPFTTTPEE
FT                   AKTLFALAREKGLTVSPFQNRRFDSCYLTMKQAIESGKLGEIVEIESHFDYFRPASETC
FT                   PGSYFDGAFYGLGVHTLDQIIALLGRPQQVGYHLQRQRNPLNPDDAFTVHLYYPKTTAI
FT                   VKTSHLVKIPAPRFTVHGTRGSFIRYGIDQQETSLKAGIMPGHPGFGEDSECAVLEYID
FT                   DAGCSVREELSAVPGDYGRVYDALYDTLSSGKANYVSEHEALTNLDILQKAFQQPTPAI
FT                   VSLEEEA"
FT   gene            297066..297926
FT                   /locus_tag="ECL_00286"
FT   CDS_pept        297066..297926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDE7"
FT                   /protein_id="ADF59853.1"
FT                   /translation="MKRLLNCRASDFRGPITGDSLRDAISASEGRVIMAEIAVQAPPLF
FT                   AEVTNAELLCAFGADLLLLKGIHFQRPALNGGEERFGADPVSQVKCLTGRLTGVNFEVL
FT                   PADDLSSPGAFLPAHLEAVRHADFYCLTGYDKPGVTAGRMCQAIAALRAQTNKLILAAK
FT                   FYNSGLAQPQEYAGYISAGADGAIFSAPGGCRGASEGRVSHIAQAVQSLGGLAITTLSS
FT                   SQEGADCATVRDIGLASKRCGSDMHNFGDAGVAGMADPEALNALSLAIRGRRHTWVRMA
FT                   ASLSR"
FT   gene            297967..298671
FT                   /locus_tag="ECL_00287"
FT   CDS_pept        297967..298671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00287"
FT                   /product="transcriptional regulator, GntR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59854"
FT                   /db_xref="GOA:A0A0H3CE23"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE23"
FT                   /protein_id="ADF59854.1"
FT                   /translation="MPKYMEIYHEVRRRIVVGIYAPDKKLPEGARLAAEFGCSELTITK
FT                   ALDLLVREGLVLRKRGLGSFVKRQVSAASNSHLIGTAQRCATQGKTLTTRVQLYTAVPA
FT                   SADIAQKLQIPEGELVHEIHRVRVIAEIPSIVEYTWMPVALFPRLALSHVQHSIYAYIT
FT                   HELGCTVHSAHMKVTGRNASEQERVWLELTEPTTLIQVEQTAFLDNGKLFEYSCARHLW
FT                   HTFNFETDFVRV"
FT   gene            complement(298775..299665)
FT                   /locus_tag="ECL_00288"
FT   CDS_pept        complement(298775..299665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00288"
FT                   /product="maltose ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59855"
FT                   /db_xref="GOA:A0A0H3CF15"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF15"
FT                   /protein_id="ADF59855.1"
FT                   /translation="MAMVQPKSQKLRLLATHLGLLIFIAAIMFPLLMVIAISLRSGNFA
FT                   TGSLIPDEISWEHWKLALGFSVEHADGRVTPPPFPVLLWLWNSVKVATITAIGIVTLST
FT                   TCAYAFARMKFPGKASLLKGMLIFQMFPAVLSLVALYALFDRLGQYVPFIGLNTHGGVI
FT                   FAYLGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVVFILS
FT                   FIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITVVFLLA
FT                   QRWLVNGLTAGGVKG"
FT   gene            complement(299680..301224)
FT                   /locus_tag="ECL_00289"
FT   CDS_pept        complement(299680..301224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00289"
FT                   /product="maltose ABC transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59856"
FT                   /db_xref="GOA:A0A0H3CFD2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR029345"
FT                   /db_xref="InterPro:IPR030156"
FT                   /db_xref="InterPro:IPR035277"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFD2"
FT                   /protein_id="ADF59856.1"
FT                   /translation="MDVIKKKHWWQSDVLKWSAIGLLCLLVGYLVVLMYVQGEYLFAIM
FT                   TLILSSAGLYIFANRKAYAWRYVYPGVAGMGLFVLFPLICTIAIAFTNYSSTNQLAQER
FT                   ATQVLLDSSYQAGKTFNFGLYPAGDEWKLALTDGESGKTYISDAFKFGGEQKLALKEAP
FT                   ALPEGERANLRIITQNRQALTQLTAVLPDESKVTMSSLRQFSGTQPLYTLADDGTLTNN
FT                   QSGVKYRPNNDIGFYQSVNADGSWGDDKLSPGYTVTIGWDNFTRVFTDEGIQKPFFAIF
FT                   VWTVVFSVLTVLLTVAVGMVLACLVQWEALKGKAIYRVLLILPYAVPSFISILIFKGLF
FT                   NQSFGEINMMLSALFGIKPAWFSDPTTARSMIIIVNTWLGYPYMMILCMGLLKAIPDDL
FT                   YEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTT
FT                   TPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD"
FT   gene            complement(301350..302540)
FT                   /locus_tag="ECL_00290"
FT   CDS_pept        complement(301350..302540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00290"
FT                   /product="maltose ABC transporter periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59857"
FT                   /db_xref="GOA:A0A0H3CH19"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH19"
FT                   /protein_id="ADF59857.1"
FT                   /translation="MKIKTGARVFALSALAAMMISAPALAKIEEGKLVIWINGDKGYNG
FT                   LAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAE
FT                   VTPDKAFQDKLFPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPKLDK
FT                   ELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGLTFLV
FT                   DLIKNKHINADTDYSIAEAAFNKGETAMTINGPWAWTNIDKSKINYGVTLLPTFNGKPS
FT                   KPFVGVLSAGINAASPNKELAKEFLENYLLTDQGLDEVNKDKPLGAVALKSFQDQLAKD
FT                   PRIAATMDNAQKGEIMPNIPQMAAFWYATRTAVINAASGRQTVDAALKDAQGRITK"
FT   gene            302583..302708
FT                   /locus_tag="ECL_00291"
FT   CDS_pept        302583..302708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59858"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDF2"
FT                   /protein_id="ADF59858.1"
FT                   /translation="MVQRHSVSLFDILFPSSQPLRPTPGLCDLCCINLSYECWRT"
FT   gene            302912..304021
FT                   /locus_tag="ECL_00292"
FT   CDS_pept        302912..304021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00292"
FT                   /product="maltose/maltodextrin transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59859"
FT                   /db_xref="GOA:A0A0H3CE26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015855"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE26"
FT                   /protein_id="ADF59859.1"
FT                   /translation="MASVQLRNVTKAWGDVVVSKDINLDIHEGEFVVFVGPSGCGKSTL
FT                   LRMIAGLETITSGDLLIGDTRMNDIPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAG
FT                   AKKEVINQRVTQVAEVLQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSN
FT                   LDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY
FT                   HYPADRFVAGFIGSPKMNFLPVKVTATAIEQVQVELPNRQQVWLPVDSANVQVGANMSL
FT                   GIRPEHLLPSHIADVTLEGEVQVVEQLGHETQIHIQIPAIRQNLVYRQNDVVLVEEGAT
FT                   FAIGLPPERCHLFREDGTACRRLHKEPGV"
FT   gene            304093..305400
FT                   /locus_tag="ECL_00293"
FT   CDS_pept        304093..305400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00293"
FT                   /product="maltose-inducible porin"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59860"
FT                   /db_xref="GOA:A0A0H3CF20"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR023738"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF20"
FT                   /protein_id="ADF59860.1"
FT                   /translation="MMITLRKVPLALAIAAGIMSAQAGAVDFKGYARSGIGWTGSGGEQ
FT                   QCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWESTSP
FT                   AFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLGFGK
FT                   LSLAATRSSESGGSATFADRDANGDRVYDNVVPNDVFDVRLAGLETNPGGTLELGVDYG
FT                   HTNIPDDYYLQPGASKDGWLFTAEHTQSMMKGFNKFVLQYGTDSMTSNGKGIPQGGSVD
FT                   NDGSMWRVLDHGAITLADRWDLMYVGMYQNIDRDNNNGTEWWTVGVRPMFKWTPIMSTL
FT                   LEVGYDNVKSQRTDEKNSQYKITLAQQWQAGDSIWSRPAIRVFATYAKWDEKWGYANNS
FT                   DTGYTSGVAYSDTSAKTFSRGDNDEWTFGAQMEIWW"
FT   gene            305515..306459
FT                   /locus_tag="ECL_00294"
FT   CDS_pept        305515..306459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00294"
FT                   /product="maltose regulon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59861"
FT                   /db_xref="GOA:A0A0H3CFD8"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFD8"
FT                   /protein_id="ADF59861.1"
FT                   /translation="MKMKKSLVALCLSAGLLACVPAVSFADVNFVPQNTSAAPAIPAAA
FT                   LQQLTWTPVDQSKTQSTQLSMGGQQLNVPGISGPVAAYSVPANIGELTLTLTSEVNKQT
FT                   SVFAPNVLILDQNMTPSAFFPSDYFSYQEPGVMSADRLEGVMRLTPALGQQKIYVLVFT
FT                   TEKDLQQTTKLVDPAKAYAKGTGNSVPDIPDPLARHTTDGLVKLKVSTNSASSVLVGPL
FT                   FGSSGTGPVTVGNTAAPVYTAPAATAAATAAPAPAKKAEPVLNDTEEYFNNAIKQAVKR
FT                   GDVDKALKLLDEAERLGSTTARSTFISSVKGKG"
FT   gene            306640..307137
FT                   /locus_tag="ECL_00295"
FT   CDS_pept        306640..307137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00295"
FT                   /product="chorismate pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59862"
FT                   /db_xref="GOA:A0A0H3CH24"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH24"
FT                   /protein_id="ADF59862.1"
FT                   /translation="MSHPALTQLRSLRYFDQIPALDPQQLDWLLLEDSMTKRFEQQGKT
FT                   VTVTMIQEGFVTSADIASELPLLPKEERYWLREILLCADGEPWLAGRTVVPESTLSGPE
FT                   LALQRLGNTPLGRYLFTSSELTRDFIEIGRDAELWGRRSRLRLSGKPLILTELFLPASP
FT                   LY"
FT   gene            307151..308020
FT                   /locus_tag="ECL_00296"
FT   CDS_pept        307151..308020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00296"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59863"
FT                   /db_xref="GOA:A0A0H3CDF7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDF7"
FT                   /protein_id="ADF59863.1"
FT                   /translation="MEWSLTQNKLLAYHRLMRTDKPIGALLLLWPTLWALWVATPGVPP
FT                   LWILGVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGQVTEKEARVLFIVLV
FT                   LLSFLLVLTLNTMTILLSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSE
FT                   SVPLSCWLMFLANILWAVAYDTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGILQVAV
FT                   LALMVAIGRLNGLNWEFYWSVLVAGLLFAYQQKLIAKRERDACFKAFMNNNYVGLVLFL
FT                   GLAMSYFG"
FT   gene            complement(308119..310539)
FT                   /locus_tag="ECL_00298"
FT   CDS_pept        complement(308119..310539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00298"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59864"
FT                   /db_xref="GOA:A0A0H3CE31"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE31"
FT                   /protein_id="ADF59864.1"
FT                   /translation="MSGWPRIYYKLLNLPLSVLVKSKSIPAEPALELGLDTSRPIMYVL
FT                   PYNSKADLLTLRAQCLAHDLPDPLEPLEVDGTLLPRYVFIHGGPRVFTYYTPKEESIKL
FT                   FHDYLDLHRSNPDLDVQMVPVSVMFGRRPGREKGEENPPLRMLNGIQKFFAVSWLGRDS
FT                   FVRFSPSVSLRRMADEHGTDKIIAQKLARVARMHFARQRLAAVGPRLPARQDLFNKLLA
FT                   SKAIARAVEDEARSKKISHEKAQQNAIALMEEIAANFSYEMIRLSDRILGFTWNRLYQG
FT                   INVHNAERVRQLAHDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWPA
FT                   GPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFVEGGRSRTGRLLDPKT
FT                   GTLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGATKEKESLPQMLRGLSK
FT                   LRNLGQGYVNFGEPMPLMTYLNNHVPDWRESIDPIEAVRPAWLTPTVNGIAAELMVRIN
FT                   NAGAANAMNLCCTALLASRQRSLTREQLTEQLDCYLDLMRNVPYSVDSTTPASTASELI
FT                   DHALQMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIAHMLMLPSLMAAIITQHRRISR
FT                   QELLRHVETLYPMLKAELFLRWSKDELAIELDKMTEELRRQGLITVVNDELHINPSRSR
FT                   TLQLLAAGARETLQRYAITFWLLSANPSINRGTLEKESRTLAQRLSVLHGINAPEFFDK
FT                   AVFSSLVLTLRDEGFISDTGDAEPEETLKVYQMLAELITSDVRLTIESATQGE"
FT   gene            310694..311062
FT                   /locus_tag="ECL_00299"
FT   CDS_pept        310694..311062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00299"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59865"
FT                   /db_xref="GOA:A0A0H3CF24"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF24"
FT                   /protein_id="ADF59865.1"
FT                   /translation="MANNTTGLTRIIKAAGYSWKGFRAAWVNEAAFRQEGVAAIVAVII
FT                   ACFLDVDAITRVLLIGSVLLVMIVEILNSAIEAVVDRIGSDFHELSGRAKDMGSAAVLL
FT                   AIITAVITWVTLLWSHFR"
FT   gene            311171..311779
FT                   /locus_tag="ECL_00300"
FT   CDS_pept        311171..311779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00300"
FT                   /product="LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59866"
FT                   /db_xref="GOA:A0A0H3CFE3"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFE3"
FT                   /protein_id="ADF59866.1"
FT                   /translation="MKALTTRQQEVFDLIRDHIGQTGMPPTRAEIAQRLGFRSPNAAEE
FT                   HLKALARKGVIEIVSGASRGIRLLVEEETGIPLVGRVAAGEPLLAQQHIEGHYQVDPGM
FT                   FKPSADFLLRVSGMSMKDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKKQGN
FT                   TVQLLPENNEFSPIVVDLREQNFSIEGLAVGVIRNGEWL"
FT   gene            complement(311795..311908)
FT                   /locus_tag="ECL_00301"
FT   CDS_pept        complement(311795..311908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59867"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH29"
FT                   /protein_id="ADF59867.1"
FT                   /translation="MEKIIGSARRHNALSDAVSSDMKKYREWIKNQATADP"
FT   gene            311895..313181
FT                   /locus_tag="ECL_00302"
FT   CDS_pept        311895..313181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00302"
FT                   /product="DNA-damage-inducible SOS response protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59868"
FT                   /db_xref="GOA:A0A0H3CDG2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDG2"
FT                   /protein_id="ADF59868.1"
FT                   /translation="MIFSNITVPLLGLVDTAVIGHLDSPIYLGGVAIGATATSFLFMLL
FT                   LFLRMSTTGLTAQAYGAKDPLRLARALVQPLILALGAGALIAILRTPLIDLALHVVGGS
FT                   EAVLEQARRFLEIRWLSAPASLANLVLLGWLLGVQYARAPVILLVVGNLLNIVLDLWLV
FT                   MGLHMNVQGAALATAIAEYGTFILGLWMVWRVLVMRGISLALLKSAWRGNIRTLLALNR
FT                   DIMLRSLLLQLCFGALTVFGARLGPDIVAVNAVLMTLLTFTAYALDGFAYAVEAHSGQA
FT                   YGARESGQLRDVWRAACRQSGLVALTFALIYACFGEQIIALLTSLPALRELASHYLIWQ
FT                   VILPVVGVWCYLLDGMFIGATRGAEMRNSMAVAAAGFALTLLTLPWLGNHGLWLSLAVF
FT                   LALRGLSLGFIWHRHWQNNTWLPSRNDIS"
FT   gene            313299..313511
FT                   /locus_tag="ECL_00303"
FT   CDS_pept        313299..313511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00303"
FT                   /product="putative stress-response protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59869"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE36"
FT                   /protein_id="ADF59869.1"
FT                   /translation="MMNKDEIGGNWKQFKGKAKEQWGKLTDDDMTVIEGKRDQLVGKIQ
FT                   ERYGYEKDQAEKEVGDWEKRNDYRW"
FT   gene            complement(313581..314093)
FT                   /locus_tag="ECL_00304"
FT   CDS_pept        complement(313581..314093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00304"
FT                   /product="zinc uptake transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59870"
FT                   /db_xref="GOA:A0A0H3CF29"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF29"
FT                   /protein_id="ADF59870.1"
FT                   /translation="MDKSTKELLAQAEKLCAQRNVRLTPQRLEVLRLMTLQQGAISAYD
FT                   LLDLLRESEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFICDR
FT                   CGVVKEEGAEGVEDIMHTLAARMGFALRHNVIEAHGLCSACVEVEACRHQDACHHDHSI
FT                   LVKKKPR"
FT   gene            314206..314697
FT                   /locus_tag="ECL_00305"
FT   CDS_pept        314206..314697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59871"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFE5"
FT                   /protein_id="ADF59871.1"
FT                   /translation="MMKKPDCIRHWRDVEEPDNSTYPDSNELFSIGAPLARHLGLRRIG
FT                   IHHERLPPGRRTSYPHAESDEEEFIYVLEGYPEAWINGYLWKLEPGDSVGFPAGTGVCH
FT                   TFINNTEEEVRLLVVGEANKKHNRIYYPLNPEYAATREDRWVDHPPQFFGPHDGKPGKK
FT                   "
FT   gene            314867..316177
FT                   /locus_tag="ECL_00306"
FT   CDS_pept        314867..316177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00306"
FT                   /product="conjugative transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59872"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR032811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH35"
FT                   /protein_id="ADF59872.1"
FT                   /translation="MKKHFKFSVVSIAVSLFMANQAGAANTWTESRSDAMGGTGVASGS
FT                   YGSGALINPALLAKAKPDDDVTVILPSVGVQVTDEDNLQDEIDTINDKINHYKDVVDSL
FT                   TPIEVITNPLGSIDQFQGAAKDLADELDYLKGKTARATAGAGIAVSIPNDVLSVAFMAK
FT                   GYAHGRVSSSIDQQDIDYLRSIQNSDAVAAGVALDAALNGTDQITKNLNSTASGRAAIV
FT                   SDYGVAIARQFDLGGVPVSLGVTPKLQKTWIYNYTTSIYDYDSNKWNDSRYRKDDTGFN
FT                   VDAGIAADFGENWTVGVSGQNLMSRDIDTKDIRIRNGRTGEVVSYKDTYQIRPLVTAGA
FT                   AWHNDLVTLTADGDLTETKGFKSEDTSQYVGVGAEVTPLSWLAVRAGYRADMKGNDSNV
FT                   FTGGVGFAPFNTVHVDLMGLYGEDETWGAGAQLSMTF"
FT   gene            316260..317255
FT                   /locus_tag="ECL_00307"
FT   CDS_pept        316260..317255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00307"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59873"
FT                   /db_xref="GOA:A0A0H3CDG7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDG7"
FT                   /protein_id="ADF59873.1"
FT                   /translation="MSSEHQTAFPAHRFSIAPMLDWTDRHCRYFLRQLSRHTLLYTEMV
FT                   TTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAHCAKLAEERGYDEINLNVGCPSDR
FT                   VQNGMFGACLMGNAQLVADCIKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTVAGK
FT                   GECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLDEAK
FT                   THLAHMDGVMVGREAYQNPGILTTVDREIFGVEGADTDPVAVVRAMYPYIERELSNGTY
FT                   LGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADIEVLEQALRLVADKR"
FT   gene            317392..317634
FT                   /locus_tag="ECL_00308"
FT   CDS_pept        317392..317634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00308"
FT                   /product="phage shock protein G"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59874"
FT                   /db_xref="GOA:A0A0H3CE41"
FT                   /db_xref="InterPro:IPR014318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE41"
FT                   /protein_id="ADF59874.1"
FT                   /translation="MLELLFVIGFFVMLLATGVSLLGILAALVVATVVMFIGGLFALTI
FT                   KLLPWLLLAVAVVWVIRAIKSPKLPTYQRNNRFRY"
FT   gene            complement(317819..318802)
FT                   /locus_tag="ECL_00309"
FT   CDS_pept        complement(317819..318802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00309"
FT                   /product="quinone oxidoreductase, NADPH-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59875"
FT                   /db_xref="GOA:A0A0H3CF34"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF34"
FT                   /protein_id="ADF59875.1"
FT                   /translation="MATRIEFHKHGGPDVLNAVEFTPAAPGENEVQVENKAIGINYIDT
FT                   YIRGGLYPPPSLPSGLGTEAAGVVSKVGSAVKHVKEGDRVVYAQSALGAYSSVHNVPAD
FT                   KVALLPNAISFEQAAASFLKGLTVYYLLRKTYEIKPDEQFLFHAAAGGVGLIACQWAKA
FT                   LGAKLIGTVGSAQKAQRALQAGAWQVINYREESIVERLKEVTGGKKVRVVYDSVGKDTW
FT                   EASLDCLQRRGLMVSFGNASGAVTGVNLGILNQKGSLYVTRPSLQGYITNREELLEASN
FT                   ELFSLIASGVIKVDVADAQKYALSDAQRAHEVLESRSTQGSSLLIP"
FT   gene            318863..320275
FT                   /locus_tag="ECL_00310"
FT   CDS_pept        318863..320275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00310"
FT                   /product="replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59876"
FT                   /db_xref="GOA:A0A0H3CFE9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFE9"
FT                   /protein_id="ADF59876.1"
FT                   /translation="MAGNKPFNKQTEPRERDFQVAGLKVPPHSIEAEQSVLGGLMLDNE
FT                   RWDDVAERVVSDDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGFAY
FT                   LAELSKNTPSAANISAYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLAESR
FT                   VFKIAESRANKDEGPKNIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTAGLQP
FT                   SDLIIVAARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLSRVDQT
FT                   RIRTGQLDDEDWARISGTMGILLEKRNIYIDDSSGLTPTEVRSRARRIAREHGGIGLIM
FT                   IDYLQLMRVPSLSDNRTLEIAEISRSLKALAKELHVPVVALSQLNRSLEQRADKRPVNS
FT                   DLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIIIGKQRNGPIGTVRLTFNGQWSR
FT                   FDNYAGPQYDDE"
FT   gene            320292..321371
FT                   /locus_tag="ECL_00311"
FT   CDS_pept        320292..321371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00311"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59877"
FT                   /db_xref="GOA:A0A0H3CH41"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH41"
FT                   /protein_id="ADF59877.1"
FT                   /translation="MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLET
FT                   ARTLPDADAFGVARLEEALRLRAGGITQPILLLEGFFEAADLPTIADQHLHTAVHNEEQ
FT                   LSALETAELSEPVTVWMKLDTGMHRLGVRPEHAQAFYQRLCQCKNVRQPVNIVSHFARA
FT                   DEPDCGATEQQLDIFNTFCEGKPGMRSIAASGGILLWPQSHFDWARPGIILYGVSPLEN
FT                   RPWGPDFGFQPVMSLVSKLIAVREHKAGEPVGYGGTWTSARDTRLGVVAMGYGDGYPRA
FT                   APSGTPVLVNGREVKIVGRVAMDMICVDLGPDAQDKAGDDVVMWGDGLPVERIAEITKV
FT                   SAYELITRLTSRVAMKYID"
FT   gene            321498..322691
FT                   /locus_tag="ECL_00312"
FT   CDS_pept        321498..322691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00312"
FT                   /product="aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59878"
FT                   /db_xref="GOA:A0A0H3CDH0"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDH0"
FT                   /protein_id="ADF59878.1"
FT                   /translation="MFQKVDAYAGDPILSLMERFKEDPRSDKVNLSIGLYYNEDGIIPQ
FT                   LKAVAEAEARLNAAPHGASLYLPMEGLNTYRNAIAPLLFGADHAVLAQKRVATIQTLGG
FT                   SGALKVGADFLKKYFPDSGVWVSDPTWENHVAIFEGAGFKVATYPWFDSETNGVRVDAL
FT                   LEKLNTLPERSIVLLHPCCHNPTGADLTNTQWDAVIEVLKARNLIPFLDIAYQGFGAGM
FT                   EEDAYAIRAVASAGLPVLVSNSFSKIFSLYGERVGGLSVVCEDAEAAGRVLGQLKATVR
FT                   RIYSSPPNFGAQVVATVLGDEQLKASWLAEVVSMRKRILSMRQELVNVLKEAVPGHNFD
FT                   YLLKQRGMFSYTGLSAAQVERLREEFGVYLIASGRMCVAGLNASNVHRVAQAFAAVM"
FT   gene            322909..323622
FT                   /locus_tag="ECL_00313"
FT   CDS_pept        322909..323622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00313"
FT                   /product="acid phosphatase/phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59879"
FT                   /db_xref="GOA:A0A0H3CE46"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR010025"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE46"
FT                   /protein_id="ADF59879.1"
FT                   /translation="MRKITLALSAACLLFSLNSTVVARASAPTPLYTGTTAAILAEQAP
FT                   IHWVSVAQIENSLMGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSEAYLKNPEFWEK
FT                   MNNGWDEFSIPKEVARALIAMHVKRGDSIYFVTGRSQTKTETVSKTLQDDFLIPAASMN
FT                   PVIFAGDKPGQNTKTQWLEQKHIKVFYGDSDNDISAARDVGARGIRVLRASNSTYRPLP
FT                   MAGKFGEEVIVNSEY"
FT   gene            323735..324151
FT                   /locus_tag="ECL_00314"
FT   CDS_pept        323735..324151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00314"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59880"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF38"
FT                   /protein_id="ADF59880.1"
FT                   /translation="MWYQQTLTLSAKPRGFHLVTDEVIGQIRDLSRVKTGLLHLLLQHT
FT                   SASLTLNENCDPTVRSDMERHFLKTVPDNASYEHDYEGADDMPSHIKSSLLGVSLMLPV
FT                   HNGRLLLGTWQGIWLGEHRIHGGSRKIIATLQGE"
FT   gene            324154..324507
FT                   /locus_tag="ECL_00315"
FT   CDS_pept        324154..324507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59881"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFF3"
FT                   /protein_id="ADF59881.1"
FT                   /translation="MTISELLQYCMSKPGAEQSVHSDWKATQIKVGDVLFAMVKEVEGR
FT                   PAASLKTSPELAELLRQQHDDVRPSKHLNKAHWSTVYLDGSLPGSQIYYLVDASYQQAV
FT                   ELLPEATRQQLSV"
FT   gene            complement(324511..327333)
FT                   /locus_tag="ECL_00316"
FT   CDS_pept        complement(324511..327333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00316"
FT                   /product="excision nuclease subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59882"
FT                   /db_xref="GOA:A0A0H3CH46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH46"
FT                   /protein_id="ADF59882.1"
FT                   /translation="MDKIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLYARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPIIKERKGEHT
FT                   KTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVIDRFKVRDDLATRLAESFE
FT                   TALELSGGTAVVSDMDDPNAEELLFSANFACPICGYSMRELEPRLFSFNNPAGACPTCD
FT                   GLGVQQYFDPDRVIQNPELSLAGGAIRGWDKRNFYYFQMLKSLAEHYKFDVEAPWASLS
FT                   PNVHKVILFGSGKENIEFKYMNDRGDTSVRRHPFEGVLHNMERRYKETESSAVREELAK
FT                   FISNRSCATCEGTRLRREARHVFVENTALPTISDMSIGHAMDFFNNLKLSGQRAKIAEK
FT                   VLKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLGTLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGVHGGQVVAEGT
FT                   LKDIMAVPESLTGQYMSGKRKIEVPKQRVAANPEKVLKLTGARGNNLKDVTLTLPVGLF
FT                   TCITGVSGSGKSTLINDTLFPIAQTALNGATLAEPAPYRDIQGLEHFDKVIDIDQSPIG
FT                   RTPRSNPATYTGVFTPVRELFAGVPEARSRGYTPGRFSFNVRGGRCEACQGDGVIKVEM
FT                   HFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEAREFFDAVPALARKLQT
FT                   LMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYILDEPTTGLHFADIQQL
FT                   LDVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGEILVSGTPETVAECEAS
FT                   HTARFLKPLL"
FT   gene            327585..328109
FT                   /gene="ssb"
FT                   /locus_tag="ECL_00317"
FT   CDS_pept        327585..328109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="ECL_00317"
FT                   /product="single-strand DNA-binding protein Ssb"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59883"
FT                   /db_xref="GOA:A0A0H3CDH5"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDH5"
FT                   /protein_id="ADF59883.1"
FT                   /translation="MASRGVNKVILVGNLGQDPEVRYMPSGGAVANITLATSESWRDKA
FT                   TGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQSGQEKYTTEVVV
FT                   NVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQQSAPAPSNE
FT                   PPMDFDDDIPF"
FT   gene            complement(328172..328453)
FT                   /locus_tag="ECL_00318"
FT   CDS_pept        complement(328172..328453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00318"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59884"
FT                   /db_xref="GOA:A0A0H3CE52"
FT                   /db_xref="InterPro:IPR016958"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE52"
FT                   /protein_id="ADF59884.1"
FT                   /translation="MATITTSMVLLRWPLLSAVLMFLASTLNIQFRKSDYAGLAVISTL
FT                   LGLGAACWFATGLLGITLLDIAAVWENIKVVMVEAMSHTPPDWPMVIT"
FT   gene            329137..330678
FT                   /locus_tag="ECL_00319"
FT   CDS_pept        329137..330678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00319"
FT                   /product="EAL domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59885"
FT                   /db_xref="GOA:A0A0H3CF42"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR024744"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF42"
FT                   /protein_id="ADF59885.1"
FT                   /translation="MLRVVGIIMVVMLPVMLALWFAQLRAVSETSAQLRTFAELALDKT
FT                   ELVIEQVDLARAEAEKYQGKVCTPSHRQYMLNVVRGRLFIADLIYAEGQNFRCSSIFTP
FT                   DRPYAISPANYIRKPDIAIYYYRDTPFFTGYKMTYMQRGNYVVVVNPLSYSEVMSTDHS
FT                   LSWGVYDTVTNAFFSVSQKANVSLLNSMIRDKDVVFQKDDRFYTVVKSDKRPIAAIVST
FT                   SNKRFYETLYHQATLTLPLGMICSIIILLVWSRTHRELNSPGRLLHRALNKRQLCVHYQ
FT                   PIIDIKNNQCVGAEALLRWPGFNGPVMSPAEFIPLAEKEGMSERITDYVVEEVFSDLGH
FT                   FLAAHPDLYISINLSATDFHSSRLIAMISDKARHYAVRAQQIKIEVTERGFIDVPKTTP
FT                   VIQAFRQAGYEVAIDDFGTGYSNLHNLYSLNVDILKIDKSFIDTLTTNSTSHLIAEHII
FT                   EMAQSLRLKTIAEGVETAEQVSWLLKRGVQFCQGWHFAKAMPPQEFMTWQQQPLH"
FT   gene            complement(330684..331010)
FT                   /locus_tag="ECL_00320"
FT   CDS_pept        complement(330684..331010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00320"
FT                   /product="DNA-binding transcriptional regulator SoxS"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59886"
FT                   /db_xref="GOA:A0A0H3CFF7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFF7"
FT                   /protein_id="ADF59886.1"
FT                   /translation="MSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRTV
FT                   MHQTLGEYIRQRRLLLAAQALRSTQRPIFDIAMDLGYVSQQTFSRVFRREFDRTPSDYR
FT                   HQLN"
FT   gene            331108..331566
FT                   /locus_tag="ECL_00321"
FT   CDS_pept        331108..331566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59887"
FT                   /db_xref="GOA:A0A0H3CH49"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010211"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH49"
FT                   /protein_id="ADF59887.1"
FT                   /translation="MEKRLPRIKALLTPGEVAKRSGVAVSALHFYESKGLIKSIRNAGN
FT                   QRRYTRDVLRYVAIIKIAQRIGIPLATIGEAFGVLPEGHTLSPKEWKELSSQWREELDR
FT                   RIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDKLGEQGTGARLLEED"
FT   gene            331879..332550
FT                   /locus_tag="ECL_00322"
FT   CDS_pept        331879..332550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00322"
FT                   /product="glutathione S-transferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59888"
FT                   /db_xref="GOA:A0A0H3CDI0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDI0"
FT                   /protein_id="ADF59888.1"
FT                   /translation="MLTVHHLNQSRSHRVIWALEELSLPYEIVHYQREKTMLAPESLKR
FT                   VHPLGKSPVIEDNGLILAESGAILEYLQETYDAESQLKPLDPAHKVQYRFWLHYAEGSL
FT                   MPLLLMKLVFSSLGKPPVPFGIRTLGKALGQGVQKAYLNPQLETHARFIESHLAENSWF
FT                   AGETLSMADIQMSFPIFALLARGGVEDLPHTHAWKKKVENRPAWQRTLEQGGPLTIPGE
FT                   A"
FT   gene            332849..334198
FT                   /locus_tag="ECL_00323"
FT   CDS_pept        332849..334198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59889"
FT                   /db_xref="GOA:A0A0H3CE55"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE55"
FT                   /protein_id="ADF59889.1"
FT                   /translation="MSTPSARTGGSLDAIFKISARGSTVRQEIVAGLTTFLAMVYSVIV
FT                   VPGMLGKAGFPPAAVFVATCLVAGVGSIVMGLWANLPMAIGCAISLTAFTAFSLVLGQH
FT                   ISVPVALGAVFLMGVLFTIISATGIRSWILRNLPHGVAHGTGIGIGLFLLLIAANGVGL
FT                   VIKNPLDGLPVALGHFASFPVIMSLIGLAVIIGLEKLKVPGGILLTIIGVSIVGLIFDP
FT                   TVHFSGIFAMPSLSDDNGNSLIGSLDIVGALNPVILPSVLALVMTAVFDATGTIRAVAG
FT                   QANLLDKDGQIIDGGKALTTDSLSSVFSGLVGASPAAVYIESAAGTAAGGKTGLTAITV
FT                   GVLFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVAKIDFADFVDAMSGLITAVFIV
FT                   LTCNIVTGIMIGFASLVIGRLVSGEWRKLNIGTVVIAVALVVFYAGGWAI"
FT   gene            334349..335995
FT                   /locus_tag="ECL_00324"
FT   CDS_pept        334349..335995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59890"
FT                   /db_xref="GOA:A0A0H3CF46"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF46"
FT                   /protein_id="ADF59890.1"
FT                   /translation="MEIFFTILIMTLVVSLSGVVTRVLPFQVPLPLMQIAIGALLAWPT
FT                   FGLHVEFDPELFLVLFIPPLLFADGWKTPTREFLEHGREIFGLALALVVVTVVGIGFLI
FT                   YWVVPGIPLIPAFALAAVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGLVAL
FT                   KFAVAVAMGTMIFTVGGATLEFFKVAIGGILAGFVVSWLYGRSLRFLSRWGGDEPATQI
FT                   VLLFLLPFASYLIAEHIGVSGILAAVAAGMTITRSGVMRRAPLAMRLRANSTWAMLEFV
FT                   FNGMVFLLLGLQLPGIMESSLVAAEADPNVEVWMLFTDIVLIYMALMLVRFGWLWTMKN
FT                   FSVRFLKKKPMEFGSWTTRELLIASFAGVRGAITLAGVLSIPLLLPTGDVFPARYELVF
FT                   LAAGVILFSLFVGVIMLPILLQHIDAGDATQQHKEERIARAATAEVAIVAIQKMEERLA
FT                   ADAEENIDNQLLTEVSSRVIGNLRRRADGRNDVESSLQEENLERRFRLAALRSERAELY
FT                   HLRATRQISNETLQKLLHDLDLLEALLIENQ"
FT   gene            complement(336072..336959)
FT                   /locus_tag="ECL_00325"
FT   CDS_pept        complement(336072..336959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00325"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59891"
FT                   /db_xref="GOA:A0A0H3CFG1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFG1"
FT                   /protein_id="ADF59891.1"
FT                   /translation="MDIRTLRYFVEVVRQQSFTRAAEKLFVTQPTISKMLKNLEDELNC
FT                   TLLIRDGRKLLLTDTGRVVFERGLAILAEFRQLEAELDDINHLTKGVLRLGIPPMVGMM
FT                   MAGPISLFRQRYPGVELKISEFGGLTVQQAVTNGELDVAMTALPVEEESGLATLPLFSH
FT                   PLCVLVPRSGDWLKRDSVKPELLGEYPLLIYNEDFALSRQLMTLFNQHSVKPRIAVRSG
FT                   QWDFLAAMVQAGVGIAILPQPICERLDKNTLRWIPLESDLHWQLGMIWREGIYLSHSAQ
FT                   AWLQCCEGFWVPSP"
FT   gene            337062..337469
FT                   /locus_tag="ECL_00326"
FT   CDS_pept        337062..337469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59892"
FT                   /db_xref="GOA:A0A0H3CH56"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH56"
FT                   /protein_id="ADF59892.1"
FT                   /translation="MAVALSRVTPAVVQRLQVPVQVLLYAGLFVFAEYLVGWLHLPLPA
FT                   NLVGMVLMLTLILCRVIPLSWVRAGARWLLAEMLLFFVPAVVAVVNYAQLLMVDGWRIF
FT                   AVIALSTLMVLGATAWVVDKVYRFEIRRQKT"
FT   gene            337466..338155
FT                   /locus_tag="ECL_00327"
FT   CDS_pept        337466..338155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59893"
FT                   /db_xref="GOA:A0A0H3CDI4"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDI4"
FT                   /protein_id="ADF59893.1"
FT                   /translation="MTNFQISVLCLIATLVIYFANKRLYRRFHALPLMPLVFTPILLVL
FT                   MLVFGHISWQNYIGESHWLLWLLGPATIAFAVPVYDNLNIIKRHWMSLSAGVITATVVA
FT                   VCSSVWLARLFTLPDEIQRSLAVRSVTTPFALAAAKPLGGQPDLVALFVVVTGVFGMAV
FT                   GDMLFLRLSIREGLAKGAGFGAASHGAGTARSYELGQQEGVVASLVMMLSGVLMVLIAP
FT                   LVAWVMF"
FT   gene            complement(338187..339836)
FT                   /locus_tag="ECL_00328"
FT   CDS_pept        complement(338187..339836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59894"
FT                   /db_xref="GOA:A0A0H3CE59"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR014083"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE59"
FT                   /protein_id="ADF59894.1"
FT                   /translation="MKRVLTALAATLPFAAHAADAITGEVQRQPTNWQAIIMFLIFVVL
FT                   TLYITWWASKRVRSRNDYYTAGGNITGFQNGLAIAGDFMSAASFLGISALVYTSGYDGL
FT                   IYSLGFLVGWPIILFLIAERLRNLGRFTFADVASYRLKQGPIRILSACGSLVVVALYLI
FT                   AQMVGAGKLIELLFGLNYHVAVVLVGVLMVMYVLFGGMLATTWVQIIKAVLLLFGASFM
FT                   AFMVMKHVGFSFNNLFTEAMAVHPKGEAIMSPGGLVKDPISALSLGLGLMFGTAGLPHI
FT                   LMRFFTVSDAREARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPAFKDAAGALIGGN
FT                   NMAAVHLADAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVFRKGATER
FT                   EELKVSKITVLILGVVAILLGILFEKQNIAFMVGLAFSIAASCNFPIILLSMYWSKLTT
FT                   RGAMVGGWLGLLTAVILMILGPTIWVQILGHEKALFPYEYPALFSIAVAFIGIWIFSAT
FT                   DNSPEGNLEREKFRAQFIRSQTGLGVEQGRAH"
FT   gene            complement(339833..340147)
FT                   /locus_tag="ECL_00329"
FT   CDS_pept        complement(339833..340147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00329"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59895"
FT                   /db_xref="GOA:A0A0H3CF50"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF50"
FT                   /protein_id="ADF59895.1"
FT                   /translation="MNNDICQQIENSAHYRELVDKRQRFAFLLSIIMLIIYVGFILLIA
FT                   FAPHWLGTPLHEGTSVTRGIPIGIGVIVISFVLTGVYVWRANGEFDRLNKAVLREVKAS
FT                   "
FT   gene            complement(340282..342240)
FT                   /locus_tag="ECL_00330"
FT   CDS_pept        complement(340282..342240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00330"
FT                   /product="acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59896"
FT                   /db_xref="GOA:A0A0H3CFG7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFG7"
FT                   /protein_id="ADF59896.1"
FT                   /translation="MSQIHKHDIPANIADRCLINPEQYHEKYQQSVSDPDAFWGEQGHI
FT                   LDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLAERGNETAIIWEGDDASQ
FT                   SKHISYKELHRDVCRFANVLLDQGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIF
FT                   GGFSPEAVAGRIVDSSSKLVITADEGVRAGRGIPLKKNVDEALKNPNVKTVSNVIVLKR
FT                   TGGKIDWNEGRDLWWSDLIEKASDQHQPQEMNAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPA
FT                   RMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYW
FT                   KKIGNEKCPVMDTWWQTETGGFMITPMPGATRLKAGSATQPFFGVQPALVDNEGNPLDG
FT                   ATEGNLVIVDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVD
FT                   DVLNVSGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELY
FT                   ADVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADP
FT                   GVVEKLLEEKQSIAMPS"
FT   gene            342664..343977
FT                   /locus_tag="ECL_00331"
FT   CDS_pept        342664..343977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00331"
FT                   /product="glutamate/aspartate:proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59897"
FT                   /db_xref="GOA:A0A0H3CH60"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR034703"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH60"
FT                   /protein_id="ADF59897.1"
FT                   /translation="MKNVKVSLAWQILLALVLGILLGSYLHYHSDSREWLIANLLSPAG
FT                   DIFIHLIKMIVVPIVISTLVVGIAGVGDAKQLGRIGAKTILYFEVITTIAIILGITLAN
FT                   VFQPGSGIDMSQLATVDISKYQSTTAEVQSHAHGLMGTILSLVPTNIVASMAKGEMLPI
FT                   IFFSVLFGLGLSSLPATHREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANF
FT                   GFASLWPLAKLVILVHFAILFFALVVLGIVARLCGLSIWILIRILKDELILAYSTASSE
FT                   SVLPRIIEKMEAYGAPASITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSLWQE
FT                   IVLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVV
FT                   GNALAVLVIAKWEHKFDRKKALAYEREVLGRFDKTADQ"
FT   gene            complement(344058..344732)
FT                   /locus_tag="ECL_00332"
FT   CDS_pept        complement(344058..344732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00332"
FT                   /product="Sel1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59898"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDI9"
FT                   /protein_id="ADF59898.1"
FT                   /translation="MKPFLLLLLVFTSFVHADEIGSQYKAQAEAGDARAQYYLADTWFS
FT                   SGDSKQAAMWAEKAAKGGDIDAMALLSQIHFTQGDYAQAKALAQQATIAGSKRGAIMLA
FT                   RVLVNTQGGKTDYPQAIKLLQTATEDIDNDSAVDAQMLLGLIYANGVEVAQDDALAASW
FT                   FKRSSSLSRTGYAEYWAGMLFQQGEKGFITPNKQKALYWLNLSCTEGFDTGCEEFDALS
FT                   GE"
FT   gene            complement(344854..345006)
FT                   /locus_tag="ECL_00333"
FT   CDS_pept        complement(344854..345006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59899"
FT                   /db_xref="GOA:A0A0H3CE65"
FT                   /db_xref="InterPro:IPR000021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE65"
FT                   /protein_id="ADF59899.1"
FT                   /translation="MTPLKTALGIVFIICLTIVIFTFITRGKLCELTIKSEHQEVAAKL
FT                   ACVAG"
FT   gene            complement(345328..347007)
FT                   /locus_tag="ECL_00334"
FT   CDS_pept        complement(345328..347007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00334"
FT                   /product="formate dehydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59900"
FT                   /db_xref="GOA:A0A0H3CF53"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF53"
FT                   /protein_id="ADF59900.1"
FT                   /translation="MSNAINEIDNTDLVFIFGYNPADSHPIVANHVIRAKQNGAKIIVC
FT                   DPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDQAFVATRTEGFEEYRKIVE
FT                   GYTPESVEAITGVSAQEIRQAARMYAGAKTAAILWGMGVTQFYQGVETVRSLTSLAMLT
FT                   GNLGKAHVGVNPVRGQNNVQGACDMGALPDTYPGYQYVKFPENRAKFAKAWGVESLPEH
FT                   TGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKGFEDLELVIVQDIFMTKTAA
FT                   AADVILPSTSWGEHEGVYTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYN
FT                   NTQEIWDELRHLCPDFYGATYEKMGELGYIQWPCRDESEADQGTSYLFKEKFDTPNGLA
FT                   QFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTAD
FT                   AERLGIEDEALVWVNSRKGRIITRAQVSDRPNKGAVYMTYQWWIGACNELVTENLSPIT
FT                   KTPEYKYCAVRVEPIADQHAAEQYVIDEYNKLKARLRESAMG"
FT   gene            complement(347056..347496)
FT                   /locus_tag="ECL_00335"
FT   CDS_pept        complement(347056..347496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00335"
FT                   /product="formate dehydrogenase H"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59901"
FT                   /db_xref="GOA:A0A0H3CFH2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFH2"
FT                   /protein_id="ADF59901.1"
FT                   /translation="MINWSRLMKKVVTVCPYCASGCKIHLVVDNGKIVRAEAAQGKTNQ
FT                   GTLCLKGYYGWDFINDTQILTPRLKTPMIRRERGGKLEAVSWNEALDYVATRLSAIKAK
FT                   YGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARV"
FT   gene            complement(347553..347705)
FT                   /locus_tag="ECL_00336"
FT   CDS_pept        complement(347553..347705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH63"
FT                   /protein_id="ADF59902.1"
FT                   /translation="MLSLNYSAVGSSQMDFYVTELQPMSHPLPFRHVNFDDCLLFVRVL
FT                   PGKHP"
FT   gene            347728..348459
FT                   /locus_tag="ECL_00337"
FT   CDS_pept        347728..348459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00337"
FT                   /product="two component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59903"
FT                   /db_xref="GOA:A0A0H3CDJ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDJ4"
FT                   /protein_id="ADF59903.1"
FT                   /translation="MKPAILVVDDDTAVCELLQDVLSEHVFTVLVCHNGQDALNRVHQE
FT                   PGIALVLLDMMLPDINGLQVLLQLQKQRPDLPVVMLTGLGSESDVVVGLEMGADDYIGK
FT                   PFNPRVVVARVKAVLRRTGALAADTPAPRVAGIAFNGWTLDTTRCELIDPQRNPVPLTQ
FT                   GEYGLLLALTQNARRVLSREQLLELTHSESADVFDRTIDVLIMRLRRKIEANPHQPALI
FT                   KTIRGLGYVFAADVCHPDRAA"
FT   gene            complement(348464..349372)
FT                   /locus_tag="ECL_00338"
FT   CDS_pept        complement(348464..349372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00338"
FT                   /product="putative membrane-bound beta-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59904"
FT                   /db_xref="GOA:A0A0H3CE70"
FT                   /db_xref="InterPro:IPR007803"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="InterPro:IPR039038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE70"
FT                   /protein_id="ADF59904.1"
FT                   /translation="MFAAIIIAIFIISVIYAHSRGKEKQTLSRQLFDHSTFMAPINMFM
FT                   TAFSSLPARQPFFETERFPELNKLTENWEVIREEALRLQDHIKAAQNHNDAGFNTFFKR
FT                   GWKRFYLKWYADAHPSAQILCPVTTQLVSEIPSVKAAMFAELPAGAKLGKHRDPYAGSV
FT                   RYHLGLVTPNDDRCFIEVDQQRHSWRDGEAVIFDETYVHWAENKSDHTRIILFCDIERP
FT                   MKWRWAQAVNHWVGTTLMSAASSPNDDNDRTGGINRIFKYVHAGRERGQRLKKRNRKLY
FT                   YALKYLVITAIFAALIVAAIT"
FT   gene            complement(349515..350522)
FT                   /locus_tag="ECL_00339"
FT   CDS_pept        complement(349515..350522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59905"
FT                   /db_xref="GOA:A0A0H3CF57"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF57"
FT                   /protein_id="ADF59905.1"
FT                   /translation="MERKGIIAAGNMLVDHVHQIVQWPERGWLAEITHSERSTGGAPLN
FT                   VLLTLAKMHVGLPLQAVGLIGEDSDGDYILAMLDQYHVNRQRVQRTTFAPTSMSQVMAD
FT                   PSGQRTFFHSPGANRLLDLPAFDRLDGTMKIFHLGYLLLLDSLDMPDDEYGTRSARLLA
FT                   QMREQGYETSLDLVSRKGDPRYQPLVLPALRHLDYLVINELEAGEFSGLEMRDGNDAPH
FT                   VAHIAEAAAQLLAAGVRQRVVIHCPEGAWGEAANEEGRWIPSWRLTQEEIIGSVGAGDA
FT                   FCAGFLYGCHESLPLAESIYLAHACARASLLAANAIYGAKTLEELTRFIQESSA"
FT   gene            complement(350522..351385)
FT                   /locus_tag="ECL_00340"
FT   CDS_pept        complement(350522..351385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59906"
FT                   /db_xref="GOA:A0A0H3CFH8"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFH8"
FT                   /protein_id="ADF59906.1"
FT                   /translation="MMPLISLADGLAHARQHRYALGAFNVLDTHFLRALFAAAKQERSP
FT                   FIINIAEVHFKYVSLESLVEAVKYEAARHAIPVVLNLDHGLHFDAVVRALRLGFSSVMF
FT                   DGSTLSYEENIRQTREVVKMCHAVGVSVEAELGAVGGDEGGALYGHADEAYFTDPQLAR
FT                   EFVDSTGIDALAVAIGNAHGKYKGEPKLDFPRLDAIRQQTGLPLVLHGGSGISDADFRR
FT                   AIELGIHKINFYTGMSQAALSAVEQRMANRQPLYDEFAELLLGIEEAITDTVAEQMRIF
FT                   GSAGQA"
FT   gene            complement(351393..352079)
FT                   /locus_tag="ECL_00341"
FT   CDS_pept        complement(351393..352079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59907"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH66"
FT                   /protein_id="ADF59907.1"
FT                   /translation="MKRSEINEILGHTRQFFSMHDVHLPPFASFPPTKWQQLDQAAWQE
FT                   VFDLKLGWDVTAFGGSSFAAQGLTLFTLRNGSPNGTPYEKCYAEKIMHVRDGQLTPMHF
FT                   HWRKREDIINRGGGNLIIELWNAGAHAETENTDVTVTIDGCQQTHAPGSQLRLTPGESI
FT                   CLTPGLYHSFWGERGFGDVLVGEVSSVNDDEHDNHFLQPVARYNNIEEDEPAVLVLCNE
FT                   YNLFRI"
FT   gene            complement(352150..353325)
FT                   /locus_tag="ECL_00342"
FT   CDS_pept        complement(352150..353325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00342"
FT                   /product="IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59908"
FT                   /db_xref="GOA:A0A0H3CDK0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDK0"
FT                   /protein_id="ADF59908.1"
FT                   /translation="MPLQTVCQKFFSASLPDVHSFRINVLVSMAVALTHGADLTLTSLG
FT                   RSLPGRAHVKNKIKRVDRALGNTALHRDIPRIQHLLTHTITSLMPFCVIAVDWTGWHDR
FT                   NWYLLRASLVCNGRSLPLMSEVVPAELAQNSDVQCRFLDRLHDAIPKDKAVTIITDAGF
FT                   RTDWFRHVSQLGWSFTGRVRGCISFRLDGDKKWMKISELEATGQPVCVGYGVLSRKPRT
FT                   PCYGRFYLHKRPDAGRQGKGGMPKTQREHRSSAREPWLLFSNAEGLEPHQIMALYSRRM
FT                   QIEQNFRDDKSPRFGFGLRLSRSQGKGRLEVLNMVAAMASLVMWLAGYRAERQCLHWHY
FT                   QASSIRHRRVLSYLSLAEEVIRHEPGKVRRLNIVNEMKKLGKEYSNMVMVA"
FT   gene            complement(353451..354392)
FT                   /locus_tag="ECL_00343"
FT   CDS_pept        complement(353451..354392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00343"
FT                   /product="ribose ABC superfamily ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59909"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE73"
FT                   /protein_id="ADF59909.1"
FT                   /translation="MRLKPLVTALCAGALLAATPFAQAKDLKSIGVTVGDLANPFFVQI
FT                   TKGAELEARKLAGDNVKVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGPAV
FT                   KRAKEAGIVVVAVDVAAEGADATITSDNTQAGEMACKYITDRLNGKGNVVIINGPPVSA
FT                   VQNRVEGCQTEFKKHPDIKVLSDNQNAKGSREGGLEVMTSLLAANPKIDGVFAINDPTA
FT                   IGADLAAKQAQRNEFFIVGVDGSPDGEEALKRENSLFVATPAQDPQVMAAKAVEIGYDI
FT                   LQGKPAPKEPVLIPVTMIDKKNVGTYKGWTVK"
FT   gene            complement(354421..355416)
FT                   /locus_tag="ECL_00344"
FT   CDS_pept        complement(354421..355416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00344"
FT                   /product="ribose ABC superfamily permease component"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59910"
FT                   /db_xref="GOA:A0A0H3CF61"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF61"
FT                   /protein_id="ADF59910.1"
FT                   /translation="MTTPTHPQQVAKSASAKKMLMSDLMQTVGILPILILIVAVFGFIA
FT                   PNFFTESNLLNITRQASINIVLAAGMTFIILTGGIDLSVGSILGTTAVAAMVVSLIPEF
FT                   AGLSIPAALMLGLVLGLFNGALVAFAGLPPFIVTLGTYTALRGAAYLLADGTTVINSNI
FT                   NFEWIGNNYLGPVPWLVVIALAVIVVCWFILRRTTLGVHIYAVGGNMQAARLTGIKVWL
FT                   VLLFVYGMSGLLSGLGGVMSASRLYSANGNLGMGYELDAIAAVILGGTSFVGGIGTITG
FT                   TLVGALIIATLNNGMTLMGVSYFWQLVIKGAVIIIAVLIDKYRTRHHQSA"
FT   gene            complement(355413..356933)
FT                   /locus_tag="ECL_00345"
FT   CDS_pept        complement(355413..356933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00345"
FT                   /product="ribose ABC superfamily ATP binding component"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59911"
FT                   /db_xref="GOA:A0A0H3CFI2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFI2"
FT                   /protein_id="ADF59911.1"
FT                   /translation="MSRTPVLEMRSIAKTFGNFHALKGVDLTVFPGEIHALMGENGAGK
FT                   STLMKILAGAYTATSGEILIDGQPYHIKGPKDALAAGITLIYQEMQLAPNLTVAENIFL
FT                   GSELSRGGLVQRKEMAAQAQAVIDRLGANFNATDLVMKLTIAEQQQVEIARALHRNSRI
FT                   LVMDEPTAALSSRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDGQYVG
FT                   SLTRDKLNASELVKMMVGRPLSDLFNKERDIPLGSPRLNVHHLTDGKKVQPCSLQVRSG
FT                   EIVGLAGLVGAGRSELAQLIFGVRKATGGMIEVDGEPVVIHSPRAAIENGIGFLTENRK
FT                   EQGLFLELAAQENITMATLERDATFGMLNRKKAQSISDDAIALLNIRVPHAQVRAGGLS
FT                   GGNQQKLLISRWVAIGPRILILDEPTRGVDVGAKSEIYRIMNQMARKGVAILMISSELP
FT                   EVVGMSDRVYVMREGSIAGELHGHDISQENIMTLATGVNDSHHQAVQL"
FT   gene            357115..359391
FT                   /locus_tag="ECL_00346"
FT   CDS_pept        357115..359391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00346"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59912"
FT                   /db_xref="GOA:A0A0H3CH69"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH69"
FT                   /protein_id="ADF59912.1"
FT                   /translation="MPSRSPFFASARGRLLIFNLLVVAVTLMVSGVAVLGFRHASQIQE
FT                   QVQQQTLDDMTGSMNLARDTASVATAAVRLSQVVGALEYKGEAERLKQTQMALRHSLEQ
FT                   LADAPLAQQEPGLVARIIRRSNELQQSVTGMLERGQRRHLQRNALLSSLYQSQSYLRHL
FT                   QDINRRFGSNIPDAQQLAEMDRLILAAIDTPSPRATLQQLDAVTATLPQRATQPVVNLV
FT                   LPDFNDELRRLAPLSKQLEESDLAISWYMFHIKALVAILNSDINQYVEQVAEASRLRTA
FT                   QSHQELRSISVFISIFAVLALIITGCACWYIYRNLGSNLTAISRAMSRLAHGEQDVSVP
FT                   ALQRRDELGELARAFNVFARNTASLEHTTRLLKEKTSQMEIDRIERQGLEEALLHSQKM
FT                   KAVGQLTGGLAHDFNNLLAVIIGSLELTDPDSSDAPRIARALNAAERGALLTQRLLAFS
FT                   RKQSLTPHAVEMKPLLENLRELMRHSLPATLSLEIEAQSPAWPAWIDVGQLENAIINLV
FT                   MNARDAMEGQTGVIKIRTWNQRVTRSDGRRQDMVALEVIDRGSGMTQEVKSRVFEPFFT
FT                   TKQTGSGSGLGLSMVYGFVRQSGGRVEIESAPGQGTTVRLHLPRSTLPVVPEDETHSAT
FT                   ASAENERLVLVLEDEADVRQTLCEQLHQLGYLTLEAESGEQALNMLAASPDIGMFISDL
FT                   MLPGSLSGAEVINHVRSHYPQLPVLLISGQDLRPTHNPQLPDVALLRKPFTRVQLAQAL
FT                   RKISA"
FT   gene            359512..360135
FT                   /locus_tag="ECL_00347"
FT   CDS_pept        359512..360135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59913"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDK5"
FT                   /protein_id="ADF59913.1"
FT                   /translation="MIVMPTTYSPNTVARSFTLVDEFELSGRVLHVIYDSQTPRAAIIE
FT                   ADIETFDGVPRHRVVAALDLQHKAHLGKDIIAVERCWEDTRVVQVEGICVDPAERDKGL
FT                   ATRLYEALVLHCGVTLISDFEQYEGGKMLWQKIARESDQIAVFVLDTEQGAFWPYDGSK
FT                   VIYDGGCIPEDRIWSHSPDQKCSGIVLVAENKQRVRQIMEASPR"
FT   gene            360214..360537
FT                   /locus_tag="ECL_00348"
FT   CDS_pept        360214..360537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE79"
FT                   /protein_id="ADF59914.1"
FT                   /translation="MKRYSTALLFGLLSLSSQLAHADVIDDAIGNIQQAINDAYNPGSS
FT                   RSNDDDDRYDDDRRIDSRQYDDRRRQLEDRRRRLDERQRQLDDDRRRLEEDERRLEEDY
FT                   DRG"
FT   gene            complement(360590..361348)
FT                   /locus_tag="ECL_00349"
FT   CDS_pept        complement(360590..361348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00349"
FT                   /product="carbon-phosphorus lyase complex accessory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59915"
FT                   /db_xref="GOA:A0A0H3CF66"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017693"
FT                   /db_xref="InterPro:IPR035682"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF66"
FT                   /protein_id="ADF59915.1"
FT                   /translation="MSLTITLTGTGSAQLVPVFGCDCAACRRARLQENYRRRPCSAAVK
FT                   FNDAVTLLDAGIPHLMDDWPAGSFQQFLLTHYHMDHVQGLFPLRWGVGATIPVYGPPDE
FT                   AGCDDLFKHPGILDFSHMLEPFVMFELQGLRVTPLPLNHSKLTFGYLLESAHSRVAWLS
FT                   DTAGLPEKTVKFLLNNQPQAMIIDCSHEPRPQTPRNHCDLNTVVALNEVIGCPQVILTH
FT                   ISHQFDVWMMDNPLPDGIEAGYDGMVLVLD"
FT   gene            complement(361358..361792)
FT                   /locus_tag="ECL_00350"
FT   CDS_pept        complement(361358..361792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00350"
FT                   /product="aminoalkylphosphonic acid N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59916"
FT                   /db_xref="GOA:A0A0H3CFI7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFI7"
FT                   /protein_id="ADF59916.1"
FT                   /translation="MPDCTLRPATADDAQIVYALICELKQAEFDHQAFHAGYLANLQDH
FT                   NMRYQLAELNGQVVGMIGLHMQFHLHHARWIGEIQELVVMPEARGLKVGSQLLAWAEDT
FT                   ARQAGAELTELSTSVRRLDAHRFYVREGYTQSHFRFTKPL"
FT   gene            complement(361785..362312)
FT                   /locus_tag="ECL_00351"
FT   CDS_pept        complement(361785..362312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00351"
FT                   /product="ribose 1,5-bisphosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59917"
FT                   /db_xref="GOA:A0A0H3CH72"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH72"
FT                   /protein_id="ADF59917.1"
FT                   /translation="MGPSGSGKDSLLSALRQREHPQLLVAHRYITRAANAGSENHIALS
FT                   EQEFFTRAGQNLLALSWHANGYYYGIGIEIDLWLHAGFDVLVNGSRAHLPQARARYASA
FT                   LLPVCLQVSPDVLRSRLQSRGRESEKEIAQRLERAAHYTPADCHILNNDGSLLQSVDNV
FT                   LSLIRQKEKQHA"
FT   gene            complement(362333..363469)
FT                   /locus_tag="ECL_00352"
FT   CDS_pept        complement(362333..363469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00352"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59918"
FT                   /db_xref="GOA:A0A0H3CDL0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDL0"
FT                   /protein_id="ADF59918.1"
FT                   /translation="MIINNVRLVLEDEVINGSIEIRDGAIRAYAETRSHLPEAMDGEGG
FT                   WLLPGLIELHTDNLDKFFTPRPKVDWPAHSAMSSHDALMVASGITTVLDAVAIGDVRDG
FT                   GDRLENLEKMINAVEETQKRGLNRAEHRLHLRCELPHHTTLPLFEKLVDREPVSLVSLM
FT                   DHSPGQRQFASLEKYREYYQGKYSLNDVEMARYEEEQLALAAQWSQPNRVSIAAMCRDR
FT                   NIALASHDDATHNHVRESHQLGSVIAEFPTTFEAAEASRAHGMNVLMGAPNIVRGGSHS
FT                   GNVAASKLASLGLLDILSSDYYPASLLDAAFRVADDDSNCFTLSQAIRLVTKNPASALN
FT                   LHDRGEIAEGKRADLVLAHRKGEHIHIDHVWRQGKRVF"
FT   gene            complement(363466..364146)
FT                   /locus_tag="ECL_00353"
FT   CDS_pept        complement(363466..364146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59919"
FT                   /db_xref="GOA:A0A0H3CE83"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE83"
FT                   /protein_id="ADF59919.1"
FT                   /translation="MIHVENVSKTFVLHQQNGVRLPVLQNASLKVNSGECVVLHGHSGS
FT                   GKSTLLRSLYANYLPDEGHIHIRHADEWVDLVQAPARKVLEVRRSTIGWVSQFLRVIPR
FT                   ISALDVVMQPLLDLGVPRETCAAKAASLLTRLNVPERLWHLAPSTFSGGEQQRVNIARG
FT                   FIVDYPILLLDEPTASLDSKNSAAVVELIEQAKARGAAIVGIFHDESVRNRVADRLHPM
FT                   GTNV"
FT   gene            complement(364232..364987)
FT                   /gene="phnK"
FT                   /locus_tag="ECL_00354"
FT   CDS_pept        complement(364232..364987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnK"
FT                   /locus_tag="ECL_00354"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59920"
FT                   /db_xref="GOA:A0A0H3CF71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF71"
FT                   /protein_id="ADF59920.1"
FT                   /translation="MKPLLSVNNLTHLYAPGKGFSDVSFELWPGEVLGIVGESGSGKTT
FT                   LLKSISARLAPQNGEILYEGASLYGMSEAERRRLLRTEWGVVHQHPLDGLRRQVSAGGN
FT                   IGERLMATGARHYGNIRETAQRWLTDVEIPASRIDDLPTTFSGGMQQRLQIARNLVTHP
FT                   KLVFMDEPTGGLDVSVQARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVMKQGQ
FT                   VVESGLTDRVLDDPLHPYTQLLVSSVLQN"
FT   gene            complement(364984..365829)
FT                   /gene="phnJ"
FT                   /locus_tag="ECL_00355"
FT   CDS_pept        complement(364984..365829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnJ"
FT                   /locus_tag="ECL_00355"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59921"
FT                   /db_xref="GOA:A0A0H3CFJ4"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFJ4"
FT                   /protein_id="ADF59921.1"
FT                   /translation="MANLSGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPMP
FT                   YGWGTGGIQLTASVIGESDVLKVIDQGADDTTNAVSIRNFFKRVTGVNTTEKTEDATLI
FT                   QTRHRIPETPLTEDQILIFQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYEDIAR
FT                   FGHIATTYAYPVKVNGRYVMDPSPIPKFDNPKMDMMPALQLFGAGREKRIYAVPPYTRV
FT                   ESLDFDDHPFTVQEWDEPCAICGSKHSYLDEVVLDDTGKRMFVCSDTDYCRQQSEANSQ
FT                   "
FT   gene            complement(365822..366886)
FT                   /gene="phnI"
FT                   /locus_tag="ECL_00356"
FT   CDS_pept        complement(365822..366886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnI"
FT                   /locus_tag="ECL_00356"
FT                   /product="phosphonate metabolism PhnI"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59922"
FT                   /db_xref="GOA:A0A0H3CH76"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH76"
FT                   /protein_id="ADF59922.1"
FT                   /translation="MYVAVKGGEKAIAAAHALQAHRRRGDEQLPELSVAQIEQQLNLAV
FT                   DRVMTEGGVADRELAALALKQASGDNVEAIFLLRAWRTTVPRLAVSEPVNTAEMRLERR
FT                   ISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGETPTLSTTETGQEASPHVFSLLAKQG
FT                   LAKAEEETGAQPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRNHPFA
FT                   AEIRSGYLDVEIIPEELGFAVNVGELLMTECEMVNGFVAPDDDTPHFTRGYGLVFGMSE
FT                   RKAMAMALVDRALQAPDYGEQISGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAE
FT                   LELLKRLQRERENG"
FT   gene            complement(366886..367470)
FT                   /locus_tag="ECL_00357"
FT   CDS_pept        complement(366886..367470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00357"
FT                   /product="carbon-phosphorus lyase complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59923"
FT                   /db_xref="GOA:A0A0H3CDL5"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDL5"
FT                   /protein_id="ADF59923.1"
FT                   /translation="MTLQPAFTLAVQDAQHSFRRLLKAMSEPGVIVSLHQLSQGWLPLN
FT                   LATTSVLLTLADNDTPVWLSGTLSNDIASQNLRFHTNAPLVEQPRQAVFAVADEQISHE
FT                   QLNALSEGSAVAPETSATLLLQVASLSGGRMLRLTGAGIADERMVAPQLPECIIHELTE
FT                   RPHPFPLGIDLILTCGERLLAIPRTTHVEVC"
FT   gene            complement(367467..367919)
FT                   /locus_tag="ECL_00358"
FT   CDS_pept        complement(367467..367919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59924"
FT                   /db_xref="GOA:A0A0H3CE88"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE88"
FT                   /protein_id="ADF59924.1"
FT                   /translation="MHFDTSTRQRWMRALAHSQPAALASRMNALNLTPDYETLRAPEIG
FT                   LVQIQARMGGTGERFFGGDAALTRAVIRLSSGTLGYSYVLGRDKPHAERCAVIDALLQE
FT                   QPHFQTLMETLIAPLEANLAARTAARQAQVNTSRVDFFTLVRGDNA"
FT   gene            complement(367920..368645)
FT                   /gene="phnF"
FT                   /locus_tag="ECL_00359"
FT   CDS_pept        complement(367920..368645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnF"
FT                   /locus_tag="ECL_00359"
FT                   /product="phosphonate metabolism transcriptional regulator
FT                   PhnF"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59925"
FT                   /db_xref="GOA:A0A0H3CF76"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR012702"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF76"
FT                   /protein_id="ADF59925.1"
FT                   /translation="MHLSRHPTSYPTRWQEIAAKLEVELRTHYRCGDYLPAEQQLADRY
FT                   EVNRHTLRRAIDQLVERGWVQRRQGVGVLVLMRPFDYPLNAQARFSQNLLDQGSHPTSE
FT                   KLLSVLRPASSHVADALGIQEGDNVVHLRTLRRVNGVAVCQIDHYFSDLSLWPVLQHFS
FT                   SGSLHDFLQDATGLVLKRTQTRISARRAQAKESKVLEIPNMAPLLCVRTLNHRDGEINA
FT                   TEYSVSLTRADMIEFTMEH"
FT   gene            complement(368666..369445)
FT                   /gene="phnE"
FT                   /locus_tag="ECL_00360"
FT   CDS_pept        complement(368666..369445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnE"
FT                   /locus_tag="ECL_00360"
FT                   /product="phosphonate ABC transporter, inner membrane
FT                   subunit PhnE"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59926"
FT                   /db_xref="GOA:A0A0H3CFJ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFJ9"
FT                   /protein_id="ADF59926.1"
FT                   /translation="MQTITLPPPKRSWFSLFSWAILLAVLVISWKGAEMDPLLLFKDAG
FT                   NMATFAADFFPPDFSQWQDYLGEMAVTLQIAVWGTALAVILSIPFGLMSAENIVPWWIY
FT                   QPMRRLMDACRAINEMVFAMLFVVAVGLGPFAGVMALFIHTTGVLSKLLSEAVEAIEPG
FT                   PVEGIRATGANKIEEILYGVLPQVMPLLISYSLYRFESNVRSATVVGMVGAGGIGVTLW
FT                   EAIRGFQFQQTCALMVLIIITVSLLDFLSQRLRKHFI"
FT   gene            complement(369562..370578)
FT                   /gene="phnD"
FT                   /locus_tag="ECL_00361"
FT   CDS_pept        complement(369562..370578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnD"
FT                   /locus_tag="ECL_00361"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59927"
FT                   /db_xref="GOA:A0A0H3CH81"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH81"
FT                   /protein_id="ADF59927.1"
FT                   /translation="MSYKTVAALAFTSMFSISTLLSPAYAEEQEKALNFGIISTESQQN
FT                   LKPQWEPFLKDMETKLGIKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANG
FT                   QVFAQTVAADGSPGYWSVLIVNKDSPINNLNDMLAKRKELTFGNGDPNSTSGFLVPGYY
FT                   VFAKNNASASDFKRTVNASHETNALAVANKQVDVATNNTENLDKLKTSAPDKLKELKVI
FT                   WKSPLIPGDPIVWRKNLSESTKDKVYDFFMTYGKTPEEKAVLTRLGWAPFRPSSDLQLV
FT                   PIRQLALFKEMQGVKDNKGLKDEEKTSKVAAIQAQLEDLDRLTAALGAMTSVNKAVQ"
FT   gene            complement(370602..371390)
FT                   /locus_tag="ECL_00362"
FT   CDS_pept        complement(370602..371390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00362"
FT                   /product="phosphonate/organophosphate ester transporter
FT                   subunit PhnC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59928"
FT                   /db_xref="GOA:A0A0H3CDL9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDL9"
FT                   /protein_id="ADF59928.1"
FT                   /translation="MQTVIRVEKLSKTFHHNKALHAVDLTVQQGDMVALLGPSGSGKST
FT                   LLRHLSGLITGDSIPESHVELLGNTVQRAGRLARDIRKSRAQTGCIFQQFNLVNRLTVL
FT                   ENVLIGALGSTPFWRTCLRWFSPLQKQEALRALTRVGMAHFAHQRVSTLSGGQQQRVAI
FT                   ARALMQKAKIILADEPIASLDPESARIVMETLHDINQNDGITVVVTLHQVDYALRYCER
FT                   IVALRQGHVFFDGASHQFDNERFDHLYRSINRVEENAKAA"
FT   gene            complement(371564..372007)
FT                   /locus_tag="ECL_00363"
FT   CDS_pept        complement(371564..372007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00363"
FT                   /product="putative phnB protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59929"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE92"
FT                   /protein_id="ADF59929.1"
FT                   /translation="MPLSPYISFAGNCAEATAFYQQAVGAELLYKITFGEMPKSESSEE
FT                   GCPSGMQFPDSAIAHSNVRIAGSDIMMSDGLPPGSKAQYAGFTLVLDTQDVNEGQRWFD
FT                   NLADGGNIEMAWQETFWAHGFGKVTDKYGVPWMINVVKQQQSS"
FT   gene            complement(372088..372423)
FT                   /gene="phnA"
FT                   /locus_tag="ECL_00364"
FT   CDS_pept        complement(372088..372423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="ECL_00364"
FT                   /product="alkylphosphonate utilization operon protein PhnA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59930"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF82"
FT                   /protein_id="ADF59930.1"
FT                   /translation="MQLPHCPKCNSEYTYEDNGMFICPECAHEWNDAEPSQDADVLIVK
FT                   DANGNLLADGDSVTVVKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMKLK
FT                   SEFVKKN"
FT   gene            373024..375378
FT                   /locus_tag="ECL_00365"
FT   CDS_pept        373024..375378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59931"
FT                   /db_xref="GOA:A0A0H3CFK4"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFK4"
FT                   /protein_id="ADF59931.1"
FT                   /translation="MHTQTIFELSQEAERLLQLALQNLDTLKSMPIAMLESTATAITGE
FT                   KNNVLPLHFSARGVEAQQAMLNSELRKITRLEMVLAIVGTMKAGKSTTINAIVGTEVLP
FT                   NRNRPMTALPTLIRHTPGQKEPVLHFTHVSPIDDLIQLLQKKLCDDDRGKLAQRLEIDK
FT                   DMNTLLERIERGEAFEKHHLGAQPIFHCLKSLNDLVRLSQALDVAFPFSEYAAIEHIPV
FT                   IEVEFVHLAGLDAHLGQLTLLDTPGPNEAGQPHLQKMLTEQLSRASAVLAVMDYTQLKS
FT                   ISDEEVRQAISVAGKSVPLYALVNKFDQKDRNSDDEEQVRAMISGTLMKGNISPGQIYP
FT                   VSSMWAYLANRARYEMANHGQLPDHQEQRWVQDFAEAALGRRWRTADLDDIEHIRHAAD
FT                   LLWEDSLFEQPIRKLIYAAYANASLFALRSASHKLLNYAQNAREYLDFRYQALTVAFES
FT                   LELNITRLEEDMALLQTRQRVASEEVKHEVEQALHATDDFMALQKGALQQAIGHIFNSH
FT                   TLLDLAGIDPLNHRQDAPEALTQLVLDDERQAQTVLNSIRSACEQVMLDAQTKISRELA
FT                   LRFDQLESTLARSLNEAMRPIELRIKEQLSHAGFRARISFPAFQANQLNFNTRALFTDA
FT                   IAEDTRPAGQPSAAGSVRETVSRWLNNPGWGWEDYVATRTRYVIDIAQLHDKFMQHIDQ
FT                   FCEQIRKALTAQVDVSVTAGMATFFAEFSLCLAGLQESLRDSLAVRQQNEHSTRSLSQL
FT                   LKQSITTATWIQEDTRLLRDDIQTLFAAEQP"
FT   gene            375435..376250
FT                   /locus_tag="ECL_00366"
FT   CDS_pept        375435..376250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59932"
FT                   /db_xref="InterPro:IPR025599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH87"
FT                   /protein_id="ADF59932.1"
FT                   /translation="MVDLVQGVDAPRHTHLGPQQLQFRERLTQEIMTHTRLRPWAMAGM
FT                   LNENAALRLGLAEKLAGMLDPGHLALTRMADKLVALRQQTSLRTQPSPGLVQQYAELSS
FT                   HFLQRAAYKEKALSQRGLTVQAGDHSEQIFTRWRAGHYDGWSLAGRCYIVLEELRWGAF
FT                   GDACRLANADVAAMLKDNLRSMAANYLAQGINASPTTRHFYHQWLTTPSTPGSIDHKDM
FT                   LGWLGDWCQADSHPVSWSVTQNWQTVALGMPRLCSAKRLVDGMVEEIFG"
FT   gene            complement(376294..377286)
FT                   /locus_tag="ECL_00367"
FT   CDS_pept        complement(376294..377286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00367"
FT                   /product="2-keto-3-deoxygluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59933"
FT                   /db_xref="GOA:A0A0H3CDM3"
FT                   /db_xref="InterPro:IPR004684"
FT                   /db_xref="InterPro:IPR018395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDM3"
FT                   /protein_id="ADF59933.1"
FT                   /translation="MKIKATIERIPGGMMLVPLVLGAILNTLAPDTGAYFGGFTKGMIT
FT                   GTVPILAVWFFCIGASINLRATGTVLRKSGTLVITKIAVAWVVAMVCALFIPENGIQTG
FT                   FFAGLSVLAIVSAMDMTNGGLYASLMNQYGTKEESGAFVLMSLESGPLMTMLILGSAGL
FT                   ASFEPHHFVGAILPFLIGFALGNLDHDLRDFFSKATPVLIPFFGFALGNTINLKVILDT
FT                   GLLGIVLGVAVIIITGIPLIIADRVIGGGNGTAGVAASSAAGAAVANPVIIAQINPAFE
FT                   PVAASATALVAASVIVTAILVPIITALYAKRFGNLPEPDTEPKAVELHH"
FT   gene            377936..379438
FT                   /locus_tag="ECL_00368"
FT   CDS_pept        377936..379438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00368"
FT                   /product="proline/glycine betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59934"
FT                   /db_xref="GOA:A0A0H3CE97"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR015041"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR036292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE97"
FT                   /protein_id="ADF59934.1"
FT                   /translation="MLRRKKIKPITLRDVTIIDDAKLRKAITAASLGNAMEWFDFGVYG
FT                   FVAYALGKVFFPGADPSLQMIAALGTFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIV
FT                   IMSISTFCIGLIPSYASIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRKRGF
FT                   MGSWLDFGSIAGFVMGAGVVVLISTVVGEANFLEWGWRIPFFLALPLGIIGLYLRHALE
FT                   ETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKHWRSLLVCIGLVISTNVTYYMLLTY
FT                   MPSYLSHNLHYSEDHGVLIIIAIMVGMLFVQPIMGLLSDRFGRRPFIILGSVALFALAI
FT                   PAFILINSNVLGLIFAGLLMLAVILNCFIGVMASTLPAMFPTHIRYSALAAAFNISVLI
FT                   AGLTPTLAASLVESTQNLMMPAYYLMVIAVIGLITGITMKETANRPLKGATPAASDIQE
FT                   AKEILREHYDNVEQKIEDIDAEIEELQKKRSRLVDQHPRINE"
FT   gene            complement(379472..380374)
FT                   /locus_tag="ECL_00369"
FT   CDS_pept        complement(379472..380374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00369"
FT                   /product="high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59935"
FT                   /db_xref="GOA:A0A0H3CF87"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF87"
FT                   /protein_id="ADF59935.1"
FT                   /translation="MTLLLLIAGFTLHAHWGAFIQWCLATQITLHRYLVMYLLQLNNHQ
FT                   YSGGLWLLTGAFFYGVLHAIGPGHGKFIVTTYLSTNKESELAARVVPFFGSMLQGVSAI
FT                   LFVFILAVGFNLASGDISTSRWYVEKISAVLIGAFGAFIIYQALKSLRPRRMAISAITP
FT                   LHQHDEHCGCGHHGVGADLAQGDWKTRLGVILAIGARPCSGAIMILMFSNALGIVTWGM
FT                   AAVMTMSLGTALSIMGLSLAVRYARERTVAWFGGDTSLKWLVPAVKIAGGIVLILFATI
FT                   LFLTVIPISANGDYIAAGC"
FT   gene            380924..382468
FT                   /locus_tag="ECL_16S02"
FT   rRNA            380924..382468
FT                   /locus_tag="ECL_16S02"
FT                   /product="16S ribosomal RNA"
FT   gene            382534..382610
FT                   /locus_tag="ECL_tRNA007"
FT   tRNA            382534..382610
FT                   /locus_tag="ECL_tRNA007"
FT                   /product="tRNA-Ile"
FT   gene            382647..382722
FT                   /locus_tag="ECL_tRNA008"
FT   tRNA            382647..382722
FT                   /locus_tag="ECL_tRNA008"
FT                   /product="tRNA-Ala"
FT   gene            382894..385803
FT                   /locus_tag="ECL_23S02"
FT   rRNA            382894..385803
FT                   /locus_tag="ECL_23S02"
FT                   /product="23S ribosomal RNA"
FT   gene            385862..385985
FT                   /locus_tag="ECL_5S02"
FT   rRNA            385862..385985
FT                   /locus_tag="ECL_5S02"
FT                   /product="5S ribosomal RNA"
FT   gene            386456..386986
FT                   /locus_tag="ECL_00370"
FT   CDS_pept        386456..386986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00370"
FT                   /product="Major fimbrial subunit PmfA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59936"
FT                   /db_xref="GOA:A0A0H3CFK7"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFK7"
FT                   /protein_id="ADF59936.1"
FT                   /translation="MKLNKVAMAVALTAALSSMSAFADTTNGQIEFQGELVNTACGLAP
FT                   GSSPVSVDFGQIPVSALANGARAGNVHQNIELQHCDTTVAQTAEVTYSPTSVNPTDASL
FT                   AAFTSGTASGAGIGLRDSASQDVVWGNATTPVQLVDGTNTIPFVAYVKAESASATVTAG
FT                   SFQSTVNFEIAYQ"
FT   gene            387206..389623
FT                   /locus_tag="ECL_00371"
FT   CDS_pept        387206..389623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00371"
FT                   /product="Outer membrane usher protein PmfC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59937"
FT                   /db_xref="GOA:A0A0H3CH93"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH93"
FT                   /protein_id="ADF59937.1"
FT                   /translation="MSVKLKTNLTIIALLVMNCCYAATARGEERVEFNTDVLDASDRTR
FT                   IDLSRFATDNYVTPGDYLLDIRINGQSVGQEKIRYVESPEGNRTLPCISGDLLNKLALK
FT                   EDARSQIAQIYENCYSLQRLSGAKLSNYAGVLDITVPQAWMKYNDPDWTPPERWDEGIA
FT                   GLIFDYSINGQLTRQFSDNKNYSAISGYGQAGANIGGWRIRGEYQTSYYSQHHQSSFDW
FT                   NQIYAYRPLPMMAAKLTLGEIYLNSQVFDTLRFTGINLASDERMLPPALQGYAPEIHGI
FT                   ARSNAKVTVSQSGRVIYETTVPAGPFNIQDLRSSVRGTLDVRVEEQDGSVSLFQVNTAS
FT                   IPYLTRPGYVRYNLSGGTPSRYNHSLKGPTFLSGDFSWGISNAWSLYGGLQSSGEAYTA
FT                   ASLGIGRDLNALGAISLDATESWSREPDGKRLKGTSYKLSYAKTFDEYNSSITFAGYRF
FT                   SQEDFRTMAQYLDERYQGYDHVGREKQLYTITGSKTFWAGEAGKATTVFLTWTHQNYWN
FT                   QRSQDRYGMSVGRAFRVGDINGITANLSAYRTDYKGRKDDSISFSLSVPIGDNKWAGLD
FT                   VQTNNGKTSPMASYTDNSDFNNLWRVRAGASQNSNASVDGYYLHRSQWAEINTNASYQQ
FT                   NEFMALSTTLRGGFTATRHGAAMHNSGATMNTARVMVDTNGIGGVPLNGEKSRTNRFGI
FT                   AVVPDVVSYNSFDTRVDVDAMDGDIEPARAISTSTLTEGAIGYQAFGMAKGMKMMGTLR
FT                   LVDNSVPPFGAEIYNADGVSVAMVLEDGKAWLAGINANETLNVMWGVNSSAK"
FT   gene            389751..390464
FT                   /locus_tag="ECL_00372"
FT   CDS_pept        389751..390464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00372"
FT                   /product="Chaperone protein PmfD"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59938"
FT                   /db_xref="GOA:A0A0H3CDM7"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDM7"
FT                   /protein_id="ADF59938.1"
FT                   /translation="MAACALSLVAGYAQAGVSLDRTRIIITEKESSSSANLSNTSPDIP
FT                   FLAQSWVEDEKGNKIASPLIVLPPLQRINGGQKGIARVTKTAGIEKLPKDRESLFYLNV
FT                   REIPPKPEKPNTLQLAMQSRIKLFYRPEAVIPKTKGEVWQDRVVFQKSGSEMTVQNPTP
FT                   YYVTILSLTKGDGVKITRFPGIMVAPKSSQTFAVTDAGVSQFSMKFVNDYGGHPELKFR
FT                   CDGNTCKALPPAQQG"
FT   gene            390483..391526
FT                   /locus_tag="ECL_00373"
FT   CDS_pept        390483..391526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00373"
FT                   /product="Putative minor fimbrial subunit PmfE"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59939"
FT                   /db_xref="GOA:A0A0H3CEA1"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA1"
FT                   /protein_id="ADF59939.1"
FT                   /translation="MQHPYPYAALLAMCALGFSGAARSVVDGEIKAVNGTYEYLININN
FT                   HDITSNQVGAVVIDEFDLAGMFQGRAYCAQPMISQPVYYTSQATLTQSGMTAGYLKLND
FT                   YMDVKIEIYIGGNLQQYKTVPFDNVSNNVNQNYCNPPSTILDNQFASGAKGKVTFMITN
FT                   PIINGVNLQGSEIATLYGRLGPGAMGQTPLSRVTIASGVITVPDKCIVNQGTPIVVDFG
FT                   NIPGTGSRLDGINYSQNVPIHVKCQGGSFSQGELNIKLGIQQANPAFSDGKYLSTQGAV
FT                   DRSELGIALRDSKGNPVVPNTFYNVPGFSHNEGDWNLIAAPVAKNTTSVIPEGEFHASA
FT                   TVVAEFQ"
FT   gene            391536..392084
FT                   /locus_tag="ECL_00374"
FT   CDS_pept        391536..392084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00374"
FT                   /product="Putative minor fimbrial subunit PmfF"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59940"
FT                   /db_xref="GOA:A0A0H3CF92"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF92"
FT                   /protein_id="ADF59940.1"
FT                   /translation="MHRMIIILTCYLTVFAAAPAWARGELIGGDLSFKGVVMAYPCSIA
FT                   PESGRILVDFGEISTKSLYIKGKTTPVPFAIKLQDCNPNVFNAVTVTFSGIANANMADR
FT                   LAINATAPGNAGGVGIGLLEEDDTPVRLNVATRPTLINDTLLRLSFQAFVEAEPDAVAS
FT                   GTLTTGPFTATAHYTLDYQ"
FT   gene            392108..392767
FT                   /locus_tag="ECL_00375"
FT   CDS_pept        392108..392767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59941"
FT                   /db_xref="GOA:A0A0H3CFL2"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFL2"
FT                   /protein_id="ADF59941.1"
FT                   /translation="MRYQFFLYDKNIFYSQGIKMVITSLLAEQADVLYSLTDDYDQLLV
FT                   QLQRQVNDEGCMWILCDLDSLPRERLHTLQLMKEFYQQENKNLIILLSKHNMPLFFALY
FT                   SLLPTAHWLLKTENMESITPFFQRLLDKTRQGCCFSASLVNYTKKKLYDRSVEPTISGS
FT                   EWWLMEELFKGKSLSQISDEVNVDIRRLSYIKRHLMKRLNIRSNIALFSAFRGIMP"
FT   gene            392857..393057
FT                   /locus_tag="ECL_00376"
FT   CDS_pept        392857..393057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59942"
FT                   /db_xref="InterPro:IPR031882"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CH98"
FT                   /protein_id="ADF59942.1"
FT                   /translation="MKKLTAFEAARIVGGTCKTCEITYQNVTVGGVTSCKQITTCTDKH
FT                   GCTTTMRDADSSKCGGIPNRY"
FT   gene            393277..393789
FT                   /locus_tag="ECL_00377"
FT   CDS_pept        393277..393789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00377"
FT                   /product="Thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59943"
FT                   /db_xref="GOA:A0A0H3CDN0"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDN0"
FT                   /protein_id="ADF59943.1"
FT                   /translation="MQANSPIKNDRSIIEVMSYGCHYCAANEENLAEFSRTLPPDSTFT
FT                   SIHIADEDNGLAAYAPLFATLEAMGIEKQIRDSAYNAIITRNVDLTDEKKLNGWLVKNN
FT                   IDVVKFNTFRLSKAVKERLSEMAAITAYYDINATPMFIINKRYVVAQDREFPAFAQRIR
FT                   ELLEEDK"
FT   gene            393824..394750
FT                   /locus_tag="ECL_00378"
FT   CDS_pept        393824..394750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00378"
FT                   /product="putative ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA4"
FT                   /protein_id="ADF59944.1"
FT                   /translation="MSFKNSTGKIEDIQQRLTQCGVFFLRKIVRVVPLPVTLTVAKGLC
FT                   ATRLFGRAFRLRNAVANENVRCLTGQKVRLNVAWLTVRRRLLEEAATWAQKPALLQQMR
FT                   TCAAELNAVVTPLYEQNAPYILAPLHTVSDVLAAIIGASVTPGKASVVVSSSAELYSAP
FT                   ARAFGGVALDYCSIHQENKTLASNLMDLITDVAAGQRNMIIFPDITPDYTSQAEGMLVA
FT                   KQPCRLFGRSARLHGGLVRLSGAIAAQVVFYHLSYDNRLHIHIHPPVSSQHVASALPDI
FT                   IESTLQASPQEWLLWHSHSLYFINHSR"
FT   gene            394753..396867
FT                   /locus_tag="ECL_00379"
FT   CDS_pept        394753..396867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00379"
FT                   /product="ABC transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59945"
FT                   /db_xref="GOA:A0A0H3CF97"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF97"
FT                   /protein_id="ADF59945.1"
FT                   /translation="MKNTIPNLIFQEETNECGLACVAMLAQTQGQTISLETLRDIFPAS
FT                   DHGTSLDTLMAILARLGIATAPVLFEHHELSELPLPAILHYGASHYVLLAWRKGNHVCV
FT                   MNPAIGEQWLPFAALKQEISGYALIVEPEQRLAADPALARPTAGQSMPRVMSMKETADV
FT                   PGIYRLMLLTFMVSLTLFLMPTMVSSAINKAFSSVESSGFPYGWFILAFVVSSLMALGV
FT                   RAIAERYIKRFVLIHSGVGFSRMLQNPLRFFEKRAPGEIFSRFTAWQMGLLQKIELDNG
FT                   LRSDWVIGAIALAIMFWIAPILAAISAIGVTVMGIISVWAVIRDRWFTQQLQLKSAALN
FT                   DFFMETLQGILTVKTAGLEGQRQAQFAALSRELYTCLQRQKVYQQVKEGLYQLCGSLEM
FT                   VAFMLVVLPMVHGKQISLGDFFAYSFLRQIFTSYVTRIFYAIIQKTQLHVIDTRAHALF
FT                   APGGERAPAPLIAVPTADTTPALAFEALGYGYDPAVPVLSSVSLSLPAGEQIAIVGESG
FT                   AGKSTLLRLIAGLFSPQAGGCYAAGRALPAAHLAQYVCLQSQEDILFNASVRENITLFD
FT                   AHYRERDRGRIEALLDALMLGDVVRALPGGLDALIRESHAALSLGQRQRLLLARALYSS
FT                   RPVLLLDEPTANLDDETAAIVMATVHAHCRRAGKSLIVVTHSEQVLSGFQQVYHLVDGR
FT                   LSLREGSDEA"
FT   gene            396857..398008
FT                   /locus_tag="ECL_00380"
FT   CDS_pept        396857..398008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00380"
FT                   /product="Macrolide-specific efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59946"
FT                   /db_xref="GOA:A0A0H3CFL9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFL9"
FT                   /protein_id="ADF59946.1"
FT                   /translation="MKHKSRWVMLGCGLAFVAAMAGVWVSMASPSPHTRLPVDTVGTGD
FT                   IEKVVLVTGILKPAVQVNVGAQVNGQLRKLYVRQGERVKKGQLLAEIDPTLQESELRNT
FT                   KAQLASARAQKRSAQAMLLRYRQELDRQRLMQRDGSGVRSEFEQARSQYAVQVQQIAVS
FT                   EAQIAQAEMAVKTAQANLSYTRIVAPVDGEVLGIVTREGQTIVSSQTAPTILVLADLDT
FT                   MQVQTRISEADVQKIHPGQPLSFYVIANPDKRYASTMGYVQPAPQDAMEASGERGMGGN
FT                   AQAMAVYYTGTFEVPNAGRELKTSMTAQVFIQIARASNVLRVPVAALGQAQDADRYTIT
FT                   TVKDGNTQSRTIRIGIQDRQYAEVLEGLQAGEQVVLEQETERG"
FT   gene            398012..399943
FT                   /locus_tag="ECL_00381"
FT   CDS_pept        398012..399943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00381"
FT                   /product="Macrolide-specific ABC-type efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59947"
FT                   /db_xref="GOA:A0A0H3CHA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHA3"
FT                   /protein_id="ADF59947.1"
FT                   /translation="MEPIIVLRRVCRRFHAGTQTLAVLSDISLTFHRGEMVAIVGASGS
FT                   GKSTLMNIIGCLDKPTSGEVLINGTPVHNADSLYLADLRSRYLGFIFQRYHLMPYLTAE
FT                   ENIAIPALYTAMSEQERTVRVQRLAVQLGLENRLQHRPAELSGGQQQRVSICRALINGA
FT                   HIILADEPTGALDSTRGKALMGVLHQLHASGHTVIIVTHDRDIARQAQRIIEISDGRII
FT                   SDVRHAEVHPSTLLPEQDNGRASLVSRFRESVRMAWRALLGHRMRAFLSMLGIIIGIAS
FT                   VVSSMAVGEGARRAIVDEIGKLGNTTLEIRPGTGWGNARPDMARALSMEDVRSLQALPW
FT                   VMGVSPVVSSTALAVRKGLDSSMMLSGVSQDFFTLQGLRVVQGNGFTARDVAEGEPVMI
FT                   LDETGRDTLFPGGENPLGALVQIAGAPWRVIGVATRPGPKVVGGFMAAWVPHTALQQRL
FT                   TGQIPLESLVLRFQPPLTSQEAAQRVERHLLREHGRKDFFIQTDDRLANAMQKTSDSMS
FT                   LLITAIAAISLLVGGVGVMNIMLVSVTERTHEIGIRLSVGARPADIMNQFLIEAVMICV
FT                   LGGLVGVSGAWLAGHIFAFVTDAFSMVFTVFPVLMACGFSAAIGLTFGYFPARSAARLS
FT                   PTEALARE"
FT   gene            399994..401322
FT                   /locus_tag="ECL_00382"
FT   CDS_pept        399994..401322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00382"
FT                   /product="Putative RND efflux system, outer membrane
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59948"
FT                   /db_xref="GOA:A0A0H3CDN5"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDN5"
FT                   /protein_id="ADF59948.1"
FT                   /translation="MTRSDYQRPLLSLPTQWPTMAEKGTENGWRFSDPRLSRVIEQVLE
FT                   SNNDLAAAALTLQQARVAAGLTSTNISPDVRVSGAASNSKNVRRGAPPQENYSGSVAIA
FT                   WELDLWGKLARTREQSEWQARASEQDYRATVLSTMGLTAQLYWRIALYNQQIRHQRDGL
FT                   TVSEQTVQQVSSWFNAGKVGQLDVLQAQQALLARQNQLRTLIQQRQNTRSALALMLNRP
FT                   AEQHADELRELDVHQQVPVAQKTPLRVIAQRPDIQAAESRLRAALAGYDAARLQFYPTL
FT                   SLDASLNAGSQVFSQWFRDPIRTTGAALALPFIQWNTRQLTVAQADLAIKQAAIAFRST
FT                   AYTALAEVDEAMENRLSADEQRSRLHQSLALSQRRLSLTESRYRAGAVDFQTLLNAQDD
FT                   LLNTENALAQTQYDYLYATLQLWLAQGGDTQNRMIKDEAEKWR"
FT   gene            401300..402553
FT                   /locus_tag="ECL_00383"
FT   CDS_pept        401300..402553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00383"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59949"
FT                   /db_xref="GOA:A0A0H3CEA8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA8"
FT                   /protein_id="ADF59949.1"
FT                   /translation="MKLKNGDNRVVVTGYGAVTPLGVTADESWQAIMDYRLGYRYVDYT
FT                   ARNIKTHFLGLVDNEPSLIGVPAAVRRRLPRFARLTFGAARQAMAMAFGGQPPQEFYSP
FT                   LDCGAIMGTGWGGLDESYDAQSDFSATGFASPFNCFYSMPSVTTAACSQFWGLNGFQNT
FT                   VVAACATGTIAIGEAYEVIRTGRAQMMLAGAGESLTSPCAIWNIDVLGALSKETQDPQR
FT                   ASCPFSAHRNGFVLSEGAAVLCLESREGALARGATILGEITGYANFSDAWDFTSPAEDC
FT                   LARVQTIISALRQAGLEPEHLDYINAHGTSTPLNDINETQSLKMALGEAVWTVPISSTK
FT                   SYSGHLISAAGAFESIVCLQAIANGIIPATTNFQHADECCDLDYVVEGHRHATIRRTLN
FT                   LSFGFGGANAALILEKHS"
FT   gene            402550..403353
FT                   /locus_tag="ECL_00384"
FT   CDS_pept        402550..403353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59950"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFA3"
FT                   /protein_id="ADF59950.1"
FT                   /translation="MMTLRYSQQDARLWAAFSGDYNPVHFDKAWVKSQGGSRLSVHGMR
FT                   ALLDVKRFISPEVRRSSFLKCTVRLRRPLWRDTTYLLMCDPNKPVSASVYDLTAQTVCL
FT                   SCAIAPVNLFAVAEAESQRELGASTIAALHQTFLPLLPHAQQWHFLDALLFRHLLQDTA
FT                   LLHQKDIAPLIPSGHTLEALFTRYPVVQTHQEVVFDSHLLAPWQTVPLPEPLEIETLPA
FT                   TVVGDLRYGAVVRIAAQTRYQQHYISSAVTLKVGPLTKGNANELV"
FT   gene            403340..403591
FT                   /locus_tag="ECL_00385"
FT   CDS_pept        403340..403591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59951"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFM4"
FT                   /protein_id="ADF59951.1"
FT                   /translation="MNSYEIIYSKISEMIADAKDLPLEALTPDTTLPQLELDSLDYVEL
FT                   MVLAKREFNVTLTAEMFMKKPHMTLRDLSLYIDQEMAG"
FT   gene            403608..404330
FT                   /locus_tag="ECL_00386"
FT   CDS_pept        403608..404330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00386"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59952"
FT                   /db_xref="GOA:A0A0H3CHA8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHA8"
FT                   /protein_id="ADF59952.1"
FT                   /translation="MLITGGSRGIGQALVSHLLPEWNIVFTGRNEAGIGRTLAQAKGLR
FT                   TATWVKGYRCDGRDEADVQRLATSLLDEFGAPAAIVHNAGMTRDALHIHQTARDWQDVL
FT                   TNNLVALVNWNRTLLPAMMMQGSGAVVLMSSVTAIKGNSGQTAYAASKAAMIGLTRSLA
FT                   QEMGRFGIRVNCLAPGLIEGEMVEAIPEARLKAMRQSIPLRRLGQTQDVAHAVAFLAGE
FT                   GSRYLTGQTLVLDGGLSA"
FT   gene            complement(404367..405539)
FT                   /locus_tag="ECL_00387"
FT   CDS_pept        complement(404367..405539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59953"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDP0"
FT                   /protein_id="ADF59953.1"
FT                   /translation="MNINLIESLACISKIIDMINPRLNLHHVRTAYIAWLLARESQFTP
FT                   AQCRKTLLAALLHDIGGLNEESRLQPMSYYDNELNNHAAVGAELLASVPLLNPLNAIVR
FT                   YHHTHWNNGRGACVNGIKTPKESHIIYLADRLDVLISHYRASDIITAQEEIIKIIVSGE
FT                   NDLFQPDYIHAFQRVASRDHFWLRIQSTEFDDYIKEIPRIHNDPLSLHNFRDIAGMLAF
FT                   IIDGFSQHGVQHSLVVGRISGYLAREMGIPPVQCLKIEIGGLLHNLPSLALCATPAQTD
FT                   EGKAVWDELYPIEAIRDIAGWCQLQKSVDAKSAYPPEVTIIKASIWLASLLQGVTLSSE
FT                   FKARVGETAEIAPALAGVVQQHSAILLQIFHESVKERRALVQRINQLTLS"
FT   gene            complement(405591..406001)
FT                   /locus_tag="ECL_00388"
FT   CDS_pept        complement(405591..406001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59954"
FT                   /db_xref="InterPro:IPR031854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB2"
FT                   /protein_id="ADF59954.1"
FT                   /translation="MYSFTSPAVFSCESQFSVVQNINGKSVHAEGLIFINMANDHILMN
FT                   IDGLLSHDNKNQLISRTLKIKYKKFNPSANLYQVTSVRTLRDSTDNIDDTVAINLLFGK
FT                   GPDDKIIYLNKLNNNTLLFGNHTFPQYGCKRK"
FT   gene            complement(407634..407712)
FT                   /locus_tag="ECL_tRNA009"
FT   tRNA            complement(407634..407712)
FT                   /locus_tag="ECL_tRNA009"
FT                   /product="tRNA-Phe"
FT   gene            complement(408385..409197)
FT                   /locus_tag="ECL_00389"
FT   CDS_pept        complement(408385..409197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00389"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59955"
FT                   /db_xref="GOA:A0A0H3CMB7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CMB7"
FT                   /protein_id="ADF59955.1"
FT                   /translation="MLDVHPSGFYAWLQQPHSQRHQADLRLTGQIKQFWLESGCVYGYR
FT                   KIHLDLRDSGQQCGVNRVWRLMKRVGIKAQVGYRSPRARKGEASIVSPNRLQRQFNPDA
FT                   PDKRWVTDITYIRTHEGWLYLAVVVDLFSRKIIGWSMQSRMTKDIVLNALLMAVWRRNP
FT                   QKQVLVHSDQGSQYTSHEWQSFLKSHGLEGSMSRRGNCHDNAVAESFFQLLKRERIKKK
FT                   SYGTREEARSDIFDYIEMFYNSKRRHGSSDQMSPTEYENQYYQRLGSV"
FT   gene            complement(409254..409532)
FT                   /locus_tag="ECL_00390"
FT   CDS_pept        complement(409254..409532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00390"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59956"
FT                   /db_xref="GOA:A0A0H3CL11"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CL11"
FT                   /protein_id="ADF59956.1"
FT                   /translation="MSGKRYPEEFKTEAVKQVVDRGYSVASVATRLDITTHSLYAWIKK
FT                   YGPDSSANKEQSDAQAEIRRLQKELKRVTDERDILKKAAAYFAKLSD"
FT   gene            409807..410283
FT                   /locus_tag="ECL_00391"
FT   CDS_pept        409807..410283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00391"
FT                   /product="IS5 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59957"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHB4"
FT                   /protein_id="ADF59957.1"
FT                   /translation="MSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPFY
FT                   PKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTT
FT                   IMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQ"
FT   gene            410296..410787
FT                   /locus_tag="ECL_00392"
FT   CDS_pept        410296..410787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00392"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59958"
FT                   /db_xref="GOA:A0A0H3CDP5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDP5"
FT                   /protein_id="ADF59958.1"
FT                   /translation="MHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGN
FT                   LLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERSGKVRTLKQHPRKNKTAINIEYM
FT                   KASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRADQMIRQWERSH
FT                   "
FT   gene            410999..412246
FT                   /locus_tag="ECL_00393"
FT   CDS_pept        410999..412246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00393"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59959"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB5"
FT                   /protein_id="ADF59959.1"
FT                   /translation="MGSSELSLLQMAVMQSWNAVVITSADRAAGYPVKIANPAFCQMTG
FT                   YAIDELYGQSLKMLQGPATDQEVINRLRNCLSSGEYFEGMTTNYRKDGLPYLVRWNISP
FT                   VRDEEGDITHFVSVQQDMTAYAKVEETSKILGQALDAAAQPILVTDAQAKIIFANQAFC
FT                   QVSDYEESELIGNTPSLFKSGLQDDDFYKNVKASLMTAKTFQAIFINKRKDGTLYHSEQ
FT                   SISAIKDHAGNITNYVSVGKDVTERLREEQALRESATVDQLTGLFNRNHGKALLSEAYS
FT                   FTLSREEPMSLILCDIDHFKQINDSFGHPVGDQILAQVSGLLRKSVRGNDRVIRWGGEE
FT                   FLILLENCTDMVAAELAERLRLRIASEQFQNVGKVTVSLGVASLFQKESLEQLISRCDE
FT                   ALYKSKRNGRNQLTLA"
FT   gene            complement(412296..413129)
FT                   /locus_tag="ECL_00394"
FT   CDS_pept        complement(412296..413129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00394"
FT                   /product="putative IS3 family transposase orfB"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59960"
FT                   /db_xref="GOA:A0A0H3CNX5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CNX5"
FT                   /protein_id="ADF59960.1"
FT                   /translation="MMLMCDATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITE
FT                   LALERRRFGYRRIWQLLRREGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRP
FT                   AAPNLTWSMDFVMDALSTGRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALF
FT                   RGYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNE
FT                   HWFSDIVHARKIINDWRQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
FT   gene            complement(413153..413416)
FT                   /locus_tag="ECL_00395"
FT   CDS_pept        complement(413153..413416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00395"
FT                   /product="putative IS3 family transposase orfA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59961"
FT                   /db_xref="GOA:A0A0H3CRT3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CRT3"
FT                   /protein_id="ADF59961.1"
FT                   /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKYG
FT                   SMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKY"
FT   gene            complement(413466..414662)
FT                   /locus_tag="ECL_00396"
FT   CDS_pept        complement(413466..414662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00396"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59962"
FT                   /db_xref="GOA:A0A0H3CHC0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHC0"
FT                   /protein_id="ADF59962.1"
FT                   /translation="MSSPKRFRFTNQLIKSLPPNTSDARSTDAEYSDTEISGLKCLVSR
FT                   REGRKKFLLRYLYHGRKRAIAIGHWPEVDVNLARQIAIEHKRSLATGTDPKQERENKRM
FT                   ELTFDELFNQHYLPWAKSAKRSWGKDVQRYRDHIRPAIGQRLLSDITPASILRLQQTLS
FT                   TSLSAATCNRVIVLIKAVFTWAGRQSMTSVHPARVVQLLRENNARQRYFTEDEIRRIFL
FT                   SADNDTSPVAARYVKLLLLTGLRRDELRLAKWEHVDPVKRTLWLPETKNGYGRIVHLNS
FT                   LAMDVIRTLPTQRGNPWLFIGKKQGMPLSNPVKAFQRIVRRAGIFDKEVCIHTCRHSVA
FT                   ALIVSYGGTLYDVQAQLGHRSSQSSQRYAHLHPQRLQNTSQLLAERITAQLPDLLPVD"
FT   gene            416426..417310
FT                   /locus_tag="ECL_00397"
FT   CDS_pept        416426..417310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59963"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDQ1"
FT                   /protein_id="ADF59963.1"
FT                   /translation="MHSKTKVVPVVSTKGGEGKSTQAANLGGFLADAGIKTLIIDGDHA
FT                   QPTASSIYPLAYEAPCGLYELLMQTVDLSKAENIISRTTIDNLDVIVSNDPRNLLPTYM
FT                   LNVPDGRVRLRNALSNQVFSQYDVILIDSQGSRSVMSELIILAATGEMIGMVKPVLPDV
FT                   REFMRGTVALMEELIPYMAFGISLPRIHMLVNCMDYTLLAKTTVEQAENIIVSGDYSQH
FT                   ADKIVIDMLQTRIYDLDVYKQGHAAGQPVHRLEKKTSRKSDSAFDSMHGLACELFPEWV
FT                   SLFDTLAKGGERV"
FT   gene            417375..418667
FT                   /locus_tag="ECL_00398"
FT   CDS_pept        417375..418667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00398"
FT                   /product="putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59964"
FT                   /db_xref="GOA:A0A0H3CEB8"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB8"
FT                   /protein_id="ADF59964.1"
FT                   /translation="MLDNDRWDEVALRLSADDFFQKVHKVIYQEMTRLVAAGKPLDLIT
FT                   LSESIESRGKDALEQLGGFAYLAELSKNTPSAANIVAYCDIVARTSRARQLASIGAEIT
FT                   ESVRTPGTDIDRVMETAEQKITRLAERAEPEQGVTLLEGMERLLPELERRCNVPDGITG
FT                   TPTGFEELDAMTSGLQAGDLVLIAARPSMGKTALLISLLLNSLMKKSGSKGQLYSMEQP
FT                   TEQILMRMLASLGSIDLTHLKSGLMDDEDWARATDASALLMGDLNDSLIIDDTGSLTPA
FT                   MLRIRARRNARRYGHPSIIGLDYLQLMRCPDQENRTQEIAEISRSLKALAKEMMCPVVA
FT                   LSQLNRQLESRADKRPNNGDLRDSGALEQDADVIVFIYRDEVYHENTEDKGIAEIIISK
FT                   QRQGPTGTIRLQYEGRFTRFSDVAGRPGRSA"
FT   gene            418664..420370
FT                   /locus_tag="ECL_00399"
FT   CDS_pept        418664..420370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59965"
FT                   /db_xref="InterPro:IPR022304"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFB7"
FT                   /protein_id="ADF59965.1"
FT                   /translation="MSNVRNLNLGAAMLQRGKTPAQGDAVPAAVPLPVSEMAMVLTLDQ
FT                   LRPNPDNPRKSRNPHFDEIKASIRACGLVQVPKVTRDPDGEDVYIFSDGGNTRYQILCE
FT                   LWQETGDERFYRVHTIFKPWPGRLKCLVGHLAENEVRGDLSYIDKAFGVHSARAIQEEL
FT                   MGRPVTLRELSDLLNLEGYPIDYSTISRMEDTIKYLWPCIPNLLNSGLARLQVLSLLRI
FT                   RSQAGKVWSQFAHESSPQCSFDQVFEASCQGFDDPDSYAYETFRDEFIGQLVKALPHPS
FT                   LNYDRWMIELDPREQKRREQFGEPPPLPVLTPPQEKAAGREPPEPQVTVLPPDTASETP
FT                   VTGLRSGTLTTPGRPEPAPELPADAELPVNALMTAGSEPRREVQNDLFGGRPVISGETA
FT                   DPDSISLPDFSPDTLMSAFGEENASPAASVSSVAFAATGLEPVSDIWHIPALQDDIEHL
FT                   QDMAYRLVFEIAEAMGCADNVREDKNPQSAGFAVSETGSEFVLFLAGLSGSLPNRQFNM
FT                   FMFCLNFFGSQSPADMAVFDDITVVKTMRLIRVIRRLRELQRLAAKGGENV"
FT   gene            420363..420620
FT                   /locus_tag="ECL_00400"
FT   CDS_pept        420363..420620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59966"
FT                   /db_xref="GOA:A0A0H3CFP0"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFP0"
FT                   /protein_id="ADF59966.1"
FT                   /translation="MSDDLNDEMAQASTALFIQHGIDAIRAKVNSATPSKAFCECCGAA
FT                   IPVARQLAVPGVELCAGCQEVKEMKNRHRADGGRGMRHVG"
FT   gene            420610..421353
FT                   /locus_tag="ECL_00401"
FT   CDS_pept        420610..421353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59967"
FT                   /db_xref="InterPro:IPR016868"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHC4"
FT                   /protein_id="ADF59967.1"
FT                   /translation="MSDNAKITARIRRLMALGTRNSNPHEAARAVALAQRLMQRHGLTP
FT                   DMLSLSDVSESVCFSLTSDAEKVPAWLSSLATVVCMATGCRCWFGWHVHVSPQGVSSVR
FT                   RSLHFYGFSERPEVALYIYTVLQRQLRAATDAHMSGYRTRRILLRTRRRRADQFREGWV
FT                   SGVWQVLQSFAPSGEENAVLQRWLVRRHAGEPLEDMAVRSAGKCRGDRTARVAGFFAGR
FT                   DIDLHHGLSGAQASRQITAGGHAHD"
FT   gene            421438..422037
FT                   /locus_tag="ECL_00402"
FT   CDS_pept        421438..422037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59968"
FT                   /db_xref="InterPro:IPR021364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDQ5"
FT                   /protein_id="ADF59968.1"
FT                   /translation="MSQHNLSQATTAILSSLLMDVKNGNIRRCESLGMSVEEIRALSHL
FT                   SLDELHYLSQSHVSVLDVTLNHENFWLMLNQARNEQKRFMMIDRALELGGSMELIDRYF
FT                   GLSPSEVSARRRLMGIESRQGRTQALTEPQDAALWAEWKAAGLSSPDSHQALEAMMLAA
FT                   EQLGLSLTAVWSRVCQWCREANAAGRRAEIPVRKEA"
FT   gene            422037..422267
FT                   /locus_tag="ECL_00403"
FT   CDS_pept        422037..422267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59969"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC3"
FT                   /protein_id="ADF59969.1"
FT                   /translation="MEMGDFSPRQQVSPAVRRRAQQLFRAACGGQKVFRRLTMNGYLKI
FT                   DVGPFWRILSKDGCRQWWLMDHETYNREIRR"
FT   gene            422236..422349
FT                   /locus_tag="ECL_00404"
FT   CDS_pept        422236..422349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFC2"
FT                   /protein_id="ADF59970.1"
FT                   /translation="MRPTTVKYGGNGLPLMTRQCRVYPGTVLSQAEEESIK"
FT   gene            422346..423584
FT                   /locus_tag="ECL_00405"
FT   CDS_pept        422346..423584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59971"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFP4"
FT                   /protein_id="ADF59971.1"
FT                   /translation="MTIPADSIVAHTLARMQQNLERRTDTGDVSQERSGLLFMGNVHDA
FT                   FPRRLFLDTRLSPLDKTAWVMIRLYAQQNEGAIFPTYDELQVQLASAHSEKASRDTVSR
FT                   VLLMLRLTGWLSLCKRVRDDRGRVRGNIYAQHDEPLGYRDAETFDPGWLKLVEESCLSR
FT                   NKAVRMTALAVVNDILQDPGMRHRHSRLALIESRLSAPSTPRQMVSHRRAVNRSPESGL
FT                   SQKSTKNIPESLSPENGLSTPSVDKTQSPESGLSLKSTSYTGVRNPDCNVRSFTQSVNK
FT                   KTYVPGGEHFLPDDFVNGLNSDDRQMLTTQMASLPEAVAKTLADMLREQLRLGRLNNPV
FT                   GWLFTMLRRARSGELNLPEAAAPAPAGSGSNNPPTTGTRAVPAAIIPVQPARRPSRDEV
FT                   RAMIESIRQNVGR"
FT   gene            423831..424553
FT                   /locus_tag="ECL_00406"
FT   CDS_pept        423831..424553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59972"
FT                   /db_xref="InterPro:IPR014996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHD1"
FT                   /protein_id="ADF59972.1"
FT                   /translation="MADKQVTKTGSLQSEMTIALHTNYAIGLWLGRKREKQEDNTPVKH
FT                   GIIGMPQFFVRATLINQDSLNNNPWADEAMYRLEEKLRSATETMTGLIKQLDEEMSMLP
FT                   AGITLTEVTSVEPLDIHVFTRTPLGYRCVFLLVGFDQFAKKVLQASHYGLITRNGRDNY
FT                   LSEGGRLLRQIYGTVLSYRRVDATRLDAAENNEVWQKACQEAGEPDRAVLLGEKRSAFS
FT                   PPVNEASVNLLRLRYQTV"
FT   gene            424571..426724
FT                   /locus_tag="ECL_00407"
FT   CDS_pept        424571..426724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00407"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59973"
FT                   /db_xref="GOA:A0A0H3CDQ9"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDQ9"
FT                   /protein_id="ADF59973.1"
FT                   /translation="MRLFICEKPSQGRDLAGVLGATRRGDGFLTGSGVTVTWAVGHLLE
FT                   TAPPEAYGQQYGKPWSLSALPILPAPWRVVVKKETQDQFKVIERLLRQVDDVVIATDAD
FT                   REGEVIARELLEYCRWEGPVQRLWLSALDELSIRAALQDLRPGQATLGMYHAGLGRARA
FT                   DWLIGMNLSRLYTLRAAESGFDGVVSVGRVQTPTLALVVRRDREIAAFVPKPFWQVKAL
FT                   ISAGDLTFPAQWVPAKVYTDEEKRCVHQNIAQQVAQLCRQTGHAVVTECDTKREKAAAP
FT                   LAFSLGSLQQACGRLWDMSPQQVLDTAQSLYEKHKATTYPRTDCGYLPESMREEISGVL
FT                   DAIGRTDPECAPVLARLDRTFVSRIWNDKKITAHHGIIPTRNAFQLSALTETERNVYML
FT                   IRRNYLAQFLPLHESDFTRLQFDTGGQLFRATGRTEVIKGWKVLFENAGDNEVDDGDEA
FT                   DIALPPLAQNDRCAVTGAEVVQLMTRPPAHYTFATLIGAMMNAAAFVTDVALRKVLKDN
FT                   AGLGTEATRAGIVEQLLNRHFIVRKGSKIMATELGADVIDALPPQLTEPGMTALWEQAL
FT                   DEVAAGRMSLDDFLQRQTGWTRNLVSQGTQQQVRIRVPPTPACPLCGGKPVCAGERKGN
FT                   SGAASAGRNAKVSSTSGAPERNDRAGLSLLNQRRINPLYPIAGRCGLCYCDPGSEAAPR
FT                   DCGFRQHLMHVLPEYSLAGPVHT"
FT   gene            426753..426905
FT                   /locus_tag="ECL_00408"
FT   CDS_pept        426753..426905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59974"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC7"
FT                   /protein_id="ADF59974.1"
FT                   /translation="MKPVPGPFSQRSHCDKQVYLRSMVQTSEGGVARHRFFYFCVLMIF
FT                   CTLRR"
FT   gene            427215..427706
FT                   /locus_tag="ECL_00409"
FT   CDS_pept        427215..427706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59975"
FT                   /db_xref="InterPro:IPR021960"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFC7"
FT                   /protein_id="ADF59975.1"
FT                   /translation="MTATTTTPASTGSASASQKKEFFNLNVNGIGYLSSIRRVQGGNGE
FT                   FTCAVINALTGPTDNASYTRFDVTIAGAETTKLINRCQKAVDEEEKVLIGFVLSGLKAD
FT                   VFTLQTGDHAGESRPSLKARLIKVEFIKKGQDVVYQAPNASQTPESGSSAQKEYDPNSF
FT                   "
FT   gene            427782..428282
FT                   /locus_tag="ECL_00410"
FT   CDS_pept        427782..428282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00410"
FT                   /product="single-strand DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59976"
FT                   /db_xref="GOA:A0A0H3CFQ0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFQ0"
FT                   /protein_id="ADF59976.1"
FT                   /translation="MSARGVNKVILVGHLGQDPEVRYMPDSTAVTTLSVATSETWRDKQ
FT                   TGENRENTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDTNGIERWTTEVRV
FT                   GVNGTMQMLGGGRNNSTNTSGNNAQSGQQGGWGQPQQPQQTPSAPQNPQNEPPMDFDDD
FT                   IPF"
FT   gene            428438..428722
FT                   /locus_tag="ECL_00411"
FT   CDS_pept        428438..428722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59977"
FT                   /db_xref="GOA:A0A0H3CHD7"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHD7"
FT                   /protein_id="ADF59977.1"
FT                   /translation="MQTPVRKSVRDKQINIRATDEERAVIDYAASLVNKNRTDFIIERA
FT                   VHEAQNIILDQRVFVLDDARYQAFIRQLEAPVQNVEGRQRLMDVKPEWK"
FT   gene            428953..429195
FT                   /locus_tag="ECL_00412"
FT   CDS_pept        428953..429195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00412"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59978"
FT                   /db_xref="GOA:A0A0H3CDR4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDR4"
FT                   /protein_id="ADF59978.1"
FT                   /translation="MPDPVPVVLLGRLAVDVSTQGNNFGKWLLNDAVMRVSNLADQVGI
FT                   KAIMVHAIDERAKAFYEYFGFVQSPVAANTLFYKI"
FT   gene            complement(429273..429455)
FT                   /locus_tag="ECL_00413"
FT   CDS_pept        complement(429273..429455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59979"
FT                   /db_xref="GOA:A0A0H3CED2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CED2"
FT                   /protein_id="ADF59979.1"
FT                   /translation="MPHVWKVLPSGFTPGLVLIRSAILAGMKKRAMRNSFRKLKKNIAE
FT                   PVRLNQLTKPFTLIR"
FT   gene            429428..430714
FT                   /locus_tag="ECL_00414"
FT   CDS_pept        429428..430714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00414"
FT                   /product="pilus biogenesis protein PilL"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59980"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFD4"
FT                   /protein_id="ADF59980.1"
FT                   /translation="MAVPSRRVATGAALLACSVIQAGCSSAVSDPAPFANGRYQQPTRF
FT                   DDIYRNRAPDVVRYDRYTLVSTRPDDAQRDPLNQIVDITMPAQLVKTVGEGFRYLLLES
FT                   GYSLCSATTSAFSELLSRPLPAVQRDIGPVRLSEALQIVAGPAWRLKVDDVNREICFEL
FT                   RDQYRSFAAPLPAPVSLVSQHAPVSLPPVIQPARTGGAAGTVNAVPRNPFTGDTSINST
FT                   PGTLQKPVLTAQNQSVPSPVLTVAKTPAAQKSAALSPAGRPPVPPPAAAPKAASSQKTP
FT                   VTAVHPVTVQPATVNAARQTVPVRPVTSLPPAPPVSGQTASSYIPGAPVTPQPVGQTWR
FT                   AEPGSTLKETLTGWASKATCSNGGNWVVIWPVSLDYRIDAPLVFHGNFESVLVQVFDLY
FT                   RKAEKPLFAEANRIQCLISVSDTPTGGGH"
FT   gene            430716..431159
FT                   /locus_tag="ECL_00415"
FT   CDS_pept        430716..431159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00415"
FT                   /product="PilM protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59981"
FT                   /db_xref="InterPro:IPR009987"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFQ5"
FT                   /protein_id="ADF59981.1"
FT                   /translation="MGYALPVFVFCLVIALMAGDAQRHSAEHVRLSLQQTLPDQLATDM
FT                   LRTADAVNNWRHGRTVADGTVTPAQAGIVPAPDSRIQTVIQGGRLWVWVPATDGVYAAL
FT                   RTQSVTSALALTVSGGRLRMADGTDMNLSLPSGVTEGSIVYLN"
FT   gene            431179..432852
FT                   /locus_tag="ECL_00416"
FT   CDS_pept        431179..432852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00416"
FT                   /product="type IV pilus formation outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59982"
FT                   /db_xref="GOA:A0A0H3CHE3"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR013359"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHE3"
FT                   /protein_id="ADF59982.1"
FT                   /translation="MPRLPFCLTALVAALALSSCSLNEISKMDKEASGQADTAQRVLQS
FT                   RQTLTQPTVVWSDKPWVNLQPVTPVISTPDEKNLPACQITINRPEGISLPELGQRITAL
FT                   CGIRVSITPDAFAALSSISTGSVVTSQMNGQLPAPDDNGRVPLSQMGTTSAQPVSVQSS
FT                   PSLIRGLKYQGDIRGLLDMAASGLGLSWRIDSSGVYFYQQDTRTFQLVILNTKVNSSAS
FT                   INSGSGNQLGSGGGTSGGTTGDISSNQKTDYGMNSDLYDDIKKTVEQMVTPKSGRFWLS
FT                   SATGTLSVTDTPDVLNRIGRYIEYQNKVLSRQVQLNIQIVSVNQTRNEQMGLDWGLVYK
FT                   SLQNVGASLTGSMANASSSAASAGISILDTASGNAAKFSGSSLLIHALSEQGNVSMALN
FT                   QTDPTANLTPVAYQLSKSTGMLTSSSSTATANVGVTSTMTTTNVTTGLFMTMLPFIQEN
FT                   GDVQLQFAFSYTSPPDIKSFVSRDGNTRNDTADTSTEGLARKVNLRSGQTLVLTGSEQQ
FT                   NVSADKQGTFTPGNFILGGGQTGSRGRTTLVIMITPVLLR"
FT   gene            433029..434135
FT                   /locus_tag="ECL_00417"
FT   CDS_pept        433029..434135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00417"
FT                   /product="pilin accessory protein PilO"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59983"
FT                   /db_xref="GOA:A0A0H3CDR8"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDR8"
FT                   /protein_id="ADF59983.1"
FT                   /translation="MAGVVSPGRVRHRLYALAVAFQLSEGGNAWGIYRLSRDEDLWVFF
FT                   AASGGQLSVMGDVTGTRAFIESAAQNFLRFNDADAPGLRCAATAEDGRDATTLTDRLSG
FT                   AQLRRCRLRKRLAPMSLILPAVVLTLATAAGVYWHDTVQQQADRDKAMEASRSRVAPKN
FT                   DKPALPARAPHPWASQPPVSVLLSNCWLTREPVFASVAGWRFTDGECVPEGLRLRFVAT
FT                   PGSTVEDFSRRARELLGHAAVFNLQEGGKNGDVFIPFRKYLAGEYTDEALPGAEAQLMR
FT                   FISHLQRRNLDVKFTEVKPPAVAPGQEKNTPVQDWREFTFSVSSRLQPERLLQDFDAAG
FT                   LRLTSVSITMSPQGQFGYTMKGSIYAQN"
FT   gene            434122..434619
FT                   /locus_tag="ECL_00418"
FT   CDS_pept        434122..434619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00418"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59984"
FT                   /db_xref="InterPro:IPR022753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CED7"
FT                   /protein_id="ADF59984.1"
FT                   /translation="MRRINPARTGLLLSVLLSGPALSATTADALPPNVTLGELEATQAR
FT                   NLILEQKVQTARLEQQLRESQSGQSTDRNYLATSLQPSAPLMTQPVPSQTAATSGTEKR
FT                   AGSVRLQEIYGRGTQLRARIVLPDGGVTEVAKGDQIPGTAKRVTEVTSTLVRLSDNSEL
FT                   SF"
FT   gene            434627..436201
FT                   /locus_tag="ECL_00419"
FT   CDS_pept        434627..436201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00419"
FT                   /product="type IV secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59985"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFD9"
FT                   /protein_id="ADF59985.1"
FT                   /translation="MTPDKDIMDFVFAEQHPSGGVTLLIDGNRRKEPAIQRWVMDVTRE
FT                   YPTAKTEFVTLSELNRRREVAERQGLALSRSVSESDLNSRDISVSQDKVISYMKLGNEF
FT                   SASDIHIEISADRKLSIVQLRIHGELEVVDEVKDVEGMTLASTSYLSMCDVREQSFFAG
FT                   REQSGRIDAKFARRAGLYGARYEHRPTPDGLIVVMRLIPDDGDNIPGLPQLGFLPEQIT
FT                   LIMQILRLPEGMVLLTGPTGSGKSATLRVFSDIWLKLTGGKKRLLTLENPPEGRIPGAI
FT                   QTPVMPADNSPEAISRAWSNANASALRLDPDAILNGEMRDLYSLIAAIYASETGHALFS
FT                   TLHTQSPIGSLRRMEHFGIDRHLLADAALITGLIGQRLVPLLCEKCRIPWQVKAPELDG
FT                   ETRARLEKYCTVEGVCDTGKLFFRNHEGCSHCQKTVPLTGRIVSRGVTGRTAIAEVVRT
FT                   DARLMQLWLSHGPAVARQYWVNQGGITRRMHLLRYLAQGRVDPVEGDLICPLDEDDIMQ
FT                   CEVPNVG"
FT   gene            436191..437306
FT                   /locus_tag="ECL_00420"
FT   CDS_pept        436191..437306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00420"
FT                   /product="type IV pilus biogenesis protein PilR"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59986"
FT                   /db_xref="GOA:A0A0H3CFR1"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFR1"
FT                   /protein_id="ADF59986.1"
FT                   /translation="MSVKTRFSPERDMSLAEMLRYRLVRATFTGQYRQPFYETLRFLLE
FT                   NRKALEEALAMIGEVHTDFGRRWHPYYELVQDCLEGVKDNREGRSLKDVLAAWAPYEEA
FT                   ALISAGMETGNIPGALMQADKLIVARRLILGQVVFASVFPSALALLSAGLLLANNMALV
FT                   PTLSKMSDPARWTGALGLMNGVAQWTDRWGVTAAGATVGGVILAFWSLPRWRGRLRRVA
FT                   DFLMPWSVYQDLQGAVFLMNIGALLGAGVQELKALQILNEFAPPWLQERIEAAMECMSD
FT                   GDSLGMALRQSGYDFPSREAVNYLSLLDKGNSAASLITNYADRWLEQALTRVARRANVT
FT                   KLFSLVLIMSFFLLILLMVMQIQDMNTFNIH"
FT   gene            437316..437912
FT                   /locus_tag="ECL_00421"
FT   CDS_pept        437316..437912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00421"
FT                   /product="type IV prepilin"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59987"
FT                   /db_xref="GOA:A0A0H3CHH3"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHH3"
FT                   /protein_id="ADF59987.1"
FT                   /translation="MSSQTSHYHQRQPDRGWGILEHGSIALFTVIVICIVGALVWGLSG
FT                   KKSVAVETSNIQTVVTNAQQLKQTQGGYNFTSGTTMTGTLIQQGGAPKAGWTIQGTASS
FT                   GTGTMWNSYGGQVVMAPVASNGFNNGFSVTTQKVPQADCISIATQLGSGGAFSAISINS
FT                   TDYSDGLVSAEDAGKACTADTGMTGNNTLVFTHNG"
FT   gene            437917..438396
FT                   /locus_tag="ECL_00422"
FT   CDS_pept        437917..438396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00422"
FT                   /product="PilT protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59988"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDU7"
FT                   /protein_id="ADF59988.1"
FT                   /translation="MLRLTVLLLFILLSPRAGAFCFDAAGAKYHIDPLLIQAIATGESS
FT                   LRPGITNVNRDKKTGRALSTDYGLMQVNSSHIPALMAQGVIRSPQDLLTRPCLNVQIGT
FT                   WILAKHFQVCGISWNCLGSYNAGFRQDRHETRESYANRIYAIYRRLLLKERGIRL"
FT   gene            438393..439049
FT                   /locus_tag="ECL_00423"
FT   CDS_pept        438393..439049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59989"
FT                   /db_xref="GOA:A0A0H3CEG7"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEG7"
FT                   /protein_id="ADF59989.1"
FT                   /translation="MTLLTLSMPWPTLGILFPLSLGLFNVMAILVRINLVISGHRNGGS
FT                   SPVRPAIVWLYAAAVSVMLLAPAPAILRLLSFFLSLFLFRMTLTDALTGLLPREMTVSC
FT                   LTAGLAAALLHPGFTEHLLSAVTAMLIFGGWRYGSTKIQGRECLGLGDVWLAGAIAAWL
FT                   GGASGLYALLTGVMFFVLWQLTVRRIREGGPMGPWLCAGAMSVTLLKLYQPLITW"
FT   gene            439055..440320
FT                   /locus_tag="ECL_00424"
FT   CDS_pept        439055..440320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00424"
FT                   /product="shufflon protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59990"
FT                   /db_xref="GOA:A0A0H3CFG5"
FT                   /db_xref="InterPro:IPR007001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFG5"
FT                   /protein_id="ADF59990.1"
FT                   /translation="MNVTKTTDRGWAILSTGAALVILLLVSVWGYSLISDWMQRRTWMN
FT                   TSAQVSRFTQAVKSYTGRYYDTLLASATTTAPVIVTPAMLKNTGFLEQGFSETTIDGQA
FT                   YSAAVIRNATNTDQLQAMIYTQNGSALPFLALRQISMDISAGMGGYIWTSGIATGAMGS
FT                   WTVPLAQFGVSSTQGHIATLLTADELGVARGESDRLYRFSVTGKPDLNTMHTSIDMGGN
FT                   NLNNTGTVNAVTGTFSGNVTAGGNMTANGTVTGQNVAAGTNVTAGNTITASNDIRSNNG
FT                   WFITRDGKGWLDETHGGGFYMSDNDWVRVVNNKNIYTAGQVRGGSVRADGRLSTGEVLQ
FT                   LDGVNTAGATCSPNGLVSRDASGAILSCQSGVWTGAGKIIIRPVNGYQRQMQMMTLLVI
FT                   NSLLSYRMDCSVCTLVSDSILC"
FT   gene            complement(440746..440889)
FT                   /locus_tag="ECL_00425"
FT   CDS_pept        complement(440746..440889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59991"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFT5"
FT                   /protein_id="ADF59991.1"
FT                   /translation="MLKVNYLPVNPVCGEKAQLHYSEPHGQYQERVRIMAMCVRHIFSH
FT                   PE"
FT   gene            441412..442572
FT                   /locus_tag="ECL_00426"
FT   CDS_pept        441412..442572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00426"
FT                   /product="shufflon-specific DNA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59992"
FT                   /db_xref="GOA:A0A0H3CHH8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHH8"
FT                   /protein_id="ADF59992.1"
FT                   /translation="MAVRNRIKKMPLAKALDKYFSAVSVHKRGHLQEFYRINVIKRSTL
FT                   SLKCMDEITSVDIADYRDMRLNTVSDRTGRTVSPNTVRLELALLSALYNLARIEWGTCS
FT                   HNPVEHVRKPAASPGRTRRLTSTEERRIARALRQKNPQLLAIFHLALETAMRQGEILSL
FT                   RWEYVDLHLGIAHLPLTKNGTARDVPLSWKARQVLKEFAGPVTGPVFDYTSNGFKSAWR
FT                   VLLAELEIHDLHFHDLRHEAVSRLFELGTLNVMEVAAISGHKSMNMLKRYTHLRASQLV
FT                   SKLDARRRQAQKLATLFVPYPAEISESGGLFRVQFSDLEHTAITAVNRDEALANAASHL
FT                   LRIQALAARAGKRLPPPGEIGVREAHRVLINPFHKGGEAAGTDNGT"
FT   gene            442691..443548
FT                   /locus_tag="ECL_00427"
FT   CDS_pept        442691..443548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59993"
FT                   /db_xref="GOA:A0A0H3CDV0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDV0"
FT                   /protein_id="ADF59993.1"
FT                   /translation="MSLSHASPDELLPEAPEHQVSAPEVQSAAAVKPRIRLPFSPRKIL
FT                   QTGSIILLTVSLTGSLIALVVMGRQVSDLTIRVNTLDAAFRSGQIGQLTSNISAMEARL
FT                   KTLEQQAATLASLPAAMQSADEQQSALRTSVSQLQEAGNDNTRAVTQLQSRVGSLEHDV
FT                   QQSRAELDEINRKAELTQKTPAPEKPRTSTGAVPPRVGAAVKKTDRSARRTVTPAAPFV
FT                   LTGIERRGGQTFAVVIPRGVSQISAMRLLSPGDAMLGWTLRSTEGSGAAVFLVNGREHR
FT                   IQVE"
FT   gene            443566..444279
FT                   /locus_tag="ECL_00428"
FT   CDS_pept        443566..444279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59994"
FT                   /db_xref="InterPro:IPR022293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEH2"
FT                   /protein_id="ADF59994.1"
FT                   /translation="MKKTLMASLFLVPLMTSAATVRTSSAQSSISTSQESSTGVLSAQQ
FT                   QAQQWGLSDSDWSRYQTLMEGDRGIMSPGLDPLTALGVETDNSAERRRLAELWVRHEYQ
FT                   RSEKELAFQREINAAWLRLYPETLAVNMGSNAAGIAHDTQGRLALFVKENCSRCDARLA
FT                   AVLADDRPVDIYLVGGNSDEAIRTWAIRHNIPVEKVRSRQITLNHDGGLWLRYGQGQMP
FT                   VILQQGENGWQLAAF"
FT   gene            444258..444869
FT                   /locus_tag="ECL_00429"
FT   CDS_pept        444258..444869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59995"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFG9"
FT                   /protein_id="ADF59995.1"
FT                   /translation="MAARRILMLGAGILFATAASGATDLQVIPDAYRQIAAAERVPAES
FT                   LYSLAMAESTRKTAWGAKPWPWTINVAGRGYHYSTREEAFTALLGFMQRWPLKNIDVGV
FT                   AQVNLGWNGHFFPTYRDAFDPYTNLRAAARILRACYDARPGSWLRAAGCYHHPSGGAHA
FT                   ATYMAIVRRKLSQIAMTGTPAAVGQPGLLARNSLSWIEPQ"
FT   gene            444866..445396
FT                   /locus_tag="ECL_00430"
FT   CDS_pept        444866..445396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59996"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFT9"
FT                   /protein_id="ADF59996.1"
FT                   /translation="MKNTLRYTLVFTLFSGLLTSAFSASATLTVVGDLGGESTGPLFDA
FT                   INAGPGQSATESPVLPPPPASLSLSDMLPVSTPEMSPGAVAARPLNLPGMPPVFVLGDD
FT                   ASSRHWLTHHATTLSRMQATGMVISVRDEQGLNALRQLAPGVAMVPVSGGDLARRLALT
FT                   HYPALITATGISQ"
FT   gene            445396..446040
FT                   /locus_tag="ECL_00431"
FT   CDS_pept        445396..446040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00431"
FT                   /product="restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59997"
FT                   /db_xref="GOA:A0A0H3CHI2"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHI2"
FT                   /protein_id="ADF59997.1"
FT                   /translation="MPASLIAELLNPHRGLSVLAMTGAVVLAFLALKPRTVSQRRHRRY
FT                   QKQAARALLRLPQLRDEAARMAWLRKMNPYVFEEMLLTALSRQGLRIQRNARYSGDNGA
FT                   DGQVWINGRRWLIQAKRYSATISAAHVSVFGLLTEREGCPGLFVHTGRTGEVSREAFRR
FT                   YDGIILISGQRLLWLLSGDRRWMDTLTRPPHRSLTPQSQRKEPAPSPVIRD"
FT   gene            446055..446429
FT                   /locus_tag="ECL_00432"
FT   CDS_pept        446055..446429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59998"
FT                   /db_xref="GOA:A0A0H3CDV4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDV4"
FT                   /protein_id="ADF59998.1"
FT                   /translation="MPRMLYSLTDRIVDLVTSQAAKTAPMVIFVLVQCVLRICILRPLI
FT                   IFCCMVLAVLIAVPVAVFISPSFTPDVLAQGLLRVIHLLPGAYTPLCVAGALSELVYLI
FT                   RRFTVLPDFWPDNAAQRKGR"
FT   gene            446433..447209
FT                   /locus_tag="ECL_00433"
FT   CDS_pept        446433..447209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ADF59999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEH7"
FT                   /protein_id="ADF59999.1"
FT                   /translation="MSDFLARTDANPPHWAGEVIGKWDDHKLRLYGGFLRRHYWTDQGS
FT                   INVFCIKGTDHPDYQGLTWHEFLHRGKRMDRNIPMLERNPGYYLETDRKKPSMYYNSYD
FT                   GIDWYIGADGNHRSGLARFLFHEREMAYLHGVHLNHYEFDEPLLAVYLALREELSQHAA
FT                   QGFHMDLNVNRVHRAREDTAGWKTDIYSTSLYFSVGSWCREHADNLDISALAAPRDFSC
FT                   PDEGWQLLVSLMAWRDKRTATKRPGFFSRLTSRGRI"
FT   gene            447206..449323
FT                   /locus_tag="ECL_00434"
FT   CDS_pept        447206..449323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00434"
FT                   /product="TraG-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60000"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR022503"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFH5"
FT                   /protein_id="ADF60000.1"
FT                   /translation="MSDRYVMESLLRPAVELYSATVAASATCICLTAPWAVALSPSVSW
FT                   VTAAGFGVLALKRTREGMKILRYRQNIRRLPRYVLTSEQIPVSRRHLFLGKGFQWSVRH
FT                   TQRLIEARRPECEIYVQPSVLYRMAREMEKKMEYSLPWLCRLTCTDSALNPFRPLPPVG
FT                   GSPVYHGVEPDETTVTYDLGERVGHMLVIGTTRVGKTRLAELLITQDIRRTNAAGEHEV
FT                   VIVFDPKGDADLLRRMYAESHRAGRQDNFWVFHLGWPDISARYNAVGRFSRISEVASRV
FT                   AGQLSGEGNSAAFREFAWRFVNIITRALVALGQRPDYGLILRYVTNIGELYETYVDNLL
FT                   SEKAPQLMNTTEAMMQSGISDKDLPRHLQGRPNGVKIWVSEQVLGSPEGKKLWDPVLDG
FT                   LRSAVQYDRTYFDKIVASLLPLLEKLTTGKTAALLAPDYTDLDDPRPILDWHNIIKSRG
FT                   VVYVGLDALSDPVVAAAVGNSMFADLVSEGGHIYKFGLGDEEEGKSAKVAINLHCDEFN
FT                   ELMGDEFIPLINKGGGAGFQVTAYTQTLSDIEARIGSTAKANQVVGNFNTLVMLRVREK
FT                   NTAMLLTDQLPEVDVYQKTLTSGVTDVSRPGEGTDFNSNVNDQVSLVKVPMIRPADIIN
FT                   LPKGQAFALLEGGRLWKIRMPLPADNNDPHMPASLKHLADSMEKNYHTGETWWTGGDIT
FT                   YAGGPDATAGQ"
FT   gene            449304..450065
FT                   /locus_tag="ECL_00435"
FT   CDS_pept        449304..450065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00435"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60001"
FT                   /db_xref="GOA:A0A0H3CFU4"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFU4"
FT                   /protein_id="ADF60001.1"
FT                   /translation="MPQQDSENGQRSATPRQRQSGPIGLLLWDFPMGLIGVLLGSLLVS
FT                   LLIEYVCIALLWPEEGAAHSYQVMVAESHWLSEGYTRSLLMAAPVETVSRWVHVAWQWL
FT                   FVDSGFSGWLQSFKSLSEKGSGLIPALNGIGATLVSWLGVYLQATVWVTLIFFIRVMIL
FT                   FLSLPLFALVVITGVVDGLVRRDLRRYGAGYESSFVYHHAKRFIKPALYGPCMLYLAWP
FT                   TAVWPNLLLLPSALLVGGVLAVVTGSFKKYL"
FT   gene            450271..450588
FT                   /locus_tag="ECL_00436"
FT   CDS_pept        450271..450588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60002"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHI6"
FT                   /protein_id="ADF60002.1"
FT                   /translation="MPHTRILTALLMAVLPALQCHASEKDELALVMRQLDQVQAGLDRA
FT                   RVVANQTQDARFYFDYQQATRDITTMKQGISTYLEPSRAQPASPSSSVTGQYRAQAPAW
FT                   R"
FT   gene            450579..450824
FT                   /locus_tag="ECL_00437"
FT   CDS_pept        450579..450824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60003"
FT                   /db_xref="GOA:A0A0H3CDV7"
FT                   /db_xref="InterPro:IPR021676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDV7"
FT                   /protein_id="ADF60003.1"
FT                   /translation="MAMNGAQLNGWSAGTGSSLTPSQLNTLILGTLAVVILLFSAWALV
FT                   QAYRGVASKSVTFRQFNELAVRLIVLYLAMLFLFFH"
FT   gene            450838..451203
FT                   /locus_tag="ECL_00438"
FT   CDS_pept        450838..451203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60004"
FT                   /db_xref="GOA:A0A0H3CEI1"
FT                   /db_xref="InterPro:IPR021356"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEI1"
FT                   /protein_id="ADF60004.1"
FT                   /translation="MISTLLRRYRAIRARAKHILLTGLFFTGNALADLPPIEQPTTGGG
FT                   GGTYNIMMGYAKMGGLALGLLVSVGAFLAVAHAVITSFHDIRKGKGSWTEFLLYGVVGI
FT                   ILILVVIFLATKASDIL"
FT   gene            451213..451587
FT                   /locus_tag="ECL_00439"
FT   CDS_pept        451213..451587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60005"
FT                   /db_xref="GOA:A0A0H3CFI0"
FT                   /db_xref="InterPro:IPR021877"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFI0"
FT                   /protein_id="ADF60005.1"
FT                   /translation="MAVIDFLPDRLNNPPVVWKGFTSGEFLLAAITGVIAGIPLAVPLA
FT                   LVPFIGWLAFPTCMLLMPMFVIFFGGGWIAGYKRGKPENYIWQRLEEIRCRTGLSRALI
FT                   LNSRAWEMKRTTAIKRGGLS"
FT   gene            451584..452228
FT                   /locus_tag="ECL_00440"
FT   CDS_pept        451584..452228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60006"
FT                   /db_xref="GOA:A0A0H3CFU9"
FT                   /db_xref="InterPro:IPR021548"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFU9"
FT                   /protein_id="ADF60006.1"
FT                   /translation="MSRFRNGMTARDNHIFSLRIACALLFAGMLMAGIGWMRAPSELTI
FT                   HNPPDLRSGSTRKWWEVPPSTVYSFAFYIFQQLNSWPKNGEVDYPAKIAQMSPYLTPSC
FT                   QDFLNKDAEMRKNSDELRDRVRVVYEIPRRGYSSRSVTILDQDHWIAQLDLVADEYYHT
FT                   EPVKRALVRYPLKVVRWEGDPERNPFGLALDCYAATPQRLEAVTLPEPEKK"
FT   gene            452228..453136
FT                   /locus_tag="ECL_00441"
FT   CDS_pept        452228..453136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60007"
FT                   /db_xref="InterPro:IPR021844"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHJ1"
FT                   /protein_id="ADF60007.1"
FT                   /translation="MKNPLKKCRLLLLAGLILSGAADAVELMKWERIPLQVPLTVGQER
FT                   IVFVNKNVRVGFPPALNNKLRIQSTGGVVYLDASEAFPVTRLELQNKENGEIILLDVSA
FT                   APGKTTREPVKIVYDGEVATATASDRQSVSSEGDSTGRSAQQADTETTKPDRKPAKLNA
FT                   PLPVVLTRYAAQNMYGPLRTVEPVPGISPVSLKLPSVITTLMPAEPVTVTPMAAWSLQG
FT                   SSVVALQVRNRSAGKVILDPRALEGQFTTATFQHRWLGRAGTPEDTTVLYLVTPGRPEG
FT                   AFIAEPPSLQPADGHKRRAKK"
FT   gene            453133..454656
FT                   /locus_tag="ECL_00442"
FT   CDS_pept        453133..454656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00442"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60008"
FT                   /db_xref="InterPro:IPR021207"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDW1"
FT                   /protein_id="ADF60008.1"
FT                   /translation="MKAPSSNLLVKVAVPVVLASAVVVGVKSCSGGGNQTAAPHTASNV
FT                   ALKDLSPEDLKALGIEGDTPQDTLRTVVGNFRKVQDRLDTLADDNKKLSDENKALKTTN
FT                   SNVDTQINQAVSNARAEEAQKRQQLSAEVTDLSTQVKQLMDQLRNGGAGTESGKNSGSG
FT                   SDIPIGLGYDSGLNSGAAGVSSSADGLHWVEPKDGVPVDASGRPVTDSNKNNATGFSFA
FT                   TSFADTADAGKQAVGNTTAAVQTQLTDAQKATDPVYTLPENSTLVGSRAMTALLGRIPV
FT                   DGKVTDPYPFKVMIGKDNLTANGIELPDVQGAIVSGTATGDWTLSCVRGSITSITFVFS
FT                   DGTVRTLPSPDGQGQNGNSSNQNSQGGNSSSIGWLSDDNGIPCISGTRKSNASTYLPTI
FT                   AALAAASAAGDAVAENQSTGQTNAYGGVTSTLTGNAGQAVLGKALSGGMRETVDWVKAR
FT                   YGQTFDAIYVPPGQTVALHITRQLAIDYEEKGRRVKYDFSLAGSGTGMD"
FT   gene            454668..455117
FT                   /locus_tag="ECL_00443"
FT   CDS_pept        454668..455117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60009"
FT                   /db_xref="InterPro:IPR022262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEI4"
FT                   /protein_id="ADF60009.1"
FT                   /translation="MQNDIPDTAVMRWRSLRPVTLFLTGAVALLLAGCSTSKDEMLPPG
FT                   DSTMLELWNDGASATHATGESRTTLRRPVTDSERVISRQTRDSYSRTQENEIQQTFPRL
FT                   PNPDLVMYVFPHLADGNTPVPGYSTVFPFYSQVQYALPGERTEDL"
FT   gene            455117..457915
FT                   /locus_tag="ECL_00444"
FT   CDS_pept        455117..457915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00444"
FT                   /product="putative plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60010"
FT                   /db_xref="InterPro:IPR022303"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFI4"
FT                   /protein_id="ADF60010.1"
FT                   /translation="MAFSLFRRRAEAQEAHQYGDGPFSVNGHEPLTREGRLTRSEEAKL
FT                   YETAPSIIDHIPWGEYLPEHQCILLDDGVSVGAVYEIIPVGTEGRPDSRLEEIRDVVEN
FT                   ALQDSLPELDTHQWVVQFYCQDESDLMVYMDKIRGYVKPRAQGTDFTDAWLREQARHLQ
FT                   NVATEKGLFVDEAVTGAPWRGQIRRTRMVIYRWVESPYRDPMAPEVLLKQVCDRLTAAM
FT                   SGAGIQCQRQNGEQIHSWLLRWFNPEPTWVDKATLYRCARHTDDAPGELPLLNDFSESL
FT                   WFTRPRSDAEKGVWWFDDVAHRAVPVARLRSAPTTGHLTGEVRRGDNINAIMDLLPEGT
FT                   VLVMTLVIHPQDKLEENFARLSRDSMGENVDSLRAREDAATARTYLGNKHKLYRAAITL
FT                   LIKARDLPSLDSRYLDLSSKLLNCGLEPVNPEHDIGPLSTYMRALPMCFNPEQDRHNWY
FT                   TRLMFVQHFACLAPVYGRDTGTGNPGFTFFNRGGGPLSVDPLNKNDRTQNAHLLLFGPT
FT                   GAGKSATALDKLAQMIAIYRSRIFLLEAGNSFGLAGDYFESLGLTVHRVSIKPGKAISL
FT                   APFGDSHLLMQEKPDELIISEDALPDIDDDEDKDEKRDVLGEMEIAARLMITGGEPAEE
FT                   QRMTRADRGMIREAIMIAARSTFEAGRQMLPEDLMFALQGIARDAGMGEDGRERRTAAR
FT                   RARAEEMSEALRMFTEGFEGELFNRPGTPWPEADVTIVDLGTLAREGYEAQMAVAVISL
FT                   LNTINNIAEREQYSDRDIIVSIDEAHIVTANPLMGPYATKIVKMWRKLGAWLWLFTQNL
FT                   ADFPDTAKKMLNMAEWWICLVMPPDEVEQIARFKTLNSEQKAMLLSATKLPKKYTEGVI
FT                   LSRKVQALFRAVPPSLYLALGMTEKEEKAERRLIMNELQCSELEAAFHVARRLDENRGL
FT                   SI"
FT   gene            457927..458331
FT                   /locus_tag="ECL_00445"
FT   CDS_pept        457927..458331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60011"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFV2"
FT                   /protein_id="ADF60011.1"
FT                   /translation="MKKLTMAPPMVVADKALIASVIFTVPPQGMASIGQSDSVSLDTLL
FT                   REILKRLKTPFLLSVYPHRVGRRSCVAVHLTDENEKKLDILITVTGNTLWPGEAEFRNG
FT                   LRWNVCVPDATDLLWVLKEIDRVTGGEICS"
FT   gene            complement(458493..458726)
FT                   /locus_tag="ECL_00446"
FT   CDS_pept        complement(458493..458726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00446"
FT                   /product="PerC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60012"
FT                   /db_xref="InterPro:IPR024684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHJ5"
FT                   /protein_id="ADF60012.1"
FT                   /translation="MELKDSIAESLEHRGQWRRAARRWLAVMDLSDDDAVREAIARRRE
FT                   HCISMGANIAPDGRRNETRRLYKMQSRYNNGY"
FT   gene            458854..461280
FT                   /locus_tag="ECL_00447"
FT   CDS_pept        458854..461280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60013"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDW6"
FT                   /protein_id="ADF60013.1"
FT                   /translation="MRYPFELDPQIIHHIIYSQAGSIGKAVIELIMNSVDAGAGAVIID
FT                   ITPEGFSCRDDGRGFASYDDVKRYFGRFGTPHQEGDATYGRFRLGRGQIMAHARTLWRS
FT                   QRWQMSVDTREMGYHYDLEELTQPIQGCIISGEWYEPLTSQERMSCLQEIRDLVRYTPV
FT                   TVHLNGTIITRNPALEKWDMEDDEAWYRLREDGAVSIYNQGVLVRHDPAHIWGVGGLVV
FT                   SKKPLALNVSRTEILRKTCPVWASIAARFGRLAATFSDNQGKHRKTEARREKTARSLLS
FT                   GEGDMQSLFNGEEVITLLPGKQHVTLEHFIRKCCHYPSAVDKNCFTLIRYAGDVPRGEL
FT                   IARAGIAPVVHPVTLSRFGCYEPEEFMECLSRVRENLMAYREPLPREQRWGSGWLSELA
FT                   LVDFETLSTNFIDSTQMVSEKQLDKETRRAWTALRWCLARYAAVCSGGEAGYQSRSYGG
FT                   KCFQILLGESTSSDAWTDGETYIAYNIDIVRRLKPDALRTASLLFSLTEHEVAHEGDSL
FT                   DCGHDEAFYQRFHDISTLCAPDRQRYMHVWLMKYTTSLEAESKRAKGTAWRERYLTERA
FT                   STGREKKGLPGVISHEGIEDAVNAPAEPEDVARLSFLNLQLNGAGTVAPAETDWNSVVA
FT                   AGIEQTRVNQDIRGQQKKLLEEWYASDKDETDILTDEQQADEAEEQMWLESRKLHYLSI
FT                   LPGATEENLHDRAVAFLAYMTDSEEEELAAWAMRAWENSDQWYARNTLSCSEADFLYEQ
FT                   DFDQPLGENVPADWLPFMQEGETRWSIERNAAAAGFIREMDYLEWRRDSAIDDIP"
FT   gene            461448..461855
FT                   /locus_tag="ECL_00448"
FT   CDS_pept        461448..461855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60014"
FT                   /db_xref="InterPro:IPR011090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEI8"
FT                   /protein_id="ADF60014.1"
FT                   /translation="MKLPVCCLAALFLTAGVRAGTVIYTDSTHPVTGNPGPEVTVVLLD
FT                   APDRLQAQLFGPLPADPAQAEQQARTVIGSPDFQRRQQDLAGAYAGLTRAWSLGLEKYP
FT                   AVVFDDKWVVYGTSDVDVATQKLNVWKEKAQ"
FT   gene            461852..462823
FT                   /locus_tag="ECL_00449"
FT   CDS_pept        461852..462823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60015"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="InterPro:IPR026331"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFI9"
FT                   /protein_id="ADF60015.1"
FT                   /translation="MKMSFSRPRRLALATLMVCTGTMASVNTASLLSSATSPDCISWRI
FT                   SGICYWLFCTPFGCSVKTSVKVTHFIPEAVVSAYLSPGANPWTEMSAVSSLADSTESTL
FT                   LGSAAGVATGGGRQEMKAPGERKQNLHFYYGDAYGHPATRLIGGMVPGYSCDSAATPFM
FT                   PYFTSALDALAWRTGVPESLYPEALIPGQREIGSTIGGNMWGNVYPRSGFVTQTDSYKS
FT                   AAMVVQRVADIITRQGQLHVYSPLTGQRSPGYWPPDPVQENTGTKNHKWQRLSPQLSQS
FT                   CAVFPDTGGQEAQDGNYAWALWQPYSCCKRRGQTFLYSTDFS"
FT   gene            462835..464259
FT                   /locus_tag="ECL_00450"
FT   CDS_pept        462835..464259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60016"
FT                   /db_xref="InterPro:IPR021204"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFV8"
FT                   /protein_id="ADF60016.1"
FT                   /translation="MKQQYPQRLRRPLATLALFAALSLPALAVNTSLSSDGASVSGAIN
FT                   DGLFYSIGGGSVISPPPSRSNMSRLGLNDGWSSDLMCGNFDLKTTVGNQLNGITSGFKD
FT                   LMGNVIQGATGAVMSMPAMAIQRANPGLYEMLTNGVLQAGLSYDKALLNCQNMSKKLAD
FT                   YTVGSKWQQAAVSEEYKDIVASSGGDAVSSDQQLQKATGEEGVTWVGGQKRGGKGQQAI
FT                   QPTRDLAKAGYNMMNSLPVTSNSSVGSASCNGTACQRWPSSDDAAAAVVKVLGDRSIRT
FT                   CRETSECTSGGTDNQPGSTVAGTGFSPVLEDATKTNLEQLDKLVGGQIQPTAENLGALK
FT                   TGSLVVTRGVIQSLRDDPDKAALVQRLAGELAMADTVETALTMRRMLTTGESEPNAAEQ
FT                   PEAIAEGDRRIDALDRELNALRNEMELRKAISNNSLLTTLERQGARNQDNQLQQKAGNQ
FT                   DQGFSQMNQTQSSGAK"
FT   gene            464261..464599
FT                   /locus_tag="ECL_00451"
FT   CDS_pept        464261..464599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60017"
FT                   /db_xref="GOA:A0A0H3CHJ9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHJ9"
FT                   /protein_id="ADF60017.1"
FT                   /translation="MKRSFLRGRTGRIVLMIAALLLITVAMFALASVFMAYDPDGHLTR
FT                   RWLHDSRWALFTWRLLMYAGIAVVWRMKVRPQMLARWPEVRARLPRTELLGVLFIAATE
FT                   CVAWAGVA"
FT   gene            464613..466157
FT                   /locus_tag="ECL_00452"
FT   CDS_pept        464613..466157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60018"
FT                   /db_xref="GOA:A0A0H3CDW8"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDW8"
FT                   /protein_id="ADF60018.1"
FT                   /translation="MTANSFLEYFLILFGWVMNNAMWTILGSTGLFALPLVFKVMGVWL
FT                   KVREEGADEGNKGLLALPRIEHALYVSFVVMLFCCIPLLPVDISTIKFDSSRAKQCGVS
FT                   VPTPQNSGYSGLVNDFDGRTAEVPIWWYLLHMISKGTTQAMIASIPCGTELRQMRFDVQ
FT                   NTKLRDPVLLQEVQDFANQCYSRAYFRLKNSNSQLSDATINSVGWIGSDYFLNTSGYYD
FT                   YYTATTPRGQWPYDSTRDSGYPDTGQGGYPTCKTWWSDGSSGLRKRVLASFGDNTRKEM
FT                   QRSFPGTQWEEVALRWLVSPRNAGLSGDGTTYAVGSSDNVTGVVGNMTRLTSTIGLGLK
FT                   QAEALPGFDALKQALPMIQALLQMMIITVIPVLMMFSAYEPKTVVTISFALFALQFITF
FT                   WWELAGWLDDRLITILYDNMAQQGLASSVPFANFISSTNDGWIMNLVLGMMYVVFPVFW
FT                   IGMLSWIGVNLGTAISTGLEKGGSLPQKAGAEAGRDAQKIATDKAGGALKGGLKLK"
FT   gene            complement(466201..466491)
FT                   /locus_tag="ECL_00453"
FT   CDS_pept        complement(466201..466491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEJ2"
FT                   /protein_id="ADF60019.1"
FT                   /translation="MSKDGFRADDIASTFARFANKRRNIVCDESKLQRKKPEPLEFSSA
FT                   TNACGTAVLAGIADLMIITPERKKQNEEWSESWDAEREDWESQDRQWNDNR"
FT   gene            complement(466686..469352)
FT                   /locus_tag="ECL_00454"
FT   CDS_pept        complement(466686..469352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00454"
FT                   /product="ATPase involved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60020"
FT                   /db_xref="GOA:A0A0H3CFJ2"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFJ2"
FT                   /protein_id="ADF60020.1"
FT                   /translation="MKGSEWNKWDLHIHSPMTWLANVYADNCDIETYVRKLGEQQLSLI
FT                   GLTNYFYFQENELEIIRSEIGRQGLNITVLGNVEFRLDQQNKDEAFINVHVLFSDKLST
FT                   SKINEILSRLPLKLTDDSGKKVYACESSVRDSGHNVDTIVVNLSDLLEHLSSALRPFID
FT                   YIVAVCPNGYGGYRPGATGRSAAIATEIDRQGHIIFGDPNDRDYFLTTTRYPGASLKPV
FT                   FHCSDAHRAEHIGRAYTWVKAKPTFEGLRQALLEPEARLQLGADWLAQRPPKVHFSHIA
FT                   VEGTIFDGQAIRFKKQSIPLNQDMVAIIGGRGTGKSLLLDALRSRFAGATAYGIEEREV
FT                   NVEHLSIELDKTNGEKTLFDTRTDSYDYLHVSQGEIKTLCQQPGLISDEIKKMLRLADC
FT                   EVADEQRRGLGENLNAFQTFREYYVAQDERQYYINTPGYQDEVIKVAQDKINTLTSEKN
FT                   KALIERFRANSLRATALTRGINAGNAFLREATAAETSLNSRLTEMNTVSAGVVPVPPLD
FT                   LSELMARVKAYMEALQTQLMETGEDNLRITAEFREQGIEQDITGVLDKIQGYQREIQQA
FT                   QLRHGEIQQRITQYNNDVRQRGNLVETYVRQLLEQKTAIDSCFAALAEKPHLKPDQQEL
FT                   IKEILTDIRIYGQPHFDTARFYNGILERLNRGRFRTAGEQSGTEKLTQVLGVRSIDDFV
FT                   ALVRGDAIIELPEEPGNKITLEAFLWRSEYFNNQGPYALQRFLCSPEHISSYLTVRAEF
FT                   EYKGKTVEKLSAGQRGTFYVCLKLATDAFGSPFVFDQPEDDLDNDFIMRQLVPLFRKIK
FT                   LYRQVIIVTHNANLVVNCDAEQVIVASNEDEVISYRSGALEHGDHGQKNSMRKAICDVL
FT                   EGGRQAFEAREQKYGML"
FT   gene            complement(469385..469588)
FT                   /locus_tag="ECL_00455"
FT   CDS_pept        complement(469385..469588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFW3"
FT                   /protein_id="ADF60021.1"
FT                   /translation="MAPHPVFFRLKRLTESQERCQFNSSFSGRFHPIYSSVSVSVYDFP
FT                   DTLMLIIAQKHGKLKTLSLLSQ"
FT   gene            469649..469864
FT                   /locus_tag="ECL_00456"
FT   CDS_pept        469649..469864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHK5"
FT                   /protein_id="ADF60022.1"
FT                   /translation="MYTKMLNYLLPMHSQLVTVGDEMERQSKIRVNASESYARVALDHL
FT                   LAQYLPGQSRINDCVAALPAFSVPLM"
FT   gene            complement(470012..470128)
FT                   /locus_tag="ECL_00457"
FT   CDS_pept        complement(470012..470128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60023"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDX2"
FT                   /protein_id="ADF60023.1"
FT                   /translation="MLITPISKYFIRIQPRANSDELMKVLDGINHSGLGKCE"
FT   gene            470195..470725
FT                   /locus_tag="ECL_00458"
FT   CDS_pept        470195..470725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00458"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60024"
FT                   /db_xref="GOA:A0A0H3CEJ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEJ7"
FT                   /protein_id="ADF60024.1"
FT                   /translation="MEITEADERHISAIQQIYAWHVLHGTATFETEPPDVAEMTARQKN
FT                   IHAAGLPWFVATENGEVLGYCYLSLYRERCAYRFTLEDSVYIAPAFQGRGIGTLLLSRV
FT                   VAWAEEHGFRQLIAVVGNSENIASLSLHRSAGFRHTGTLKSVGFKHGRWLDTVILQRTL
FT                   GAGDVTLPDIPTG"
FT   gene            complement(470808..471530)
FT                   /locus_tag="ECL_00459"
FT   CDS_pept        complement(470808..471530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00459"
FT                   /product="putative arsenic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60025"
FT                   /db_xref="GOA:A0A0H3CFJ7"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFJ7"
FT                   /protein_id="ADF60025.1"
FT                   /translation="MNELNDSLPNIIPDIFDTPDFTGKPLSETPGHAPRILMLYGSVRE
FT                   RSYSRLTTEEGARLLTAMGAEVRIFNPSGLPLPDDAPDTHPKVAELRELVRWSEGMVWC
FT                   SPERHGAMTGIMKAQIDWLPLSEGAVRPSQGKTLAVMQVSGGSQSFNAVNQMRILGRWM
FT                   RMITIPNQSSVAKAWQEFDEEGRMKPSAYYDRIVDVMEELMKFTLLTRGRTAYLVDRYS
FT                   ERKESASALSGRVNQRSI"
FT   gene            complement(471829..472200)
FT                   /locus_tag="ECL_00460"
FT   CDS_pept        complement(471829..472200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00460"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60026"
FT                   /db_xref="GOA:A0A0H3CFW8"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFW8"
FT                   /protein_id="ADF60026.1"
FT                   /translation="MCHYMMTLAELSENQADALPSLCADLHMDWFHLPVQDSCAPEEPF
FT                   EQAFAREKKSLLALVRSGGTLVIHCHGGSGRTGMMAAVLMLESGYQPAQVKKQVQLIRP
FT                   KSLTSPVQVNYLCKRYGYQ"
FT   gene            472260..472571
FT                   /locus_tag="ECL_00461"
FT   CDS_pept        472260..472571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00461"
FT                   /product="IS3 family transposase orfA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60027"
FT                   /db_xref="GOA:A0A0H3CVQ5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CVQ5"
FT                   /protein_id="ADF60027.1"
FT                   /translation="MNKKTKRTFPPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESW
FT                   VRQLRRERQGITPSATPITPDQQRIRELEKQVRRLEEQNTILKKATALLMSDSLNGSR"
FT   gene            472760..473437
FT                   /locus_tag="ECL_00462"
FT   CDS_pept        472760..473437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00462"
FT                   /product="IS3 family transposase orfB"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60028"
FT                   /db_xref="GOA:A0A0H3CDX6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDX6"
FT                   /protein_id="ADF60028.1"
FT                   /translation="MLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQEHTSLPN
FT                   LLERQFAVPEPDRVWCGDITYLWAGNRWCYLAVVMDLFARRVIGWSLSAHADTALISSA
FT                   LRMAYETRGQPRDVMFHSDQGSQYTGLKYQQLLWRCRINQSVSRRGNCWDNSPMERFFR
FT                   SLKTEWVPTNGYAGKDEARQQINDYILNYYNSVRPHHYNGGLTPEESENRYHFYCKTVA
FT                   SIT"
FT   gene            complement(473441..473587)
FT                   /locus_tag="ECL_00463"
FT   CDS_pept        complement(473441..473587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60029"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEK2"
FT                   /protein_id="ADF60029.1"
FT                   /translation="MFHPFDILTLDNGARLIFTPCPGTRGVSLADSLKSLKEAGAQAVI
FT                   TMM"
FT   gene            complement(473727..474236)
FT                   /locus_tag="ECL_00464"
FT   CDS_pept        complement(473727..474236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60030"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFK1"
FT                   /protein_id="ADF60030.1"
FT                   /translation="MMSKTYNVLFLCSGNSARSLFAEVLMNQLGGGKFRAFSAGTQPAS
FT                   SPHPLTLRVLNDQGFSTESLKSKHLQNFRHPDAPQMDFIFTLCDRMAGEGCPVFPGSPI
FT                   TAHWGFRDPALAAGTDTEKYHAFVEVEKQIATRIRLFLSLPLDKIDRLSLQKQLQAMGN
FT                   TGSDEH"
FT   gene            complement(474309..474737)
FT                   /locus_tag="ECL_00465"
FT   CDS_pept        complement(474309..474737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00465"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60031"
FT                   /db_xref="GOA:A0A0H3CFX3"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFX3"
FT                   /protein_id="ADF60031.1"
FT                   /translation="MSAITIYHNPACGTSRNTLELIRNSGVEPTVILYLETPPARAELV
FT                   TLIADMGICVRDLLRKNVEPYEQLGLAEDKWSDDELIDFMLQHPILINRPVVVTPLGTR
FT                   LCRPSEVVLDILPDAQKGAFSKEDGEQVIDAQGQRVVK"
FT   gene            complement(474795..476084)
FT                   /locus_tag="ECL_00466"
FT   CDS_pept        complement(474795..476084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00466"
FT                   /product="arsenite/antimonite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60032"
FT                   /db_xref="GOA:A0A0H3CHL4"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHL4"
FT                   /protein_id="ADF60032.1"
FT                   /translation="MWLAAAIFILTIVLVIWQPRGLGIGWSAMLGALLALITGVVHPGD
FT                   IPAVWHIVWNATAAFIAVIIISLLLDESGFFEWAALHVARWGNGRGRWLFSWIVLLGAA
FT                   VAALFANDGAALILTPIVIAMLLALGFSKGTTLAFVMAAGFIADSASLPLIVSNLVNIV
FT                   SADFFKLGFNEYASVMVPVDIAAIIATLVMLHLYFRKDIPATYEISRLKAPEEAIRDRN
FT                   TFRTGWGILALLLLGFFGLEPLGIPVSAVAAVGALILFLVAKKGHAINTGKVLRGAPWQ
FT                   IVIFSLGMYLVVYGLRNAGLTDYLSAVLNQFASQGLWAATLGTGFLTAFLSSIMNNMPT
FT                   VLVGALSIDGSTATGVIKEAMIYANVIGSDLGPKITPIGSLATLLWLHVLAQKDIRITW
FT                   GYYFRVGIVMTLPVLFVTLVALALRLSVSF"
FT   gene            complement(476125..477891)
FT                   /locus_tag="ECL_00467"
FT   CDS_pept        complement(476125..477891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00467"
FT                   /product="arsenical pump-driving ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60033"
FT                   /db_xref="GOA:A0A0H3CDX9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027541"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDX9"
FT                   /protein_id="ADF60033.1"
FT                   /translation="MNYLNTIPKFLFFTGKGGVGKTSLSCATAIRLADEGKRILLVSTD
FT                   PASNVGQVFGQQIGNTLTVISDVPGLTALEIDPQAAAQQYRARIVDPVKGILPEDVVRS
FT                   IEEQLSGACTTEIAAFDEFTGLLTDDALLNDFDHVIFDTAPTGHTIRLLQLPGAWSSFI
FT                   ETNPDGASCLGPLAGLEKQRERYSHALSVLADGEKTRLILVARAQQSTLAEVARTHDEL
FT                   LHVGLKHQYLVINGIMPAGEASEDSLASALYQREQRILSHMPQVLASLPTDRLSLQQEN
FT                   LVGVTALRRLLTGENKPCSLPAAKPVSEPLSVPSLEMLIDDIARGGHGLVMLMGKGGVG
FT                   KTTLAAAVAVALADKGFDVHLTTSDPAAHLESTLNGQLPHLQVSRIDPHAETARYREHV
FT                   LATKGKELDPQGRALLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMDTAPTGHTLLL
FT                   LDATGAYHREVVKRMGEKGHYLTPMMQLQDPERTKIMLVTLPETTPVLEAAGLQEDLRR
FT                   AGIEPWAWLINNSLVATETTSPLLLTRAAHEAAQINKVRTELASRMALIPLQQEEPTGI
FT                   EQLKRLTRQAGK"
FT   gene            complement(477915..478202)
FT                   /locus_tag="ECL_00468"
FT   CDS_pept        complement(477915..478202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00468"
FT                   /product="arsenical resistance operon trans-acting
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60034"
FT                   /db_xref="GOA:A0A0H3CEK7"
FT                   /db_xref="InterPro:IPR010712"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEK7"
FT                   /protein_id="ADF60034.1"
FT                   /translation="MSFSADVTWLKQQGVSVERFNLSQQPLAFAENPSVKAFLERSGAE
FT                   SLPLILLDGEFVLSGRYPTRQDLARWFGLNQEKTGMAPGKSCCGGNTSCC"
FT   gene            complement(478303..478782)
FT                   /locus_tag="ECL_00469"
FT   CDS_pept        complement(478303..478782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00469"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60035"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFK6"
FT                   /protein_id="ADF60035.1"
FT                   /translation="MNILFLCTGNSCRSILAEATFNALSPEAHHAFSAGSQPKGEVHPR
FT                   ALALLRKEGIPTDGYYSKSWNNLPVTPDVVITVCGNAAGETCPAYLAPAVRAHWGVEDP
FT                   DKTTGSDEEIDAAFEQAWHILRRRIEAFLLLAPSVLSGPEERLQAELNRIGETIF"
FT   gene            complement(478839..479192)
FT                   /locus_tag="ECL_00470"
FT   CDS_pept        complement(478839..479192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00470"
FT                   /product="Arsenical resistance operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60036"
FT                   /db_xref="GOA:A0A0H3CFX6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFX6"
FT                   /protein_id="ADF60036.1"
FT                   /translation="MAPITALQLFKNLSDETRLKIVLLLRASGELCVCELCGTLEESQP
FT                   KISRHLSMLRESGLLIDRREGKWIHYRLSAHMPAWAAAVIEQAYLSQKEDISLLAGRIA
FT                   RNSATTGGRAVCL"
FT   gene            479312..479494
FT                   /locus_tag="ECL_00471"
FT   CDS_pept        479312..479494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHL9"
FT                   /protein_id="ADF60037.1"
FT                   /translation="MRIEKVTGWLFRLIPERVFDALSGIVCAEMDGIARDRLPEQTERK
FT                   ATLPAAGQERRKRNN"
FT   gene            complement(479541..479660)
FT                   /locus_tag="ECL_00472"
FT   CDS_pept        complement(479541..479660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDY3"
FT                   /protein_id="ADF60038.1"
FT                   /translation="MPSSGKVVSLSVAPLKRSLDMSVIAGEMLSDSPEGLTAD"
FT   gene            complement(479693..479875)
FT                   /locus_tag="ECL_00473"
FT   CDS_pept        complement(479693..479875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEL2"
FT                   /protein_id="ADF60039.1"
FT                   /translation="MERLIWALPPAFINNQMPGNLKQPGSCIYNGTEFSLLTYCPEEGF
FT                   LYQIISISLITRLSE"
FT   gene            480123..480239
FT                   /locus_tag="ECL_00474"
FT   CDS_pept        480123..480239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60040"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFL1"
FT                   /protein_id="ADF60040.1"
FT                   /translation="MSMVGYVVLLPDEDFRTQKETISVALHMYIAQVVTLSE"
FT   gene            480365..481366
FT                   /locus_tag="ECL_00475"
FT   CDS_pept        480365..481366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00475"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60041"
FT                   /db_xref="GOA:A0A0H3CFY0"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFY0"
FT                   /protein_id="ADF60041.1"
FT                   /translation="MFQIFTDFATWLVYQRLNLSPATKLGDALHFFVEDVSKIFVLLLV
FT                   LIYFVAMLRASLDVGRVRDYLAGKHRGVGYLLGSCFGAITPFCSCSSIPVFLGFTSAGI
FT                   PLGITMAFLITSPLINEVAVLLLVSLLGWRFTLIYIVVGMAVGIAGGAFLDRIKAERWL
FT                   ADFAADALRDGQQHQTAVIRQSTGTPHMSLSKRHAFAKDETLTIFKRVWLWVILGVGLG
FT                   AALHGFVPDGWIASHLGAGQWWSVPVAVLVGIPLYSNATGVIPVMESLITNGLPVGTAL
FT                   AFCMSTVAVSFPEFVLLKQVMKWQLLCILLLLLLTSFTLVGWVFNVVFPLVS"
FT   gene            481380..481610
FT                   /locus_tag="ECL_00476"
FT   CDS_pept        481380..481610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00476"
FT                   /product="thiol-disulfide isomerase and thioredoxins family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60042"
FT                   /db_xref="GOA:A0A0H3CHM3"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHM3"
FT                   /protein_id="ADF60042.1"
FT                   /translation="MKHVKVLGTGCSSCKTTIRLIQQVADERGVAIQLEKVESLPEIMK
FT                   YKVMSTPAVVINDIVVHAGGIPSKDIIESWL"
FT   gene            complement(481721..481924)
FT                   /locus_tag="ECL_00477"
FT   CDS_pept        complement(481721..481924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDY7"
FT                   /protein_id="ADF60043.1"
FT                   /translation="MQKALMTAELLALARLSIMAFKKPLKYMDDTDAEVIARFKKTFTP
FT                   ELIEQMCLRILGLEAERQSLNE"
FT   gene            complement(482006..482833)
FT                   /locus_tag="ECL_00478"
FT   CDS_pept        complement(482006..482833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00478"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60044"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEL6"
FT                   /protein_id="ADF60044.1"
FT                   /translation="MNNTIIACVDGSSSTRAVCEYAAWVAGKLDVPLALLHVLEKNEQP
FT                   AVSDLTGAIGIDSREQLTQELVRIEGERNRLLMTQGRAILAGCAELLSQIGIPDVQQLQ
FT                   KHGALDIILADLKDIRLMILGRRGTQNPVGSNLESIIRLQKKPVLIVPETFTPPSKAMF
FT                   AFDGSEESRRNLRRLTLSPLLLGMECHVVMVNGDAHTLEEARRSLQTSGISAISRLAEG
FT                   RSVPEALCRYASDNNVDLIVMGAYGHSSLRRFFIGSNTTAMIEQTRVPLLMLR"
FT   gene            complement(482851..484329)
FT                   /locus_tag="ECL_00479"
FT   CDS_pept        complement(482851..484329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00479"
FT                   /product="sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60045"
FT                   /db_xref="GOA:A0A0H3CFL6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFL6"
FT                   /protein_id="ADF60045.1"
FT                   /translation="MLLSSTRRDWLGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPQV
FT                   GLYSAFCIPLVMAFFGGRPAMISSSTGAMALLMVTLVKDHGLQYLLAASILTGVFQLIA
FT                   GYLKLGGLMRFVSRSVVTGFVNALAILIFMAQLPELTNVTWHVYAMTAGGLAIIYLFPY
FT                   LNKTIPSPLVCIVVLTAIAMWLHLDVRTVGDMGKLPDSLPVFLLPDIPLNLDTLLIILP
FT                   YSAGLAVVGLLESMMTATIVDDMTDTPSDKNRECKAQGIANICTPFIGGMAGCAMIGQS
FT                   VINVKSGGRGRLSTLTAGVVLLCMVVFLRDLVSQIPMAALVAVMIMVSIGTFSWRSVAD
FT                   LKSHPISTSVVMLATVVVVVATHNLAFGVLTGVLIASLNFATKVARFLVVSSELKKDTR
FT                   FYKVTGQVFFASADRFMAYFDFREAVEKVVIDVAQAHFWDITSVSALDKVVIKFRREGT
FT                   EVEIRGMNEATRTIVDRFGVHDKPEEVEKLMGGH"
FT   gene            485670..485915
FT                   /locus_tag="ECL_00480"
FT   CDS_pept        485670..485915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00480"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60046"
FT                   /db_xref="GOA:A0A0H3CFY3"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFY3"
FT                   /protein_id="ADF60046.1"
FT                   /translation="MSQLEHVHLKEDEFEALRLVDLLGMQQQEAAVAMGVSRQTLANVL
FT                   KAARFKVVDCLTQGKALIMHSEREGVTQDDHSHSSE"
FT   gene            485890..486351
FT                   /locus_tag="ECL_00481"
FT   CDS_pept        485890..486351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60047"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHM8"
FT                   /protein_id="ADF60047.1"
FT                   /translation="MITAIPVNDDRVANHFTKASHLVFVDKRGAELSRTENPALGADCS
FT                   GKRKLVDLLVQQQVSRVVVRNIGERMLGKLLGHQIAVYQTDCGRRLFTELCDPDTRVLT
FT                   ELNKPEQGRQSLNHEAKGKKCCHSDGNTAENACLRGHQHHHGNGRCCHS"
FT   gene            complement(486378..487178)
FT                   /locus_tag="ECL_00482"
FT   CDS_pept        complement(486378..487178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00482"
FT                   /product="integrase core subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60048"
FT                   /db_xref="GOA:A0A0H3CDZ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDZ0"
FT                   /protein_id="ADF60048.1"
FT                   /translation="MLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQEHTSLPN
FT                   LLERQFAVPEPDRVWCGDITYLWAGNRWCYLAVVMDLFARRVIGWSLSAHADTALISSA
FT                   LRMAYETRGQPRDVMFHSDQGSQYTGLKYQQLLWRCRINQSVSRRGNCWDNSPMERFFR
FT                   SLKTEWVPTNGYAGKDEARQQINDYILNYYNSVRPHHYNGGLTPEESENRIPFFTVKLW
FT                   PVLLDHYILTGGIRNSVRWGSHTRQSLLPPPHIPAPGLYTIRVG"
FT   gene            complement(487409..487681)
FT                   /locus_tag="ECL_00483"
FT   CDS_pept        complement(487409..487681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60049"
FT                   /db_xref="GOA:A0A0H3CEL9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEL9"
FT                   /protein_id="ADF60049.1"
FT                   /translation="MNKKTKRTFPPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESW
FT                   VRQLRRERQGDYALCHTHYSRPATYPRAGKQVRRLEERKYDIKKG"
FT   gene            487958..488218
FT                   /locus_tag="ECL_00484"
FT   CDS_pept        487958..488218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60050"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFM1"
FT                   /protein_id="ADF60050.1"
FT                   /translation="MTSTLLDAAMTHCLFMQGVQALTAELTVRFISPVCTGEKLMVCAR
FT                   LLGQRRGIYQLEAWLTKGQQKVARATAKFIVPSQDIALAHR"
FT   gene            488332..488808
FT                   /locus_tag="ECL_00485"
FT   CDS_pept        488332..488808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00485"
FT                   /product="Ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60051"
FT                   /db_xref="GOA:A0A0H3CFY7"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFY7"
FT                   /protein_id="ADF60051.1"
FT                   /translation="MSKQIIDIGIAESSRVEIADGLARLLADTYTLYIKTHYYHWNVTG
FT                   PMFNSLHLMFENQYNELATAVDDIAERIRSLGCFAPGTYHEFSRLTAVNEDKDIPAAKN
FT                   MIENLVQGQETVVKTARSLFPVVNNANDEATADLLTQRIQLHEKTAWMLRSLLE"
FT   gene            complement(489111..489461)
FT                   /locus_tag="ECL_00486"
FT   CDS_pept        complement(489111..489461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00486"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60052"
FT                   /db_xref="GOA:A0A0H3CHN5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHN5"
FT                   /protein_id="ADF60052.1"
FT                   /translation="MRMNEDTKRQTDMKNAALGAADVLRGLANSDRLLLMCQLSQGEAN
FT                   VTELEAAVGITQPTLSQQLGVMRRLKLVETRRAGKMVYYRIGDNRIMTLLNTLYDLYCP
FT                   QEDTGKESHNNE"
FT   gene            489623..491281
FT                   /locus_tag="ECL_00487"
FT   CDS_pept        489623..491281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00487"
FT                   /product="putative NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60053"
FT                   /db_xref="GOA:A0A0H3CDZ5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDZ5"
FT                   /protein_id="ADF60053.1"
FT                   /translation="MKIVIVGGVAGGASAAARARRLSEDVSIVVLERGSNVSFANCGLP
FT                   YHIGGKIPLRQSLILKTPEDFKSRFNIDVRIYHEVTSVDPVNKTVTVKNLTSGEVYSEE
FT                   WDRLLLSTGAAPVVPPLPGLQEEGVFTLRNLTDMDAIQAWIEQHNVAHTTLVGGGFIGL
FT                   EVMEALSERGISVTLLEMGEQVMAPVDPEMASALHQEIRSHGVDLRLRTALNEVLRTET
FT                   GFRVALSDGEFLQTDMVILAIGVKPENTLATGAGLAVGKRGGISVNACMQTSIPDIYAV
FT                   GDAVETPDLVFQEPANVPLAGPANRQGRIAADNMLERHSLYHGSQGTSICKVFSLSIGS
FT                   VGANEKQLKAHGTRYEKVYVHAADHASYYPGATMISLKLLFSPDTGKILGAQASGKKGV
FT                   DKRIDVLAVAQRAGLTVNDLEHLELTYAPPFNSARDVVNQAGMVAANVIKGDTVICHAS
FT                   DVLQREPGSYCFLDIRSPAELKQFGEYPDALSIPLDSLRENLEKLPKDKEIFIGCQSGL
FT                   RGHVAYRILQAHGFRAYNLSGGFITWKAVMASMNK"
FT   gene            complement(491342..492499)
FT                   /locus_tag="ECL_00488"
FT   CDS_pept        complement(491342..492499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00488"
FT                   /product="putative sodium-proton antiporter NhaA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60054"
FT                   /db_xref="GOA:A0A0H3CEM4"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEM4"
FT                   /protein_id="ADF60054.1"
FT                   /translation="MSANKKKLNGVVRGFISSPAAGGIILILASVAAIVVANSPLLEGY
FT                   ESLLKYKTVGLSTEHWVNDGLMAIFFLFVGLEIKRELLVGQLATWSQRALPGFAALGGV
FT                   AVPALIYAGFNASNAETLRGWAIPAATDIAFALGVLTLLGRRVPASLKIFLSALAILDD
FT                   MGAVAIIAIFYTSHISLMMLGGAMVTALMMFMMNRAGLKRLLPYLVAGCLMWFFMLQSG
FT                   VHATVAGILVALFIPLKTDSTSGSPLERLEHGLEPWVVFLILPVFGFANAGVSLTGLTA
FT                   EDLLSPVPVGVATGLFLGKQVGVFGLSLLAVGLGLAQKPKNSSWLQIYGVSVLCGIGFT
FT                   MSLFIGNLAFAESQLLIDEVKVGVLVGSVLSALTGALIMLLPRQR"
FT   gene            complement(492486..492602)
FT                   /locus_tag="ECL_00489"
FT   CDS_pept        complement(492486..492602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFM7"
FT                   /protein_id="ADF60055.1"
FT                   /translation="MSSARCLQGQIHVFRISVSKKQPGINFLKGGDTFHERK"
FT   gene            492796..492933
FT                   /locus_tag="ECL_00490"
FT   CDS_pept        492796..492933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFZ1"
FT                   /protein_id="ADF60056.1"
FT                   /translation="MMFLKVMAFHLSQPPRPGLMTPDMTLDFQEVCQAVDKSFRPVYFP
FT                   "
FT   gene            492947..493855
FT                   /locus_tag="ECL_00491"
FT   CDS_pept        492947..493855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00491"
FT                   /product="Inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60057"
FT                   /db_xref="GOA:A0A0H3CHN8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHN8"
FT                   /protein_id="ADF60057.1"
FT                   /translation="MINVFGHLNPDSDAVCTAAVTAGWLNRCNRPARAWRPGEANPETR
FT                   YIFEAAGLSLPPLLDIPLKGEPVWLVDFTEPAQGPADLLQSNIIGIIDHHRLGGLVTQL
FT                   PPEVWIKPAGSSATVLWLLMDAEMRRTMPPTHATLLLGALLSDTINLCSPTTTEDDIRT
FT                   ATELCVLSGIKRRAFAHGLMTAKTDISGQSAEQLLNKDLKAFSLAGTDVRIAQLEVNSP
FT                   EQVAPLLDELQNAMAQMAVTTGAGLIVLMVTDIQECFSTLYFAGPESGNITSCSVPGMV
FT                   SRKKQLLPWLEHFLSQSRRQP"
FT   gene            493852..494277
FT                   /locus_tag="ECL_00492"
FT   CDS_pept        493852..494277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00492"
FT                   /product="universal stress protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60058"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CDZ9"
FT                   /protein_id="ADF60058.1"
FT                   /translation="MKIYTHALVLVQGKEDGVTLLALAATLSRLLQMKITLAHICNDYR
FT                   EMNYVSDGLMDDAVSKDVVQVKALFSELTSSVAEHVDARELVTMRRFEDVQKCITDTGV
FT                   DLVIAGHRNRFMGALTSRSAEYINHLNVDVLIKHIPN"
FT   gene            494294..495583
FT                   /locus_tag="ECL_00493"
FT   CDS_pept        494294..495583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00493"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60059"
FT                   /db_xref="GOA:A0A0H3CEM8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEM8"
FT                   /protein_id="ADF60059.1"
FT                   /translation="MSFILEKVTAREILDSRGNPTVEVDAFTSDGMMARASVPSGASTG
FT                   SREATERRDGDATRFGGKGVRDAVKAVDTEICDTVRGTDVREQRRLDNLMRELDGTENK
FT                   SRLGANAILGVSLAVARLAAQVTRQPLYRYLGGLNASLLPVPCMNIINGGVHARGQGAD
FT                   FQEFMIAPHGAPTLAEAVRQGSEVYQALRQILLSRNLSAAVGDEGGFAPAVSSNREPLE
FT                   FIVQAIEKAGYRPGEDISICMDPASSEFYRDGKYHLRTESSALSSEEMTDYYGELMNQF
FT                   PIVLLEDGLAEDDWAGWKYLHNKLGGRTELVGDDLFVTNVKYIRRGIEEKLASAALIKL
FT                   NQIGTLSETFDAVSLCHEHGWGAFISHRSGETMDTFIADMTVALRAGHLKTGAPCRGER
FT                   IEKYNQLMRIEQDLGSEARYAGIKAFVRRG"
FT   gene            495680..496054
FT                   /locus_tag="ECL_00494"
FT   CDS_pept        495680..496054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00494"
FT                   /product="putative CrcB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60060"
FT                   /db_xref="GOA:A0A0H3CFN1"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFN1"
FT                   /protein_id="ADF60060.1"
FT                   /translation="MGQLSAIMIGGAVGCVIRWFFGVKLNSFFPSLPPGTLVVNLLGAF
FT                   IIGAAMAYFMRNPQLDPAWKLLIVTGLCGGLTTFSTFSVEVFTLLQVGNYLWALTSVLV
FT                   HVVGSLLMTAAGFYLITLLA"
FT   gene            496424..496843
FT                   /locus_tag="ECL_00495"
FT   CDS_pept        496424..496843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00495"
FT                   /product="UspA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60061"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFZ5"
FT                   /protein_id="ADF60061.1"
FT                   /translation="MITKILIAYDGSESAKEAMDFAFELAHHFNSELYVMAVCHLTEFG
FT                   GEVEMLDFVSRTQSYFYQRMRNLRKQYPEMKKKPRLHIATGHPAEQILHYADGHGIDHI
FT                   VVGHRGKKQFSQWLLGSVARQVVDHAPCPVTVTRK"
FT   gene            complement(496875..496988)
FT                   /locus_tag="ECL_00496"
FT   CDS_pept        complement(496875..496988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60062"
FT                   /db_xref="GOA:A0A0H3CHP3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHP3"
FT                   /protein_id="ADF60062.1"
FT                   /translation="MDYLITTLILLSLGLICVFAFSLWSLNRTSRKKNKRK"
FT   gene            497520..498644
FT                   /locus_tag="ECL_00497"
FT   CDS_pept        497520..498644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00497"
FT                   /product="DNA mismatch repair protein MutS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60063"
FT                   /db_xref="GOA:A0A0H3CE03"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE03"
FT                   /protein_id="ADF60063.1"
FT                   /translation="MTNFRNYLSGYIDSENFKSLSAMANRIKDNLEGIRYNLRIKGDTI
FT                   NVEHHADEINYSDKIINVFSKFKQRDVTVKLDFKSHDTVMTNVEARILECVARLFPSVF
FT                   SELDTFIETRSDYQSHTLNIFEREIQFYLASIEYFRNFQNAGLSFCIPEINVNNKNITV
FT                   TNGFDLALAYSLLKKKENVVCNDFQLRECERILVVSGPNQGGKTTFARMIGQLHYLALL
FT                   GLYVPAEDANLFLVDNIFTHFEKSENIHNLRGKLYDDLVRIKSILDVATSKSLIIMNEI
FT                   FTSTTSHDALYLGTQIIKKIVMLDALCVCVTFIDELTRLDRAIVSMMSTVENDERASRT
FT                   YRIARKPSDGVAWSATLVQKYGLTYEKIKGEVNG"
FT   gene            498641..500149
FT                   /locus_tag="ECL_00498"
FT   CDS_pept        498641..500149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00498"
FT                   /product="DNA mismatch repair protein MutS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60064"
FT                   /db_xref="GOA:A0A0H3CEN3"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEN3"
FT                   /protein_id="ADF60064.1"
FT                   /translation="MNVYLMYKDADFVLDDIFPDNFNIQVRDLGLDVLFQSLSAGDEFL
FT                   YSVVKKACSQSLADVPCIEYRQAILRDCLYNSNIIREFYQAVLECLTMEKEKLHYIVFG
FT                   HSPSAMLHQSISFTRFFLENLKKVRAIAEKNIYFFESSGMTRLLKMIIQELNEDYLRGI
FT                   EEHLKQMDFKRGVLMSAKLGPGSRGDEYILREPNSPDKCWFRRIFSRRPEHYSVQIAPR
FT                   DENGFRALSDLRDEGLVLVASAMAQSTEHLRNFFKSLRAELGFYVCCINLAEELNKRNL
FT                   PQCFPVPVYKRERRLVFESLYDVCLGLTSDKNIVGNTLKTDNKNTFIITGANQGGKSTF
FT                   LRSIGLAQIMMQSGMFVVAEYFCTDICGQIFTHYKCEEDSSMVSGKLDEELLRMRDIVD
FT                   LLEQDDLVLFNESFSATNSREGADIIRGIVMALAESRVKIFFVTHCSEFACAFYQEFHP
FT                   DTEYLCAERRDDGERTFRIEEGAPMDTSFGEDLYQAVFTSDELA"
FT   gene            complement(500474..500593)
FT                   /locus_tag="ECL_00499"
FT   CDS_pept        complement(500474..500593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60065"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFN6"
FT                   /protein_id="ADF60065.1"
FT                   /translation="MYLEQTDENNVMDLHIPTGVPVLYEMSEDKTISGRYILE"
FT   gene            complement(500709..501677)
FT                   /locus_tag="ECL_00500"
FT   CDS_pept        complement(500709..501677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00500"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60066"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGV8"
FT                   /protein_id="ADF60066.1"
FT                   /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLR
FT                   CPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRK
FT                   LHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHDELRR
FT                   KKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVK
FT                   QLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
FT   gene            complement(501699..502022)
FT                   /locus_tag="ECL_00501"
FT   CDS_pept        complement(501699..502022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00501"
FT                   /product="phosphoglyceromutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60067"
FT                   /db_xref="GOA:A0A0H3CHP8"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHP8"
FT                   /protein_id="ADF60067.1"
FT                   /translation="METLNLLWLPVSKTWRLNERHYGALQGMRKDEAAQQMGEELVYHW
FT                   RKSYRGIPPLLAAAPQLLHREARYHHIALSDLPKGESLEMALRRVIPYWQHVIAPRVVS
FT                   GLC"
FT   gene            complement(503098..503217)
FT                   /locus_tag="ECL_00502"
FT   CDS_pept        complement(503098..503217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE07"
FT                   /protein_id="ADF60068.1"
FT                   /translation="MIFVREWITHQDIHQFFFVLRESEYQVNNTCLFPVVTHR"
FT   gene            complement(503407..503583)
FT                   /locus_tag="ECL_00503"
FT   CDS_pept        complement(503407..503583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEN6"
FT                   /protein_id="ADF60069.1"
FT                   /translation="MEGTRQRSAARWPSGYSSTASWCHLSSASEGKRLRHCQNIDASSS
FT                   DQREYYAPTISGD"
FT   gene            504078..504194
FT                   /locus_tag="ECL_00504"
FT   CDS_pept        504078..504194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60070"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFN9"
FT                   /protein_id="ADF60070.1"
FT                   /translation="MKMIFMWLRNAMVYRQGYRLEKSPLVALYFATEKIQMS"
FT   gene            505868..506752
FT                   /locus_tag="ECL_00505"
FT   CDS_pept        505868..506752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00505"
FT                   /product="putative DNA-binding prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60071"
FT                   /db_xref="GOA:A0A0H3CG04"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG04"
FT                   /protein_id="ADF60071.1"
FT                   /translation="MAKLNKNLKTLARQAGGSFKTVADRMKIADRFAARLQSLNIQIRD
FT                   IKNIKTGHVELYVRSRLAEDISKRTLQNEMSAIRSLLRVAGKTFMADPSHEKLSNEALN
FT                   ISGTSRDGTKVAITDEHLDSVLSLVKEKDEGVAVAIQLSRLLGLRTEETIQSVKSLSTW
FT                   KKALQNGENKIRVVFGTKGGRPRDTTIIKREETLKLLSSALKYTAEHNGKLIDKPSLHL
FT                   AIERYRNIVREAGMVGEFAPHSLRYAYTQDVIGLYLEHGFSVKEAQALASMDLGHGDGR
FT                   GHYVARIYSKTKS"
FT   gene            506829..507272
FT                   /locus_tag="ECL_00506"
FT   CDS_pept        506829..507272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHQ3"
FT                   /protein_id="ADF60072.1"
FT                   /translation="MNVLKVSRLVKVANRASFFDFISLVSEIEGRLKLLHAYSILFAID
FT                   GKGDSYFSFEHVSRTTFLVTERLMEYKLLGLIPDHRVKCLDDIFEQCKQVLGDKKWNMA
FT                   VTGGTVVAQDVLDTYAETFLTTYVEESDTRFLKDFVQWYLSTC"
FT   gene            507559..507948
FT                   /locus_tag="ECL_00507"
FT   CDS_pept        507559..507948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60073"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE10"
FT                   /protein_id="ADF60073.1"
FT                   /translation="MTFLHIVYFVAVFADRFVCFIAPKTLIAEWFFWFTGDAKSLLLVV
FT                   RELELARSYQKDEASVLLTEFSVYHAAFFFGEREYYGLKVRWPRWFINRLHFTGMQLDA
FT                   TQWQEGCQNGFSDAAALESRATAHC"
FT   gene            508031..508393
FT                   /locus_tag="ECL_00508"
FT   CDS_pept        508031..508393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEP0"
FT                   /protein_id="ADF60074.1"
FT                   /translation="MTAFAITVDVLAASIHSKTGFISVMSEIEGLLQSATALNICGIPD
FT                   SIDLDGFPERCSQTIHLASVVGEAQEMNLIPDSLRQFVDDVVLTGKRFDAEGDTNAWCY
FT                   GFKLGTERGLANWSGV"
FT   gene            508517..508813
FT                   /locus_tag="ECL_00509"
FT   CDS_pept        508517..508813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60075"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFP2"
FT                   /protein_id="ADF60075.1"
FT                   /translation="MLILASKAASALAHVSESLNQRKKEWFTNQSGHSSFRPEVIPDGN
FT                   GFTAIISRRTGYSPKDWTYQRCATAGRFASSRQAMNAGRRMAQQLADLRYRFD"
FT   gene            508867..509334
FT                   /locus_tag="ECL_00510"
FT   CDS_pept        508867..509334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG08"
FT                   /protein_id="ADF60076.1"
FT                   /translation="MASFYSEVFNMTVFNDIAFDRSYAPQGMHELWQGQRSLSRFIAYV
FT                   AELEGELLAIRAFRRCAIPDLTGSYGVPVRTFRLVSIARLIGYACMTGAFTDGLFEKYI
FT                   AGLILLGEQIAPRAWNFGFSEGQMHFDEMRSDDEASEEQRAVFCASADYIA"
FT   gene            509444..510055
FT                   /locus_tag="ECL_00511"
FT   CDS_pept        509444..510055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60077"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHQ7"
FT                   /protein_id="ADF60077.1"
FT                   /translation="MIRFTSDELRPLFTQNLGMQRPLILEKKLGIYLRVPDDRRPGEWL
FT                   KAWAAGCNPLKDADWFTLVDTLIPEHEFSFQTFMAQSMFDAVLNDHHDLLMKPVISKLN
FT                   NALTLHKGTRPPMKVYVPVGEYRYRIQWLYEQSLRHFHACVGDAERLSWRSQALHVLDQ
FT                   VIRLDSKRAKPADRERFDRAVESVRDRIRSVMSDGSLRYY"
FT   gene            510128..511111
FT                   /locus_tag="ECL_00512"
FT   CDS_pept        510128..511111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60078"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE13"
FT                   /protein_id="ADF60078.1"
FT                   /translation="MKITTGRRKPAAVQTPDLYQQVTDKIILALENGVPPWRRPWRSAQ
FT                   NVHGGSLPVNAVTGRAYSGINVPLLWMAAEEHGYTSDRWLTFRQAKAVGGYVRKNETSA
FT                   LAIIYKPFEKQARDSSDNLLYRDGEPVMEQLAMLKQLQLFNVAQCDGLPESVQGEQPNT
FT                   VEAEPPSELSAAQLQQVQQILSTTGVGCDHRRQDRAFYRPGADRIVMPTASQFRTEADY
FT                   WSTLLHELVHATGHSSRLNREGITSSSRKFGDPVYAFEELIAETGSAFLCVELGITGDV
FT                   QHESYLAGWLKALREDKRAIFRACRFAREASEYLLAPLNRNTEQAA"
FT   gene            511208..512158
FT                   /locus_tag="ECL_00513"
FT   CDS_pept        511208..512158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60079"
FT                   /db_xref="InterPro:IPR009694"
FT                   /db_xref="InterPro:IPR023136"
FT                   /db_xref="InterPro:IPR041329"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEP5"
FT                   /protein_id="ADF60079.1"
FT                   /translation="MFSWCQNRLEITGKSVCLDVMQPWIAGTEKPLYRHAIRQAIKLFL
FT                   AGCAGILKPVRAVDYAPYPMLTASGTGAQTSPNQAFQHFIELLEQNAWLDSKTLSRMEK
FT                   IWLQSGIDALKWEAIPFAARQIMAQLMAVHYADWFGVAGAGGQFDPQERWESLSIMPET
FT                   TCPCDMLMVMPSRLASELNGEGGLFTGLCITSELYMQLFGMEFPAGHQASWSRDDVGSL
FT                   TLSFASPWYPPSGEVMGIMSQMFDCEIRHYWISPDAGTSGFNCFDRGDHVDSGPYQAEA
FT                   LRQSASGDGARMYLVTPETAAVPATTAAHYGSIRA"
FT   gene            512285..512971
FT                   /locus_tag="ECL_00514"
FT   CDS_pept        512285..512971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60080"
FT                   /db_xref="GOA:A0A0H3CFP7"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFP7"
FT                   /protein_id="ADF60080.1"
FT                   /translation="MKSVINHEKAFLSLFSQTARYHHRHQVFEDFVSCSVIALQNSLQF
FT                   CDKREEKYMRIVGRYEKTDISRMAQLLAHVTNGLDETPGDFLGRVFMQLELGDKYRGQF
FT                   FTPWNIGLMMARMQLGNVEDNFRDKPFITLSEPACGAGCMALAFAFVLREAGYSPHRYL
FT                   WVSAQDIDPLAAGMAYIQLSLSGVPGEVVIGNSLNDERRRILHTPAHYMGNWSFLLQTR
FT                   MNAAVA"
FT   gene            complement(513019..513147)
FT                   /locus_tag="ECL_00515"
FT   CDS_pept        complement(513019..513147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60081"
FT                   /db_xref="GOA:A0A0H3CG13"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG13"
FT                   /protein_id="ADF60081.1"
FT                   /translation="MWDTKPFTDNYVDFFRLGFLGSYIIPLILVFLSGIFDNFSDM"
FT   gene            complement(513444..513611)
FT                   /locus_tag="ECL_00516"
FT   CDS_pept        complement(513444..513611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHR2"
FT                   /protein_id="ADF60082.1"
FT                   /translation="MKYYHHLIYTFRLTRLLLRREIPLRIFIFALQTKPGAVAGKHGSY
FT                   IVDPFYDDLG"
FT   gene            complement(513684..514565)
FT                   /locus_tag="ECL_00517"
FT   CDS_pept        complement(513684..514565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00517"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60083"
FT                   /db_xref="GOA:A0A0H3CE16"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE16"
FT                   /protein_id="ADF60083.1"
FT                   /translation="MDSARALVAKGRGIALVSRTMGVSRAQLSLRINRSADWQDRRCNR
FT                   RDDEADAEILSEILDIISDMPSYGYRRVWGILRTQRRTEGLPPVNAKRLYRLMSEHNLL
FT                   LLHDKPERSKREHKGKIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAA
FT                   STGGYDSSTVQDVMLRSVEKRFGDGLPTTPVQWLTDNGSAYTAHETRRFARELNLEPCT
FT                   TAVSSPQSNGMAERFVKTMKEDYIAFMPKPDVRTALRNLAAAFTHYNENHPHSALGYHS
FT                   PREYRRQRTSLT"
FT   gene            complement(514523..514918)
FT                   /locus_tag="ECL_00518"
FT   CDS_pept        complement(514523..514918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60084"
FT                   /db_xref="GOA:A0A0H3CEQ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEQ0"
FT                   /protein_id="ADF60084.1"
FT                   /translation="MSNTNANFEMTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSHV
FT                   ARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEV
FT                   EILKEAVEYAQSRKWIAHAPLLPKDGE"
FT   gene            complement(514967..515458)
FT                   /locus_tag="ECL_00519"
FT   CDS_pept        complement(514967..515458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60085"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFQ1"
FT                   /protein_id="ADF60085.1"
FT                   /translation="MIELPDLPKHLPKAEVPDGRFSRPKNKITKAQRAELRMKFGGRCA
FT                   YCGCFLPEKGWHADHVEPVRRDFEYVLAPVGSGVTHVARNTGKVLHPDLHTIENLFPAC
FT                   APCNLFKGAFSVEGMRKEISQQVERARTYSVNFRTAERFGLVEIVDKPVVFWFEHDVAP
FT                   "
FT   gene            complement(515489..516328)
FT                   /locus_tag="ECL_00520"
FT   CDS_pept        complement(515489..516328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00520"
FT                   /product="IS911 orfA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60086"
FT                   /db_xref="GOA:A0A0H3CML8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CML8"
FT                   /protein_id="ADF60086.1"
FT                   /translation="MATLCHVFGVHRSSYKYWKNRPEKPDGRRAVLRSQVLELHGISHG
FT                   SAGARSIATMATQRGYQMGRWLAGRLMKELGLVSCQQPTHRYKRGGHEHVAIPNHLERQ
FT                   FAVTEPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTMKALEMAW
FT                   ETRGKPVGVMFHSDQGSHYTSRQFRQLLWRYRIRQSMSRRGNCWDNSPMERFFRSLKNE
FT                   WVPATGYVSFSDAAHAITDYIVGYYSALRPHEYNGGLPPNESENRYWKNSNAVASFC"
FT   gene            complement(516355..516564)
FT                   /locus_tag="ECL_00521"
FT   CDS_pept        complement(516355..516564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00521"
FT                   /product="IS911 orfB"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60087"
FT                   /db_xref="GOA:A0A0H3CHR6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHR6"
FT                   /protein_id="ADF60087.1"
FT                   /translation="MDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQR
FT                   IEMENEILKKATALLMSDSLNSSR"
FT   gene            complement(516627..517451)
FT                   /locus_tag="ECL_00522"
FT   CDS_pept        complement(516627..517451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60088"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE20"
FT                   /protein_id="ADF60088.1"
FT                   /translation="MNNDMLTLAAKKYLSTFADHRNNPTNYEALTAWDNATSEFMALVN
FT                   NDELNIIASLLAGREADKTDNSQLRQRIADLEARPVAPFDFKETTDADYCREWAWRAIK
FT                   KDLPTEHWKTGENGTFYAFYLMGWHARLQYNEQRRSEYSQIADTILKTRTVSINTEPWR
FT                   SFVSDDDITALNRFAECCDDPESGGHDLEKEQVKRLEKIGLLRRSGRISFTTDFGDFVL
FT                   SAAGINLNLEMGEQVCPGLKWFTEFGHLNRGDMLTSEQHRCHNEKKKFQRRV"
FT   gene            complement(517448..517927)
FT                   /locus_tag="ECL_00523"
FT   CDS_pept        complement(517448..517927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00523"
FT                   /product="appr-1-p processing domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60089"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEQ5"
FT                   /protein_id="ADF60089.1"
FT                   /translation="MTLTVLPGDLFEQEADCLINAWNMNFIPWWLLWPKGVSGRLKQLA
FT                   GPEPFRQLARTGVMRPGTVCLTDGGKLKTPIIHAAALNMFWCSSESIVHCCTDAALNLA
FT                   AVKGFHSVAFPLLGSGIGGLTPSLSLEAMTRAIEINPYSKTLDIKIITYRKGDAV"
FT   gene            complement(517924..518577)
FT                   /locus_tag="ECL_00524"
FT   CDS_pept        complement(517924..518577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFQ6"
FT                   /protein_id="ADF60090.1"
FT                   /translation="MVQLQTQLNAIHERIAEAQNIVARRERSVKRAERNLEIAEDNLAQ
FT                   LQNERDELLIASWGDIPNWQVIFDLVNPSPAMYEYKEKWVREKGLHAGGMYNCHTNQGA
FT                   FSVGFTTTSEHELYQNIRMVEFVMQYLRTDHNNEKTMIVYNVPTDNCCHNFVFNTGTGK
FT                   YGITTDSYMSRSNITEFSTAEEALRYLQSISDTDIVPEPESLPGAVIYPDGDEE"
FT   gene            complement(518593..519129)
FT                   /locus_tag="ECL_00525"
FT   CDS_pept        complement(518593..519129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60091"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG23"
FT                   /protein_id="ADF60091.1"
FT                   /translation="MIKMFSVVSLTTLLLTLTGCSGSSPLNDLSLSRLTSLINPVSQQQ
FT                   TQNSAEPNQRNYVGQFYGPIPIPAETVAMRLKQHYGFVSDIDVAAAHNSGQGNAGWSAS
FT                   AISEGTSWEAQPGNYYRMSRNWAENDRLTLDVRGNSKESFITATYISSNPEHLKKTWTS
FT                   RLWKQIPDVASGSLK"
FT   gene            complement(519202..520398)
FT                   /locus_tag="ECL_00526"
FT   CDS_pept        complement(519202..520398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60092"
FT                   /db_xref="InterPro:IPR032811"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHS1"
FT                   /protein_id="ADF60092.1"
FT                   /translation="MITRCISVALLVSAVPSVYAATGWMEARGDAMGGTGVASAHYGTA
FT                   ALSNPALLTHFGPTDYFSLVLPSVGAQVSDPDNTVDKADDVKDLWDRFDAAADSQSGVS
FT                   ESAAALKNKLQDLKDTHANGQVGASVVATVPNQTLPFAVVVKSWGTVSVEGKVSDHDLD
FT                   YLDKVADGDIPPSAVDKNSLTSKAYGRAAVITDVGVAMAHEFETAGQRWSLGITPKYQR
FT                   IDLFNYNVSVRDFDKSDIHSGDYRNTKTGFNADLGLATDLTDNWTLGLAVLNVIPRSVE
FT                   TKPVNGSTGTFKVKPQATAGAAWHSGFITTALDVDLTEASRFDTDKKRQFASAGVELNA
FT                   WSWMQVRAGYRQNIISNDGSAFTAGLGFSPFDVVHLDITGIAGTDRTYGAVAQMQFTF"
FT   gene            520382..520522
FT                   /locus_tag="ECL_00527"
FT   CDS_pept        520382..520522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE22"
FT                   /protein_id="ADF60093.1"
FT                   /translation="MQRVIIETEAFIIYFLFSFMVFKAKESPDAGAPVKTGYSVNSDGT
FT                   G"
FT   gene            complement(520505..521494)
FT                   /locus_tag="ECL_00528"
FT   CDS_pept        complement(520505..521494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEQ9"
FT                   /protein_id="ADF60094.1"
FT                   /translation="MKHLNMTSLLARIALERDDELLQLTAAMSDGKKTSGNPMAIRFKP
FT                   AVGDFIILMSGRLGISAAALVNIMIEGVMRETLTPHQAAVTRIPERFWLLMDEYNLSSP
FT                   EVAHLLADWNMSLGVLENRERTLGYMTPPLLEKLSEWFYVSTGWLSGKIVPPVRITVFP
FT                   DWLDASRLLTCRIQEINPEDFIARPDLFFIRKKEQDDIFLFIRRYTTINDTRFRVVECA
FT                   GRCSVSGESGKQFTLFLALCGLLFKAEVLSLVDTFIDSGNILDSMISGEVLPPAALREI
FT                   QKPFHDSHGKYTQRIWSTEEREPFLNPDNFINDEWRKIAEDIISTRSI"
FT   gene            complement(521669..522229)
FT                   /locus_tag="ECL_00529"
FT   CDS_pept        complement(521669..522229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60095"
FT                   /db_xref="GOA:A0A0H3CFR0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFR0"
FT                   /protein_id="ADF60095.1"
FT                   /translation="MQQACVFSFFLLWLGLSGVMGLEITGGVPCSGFYLVWVLLSGLPF
FT                   LLRPLAWAERRFRPKMTLISQHGKRAWVHLAPWQPTTDLTPSRVCLFWQNVNASTCQAL
FT                   ETHRTVIISSHLLTGIRARRLLAHTTEYGLTVRSRIYQIPFTPWKRALMQLEILFRQWR
FT                   WRTDFRRDWPVLVLRRKSLNTEK"
FT   gene            complement(522391..522513)
FT                   /locus_tag="ECL_00530"
FT   CDS_pept        complement(522391..522513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG27"
FT                   /protein_id="ADF60096.1"
FT                   /translation="MAPAGSLSPGRFSCLLLPVNQLSPRTITSAGICLLKMTLR"
FT   gene            522605..524014
FT                   /locus_tag="ECL_00531"
FT   CDS_pept        522605..524014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60097"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHS8"
FT                   /protein_id="ADF60097.1"
FT                   /translation="MLTENSPLSQQVTEAWWLRPLEEMAGRVQACPGAWSGPFSGPGGF
FT                   NELSLNVATRAVRLVRGMMLPPGATPEEQAEQMPGWVCAAYWAGLFHHLPWLMQVEGAL
FT                   KSGRVWYPGLSVPGEPWRVRPAGEPPGATGSVYVAFRLLPEAALLWLQRWPVLSDTLLL
FT                   FLSGRRAEAGILNSIVNDALRSCGLSDTAVMSGQPPDPVSLVTVVPVTGHTFPKLYETD
FT                   SIPLSSNDNSPDVSVPIKTGDMTYSFSQDGEKTSVNTVPSALVLESALSTHEPLLSAEN
FT                   DISRDEEGGAQVSTENLLSLLDLMAEGKSSVVTENVPADSADSPPATELPPGTHPSHEE
FT                   GMDKEEQAGALFLEWVRDSVEDGTLSVNEKDSILHVLAQFVFMVSPACFYRHTSTAEGS
FT                   VTDKDRLQKSFEALNVHHSRNGKGLFHYHQYDTPDKSGRFTKVSGYMINADIIFKKGSC
FT                   LTDSIWLSAKK"
FT   gene            524049..525014
FT                   /locus_tag="ECL_00532"
FT   CDS_pept        524049..525014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00532"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60098"
FT                   /db_xref="GOA:A0A0H3CE25"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE25"
FT                   /protein_id="ADF60098.1"
FT                   /translation="MADIVTFEKILDDYFFNKVLRRATEWSYRKVVRTFLEFYGEDILP
FT                   ENVTRMDVLKWRRYVLNEQMSSKRTWNNKVAHMRAVFNHAITNKLISARENPFNQVIVK
FT                   PDIKRKKTLSGEQMKKIDLIMERKIELEQMGVHDPRPNALEPAWFWMTVIETLKFTGMR
FT                   QNQLLHIRLCDVDLKLGIIELQAEGSKNHREHRVPITARLRPRLEQLYLMSVQKGSKKG
FT                   EQLFNINRFTPKKKRIIRAKNMDHLPMRAFFRRLSRECQCDISPHRFRHTIATDLMKRP
FT                   ERSLNDVQMLLGHSSVAVTLEYVEANMDNLRRNLEAAYAA"
FT   gene            complement(525298..525373)
FT                   /locus_tag="ECL_tRNA010"
FT   tRNA            complement(525298..525373)
FT                   /locus_tag="ECL_tRNA010"
FT                   /product="tRNA-Phe"
FT   gene            complement(525493..526068)
FT                   /locus_tag="ECL_00533"
FT   CDS_pept        complement(525493..526068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00533"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60099"
FT                   /db_xref="GOA:A0A0H3CER4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CER4"
FT                   /protein_id="ADF60099.1"
FT                   /translation="MQREDVLGQALQLLEIQGIASTTLEMVADRIDYPLDELTRFWPDK
FT                   EALLYDALRYLSQQVDIWRRQLMLNEELTAEQKLLARYTALTECVSNNRYPGCLFIAAC
FT                   TYYPDPGHPIHQLADQQKRAAHDFTHELLTTLEVDDPAMVAKQMELVLEGCLSRMLVNR
FT                   SQADVDTAHRLAEDILRFAQCRMGGALT"
FT   gene            complement(526117..527817)
FT                   /locus_tag="ECL_00534"
FT   CDS_pept        complement(526117..527817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00534"
FT                   /product="thiol:disulfide interchange protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60100"
FT                   /db_xref="GOA:A0A0H3CFR4"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFR4"
FT                   /protein_id="ADF60100.1"
FT                   /translation="MAQRFLTLILLLCSTSVFAGLFDAPGRSNFIPADQAFVFDFQQNQ
FT                   HDLNLTWQVKEGYYLYRKQVSITPAQASVGALQLPAGEWHEDEFYGKSEIYRQHLSVPV
FT                   TVQQADKGATLTVTYQGCADAGFCYPPETRIVPLSEVKASAANVAPLPAEVKREGEPAS
FT                   DLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLAFIYVQGMALT
FT                   YTALGLVVAAAGLQFQAALQHPYVLIGLSVMFILLALSMFGLFTLQLPSSLQTRLTLLS
FT                   NRQQGGSAGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNMWLGGGTLYLYALGMGL
FT                   PLILVTVFGNRLLPKSGPWMETVKTAFGFVILALPVFLLERIVGDVWGMRLWAMLGVAF
FT                   FSWAFIVSLGAKSAWMRLVQIVLLAAALVSVRPLQDWAFGTPVAQNQAHLNFIQIKNVD
FT                   DLNQALAQARGKPVMLDLYADWCVACKEFEKYTFSDPQVQGALNGTVLLQANVTANNAQ
FT                   DKALLKQLNVLGLPTILFFNQQGEEQPGQRVTGFMDAAAFSAHLRDRQP"
FT   gene            complement(527793..528116)
FT                   /locus_tag="ECL_00535"
FT   CDS_pept        complement(527793..528116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00535"
FT                   /product="divalent-cation tolerance protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60101"
FT                   /db_xref="GOA:A0A0H3CG31"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG31"
FT                   /protein_id="ADF60101.1"
FT                   /translation="MNTPDAVVVLCTAPDEASAQDLAAKVLAEKLAACVTLLPGATSLY
FT                   YWEGKLEQEYEVQMLLKTNPANQQALLDCLKSHHPYQTPELLVLPVLHGDNDYLSWLNV
FT                   SLR"
FT   gene            complement(528230..529531)
FT                   /locus_tag="ECL_00536"
FT   CDS_pept        complement(528230..529531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00536"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60102"
FT                   /db_xref="GOA:A0A0H3CHT1"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHT1"
FT                   /protein_id="ADF60102.1"
FT                   /translation="MFGAELVIVLLAIYLGARLGGIGIGFAGGLGVLVLTLIFQIKPGA
FT                   IPFDVIEIIMAVIAAIAAMQVAGGMDYLVSLAERMLRRHPKYITFLAPLVTWFMTILAG
FT                   TGHTAFSTLPVITEVAKEQGIRPSRPLSIAVVASQIAITASPISAAVVFFAGILEPMGV
FT                   SYLTLLAICIPVTLIAVMITAVLCNFLGAELKDDPVYQERLAKGEVSLRGSQVFKLKPH
FT                   AKRSVVLFLIGIVAVMFYATAISDTVGLIQNPVLPRNEAIVVFMLTIATLISITCKIDT
FT                   SEVLNASTFKSGMSACVCVLGVAWLGDTFVKAHISDIQTVAGDLLHNYPWLLAVVLFFA
FT                   ATLLYSQAATTKALMPAALMLGVTPLTAIASFAAVSALFVLPTYPTLLAAVEMDDTGST
FT                   RIGKYVFNHAFLIPGVVAITLCVILGFIIGGVVL"
FT   gene            complement(529648..531084)
FT                   /locus_tag="ECL_00537"
FT   CDS_pept        complement(529648..531084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00537"
FT                   /product="Aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60103"
FT                   /db_xref="GOA:A0A0H3CE30"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE30"
FT                   /protein_id="ADF60103.1"
FT                   /translation="MLNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNSKISDIP
FT                   EFVRGMVMVKKAAALANKELQTIPKSAANAIIAACDEVLNNGKCMDQFPVDVYQGGAGT
FT                   SVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYASVVKL
FT                   VDAINQLGDGFQRKAVEFQDILKMGRTQLQDAVPMTLGQEFHAFNVLLNEETKNLLRTS
FT                   ELLLEVNLGATAIGTRLNTPDGYQQLAVQKLAEVSNLPVVPAEDLIEATSDCGAYVMVH
FT                   SALKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVC
FT                   FKVIGNDTTVTMASEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCINGITANKE
FT                   VCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEAELDDIFS
FT                   AQNLMHPAYKAKRYTDESEQ"
FT   gene            531420..531884
FT                   /locus_tag="ECL_00538"
FT   CDS_pept        531420..531884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00538"
FT                   /product="FxsA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60104"
FT                   /db_xref="GOA:A0A0H3CER9"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CER9"
FT                   /protein_id="ADF60104.1"
FT                   /translation="MRWIPFIAFFLYVYIEISIFIQVAHVLGVLLTLILVIFTSVIGMS
FT                   LVRNQGFKNFLLMQQKMAAGESPAAEMIKSVSLIIAGLLLILPGFFTDFLGLLLLLPPV
FT                   QKHLTMKLLPHLRFSRMPGGGFSTGPGDTFEGEYQRKDDQHDRLDHKDDR"
FT   gene            complement(531922..533148)
FT                   /locus_tag="ECL_00539"
FT   CDS_pept        complement(531922..533148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00539"
FT                   /product="putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60105"
FT                   /db_xref="GOA:A0A0H3CFR7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFR7"
FT                   /protein_id="ADF60105.1"
FT                   /translation="MSMSGLKQELGLAQGVGLLSTSLLGTGVFAVPALAALVAGNNSLW
FT                   AWPVLIVLVFPVAIVFAILGRHFPSAGGVAHFVGMAFGPRLERVTGWLFLSVIPVGLPA
FT                   ALHIATGFGQALFGWHDEALLLAELGTLAIVWWVGSRGASSSANLQTIVAVLIVALITA
FT                   IWWAGDIRVEEIPFPAITDINHAQLFAALSVMFWCFVGLEAFAHLASEFKHPERDFPRA
FT                   LMIGLLVAGTVYWACTVLVLHFDAFGADKAAAASLPGIVVQLFGVKALWVACVIGYLAC
FT                   FASLNIYIQSFARLVWSQARNKPQSRLAQLSKRQLPLNALNLVLGSCVVSTLCIYALKI
FT                   NLDALIIYANGIFIMIYLLCMLAGCRLLKGRYKALAVVGGVLCLLLLMMVGWKSMYAVV
FT                   MLAGLWVAL"
FT   gene            533321..533614
FT                   /locus_tag="ECL_00540"
FT   CDS_pept        533321..533614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60106"
FT                   /db_xref="GOA:A0A0H3CG35"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG35"
FT                   /protein_id="ADF60106.1"
FT                   /translation="MSIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEIIAVGK
FT                   GRILENGTVQPLDVKVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA"
FT   gene            533654..535300
FT                   /locus_tag="ECL_00541"
FT   CDS_pept        533654..535300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00541"
FT                   /product="GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60107"
FT                   /db_xref="GOA:A0A0H3CHT6"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHT6"
FT                   /protein_id="ADF60107.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVASAVEELKALSVPCSDSKAIAQVGTISANSDETVGKLIA
FT                   EAMDKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKVSNIREMLPVLEAVAKAGKPLVIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIIDGVGEES
FT                   AIQGRVAQIRKQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVDDA
FT                   LHATRAAVEEGVVAGGGVALVRVAAKLAGLSGQNEDQNVGIKVALRAMEAPLRQIVSNA
FT                   GEEPSVVTNNVKAGEGNYGYNAATEEYGNMIDFGILDPTKVTRSALQYAASVAGLMITT
FT                   ECMVTDLPKGDAPDLGAAGGMGGMGGMGGMM"
FT   gene            complement(535539..536507)
FT                   /locus_tag="ECL_00542"
FT   CDS_pept        complement(535539..536507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00542"
FT                   /product="putative IS903 trasposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60108"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGV8"
FT                   /protein_id="ADF60108.1"
FT                   /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLR
FT                   CPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRK
FT                   LHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHDELRR
FT                   KKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETAMYRVK
FT                   QLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
FT   gene            complement(536525..536914)
FT                   /locus_tag="ECL_00543"
FT   CDS_pept        complement(536525..536914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60109"
FT                   /db_xref="GOA:A0A0H3CES3"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CES3"
FT                   /protein_id="ADF60109.1"
FT                   /translation="MTAEVRKNLMDLFIDGARRGFTIATTSLLPNVVMAFVIIQALKVT
FT                   GLLDIVGRVCEPIMALWGLPGEAATVLLASVMSMGGGVGVCASLVVAGSLSGHDATVLL
FT                   PAIYLMGNPVQNTGRCLGTAGGFVE"
FT   gene            complement(536895..537572)
FT                   /locus_tag="ECL_00544"
FT   CDS_pept        complement(536895..537572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60110"
FT                   /db_xref="GOA:A0A0H3CFS0"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFS0"
FT                   /protein_id="ADF60110.1"
FT                   /translation="MSEVSPNQGKVTWVGYLAFFLTIIFFSGFFAKATEWWRVFDFTVL
FT                   NGTFGQVNGEGAASVSFRGTGGTGAKDGFLFALELAPSVILSLGIISVTEGLGGLRAAQ
FT                   QLMTPVLKPLLGIPGICSLALIANLQNTDAAAGMTKELADEGVISDRERAIFATFQTSG
FT                   SAIITNYFSSGAALFTSITVPVITPLAVILVFKFIGANFLRAWIAHMETRQIKEREDDR
FT                   RSA"
FT   gene            537827..538180
FT                   /locus_tag="ECL_00545"
FT   CDS_pept        537827..538180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00545"
FT                   /product="putative outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60111"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG40"
FT                   /protein_id="ADF60111.1"
FT                   /translation="MRVKVCAGIVGAALLLAGCSSSNELTAAGQGVRFVEDKPGNECQF
FT                   LGTATGEQSNWMSGQHGEEGGSMRGAANALRNQAAAMGGNVIYGVSSPTQGMLSSFVPT
FT                   ASQMNGQVYKCPN"
FT   gene            complement(538228..539256)
FT                   /locus_tag="ECL_00546"
FT   CDS_pept        complement(538228..539256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00546"
FT                   /product="L-lysine 2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60112"
FT                   /db_xref="GOA:A0A0H3CHU1"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHU1"
FT                   /protein_id="ADF60112.1"
FT                   /translation="MAHIVTLNTPSREDWLSQLADVITSPDELLRLLELEQHTDLLAGR
FT                   EAKRLFALRVPRAFVARMEKGNPDDPLLKQTLTAQEEFITAPGYSTDPLEEQNSVVPGL
FT                   LHKYLNRALLLVKGGCAVNCRYCFRRHFPYAENQGNKRNWQVALDYIAAHSELDEIIFS
FT                   GGDPLMAKDYELDWLLTQLEAIPHIKRLRIHSRLPIVIPARITDGLVSRLEQSRLQVLL
FT                   VNHINHANEIDDAFRAAMVRLRKAGVTLLNQSVLLRGVNDNARVLADLSNALFDAGVMP
FT                   YYLHVLDRVQGAAHFMVTDEEARQIVRELLTLVSGYMVPKLAREIGGEPSKTPLDLQLR
FT                   QS"
FT   gene            539345..539863
FT                   /gene="eF-P"
FT                   /locus_tag="ECL_00547"
FT   CDS_pept        539345..539863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eF-P"
FT                   /locus_tag="ECL_00547"
FT                   /product="elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60113"
FT                   /db_xref="GOA:A0A0H3CE39"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE39"
FT                   /protein_id="ADF60113.1"
FT                   /translation="MDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTDS
FT                   AEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDSDKWLLDQAECIVTLWNG
FT                   QPIAVTPPNFVELEIVETDPGLKGDTAGTGGKPAKLSTGAVVKVPLFVQTGEVIKVDTR
FT                   SGEYVSRVK"
FT   gene            539911..540042
FT                   /locus_tag="ECL_00548"
FT   CDS_pept        539911..540042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00548"
FT                   /product="entericidin A"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60114"
FT                   /db_xref="GOA:A0A0H3CES7"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CES7"
FT                   /protein_id="ADF60114.1"
FT                   /translation="MKRTVKILLLLALSSALLSGCNTTRGMGEDIQDLGHIISHAAS"
FT   gene            540151..540297
FT                   /locus_tag="ECL_00549"
FT   CDS_pept        540151..540297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00549"
FT                   /product="entericidin B membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60115"
FT                   /db_xref="GOA:A0A0H3CFS3"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFS3"
FT                   /protein_id="ADF60115.1"
FT                   /translation="MVKKTIAAIFSVLVLSSVLTACNTTRGVGQDISEGGSAISGAATK
FT                   AQQ"
FT   gene            complement(540335..540934)
FT                   /locus_tag="ECL_00550"
FT   CDS_pept        complement(540335..540934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00550"
FT                   /product="two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60116"
FT                   /db_xref="GOA:A0A0H3CG47"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG47"
FT                   /protein_id="ADF60116.1"
FT                   /translation="MFKILLIDRCHFTRAGFEAWLNHSGLFPGHFVVTGLNNLILAREH
FT                   ILQWDPSVVIADLHGFMQDIHHFQQLSSLLNASEKVPFILLQSGEDKEMAGFLSQFPIW
FT                   ASLTKNAGLETLATVINDALTTRASVEIPAVAAPLLTRQEEKVLTLWMDGASNQKIATH
FT                   LRINGKTVYTYKRNIRMKLHMDTRFSPFLSLQESEN"
FT   gene            541197..541514
FT                   /gene="sugE"
FT                   /locus_tag="ECL_00551"
FT   CDS_pept        541197..541514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="ECL_00551"
FT                   /product="suppresser of groEL"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60117"
FT                   /db_xref="GOA:A0A0H3CHU6"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHU6"
FT                   /protein_id="ADF60117.1"
FT                   /translation="MSWIILVIAGLLEVVWAIGLKYTHGFTRLTPSVITVTAMIVSIVL
FT                   LSWAMRSLPVGTAYAVWTGIGAVGAAITGILLLGESASLARIASLALIVCGIIGLKLSA
FT                   H"
FT   gene            complement(541511..542041)
FT                   /locus_tag="ECL_00552"
FT   CDS_pept        complement(541511..542041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00552"
FT                   /product="outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60118"
FT                   /db_xref="GOA:A0A0H3CE43"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE43"
FT                   /protein_id="ADF60118.1"
FT                   /translation="MRILPVIAAVTAAFLVVACSSPTPPSGVTVVSNFDAQRFLGTWYE
FT                   IARLDHRFERGLEKVTAHYSSMDDGGIQVINRGYNPDRQMWQQSTGKAYFTGDPRRAAL
FT                   KVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISSEMKQQMLDVATRQG
FT                   FDVSKLIWVEQPH"
FT   gene            complement(542200..543345)
FT                   /gene="ampC"
FT                   /locus_tag="ECL_00553"
FT   CDS_pept        complement(542200..543345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampC"
FT                   /locus_tag="ECL_00553"
FT                   /product="class C beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60119"
FT                   /db_xref="GOA:A0A0H3CET2"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001586"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CET2"
FT                   /protein_id="ADF60119.1"
FT                   /translation="MMKKSLSCALLLSVACSAFAAPMSEKQLADVVERTVTPLMKAQAI
FT                   PGMAVAVIYQGQPHYFTFGKADVAANKPVTPQTLFELGSVSKTFTGVLGGDAIARKEIS
FT                   LADPVTKYWPELTGKQWQGIRLLDLATYTAGGLPLQVPDDVTDNASLLRFYQSWQPKWA
FT                   PGTTRLYANTSIGLFGSLAVKPSGMRFEQAMAERVFKPLKLNHTWINVPHAEEPHYAWG
FT                   YREGKAVHVSPGMLDAEAYGVKSNVKDMASWVMANMAPETLPQSTLQQGIALAQSRYWR
FT                   VGAMYQGLGWEMLNWPVDAKTVVDGSDNKVALAPLPVAEVNPPAPPVKASWVHKTGSTG
FT                   GFGSYVAFIPEKQIGIVMLANKSYPNPVRVETAYRILDALQ"
FT   gene            543478..544353
FT                   /locus_tag="ECL_00554"
FT   CDS_pept        543478..544353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00554"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60120"
FT                   /db_xref="GOA:A0A0H3CFS5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFS5"
FT                   /protein_id="ADF60120.1"
FT                   /translation="MTRSYLPLNSLRAFEAAARHLSFTHAAIELNVTHSAISQHVKALE
FT                   QHLNCQLFVRVSRGLMLTTEGENLLPVLNDSFDRIAGMLDRFANHRAQEKLKIGVVGTF
FT                   ATGVLFSQLDDFRRSYPHIDLQLSTHNNRVDPAAEGLDYTIRYGGGAWHGTEATFLCSA
FT                   PLAPLCTPDIAAALHTPADILKFTLLRSYRRDEWTAWMQAAGENPPSPTHRVMVFDSSV
FT                   TMLEAAQTGTGIAIAPVDMFTHLLNSERIVQPFTTQIDLGSYWLTRLQSRAQTPAMREF
FT                   AQWLVGKMQK"
FT   gene            complement(544383..544742)
FT                   /locus_tag="ECL_00555"
FT   CDS_pept        complement(544383..544742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00555"
FT                   /product="fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60121"
FT                   /db_xref="GOA:A0A0H3CG51"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG51"
FT                   /protein_id="ADF60121.1"
FT                   /translation="MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVIILLVGIMLPLGLF
FT                   PGDALSYERVLAFAGSFIGRVFIFLMIVLPLWCGLHRIHHAMHDLKIHVPSGKWVFYGL
FT                   ATILTVVTLIAVVTI"
FT   gene            complement(544753..545148)
FT                   /locus_tag="ECL_00556"
FT   CDS_pept        complement(544753..545148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00556"
FT                   /product="fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60122"
FT                   /db_xref="GOA:A0A0H3CHV0"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHV0"
FT                   /protein_id="ADF60122.1"
FT                   /translation="MTTKRKAYVRPMPSTWWKKLPFYRFYMLREGTAVPAVWFSLELMY
FT                   GVFALKHGPETWASFVGFLQNPIIVILNLIVLAAALLHTKTWFELAPKAANIIVKGEKM
FT                   GPEPVIKGLWAVTAVVSVVILFVALFW"
FT   gene            complement(545159..545893)
FT                   /locus_tag="ECL_00557"
FT   CDS_pept        complement(545159..545893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00557"
FT                   /product="fumarate reductase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60123"
FT                   /db_xref="GOA:A0A0H3CE48"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE48"
FT                   /protein_id="ADF60123.1"
FT                   /translation="MAEMQTLKVEVVRYNPEVDTAPHSAFYEVPYDEQTSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLRDYTKGIKVEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNPRTPDQGPNTQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNEDSRDHGKKERMPQLNSQNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESSKDFLIATLKPR"
FT   gene            complement(545886..547676)
FT                   /locus_tag="ECL_00558"
FT   CDS_pept        complement(545886..547676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00558"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60124"
FT                   /db_xref="GOA:A0A0H3CET7"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CET7"
FT                   /protein_id="ADF60124.1"
FT                   /translation="MQTFQADLAVIGAGGAGLRAAIAAAQANPNAKIALISKVYPMRSH
FT                   TVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLEQWGCPW
FT                   SRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLDILV
FT                   DDGHARGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMALSHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLLERLPFICELAKAYV
FT                   GVDPVKEPIPVRPTAHYTMGGIETDQQCETRIKGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRMAGERAMERAATAGEANGAALDAQVADVEKRLKDLVNQEGNENWSKIRDEMGM
FT                   SMEEGCGIYRTPELMQKTVDKLAELQERFKRVRITDTSSVFNTDLLYTIELGHGLNVAE
FT                   CMAHSALARKESRGAHQRLDEGCTERDDVNFLKHTLAWRDADGTTRLDYSDVKITTLPP
FT                   AKRVYGAEAEAAEKKEKANG"
FT   gene            547986..548963
FT                   /locus_tag="ECL_00559"
FT   CDS_pept        547986..548963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00559"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60125"
FT                   /db_xref="GOA:A0A0H3CFS7"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFS7"
FT                   /protein_id="ADF60125.1"
FT                   /translation="MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMSQ
FT                   ATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLAAGCGPVYQLCRSFRNEEM
FT                   GRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCSEAETLSYQQAFQRYLEIDPLS
FT                   ADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPQIGKDRPTFVYHFPASQASL
FT                   AQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDT
FT                   NLLAALKAGLPDCSGVALGVDRLVMLALGAEQLGDVIAFTVDRA"
FT   gene            complement(549007..552330)
FT                   /locus_tag="ECL_00560"
FT   CDS_pept        complement(549007..552330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60126"
FT                   /db_xref="GOA:A0A0H3CG56"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG56"
FT                   /protein_id="ADF60126.1"
FT                   /translation="MRPIIVLLMAWCLSMGAYAATAPDAKQITQELEQAKAAKPAQPET
FT                   VESLQSALNALEERKGSLERAQQYQQVIDNFPKLSQTLRNQLSNLRDEPRDVPAGMTSD
FT                   ALNQEILQVSSQLLEKSRLAQQEQERAREIADSLSQLPQQQTDARRQLNEVERRIGTQT
FT                   GNTPQNQAQNLSLQAQSARLKALVDELELAQLSANNRQELSRMRSELAQKQSEQLDAYL
FT                   QALRNQLNSQRQREAERALESTELLAENSDNLPAGIVDQFKVNRELSAALNQQAQRMDL
FT                   VASQQRQATNQTLQVRQALNTLREQSQWLGSSNLLGEALRAQVSRLPEMPKPQQLDTEM
FT                   AQLRVQRLHYEDLLNKQPQIRQIRQADGQPLTSEQNRILEAQLRTQRELLNSLLQGGDT
FT                   LILELTKLKVSNSQLEDALKEVNEATHRYLFWTSDVRPMTFSWPIEIVQDLRRLISLDT
FT                   FSQLGKASVMMLTSKETIFPLLGALILVGFSIYSRRHFTRFLERSSARVGKVTQDHFWL
FT                   TLRTVFWSILVASPLPVLWMTLGYGLREAWPYPLAVAIGDGVTATVPLLWVVMICATFA
FT                   RPNGLFIAHFGWPRNRVARAMRYYLMSIGLIVPLIMALIMFDNLNDREFSGSLGRLCFM
FT                   LICGALAIVTLSLKRAGIPLYLDKTGSGDNMFNRMLWNLLLCAPLVAMLAAAVGYLATS
FT                   QALLARLETSVAIWFLLLVIYHVIRRGMLIQRRRLAFDRAKHRRAEILAQRARGEDEPN
FT                   HVNSTEGTIDADEVELDLDAISTQSLRLVRSILMLIALLSVIFLWSEIHSAFGFLENIS
FT                   LWDVTSTVQGVESLEPITLGAVLIAILVLIITTQLVRNFPALLELALLQHLDLTPGTGY
FT                   AITTITKYLILLFGGMVGFSMIGIEWSKLQWLVAALTFGLGFGMQEIFANFVSGLIILF
FT                   EKPIRIGDTVTIRDLTGSITKINTRATTISDWDRKEIIVPNKAFITEQFINWSLSDSVT
FT                   RVVLTVPAPSDANSEEVTQILYTAAERCTLVLDNPAPEVFLVDLQQGIQIFELRIYAAE
FT                   MGHRMPLRHEIHQLILAGFREHGIDMPFPPFQMRLESLDGLKTGKTLTSAARKRPAGSL
FT                   "
FT   gene            complement(552350..553318)
FT                   /locus_tag="ECL_00561"
FT   CDS_pept        complement(552350..553318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00561"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60127"
FT                   /db_xref="GOA:A0A0H3CHV5"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHV5"
FT                   /protein_id="ADF60127.1"
FT                   /translation="MLNAFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYY
FT                   KVDMKEAQKPDTASYRTFNEFFVRPLRDEVRPVDTDPNVLVMPADGVISQLGNIEDDKI
FT                   LQAKGHNYSLEALLAGNYLMADLFRNGTFATTYLSPRDYHRVHMPCNGILREMIYVPGD
FT                   LFSVNHLTAQNVPNLFARNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPRE
FT                   GVIKRWTWPAGEEEGAVALLKGQEMGRFKLGSTVINLFAPGKVKLAEQLQSLSVTKLGQ
FT                   PLAVSTEPFVTPDAEPAPLPEEEIKAELDASPLVDDKKDEG"
FT   gene            complement(553415..554467)
FT                   /locus_tag="ECL_00562"
FT   CDS_pept        complement(553415..554467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00562"
FT                   /product="ribosome-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60128"
FT                   /db_xref="GOA:A0A0H3CE53"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE53"
FT                   /protein_id="ADF60128.1"
FT                   /translation="MSKNKLSKGQQRRVNANHQRRLKTTSEKVDYDDNLFGEPTEGVVI
FT                   SRFGMHADVESADGEIHRCNIRRTIRSLVTGDRVVWRPGKEAAEGVTVKGIVEAVHERT
FT                   SVLTRPDFYDGVKPIAANINQIVIVSAILPELSLNIIDRYLVACETLQVEPIIVLNKID
FT                   LLDDEGMDFVNEQMDIYRKIGYRVLMVSSYTKDGLKPLEEALTGRISIFAGQSGVGKSS
FT                   LLNNLLGLQQEILTNDVSDVSGLGQHTTTASRLYHFPHGGDVIDSPGVREFGLWHLEPE
FT                   QIFNGFVEFHDYLGACKYRDCKHDNDPGCAIREAVEKGEIAETRFDNYHRILESMDQVK
FT                   TRKNFSDSDN"
FT   gene            554575..555120
FT                   /locus_tag="ECL_00563"
FT   CDS_pept        554575..555120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00563"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60129"
FT                   /db_xref="GOA:A0A0H3CEU2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEU2"
FT                   /protein_id="ADF60129.1"
FT                   /translation="MSADENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPT
FT                   IAVHQSDDQLALMDEWNVRTHTGSGLVERVKASTMGDREAELATLEFLKQWVPAGKSPI
FT                   CGNSIGQDRRFLFKYMPELESYFHYRYLDVSTLKELARRWKPEILDGFKKQGTHQAMDD
FT                   IRESVAELAYYRENFIKL"
FT   gene            555317..555392
FT                   /locus_tag="ECL_tRNA011"
FT   tRNA            555317..555392
FT                   /locus_tag="ECL_tRNA011"
FT                   /product="tRNA-Gly"
FT   gene            555437..555512
FT                   /locus_tag="ECL_tRNA012"
FT   tRNA            555437..555512
FT                   /locus_tag="ECL_tRNA012"
FT                   /product="tRNA-Gly"
FT   gene            complement(555783..556922)
FT                   /locus_tag="ECL_00564"
FT   CDS_pept        complement(555783..556922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00564"
FT                   /product="putative iron-sulfur cluster binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60130"
FT                   /db_xref="GOA:A0A0H3CFT0"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFT0"
FT                   /protein_id="ADF60130.1"
FT                   /translation="MSQPLDLNQLAQKIKQWGAELGFQKVGITDTDLSASEPKLQAWLD
FT                   KQYHGEMEWMARHGMMRARPHELLPGTLRVISVRMNYLPANAAFARTLKNPSLGYVSRY
FT                   ALGRDYHKLLRNRLKKLGETIQQHCVSLNFRPFVDSAPVLERPIAEKAGLGWTGKHSLI
FT                   LSRDAGSFFFLGELLIDLPLPVDGPVEEGCGRCVACMTICPTGAIVEPYTVDARRCISY
FT                   LTIELEGAIPEEFRPLIGNRIYGCDDCQLICPWNRYSQLTDEEDFSPRKALHAPQLIEL
FT                   FAWSEAWFLKVTEGSAIRRIGHLRWLRNVAVALGNAPWDEANIRALESRRGEHPLLDEH
FT                   IEWAIAQQIEKRNACVVEVQPPQKQRLVRVIEKGLPRDA"
FT   gene            557044..558444
FT                   /locus_tag="ECL_00565"
FT   CDS_pept        557044..558444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60131"
FT                   /db_xref="GOA:A0A0H3CG60"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG60"
FT                   /protein_id="ADF60131.1"
FT                   /translation="MQRAGEAAFNIARSAYPQSGHWLILCGHGNNGGDGYVVARLAVAA
FT                   GLRVTLLALESDKPLPEEASAAREAWLNAGGVIHASDIVWPEDVDLIVDGLLGTGLRSA
FT                   PRDNVAALIARANAHTAPVVALDIPSGLMAETGATPGAVIQAAHTVTFIALKPGLLTGK
FT                   ARDVVGSLHHNALGLESWLAGQETHLSRFDATQLSHWLPPRRPTSHKGDHGRLVIIGGD
FT                   HGTAGAIRMTGEAALRSGAGLVRVLTRSENIPPIITARPELMVHELTPQTLEESLEWAD
FT                   VVVIGPGLGQQAWGKQALQKVENFRKPMLWDADALNLLAINPDKRHNRILTPHPGEAAR
FT                   LLNCSVAEIESDRLLSARRLVKRYGGVAVLKGAGTVIASDEALGIIDAGNAGMASGGMG
FT                   DVLSGIIGALLGQKLPLYDAACAGCVAHGAAADSLAARYGTRGMLATDLFCTLRRVVNP
FT                   DVIDVEDD"
FT   gene            558437..558898
FT                   /locus_tag="ECL_00566"
FT   CDS_pept        558437..558898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00566"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60132"
FT                   /db_xref="GOA:A0A0H3CHW0"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHW0"
FT                   /protein_id="ADF60132.1"
FT                   /translation="MTNRAIPLPDEQATLELGKRVAQACQGATVIYLYGDLGAGKTTFS
FT                   RGFLQALGHNGNVKSPTYTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFANDAI
FT                   CLVEWPQQGAGVLPDPDVEIHLDYQAQGREARISAVSSSGSSLLARLAG"
FT   gene            558942..560252
FT                   /locus_tag="ECL_00567"
FT   CDS_pept        558942..560252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00567"
FT                   /product="N-acetylmuramoyl-l-alanine amidase II"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60133"
FT                   /db_xref="GOA:A0A0H3CE57"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE57"
FT                   /protein_id="ADF60133.1"
FT                   /translation="MAATVLLCAQAGAASLSDIQVSNGESQARITFSFMGDPEYAFSQP
FT                   DSRSVALDIKQTGVIQGLPLQFSGNNLVKSIRSGTPKDSQSLRLVVDLTEKGKTRAVKQ
FT                   QNGANYTVVFTINADAPPPPPPPPVVAKRVEEPVYTPRPSEPARNPFKTDNDRITGVTS
FT                   SNTVTRPAASARRVVSSDKVIIAIDAGHGGQDPGAIGPGGTREKNVTIAIARKLRTLLN
FT                   DDPMFKGVLTRDGDYFISVMGRSDVARKQNANFLVSIHADAAPNRNATGASVWVLSNRR
FT                   ANSEMANWLEEHEKQSELLGGAGDVLANSQSDPYLSQAVLDLQFGHSQRVGYDVATNVL
FT                   NQLQGIGALHKRRPEHASLGVLRSPDIPSILVETGFISNNSEERLLGSDSYQQQIAEAI
FT                   YNGLRKYFEAHPLQSAPQGGAAQTASAVLPGEMTATN"
FT   gene            560262..562106
FT                   /locus_tag="ECL_00568"
FT   CDS_pept        560262..562106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00568"
FT                   /product="DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60134"
FT                   /db_xref="GOA:A0A0H3CEU6"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEU6"
FT                   /protein_id="ADF60134.1"
FT                   /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGIKKEELALALARHATSKIASLDDLEAIISLGFRGEALASISS
FT                   VSRLTLTSRTAEQQEAWQAYAEGRDMDVTIKPAAHPVGTTLEVLDLFYNTPARRKFMRT
FT                   EKTEFGHIDEIIRRIALARFDVTINLSHNGKVMRQYRAVAEGGQKERRLGAICGTPFLE
FT                   QALAIEWQHGDLALRGWVADPNASSAAFAEIQYCYVNGRMMRDRLINHAIRQACEDKLG
FT                   ADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQVEPTLPL
FT                   EKEEPASRPIPENRVAAGRNHFAEPAVAREPEAPRFSSAGSAPRPTGANYPNAQPGYQK
FT                   QQGALYRKLLETPAVTRKEHSEVQAPSLEGHSQSFGRVLTIIAPDMALLEREGKLMLLA
FT                   LPVAERWLKQVQLTPGENAACAQPLLIPVRLKISTEETRVLQRAEAQLAQMGIEMVLES
FT                   QHVTIRAVPLPLRQQNLQNLIPELIGYLAQQTTFDAANTAQWIARHLASEHTPWSMAQA
FT                   ISVLAEVERLCPHLVKAPPGGLLQPVDLQTAMTALKDD"
FT   gene            562099..563049
FT                   /locus_tag="ECL_00569"
FT   CDS_pept        562099..563049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00569"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60135"
FT                   /db_xref="GOA:A0A0H3CFT2"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFT2"
FT                   /protein_id="ADF60135.1"
FT                   /translation="MIDVSKASLPKAIFLMGPTASGKTALAIELRKVLPVELISVDSAL
FT                   IYRGMDIGTAKPDAAELRAAPHRLLDILDPAQAYSAADFRRDALAEMAEITAAGRIPLL
FT                   VGGTMLYFKALLEGLSPLPSADPEIRAKIEQKAAEQGWDVLHQQLAEIDPVAAARIHPN
FT                   DPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQML
FT                   ASDFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKR
FT                   QITWLRGWEGVHWLDSEKPQQALNEVIEVIGDIAH"
FT   gene            563135..563446
FT                   /locus_tag="ECL_00570"
FT   CDS_pept        563135..563446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00570"
FT                   /product="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60136"
FT                   /db_xref="GOA:A0A0H3CG65"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG65"
FT                   /protein_id="ADF60136.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTGSNYHHGSNAQGSSAPAQDSDETE"
FT   gene            563521..564801
FT                   /locus_tag="ECL_00571"
FT   CDS_pept        563521..564801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00571"
FT                   /product="putative GTPase HflX"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60137"
FT                   /db_xref="GOA:A0A0H3CHW5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHW5"
FT                   /protein_id="ADF60137.1"
FT                   /translation="MFDRYDAGEQAVLVHIYFSQDKDMEDLQEFESLVSSAGVEAMQVI
FT                   TGSRKAPHPKYFVGEGKAVEIADAVKATGASVVLFDHALSPAQERNLEALCECRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRGRITQILSRLERVEKQREQGRRARTKADIPTVSLVGYTNAGKSTLFNQITEAQV
FT                   YAADQLFATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQATLLL
FT                   HVIDAADVRVQENIDAVNVVLEEIEAHEIPTLLVMNKIDMLDDFEPRIDRDEENKPIRV
FT                   WLSAQTGIGVPLLFQALTERLSGEVAQHTLRLPPQEGRLRSRFYQLQAIEKEWMEDDGS
FT                   VGMQVRMPIVDWRRLCKQEPALVDYIV"
FT   gene            564858..566117
FT                   /locus_tag="ECL_00572"
FT   CDS_pept        564858..566117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60138"
FT                   /db_xref="GOA:A0A0H3CE60"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE60"
FT                   /protein_id="ADF60138.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGRDQGPPDLDDI
FT                   FRKLSKKLGGLGGGKGSGSGGNSTQGPRPQMGGRIVGIVAAAVVIIWAASGFYTIKEAE
FT                   RGVVTRFGKFSHLVEPGLNWKPTFIDDVTAVNVESVRELAASGVMLTSDENVVRVEMNV
FT                   QYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQRELEE
FT                   TIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANG
FT                   QAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKVLSHTRK
FT                   VLVNDSKGGNLMVLPLDQMLKGGSAPAAKDNSGANNLLRLPPASSGSSSATTTPSSNDG
FT                   DIMDQRRANAQRNDYQRQGE"
FT   gene            566120..567124
FT                   /locus_tag="ECL_00573"
FT   CDS_pept        566120..567124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00573"
FT                   /product="FtsH protease regulator HflC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60139"
FT                   /db_xref="GOA:A0A0H3CEV1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEV1"
FT                   /protein_id="ADF60139.1"
FT                   /translation="MRKSVIAIIVIVLVVLYTSIFVVKEGERGIKFQFSSVVRDSDKRP
FT                   VIYEPGLHFKVPFIQSVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSRYF
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKDIVTDSRGRLTLEVRDALNSGTAGTE
FT                   DEVETPAADDAIAKAAERVQAETNGKVPVINPNSMAALGIEVVDVRIKQINLPAEVSEA
FT                   IYNRMRAEREAVARRHRSQGQEEAEKLRAAADYEVTKTLAESERQGRILRGEGDAEAAK
FT                   LFADAFSQDPDFYAFIRSLRAYENSFQSNQDVMVLSPDSDFFRYMKTPTNATR"
FT   gene            567196..567393
FT                   /locus_tag="ECL_00574"
FT   CDS_pept        567196..567393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60140"
FT                   /db_xref="GOA:A0A0H3CFT6"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFT6"
FT                   /protein_id="ADF60140.1"
FT                   /translation="MNSTIWLALALVLVLEGLGPMLYPRAWRRMIATLSQLPDNILRRF
FT                   GGGLVVAGIVIYYMLRKTIG"
FT   gene            567456..568796
FT                   /locus_tag="ECL_00575"
FT   CDS_pept        567456..568796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00575"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60141"
FT                   /db_xref="GOA:A0A0H3CG70"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG70"
FT                   /protein_id="ADF60141.1"
FT                   /translation="MVESIFKQTVILKKMGNNVVVLGTQWGDEGKGKIVDLLTERAKYV
FT                   VRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKGLEDR
FT                   GIPVRERLLLSEACPLILDYHVALDVAREKARGAKAIGTTGRGIGPAYEDKVARRGLRV
FT                   GDLFDKATFAEKLKEVMEYHNFQLVNFYKADAVDYQKVLDDVMAIADILTGMVVDVSDL
FT                   LDQARKRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGII
FT                   KAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDAVAVRRAVQINSLS
FT                   GFCLTKLDVLDGLKEVKICVGYRMPDGREVTTTPLAADDWEGIEPIYETMPGWSETTFG
FT                   VKERSGLPQAALDYIKRIEELTEVPIDIISTGPDRTETMILRDPFDA"
FT   gene            568939..569415
FT                   /gene="nsrR"
FT                   /locus_tag="ECL_00576"
FT   CDS_pept        568939..569415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsrR"
FT                   /locus_tag="ECL_00576"
FT                   /product="transcriptional repressor NsrR"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60142"
FT                   /db_xref="GOA:A0A0H3CHW9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR023761"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHW9"
FT                   /protein_id="ADF60142.1"
FT                   /translation="MNISAVLPRFPFFPEVDVQLTSFTDYGLRALIYMASLPDGKMTSI
FT                   SEVTEVYGVSRNHMVKIINQLSRAGYVAAVRGKNGGIRLGKPAQSIRIGDVVRELEPLS
FT                   LVNCSSEFCHITPACRLKQALSLAVQSFLKELDNYTLADLVEENQPLYKLLLVE"
FT   gene            569454..571895
FT                   /locus_tag="ECL_00577"
FT   CDS_pept        569454..571895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00577"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60143"
FT                   /db_xref="GOA:A0A0H3CE64"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE64"
FT                   /protein_id="ADF60143.1"
FT                   /translation="MSHDPFQEREAEKYANPIPSREFIIEHLTKREKPANREELAVELN
FT                   IEGEEQTEALRRRLRAMERDGQLVFTRRQCYALPERLDLLKGTVIGHRDGYGFLRVEGR
FT                   KDDLYLSSEQMKMCIHGDQILAQPLGADRKGRREARVVRVLVPKTSQIVGRYFTDAGVG
FT                   FVVPDDSRLSFDILIPPEEVMGARMGFVVVVELTQRPTRRTKAVGKIVEVLGDNMGTGM
FT                   AVDMALRTHEIPYIWPKAVEEQIVGLKEEVPEESKAGRVDLRSLPLVTIDGEDARDFDD
FT                   AVYCEKKRGGGWRLWVAIADVSYYVRPHTPLDNEARSRGTSVYFPSQVVPMLPEVLSNG
FT                   LCSLNPQVDRLCMVCEMTISSKGRLTGYKFYEAVMSSHARLTYTKVWHMLQGDQDLREQ
FT                   YAPLVKHIEELHNLYKTLDQAREERGGISFESEEAKFIFNAERRIERIEQTQRNDAHKL
FT                   IEECMILANISAARFVEKAKEPALFRIHDKPSTEAITAFRSVLAELGLELPGGNKPEPR
FT                   DYAELLESIGDRPDAEMLQTMLLRSMKQAIYDPENRGHFGLALQSYAHFTSPIRRYPDL
FT                   SLHRAIKYLLAQEQGHKGNTTETGGYHYSMEEMLQLGQHCSMTERRADEATREVSDWLK
FT                   CDFMLDQVGNIFKGVIASVTGFGFFVRLDELFIDGLVHVSSLDNDYYRFDQVGQRLIGE
FT                   SGGQTYRLGDRVEVKVEAVNMDERKIDFSLISSERAPRNVGKTAREKAKKGGNGNASGK
FT                   RRQAGKKVNFEPDSAFRGEKKQKPKAAKKEARKAKKPSAKTQKIAAATKAKRAAKKQQA
FT                   E"
FT   gene            571963..572697
FT                   /locus_tag="ECL_00578"
FT   CDS_pept        571963..572697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00578"
FT                   /product="23S rRNA 2'-O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60144"
FT                   /db_xref="GOA:A0A0H3CEV5"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR024915"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEV5"
FT                   /protein_id="ADF60144.1"
FT                   /translation="MSEMIYGIHAVQALLERAPERFQEVFILKGREDKRLMPLIHALEA
FT                   QGVVIQLANRQFLDEKSEGAVHQGIIARVKPGRQYQENDLPDLIAALDNPFFLILDGVT
FT                   DPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLARTMRM
FT                   LQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSV
FT                   SSLNVSVATGICLFEAVRQRGE"
FT   gene            complement(572776..574050)
FT                   /locus_tag="ECL_00579"
FT   CDS_pept        complement(572776..574050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00579"
FT                   /product="major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60145"
FT                   /db_xref="GOA:A0A0H3CFU1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFU1"
FT                   /protein_id="ADF60145.1"
FT                   /translation="MQPNAHKRALIAGSIGNFIEWYEFAVYGFLATVIAKNFFQLEGES
FT                   GLTSLILTYASFAIAFFFRPLGAVVFGRIGDRIGRKPTLIIVLVLMTLATAAIGVVPVY
FT                   ASIGIAAPLIVTLLRILQGLFAGGEYGGAVSLMTEFAPRGKRGLYGAWQSFTVALGLLA
FT                   GAGIVALLSALLTPEALHDWGWRIPFFLALPMGVVALWLRVSMEETPSFVQQQEKPLIA
FT                   QASTVATIKAIVMGIGRVMVWSAAGYTYLVIMPTYLQSALHTGFNQALLIAVISNVGFA
FT                   LTIIPSGILSDRIGRRTVMIIATALLLILALPLLKILQAESSTLAVKAIVVLIAGGLVG
FT                   MLAGPGPAMLSEMFPTRVRYTGLGLAYSLSNAIFSGCAGLIITGLIKETGNLDIPAYYV
FT                   MATAVVSIVALMTLRKDDHLRTLEE"
FT   gene            574244..575866
FT                   /locus_tag="ECL_00580"
FT   CDS_pept        574244..575866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00580"
FT                   /product="isovaleryl CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60146"
FT                   /db_xref="GOA:A0A0H3CG75"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR034184"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG75"
FT                   /protein_id="ADF60146.1"
FT                   /translation="MHWQTHTVFNQPAPLSNSNLFLSDCALRDAVAREGAEWDSELLAS
FT                   IGQQLGTAESLELGRLANVNPPELLRYDPTGERLDDVRFHPAWHLLMQGLCANRVHNLA
FT                   WEEEARKGSFVARAARFVLHAQVEAGTLCPVTMTFAATPLLQQALPEPFQNWLTPLLSD
FT                   RYDPHLAPGAQKRGLLIGMGMTEKQGGSDVLSNTTKAEKCSDGSYRLVGHKWFFSVPQS
FT                   DAHLVLAQAKGGLSCFFVPRFLPDGQRNAVRLERLKDKLGNRSNASSEAEFLDASGWLL
FT                   GEEGEGVRQILRMGGLTRFDCALGSHGLMRRALSVALYHAHQRQTFGKNLIDQPLMRDV
FT                   LSRMALVLEGQTALLFRLARAWDKRADPQEAAWARLFTPAAKFSVCKAGIPFVAEAMEV
FT                   LGGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVLRVLAKQPGMFDLLAEDFAQVKG
FT                   QDRHFDRSWRQLQQKLRKPQEAQGREIAHQLFLLGAGSQMLRHASPPVAQAWCRMMLDT
FT                   RGGTLMTEQVQSDLLLRATGRVG"
FT   gene            complement(575863..577794)
FT                   /locus_tag="ECL_00581"
FT   CDS_pept        complement(575863..577794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00581"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60147"
FT                   /db_xref="GOA:A0A0H3CHX4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHX4"
FT                   /protein_id="ADF60147.1"
FT                   /translation="MITFFRRAGLGAKLSLLTGVSVATLFLLFTFLLSHKASQQLEALA
FT                   VEDLHNQSTGMVDMVQMFNTSLSEEVESYTRLFTTFLPQPLSVDSNQLQTINGLSVPLL
FT                   KGGETGLHENNALSDDFLTRTGAISTLFVRSGNDFVRVATSLRKENGDRAMGTVLDTAS
FT                   PAYAAVTKGEVYRGLALLFGKRYITQYQPFKNAEGQVIGIIFVGVDITHSWNVMREKIL
FT                   NRRLGDSGHFFVLDRSNGKTRGQFLFHSNREGQLPEWDSATQQQLLSNTPGTLERTSEG
FT                   GRILKMAYTPLPGWNWTIVGEVDKSVLLSSVTTMRDRFLLAGVALSVLFAALFVIIIRR
FT                   MLTRPLRNVIHLARQYAAGDLRASLSVTRQDEVGQLIDAINGIGGGLQKIVLQVREAAG
FT                   EIHLGTNALASDTGEISEQINKQASSVEETSASMEQLAATVQQNAANMEQTQQLVGETS
FT                   RAVHQGGETVTHAVSTMDDIRDASKRIEDITRVIESIAFQTNILALNAAVEAARAGEHG
FT                   KGFAVVAQEVRALAARSANAVKEIEQLIGDTLNKVSEGHALSEQTRLAMDAIIAHIDNI
FT                   NQLVTEINHASREQSAGIRQVNLAMTHIGEASHINADRVSRSEQTAQSLREKGSHLTQL
FT                   VSLFQLKN"
FT   gene            complement(577965..578252)
FT                   /locus_tag="ECL_00582"
FT   CDS_pept        complement(577965..578252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60148"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE69"
FT                   /protein_id="ADF60148.1"
FT                   /translation="MELTMKRTLALTSLLLSVGLVSTTAQSAEFASADCVTGLNEIGQI
FT                   SVNNISGSPQDVERVVALKADEQGASWYRIIQMQEDNRSDHWRVQAILYV"
FT   gene            complement(578389..578697)
FT                   /locus_tag="ECL_00583"
FT   CDS_pept        complement(578389..578697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00583"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60149"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEW0"
FT                   /protein_id="ADF60149.1"
FT                   /translation="MVMRRFATLLLLVLLSGCSALQGTPQPAPPVADHPQEIRRNQTEG
FT                   LQRMGTVSALVRGSPDDAEESIKAQAAAAKADYYVIIMIDETIITGQWYSQAILYRK"
FT   gene            578856..579578
FT                   /locus_tag="ECL_00584"
FT   CDS_pept        578856..579578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00584"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00584"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60150"
FT                   /db_xref="GOA:A0A0H3CFU5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFU5"
FT                   /protein_id="ADF60150.1"
FT                   /translation="MIEIETRRLGNHEILHAIPAGKSAHPLPVVVFYHGFTSSKLVYSY
FT                   FAVALAQAGFRVVMPDAPDHGARFTGDEQVRLGQFWQILHGSLSEFAGLRDALYQAGLV
FT                   ADQRLSVAGASMGGMTALGIMARHPEVTSVACLMGSGYFTSLSKTLFPPQDATEIDALL
FT                   AEWEVTRALPRLADRPLLLWHGDADDVVPPGETFRLQQALQREGLDGNLTCLWEAGVRH
FT                   RITPAALDATVDFFRQHL"
FT   gene            complement(579575..580330)
FT                   /locus_tag="ECL_00585"
FT   CDS_pept        complement(579575..580330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00585"
FT                   /product="transcriptional repressor UlaR"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60151"
FT                   /db_xref="GOA:A0A0H3CG80"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG80"
FT                   /protein_id="ADF60151.1"
FT                   /translation="MTEAQRHQILLELLAQTGFITVEKVIERLGISPATARRDINKLDE
FT                   SGKLKKVRNGAEAISQQRPRWTPMNIHQAQNHDEKVRIARAASQLVNPGESVVINCGST
FT                   AFLLGREMCGKPVQIITNYLPLANYLIDQEHESVVIMGGQYNKSQSITLSPQDSENSLY
FT                   AGHWMFTSGKGLTADGLYKTDMLTAMAEQNMLNVVGKLVVLVDSSKVGERAGMLFSRAE
FT                   QIDMVITGKHANPEILQKLEDQGVKILRV"
FT   gene            complement(580441..581505)
FT                   /locus_tag="ECL_00586"
FT   CDS_pept        complement(580441..581505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00586"
FT                   /product="putative beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60152"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHX8"
FT                   /protein_id="ADF60152.1"
FT                   /translation="MSKVNTITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGC
FT                   TGIWLKSEGGANICVDFWCGTGKQSHGNPLMKKGHQMQRMAGVEKLQPNLRTTPFVLDP
FT                   FAIRQIDAVLSTHDHNDHIDVNVAAAVMQNCADDVPFIGPQTCVDLWIGWGVPKERCIV
FT                   MKPGDVVKIKDIEIHALDAFDRTALITLPADQKAAGVLPDGMDERAVNYLFKTPGGSLY
FT                   HSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMAEALNTKVVIPFH
FT                   HDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNLEYHYPRGFDD
FT                   CFTIEPDLPFKSFL"
FT   gene            581865..583265
FT                   /locus_tag="ECL_00587"
FT   CDS_pept        581865..583265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60153"
FT                   /db_xref="GOA:A0A0H3CE76"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE76"
FT                   /protein_id="ADF60153.1"
FT                   /translation="MEILYNVFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKGT
FT                   IKTIIGFMLLQAGSGILTSTFKPVVAKMSEVYGINGAISDTYASMMATIDRMGDAYSWV
FT                   GYAVLLALALNIIYVLLRRITGIRTIMLTGHIMFQQAGLIAVSLYIFGYPMWTTIICTA
FT                   VLVSLYWGITSNMMYKPTQEVTDGCGFSIGHQQQFAAWLAYKVAPYLGKKEDSVEDLKL
FT                   PGWLNIFHDNIVSTAIVMTIFFGAILLSFGIDVVQAMAGKTHWTVYILQTGFSFAVAIF
FT                   IITQGVRMFVAELSEAFNGISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGTIGQLIA
FT                   VGILVGCGSSILIIPGFIPMFFSNATIGVFANHFGGWRAALKICLVMGMVEIFGCVWAV
FT                   KLTGMSAWMGMADWSILAPPMMQGFASVGLVFMAVIILIALAYMFFAGRSLRAEEDAEK
FT                   QTAEVSAH"
FT   gene            583326..583583
FT                   /locus_tag="ECL_00588"
FT   CDS_pept        583326..583583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60154"
FT                   /db_xref="GOA:A0A0H3CEW5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEW5"
FT                   /protein_id="ADF60154.1"
FT                   /translation="MIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELNGADIIIASTHIA
FT                   GEISVSGNKYVVGVRNMLSPADFGPKLLEVIKAHFPQDVK"
FT   gene            583593..584060
FT                   /locus_tag="ECL_00589"
FT   CDS_pept        583593..584060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60155"
FT                   /db_xref="GOA:A0A0H3CFV0"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFV0"
FT                   /protein_id="ADF60155.1"
FT                   /translation="MKLRDSLAENNSILLQAEASTWQEAVKLSVDLLVKADVVEPRYYQ
FT                   AILDGVAQHGPYFVIAPGLAMPHGRPEEGVKKTGFALVTLKTPLVFNHEDNDPVDILIT
FT                   MAAVDANTHQEVGIMQIVNLFDDEANFDRLRACRTEQEVLDLIDNATAAAV"
FT   gene            584074..584724
FT                   /locus_tag="ECL_00590"
FT   CDS_pept        584074..584724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60156"
FT                   /db_xref="GOA:A0A0H3CG85"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG85"
FT                   /protein_id="ADF60156.1"
FT                   /translation="MSLPMLQVALDNQTLSDAYETTRLIAEEVDIIEVGTILCVGEGVR
FT                   AVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVAKE
FT                   FNGDVQIELTGFWTWEQAQAWRDAGIQQVVYHRSRDAQAAGVAWGDADISAIKRLADMG
FT                   FKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAQLWG"
FT   gene            584734..585594
FT                   /locus_tag="ECL_00591"
FT   CDS_pept        584734..585594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00591"
FT                   /product="L-ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60157"
FT                   /db_xref="GOA:A0A0H3CHY2"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHY2"
FT                   /protein_id="ADF60157.1"
FT                   /translation="MLSKQVPLGIYEKALPAGECWLERLKLAKQLGFDFVEMSVDETDE
FT                   RLSRLDWSQEQRLALVSAVAETGVRVPSMCLSAHRRFPLGSEDDTVRAQGLEIMRKAIR
FT                   FAQDVGIRVIQLAGYDVYYQEANDETRRRFRDGLKESVEMASRAQVTLAMEIMDYPLMN
FT                   SISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELLAGMGHIVAVHVKDTRPGVFKN
FT                   VPFGTGVVDFERCFQTLKQAGYCGPYLIEMWSETSDDPAGEVANARDWVRERMARAGLL
FT                   EAEYA"
FT   gene            585587..586273
FT                   /locus_tag="ECL_00592"
FT   CDS_pept        585587..586273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00592"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60158"
FT                   /db_xref="GOA:A0A0H3CE78"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR023499"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE78"
FT                   /protein_id="ADF60158.1"
FT                   /translation="MLKLKQQVFDANMDLPRYGLVTFTWGNVSAIDREQGLVVIKPSGV
FT                   AYDAMSPDDMVVVDLEGNVVDGKWRPSSDTATHLALYRRYPSLGGVVHTHSTHATAWAQ
FT                   AGRAIPALGTTHADYFFGDIPCTRALTQTEVEGEYELNTGNVIIETLGESEPLHTPGIV
FT                   VYQHGPFAWGKDAHDAVHNAVVMEEVARMAWIARGINPQLQGIDDYLMNKHFMRKHGPN
FT                   AYYGQK"
FT   gene            complement(586413..586688)
FT                   /locus_tag="ECL_00593"
FT   CDS_pept        complement(586413..586688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60159"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEX0"
FT                   /protein_id="ADF60159.1"
FT                   /translation="MKKIAIAVMAALLLSANAMAAIKIDSRQARNMDDVQSLGVIYINH
FT                   HFATESEADQALNKETDAQGANYYHVILMREPGSNGNMHASADIYR"
FT   gene            587032..587427
FT                   /locus_tag="ECL_00594"
FT   CDS_pept        587032..587427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00594"
FT                   /product="ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60160"
FT                   /db_xref="GOA:A0A0H3CFV4"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR020815"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFV4"
FT                   /protein_id="ADF60160.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGTIHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPMVK
FT                   AKDERRERRDDFANETADDSDAGDSEE"
FT   gene            587581..587748
FT                   /locus_tag="ECL_00595"
FT   CDS_pept        587581..587748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00595"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60161"
FT                   /db_xref="GOA:A0A0H3CG90"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR023646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG90"
FT                   /protein_id="ADF60161.1"
FT                   /translation="MPVIISGHENQAITHSLTVGSAVIVQGFISCHKAKNGLSKMVLHA
FT                   EQIDLIDSGD"
FT   gene            587753..587980
FT                   /locus_tag="ECL_00596"
FT   CDS_pept        587753..587980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00596"
FT                   /product="ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60162"
FT                   /db_xref="GOA:A0A0H3CHY5"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHY5"
FT                   /protein_id="ADF60162.1"
FT                   /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
FT   gene            588022..588471
FT                   /locus_tag="ECL_00597"
FT   CDS_pept        588022..588471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00597"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60163"
FT                   /db_xref="GOA:A0A0H3CE82"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE82"
FT                   /protein_id="ADF60163.1"
FT                   /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNVE
FT                   FFEARRAELEAKLADVLAAANARAEAINALGTVTIASKAGDEGKLFGSIGTRDIADAVS
FT                   AAGVKVAKSEVRLPNGVLRTTGEHEVDFQVHSEVFAKLVVNVVAE"
FT   gene            588623..589552
FT                   /locus_tag="ECL_00598"
FT   CDS_pept        588623..589552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60164"
FT                   /db_xref="GOA:A0A0H3CEX4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEX4"
FT                   /protein_id="ADF60164.1"
FT                   /translation="METALSTPVFARRNVAYACATLCCLLWGSSYPAIKSGYELFQIAT
FT                   DDIPSKVVFAGYRFLFAGALLLLFALAQRKPIARLTPTQFGQLTILGLTQTTIQYTFFY
FT                   IGLAYTTGVNGSIMNATGTFFSVLLAHFIYHNDKLSYNKTLGCILGFAGVMLVNFHSGI
FT                   RDFRFVWNGDGFVVLAAFILSAATLYGKRISQTVDPTVMTGWQLGIGGLALVAGGYATG
FT                   GTLEVHSLTAVAVLGYLTLLSSVAFALWSALLKVNRVSMIAPFNFVIPVAGTVLSAIFL
FT                   GENILEIKYAIALVLVCSGIWWVNKRSA"
FT   gene            complement(589599..590243)
FT                   /locus_tag="ECL_00599"
FT   CDS_pept        complement(589599..590243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00599"
FT                   /product="opacity-associated protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60165"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFV7"
FT                   /protein_id="ADF60165.1"
FT                   /translation="MPGRFELKPTLAKIWHAPDNFRIMDPLPPLHRRGIIIGALLMIVG
FT                   FLLPSGGDNVDTAPVTRNAQLDLQSQTRPQPDTQTMQTQLVTPSNDPGQVAPVEPEPIQ
FT                   EEQPQEQAAAPSEPQTQQPTGIEQQWRSYRVEAGKTLAQLFRDHNLPPTDVYAMAQVEG
FT                   AGKPLSNLQNGQMVQIRQNASGVVTGLTIDTGNGQQVLFTRQPDGSFIRAR"
FT   gene            590477..591097
FT                   /locus_tag="ECL_00600"
FT   CDS_pept        590477..591097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00600"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60166"
FT                   /db_xref="GOA:A0A0H3CG94"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG94"
FT                   /protein_id="ADF60166.1"
FT                   /translation="MTTPTFDTIEAQASYGIGLQVGQQLSESGLEGLLPEALVAGIADA
FT                   LEGKQPAVPVDVVHRALREIHERADAVRRARFEEMAAEGVKYLEENREREGVNSTESGL
FT                   QFRVINQGDGAIPARTDHVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIAGWIEALT
FT                   LMPVGSKWELTIPHNLAYGERGAGASIPPFSTLVFEVELLEIL"
FT   gene            591409..592818
FT                   /locus_tag="ECL_00601"
FT   CDS_pept        591409..592818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00601"
FT                   /product="D-alanine/D-serine/glycine permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60167"
FT                   /db_xref="GOA:A0A0H3CHY9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHY9"
FT                   /protein_id="ADF60167.1"
FT                   /translation="MVDQVKVAATEEATSEQSLRRNLTNRHIQLIAIGGAIGTGLFMGS
FT                   GKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYFTG
FT                   WTYWFCWVVTGMADVVAITAYAQFWFPGLSDWVASLAVIVLLLSLNLATVKMFGEMEFW
FT                   FAMIKIVAIVALIVVGLVMVLTHFQSPTGVQASFTHLWNDGGWFPKGISGFFAGFQIAV
FT                   FAFVGIELVGTTAAETKDPEKSLPRAINSIPVRIIMFYVFALIIIMSVTPWSSVVPSKS
FT                   PFVELFVLVGLPAAASLINFVVLTSAASSANSGVFSTSRMLFGLAQEGVAPSAFAKLSK
FT                   RAVPAKGLTFSCMCLLGGVVMLYVNPSVIGAFTMITTVSAILFMFVWTIILCSYLVYRK
FT                   QRPHLHEKSIYKMPLGKLMCWVCMAFFAFVLVLLTLEDDTRQALIVTPLWFIALGLGWL
FT                   FIGKKRMAGVR"
FT   gene            complement(592914..593576)
FT                   /locus_tag="ECL_00602"
FT   CDS_pept        complement(592914..593576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00602"
FT                   /product="iron-sulfur cluster repair di-iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60168"
FT                   /db_xref="GOA:A0A0H3CE87"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="InterPro:IPR023742"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE87"
FT                   /protein_id="ADF60168.1"
FT                   /translation="MAFRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAASRKE
FT                   LDVEVIEAELALLAEQPINKEWRTAPLAEIIDHIIVRYHDRHREQLPELILQATKVERV
FT                   HADKPSVPRGLAKYLTMLHEELTSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDDA
FT                   GELLEVIKHTTNNVTPPPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALAGK"
FT   gene            593821..595470
FT                   /locus_tag="ECL_00603"
FT   CDS_pept        593821..595470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00603"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60169"
FT                   /db_xref="GOA:A0A0H3CEX8"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR004091"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEX8"
FT                   /protein_id="ADF60169.1"
FT                   /translation="MFKRIKVITLLISVLLVLGIMQLVSAGIFINALNNDKDNFTVSQL
FT                   SSKNVAEFTDAWISLNQARVTLNRGMLRLQSSMASQINGGQLNELVNTAKNLLANAQSH
FT                   YDKYYALPNTPGLDPNLANRLEEQYRNYSATLTQMNVLLSQGNLEEMFKQNAEQKQTAM
FT                   QNVYREWREAQAVLTDKGIKDNESDYKRILWILSAVMLLVIIVIISSWIAMRRVLLLPL
FT                   QDVISHIRAIAAGDLTQPIHAEGKNEMAVLAQNVQEMQTALANTVGVVREGADTIYTGA
FT                   GEISAGSNDLSSRTEQQAASLEETAASMEQLTATVKQNADNARQASRLALDASSTAKKG
FT                   GNVVEGVVRTMDEIATSSSKIAQITNVIDGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   AGEVRTLAQRSAQAAKEIKALIDDSGERVNAGSQLVNEAGATMAEIVNAVTRVTDIMGE
FT                   IASASDEQSRGIDQVGQAVAEMDRVTQQNASLVEESAAAAAALEDQAARLNDAVAVFKI
FT                   ARSQAVKAAPAKTYAPKAQPVASASEANWETF"
FT   gene            complement(595533..596498)
FT                   /locus_tag="ECL_00604"
FT   CDS_pept        complement(595533..596498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60170"
FT                   /db_xref="GOA:A0A0H3CFW2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFW2"
FT                   /protein_id="ADF60170.1"
FT                   /translation="MISGVLYALLAGLMWGLIFVGPLIVPEYPAALQSTGRYLALGLIA
FT                   LPLAWLGRTRLRQLNRQDWMTALALTMMGNLIYYVCLASAIQRTGAPVSTMIIGTLPVV
FT                   IPVFANLLYSQRDGKLAWSKMVPALICTGVGLVCVNIAELRHGLADFSVWRYGSGIGLA
FT                   FISVACWAWYALRNARWLRENPDKHPMMWATAQALVTLPVSLVGYAGACLWSGQQQPDF
FT                   ALPFGPRPWVFVGLMIAIAVLCSWVGALCWNIASQKLPTVILGPLIVFETLAGLLYTFL
FT                   MRQSVPPLLTACGIVLLVMGVVMAVRAKPEKPMVVPASEM"
FT   gene            complement(596574..597398)
FT                   /locus_tag="ECL_00605"
FT   CDS_pept        complement(596574..597398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00605"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60171"
FT                   /db_xref="GOA:A0A0H3CGA0"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGA0"
FT                   /protein_id="ADF60171.1"
FT                   /translation="MQGVPEQFSDERDSARFRHLAQLPGLELYHAHIADYAFEPHTHEA
FT                   FGIGTIETGAERFRYRGTQHLAAEKSVVTMNPDEIHTGESATEGGWRYRMVYIEPALLE
FT                   EVTGLRHWWFSDVTRHDPLRSQQIGQLIYGLWHTQDPLAQKGLLLDLIETFQPLAHHAP
FT                   IIKEGAHRFERVREYLHDNYMHAVTLDELANVVSLSPYHFQRQFKAHFHVTPHQMLMAI
FT                   RLWRAKGFLTHGMPAAEVAAATGLTDQSHLTRAFTRRYGITPVRYQKQVIGR"
FT   gene            complement(597448..598278)
FT                   /locus_tag="ECL_00606"
FT   CDS_pept        complement(597448..598278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00606"
FT                   /product="AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60172"
FT                   /db_xref="GOA:A0A0H3CHZ3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHZ3"
FT                   /protein_id="ADF60172.1"
FT                   /translation="MPIRTHSGFSITADTTLADDRHYDVIYIPALWRNPRAVVRQQPEL
FT                   LAWLSEQAARGTRIAAVGTGCCFLAESGLLNGKPATTHWHYFRQFSRDYPSVKLQTKHF
FT                   LTQAENIYCAASVKALSDLTIHFIETIYGKRVATHTQRTFFHEIRSQFDRQCYSEENKP
FT                   HPDEDIVQIQTWIKANCASDISMQNLADMAGMSLRNFNRRFKNATDMSPLQYLLTARIE
FT                   LAMNMLQSTNLCIQEIANAVGYEDIAHFNRQFKHKTTVSPGDYRKTVRAKMFSA"
FT   gene            598265..598396
FT                   /locus_tag="ECL_00607"
FT   CDS_pept        598265..598396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00607"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60173"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE91"
FT                   /protein_id="ADF60173.1"
FT                   /translation="MRIGKLFMPMVLTFKMLSGRQSLKRDRFAGGVSVLAFVFCSAK"
FT   gene            598669..600567
FT                   /locus_tag="ECL_00608"
FT   CDS_pept        598669..600567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00608"
FT                   /product="beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60174"
FT                   /db_xref="GOA:A0A0H3CEY2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEY2"
FT                   /protein_id="ADF60174.1"
FT                   /translation="MVKLPVITAFGGYGPAGRSSSHHAFRRMVIESLSEEERQQTLLSL
FT                   AILMGLLKYDEGGYCDISGKRFTPDQAAATIKNEALEGSLIRKITDDNFDVDAIVSHAK
FT                   LNMASDENGFSFNISSRQLPQPLPQGWHAEELTDQRVRITVRGDMDCRIETLLRTEVQA
FT                   AGLLPQGFRPGDYYNSQFHPRALQMAVVGASDAINALGIPWRDIQAKISPDKLGIYSGN
FT                   IMGQLDEYGFGGMLQSRLKGHRVSAKQCPLGLNSMCADFLNAYVLGSVGHTSATLGACA
FT                   TFLYNLNAAVEDIKAGRIRMAVVGSAEAPVTSEVIEGFDAMGALATESKLRHIDQTETA
FT                   DWRNSSRPFGNSCGFVIAESSQYIVLMDDELAMQLGAEIHGSVGNVFINADGYKRSIAS
FT                   PGPGNYITMAKAVASAVSMVGLETVQKGSFIQAHGSSTPKNCVSEADIFDRVAQAFSIH
FT                   NWPVTAVKSYLGHSLGPASGDQLISCLGVFRYGILPGIKSVSHIAPQVNNARLHIPVQD
FT                   CKLEDEQGQIAFINSKGFGGNNATGVVYSPKLTQQWLRKRYGEPAFADYQQRNRQVQRQ
FT                   ARAYDEAASHGELNVIYLFGQQGINEDDINIDMNGITIPGFEKPISFAREKEYSDF"
FT   gene            complement(600782..601630)
FT                   /locus_tag="ECL_00609"
FT   CDS_pept        complement(600782..601630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00609"
FT                   /product="NmrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60175"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFW7"
FT                   /protein_id="ADF60175.1"
FT                   /translation="MIAITGATGQLGRLVIEQLLKTVPANQIVAIVRNPAKAEALSQQG
FT                   IVVRQGDYTDQAALTTALKGVKKLLLISSSEVGQRATQHQNVINAAKAAGVIFIAYTSL
FT                   LHADNSPLGLHVEHVATEKALATSSIPYALLRNGWYTENYLASAPPALEHGVFIGAAGE
FT                   GKIASATRADYAAAAAKVVSEEGHAGKVYELAGDSAWTLSELAAELSKQSGKPVVYQNM
FT                   SEADFAAALKSVGLPAGLADMLADSDVGASKGGLFDDSHTLSKLIGRPTTSLAESVKTI
FT                   L"
FT   gene            601720..602100
FT                   /locus_tag="ECL_00610"
FT   CDS_pept        601720..602100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00610"
FT                   /product="HxlR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60176"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGA4"
FT                   /protein_id="ADF60176.1"
FT                   /translation="MTIPTLSEQMRDGNLFAEQCPSREVLKHVTSRWGVLILVALRERT
FT                   HRFSDLRRKMGGVSEKMLAQSLQALEHDGFVDRVSYPVVPPHVEYSLTPLGVEVSEKVA
FT                   ALADWIEVNTPKVMANRDERAA"
FT   gene            complement(602198..604141)
FT                   /locus_tag="ECL_00611"
FT   CDS_pept        complement(602198..604141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00611"
FT                   /product="bifunctional 2',3'-cyclic nucleotide
FT                   2'-phosphodiesterase/3'-nucleotidase periplasmic precursor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60177"
FT                   /db_xref="GOA:A0A0H3CHZ7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006294"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041827"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CHZ7"
FT                   /protein_id="ADF60177.1"
FT                   /translation="MIKFSATLLATLIAASVQAATVDLRILETTDLHSNMMDFDYYKDT
FT                   PTEKFGLVRTASLINAARNEVKNSVLVDNGDLIQGSPLGDYMAAKGLKKGEIHPVYKAM
FT                   NTLDYIVGNLGNHEFNYGLKYLHDALAGAKFPYVNANIIDVKTKKPLFTPYLIKETEVV
FT                   DQDGKKQTLKIGYIGFVPPQIMTWDKANLTGKVTVNDITETARKYVPEMREKGADVVVV
FT                   VAHSGLSADPYQVMAENSVYYLSEVPGVDAILFGHAHAVFPGKDFASIKGADIDKGTLN
FT                   GVPAVMPGMWGDHLGVVDLVLNNDSGSWKVTGSKAEARPIYDAAAKKSLAAEDQKLLDV
FT                   LKHDHDATREFVSKPIGKSADNMYSYLALIQDDPTVQVVNMAQKAYAEHFVQGDPDLAN
FT                   LPVLSAAAPFKVGGRKNDPASYVEVEKGHLTFRNAADLYLYPNTLVVVKATGKEVKEWL
FT                   ECSAGQFNQIDPKSSKPQSLINWDGFRTYNFDVIDGVDYQIDVTQPAKYDGECQAINPQ
FT                   AERIKNLTFKGKPVDPAATFLVVTNNYRAYGGKFAGTGDSHIAFASPDENRSVLAAWIS
FT                   AESKKAGEIHPAVDNNWRLAPIHSDTPLDIRIETSPSDKAAAFIKEKAQYPMKKVATDD
FT                   IGFAIYQVDLSK"
FT   gene            604332..605072
FT                   /locus_tag="ECL_00612"
FT   CDS_pept        604332..605072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00612"
FT                   /product="adenosine-3'(2'),5'-bisphosphate nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60178"
FT                   /db_xref="GOA:A0A0H3CE96"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE96"
FT                   /protein_id="ADF60178.1"
FT                   /translation="MLDKICQLARDAGDAIMQVYDGAQPMNVVSKADDSPVTAADIAAH
FT                   GVIMKGLQALTPEIPVLSEEAPQSWDERQHWQRYWLVDPLDGTKEFIKRNGEFTVNIAL
FT                   IDKGKAVLGVVYAPVMKVMYSAAEGKAWKEECGVRKPIQVRDARPPLVVISRSHSDSEL
FT                   EEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGAHVHD
FT                   WQGKPLDYTPRESFLNPGFRVSLY"
FT   gene            complement(605066..605623)
FT                   /locus_tag="ECL_00613"
FT   CDS_pept        complement(605066..605623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00613"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60179"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEY7"
FT                   /protein_id="ADF60179.1"
FT                   /translation="MTLRNILAAACLLLPLWASAHNIEKGQRVPPVGIADRGELILDND
FT                   KFSYKPWNSAQLAGKVRVVQHIAGRTSAKEKNANLVEAIKAAKFPHDRYQTTTIVNTDD
FT                   AIPGSGMFVRSSLESNKKLYPWSQFIVDSNGVTRKAWQLEEESSAIIVLDKNGQVQWVK
FT                   DGALTQEEVQQVVDLLHKLLAQ"
FT   gene            605948..606154
FT                   /locus_tag="ECL_00614"
FT   CDS_pept        605948..606154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60180"
FT                   /db_xref="InterPro:IPR009491"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFX1"
FT                   /protein_id="ADF60180.1"
FT                   /translation="MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILVPKVK
FT                   DKQHLSVMSEVNRQVMRLQTEMA"
FT   gene            complement(606226..607563)
FT                   /locus_tag="ECL_00615"
FT   CDS_pept        complement(606226..607563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60181"
FT                   /db_xref="GOA:A0A0H3CGA9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGA9"
FT                   /protein_id="ADF60181.1"
FT                   /translation="MLNSILVILCLIAVSAFFSISEISLAASRKIKLKLLADEGNINAS
FT                   RILKMQENPGTFFTVVQIGLNAVAILGGIVGDAAFSPAFYSLFVQYMSAELAEQMSFIL
FT                   SFSLVTGMFILFADLTPKRIGMIAPEAVALRIINPMRFCLFVFRPLVWFFNGLANVIFR
FT                   IFKLPMVRKDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTGRESV
FT                   IWFDLHEDEQSLKNKVAEHPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLALNSGV
FT                   QIRNTLIVPDTLTLSEALESFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMGDLVGQG
FT                   LEEQIVARDENSWLIDGATPIDDVMRVLDIDEFPQSGNYETIGGFMMFMLRKIPKRTDS
FT                   VKFSGYKFEVVDIDNYRIDQLLVTRIDNKPTVLVPKLPDAEEKVSA"
FT   gene            608095..609834
FT                   /locus_tag="ECL_00616"
FT   CDS_pept        608095..609834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00616"
FT                   /product="ATP-dependent OLD family endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00616"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60182"
FT                   /db_xref="GOA:A0A0H3CI00"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI00"
FT                   /protein_id="ADF60182.1"
FT                   /translation="MKLERIEIQNFRGIGTASINLENFTTLIGSNNIGKSTVLKAIKIL
FT                   VDTTNPTTEDWPFRQASDGELIIAGYFIDIQDWERTKPAISNLILNDKLAIRVRATWDE
FT                   DNNCISLPIYEAYCRREIIEGFTNKITEARRVPYLLEIIERLDVNSSEAYKANLQQVIE
FT                   IIRTEYPDKVTTEEGWSSENINFKNSLQQALPHILYIPACFKIEDDLKSQKGTPFGHLF
FT                   SNRIFPALQADSSFSGYLDSANYMQRKMKGEIDGETIEGLMELMDSISESLNKVMDISS
FT                   KVKLSVGEIDINSVFMKAAGLVIEDRLETQLEYQGSGVQRALAYALLESNAIFEVSESR
FT                   RSTIILYEEPELYIHPHLMRLLRDTLRSKSSGSEWQVIVSTHSPFLIDIAENPSSLKLL
FT                   KDHDNGTRTVHEINEDIFSVGGQYNERDMLRAALDFHPTVCEAFFAKRVVVVEGDTEVA
FT                   ILRFAENLCDKFEINKRLVKDTTIVSAGGKWTIPAIARILRKLNIPFKVIHDTDRKGRT
FT                   DQELEALSPISEYKANEKIESIVGADDVYRVDDTFEHVLWNLETDGEAPTDGGKPFNAW
FT                   KRM"
FT   gene            complement(610146..611693)
FT                   /locus_tag="ECL_00617"
FT   CDS_pept        complement(610146..611693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00617"
FT                   /product="putative oligogalacturonide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60183"
FT                   /db_xref="GOA:A0A0H3CE98"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CE98"
FT                   /protein_id="ADF60183.1"
FT                   /translation="MVKPTERRVGYGVALGYGITDLFGGGAFAIIGTWLLFFYTTYCGL
FT                   SVVEAGSIFAIARVIDALLSPIMGYITDNFGDTWLGRKFGRRRFFLLLSSPLMFLYALL
FT                   WMTDMGYWYYLGTYLSIELLSAMVLVPWETLAAEMTNRYEERSRLSGVRMICSQLGGFL
FT                   AVSVPGVIMQFTGKDNPFTYTLTGLIFSCVFCIAVFITWYTTWEAKDVQQPSTFKVDKQ
FT                   RSSGLINHLKYLVLDLFSSFRIRAFRLHIIIYIFSFTAMDVFGSVFTYYVVYCLSQDAA
FT                   AVSGWLSIAAFASVPGTYGFMLLLNRLNVSPSAALRLSYGGIFFVLVFLFTVYLTKTQV
FT                   PTLLFTAVFILLGATRAGLYYIPWNIYSFIPDIDEMVTQQRREGIFAGVMVLTRKSTVA
FT                   IAIMIIGLVLQESGFVKGGGAQPESALGAIIGLMIFATAALLAVSFFTTYKFKLTRETH
FT                   KLLLKEIARRKLGGDYRDCDANTRVVIKQLTGYEYDQVWGGDAARRAVNKLNLSSIK"
FT   gene            complement(611776..612795)
FT                   /locus_tag="ECL_00618"
FT   CDS_pept        complement(611776..612795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60184"
FT                   /db_xref="GOA:A0A0H3CEZ1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEZ1"
FT                   /protein_id="ADF60184.1"
FT                   /translation="MKLLNTAVIGAGAIHGCHVNALRQLPNVALRALADIDSVKGLKLA
FT                   LGYQCRFYQDYREMLLDDAIDVVHICTPHFEHKSMILAALAAGKHVFCEKPVGMNSSEL
FT                   VDITRAADQATGLLGVCYQNRLNPTSLRIRQALDEGELGKMLSIKAVLTWSRSGAYYTQ
FT                   SPWRGRLATEGGSLLINQAIHTLDLMQWFAGGVTRVKGVVDSGELADVTEGEDSAMATL
FT                   HFANGARGLFYASNCNTTDSPLLMEIHCEQGSLLLNDNTLWRVTPGERVRLTCDDSPDG
FT                   SVKSYWGLGHQQAIRRFYQAITHPGYTDYTDIREAGKSLTLVEAIYRSSQLRQWIEIN"
FT   gene            complement(612808..613875)
FT                   /locus_tag="ECL_00619"
FT   CDS_pept        complement(612808..613875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00619"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60185"
FT                   /db_xref="GOA:A0A0H3CFX5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFX5"
FT                   /protein_id="ADF60185.1"
FT                   /translation="MNKNDGMNYAPVGKPQPVVREGEFVFAAAALDHGHIYGMSNGLIE
FT                   AGATLKWVYDPDPAKVDKFIQQYPQARVADSLDVILADDEVRLVAGAAIPAERCALGLK
FT                   AMAAGKDYFTDKAPLTTLEQLADAKAMVEKTGRKYAVYYSERLHVESAVFAGQLVQQGA
FT                   IGRVVQTLGTGPHREGTGRPDWFYDRRYFGGILCDIGSHQIEQFLFYTGNSDATVVASQ
FT                   VRNVKHPQYPAFEDFGDAMLKGENGASGYFRCDWFTPDGLSTWGDGRLTLLGTEGYIEI
FT                   RKYVDLTRGEQDVVYLVNNEGEFRYPVAGQVGFPFFGELILDCLHRTEHAMTQAHAFKA
FT                   AELCVKAQMLANATA"
FT   gene            complement(613872..615056)
FT                   /locus_tag="ECL_00620"
FT   CDS_pept        complement(613872..615056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60186"
FT                   /db_xref="GOA:A0A0H3CGB4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGB4"
FT                   /protein_id="ADF60186.1"
FT                   /translation="MLNVAIVGTGNISHNHIQGYLQFGQRCRIVALVDIYPEKAHEKKA
FT                   RYNLTDARVYESHEQMLASEPDIDIVDVCTPPHVHAEISINALNAGCHVLCEKPMAASL
FT                   EECDAMIAAQQASGKLLAIIAQNRFTDAFWRLKAALDSGLAGKVCHAQVDSFWWRGHCY
FT                   YDLWWRGTWEKEGGGCTLNHAVHHIDAIQWMLGFPSEVVAMMTNVAHDNAEVEDLSAAI
FT                   FKYPSGALTQLTASVVHHGEDQKIIIQGEKARISAPWQAFASVSADNGFPQEDRDRQRE
FT                   AQLNAVFHETPKLEWTLHTGQINDLLYAIEHGTAPLVDGLQGKRSLELITAIYKSAVTR
FT                   CVVSLPIQRDDPFYRTGGTNALAPRFYEKSASVANFSEVGAIPLGKDLDEGVTP"
FT   gene            complement(615073..616224)
FT                   /locus_tag="ECL_00621"
FT   CDS_pept        complement(615073..616224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60187"
FT                   /db_xref="GOA:A0A0H3CI04"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI04"
FT                   /protein_id="ADF60187.1"
FT                   /translation="MEKVRFGIIGIGNIGTVHARYLLAGTVSDACLAAVCDNAPEKHPA
FT                   IRQLVGSLPLFSDAQEMLQSGLIDAVIVATPHYEHPRLSMLAMRHGIHTLCEKPAGVYT
FT                   AQVQEMNACARTCDVVFGIMYNQRPNPLYQKVKDLIDSGELGEIRRSNWIITNWYRSQS
FT                   YYNSGGWRATWKGEGGGVLLNQDPHQLDLWQWLVGMPIRLRAFCQFGKHRDIEVEDEVT
FT                   AYAEYANGATGVFITTVAETPGTNRLEIVGDRGKVVVEEGKLRYWRLRESETAFNARWQ
FT                   NGFGEPECWEVTLPVGPECSEHHVITANFCGAILRGEPLIAPGLEGIHGLTLSNAMHLS
FT                   TWTDDWVDLPLNEKQYLRLLQQRISTSVAKETASVTLDASGTW"
FT   gene            616435..617475
FT                   /locus_tag="ECL_00622"
FT   CDS_pept        616435..617475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00622"
FT                   /product="LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60188"
FT                   /db_xref="GOA:A0A0H3CEA2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA2"
FT                   /protein_id="ADF60188.1"
FT                   /translation="MEEIATLTGYSVSTVSRVLSGKSYASDKARDAIVRTARELGVLEA
FT                   MASGRLLINGIAVFAPERTFQGRGDIFYLEVTKGIAEACAPHNVWVSCCGLEEQHADVK
FT                   LFMEKASHKNINAIIIIGTDDSTIFKLASTLNKPCVLINSVDRDRVLDAVSPDHRAIGF
FT                   TAMQYLFEQGHRRVLTLTCLRRETLYARLDGIKEAYRHFHVAFDPQRDLLVTEWFTAEE
FT                   AERALDAWLLSHDRSQWPEVIFPNSTSMTEGVIRALTRHGLRIPEDISLITTDFAWNLA
FT                   HRLEKPITGVTVPCRELGIEAVHLLQTRLNRPQAPVYNLLLQGKVMDYGSVSNATRHAA
FT                   RVALDQ"
FT   gene            complement(617476..618012)
FT                   /locus_tag="ECL_00623"
FT   CDS_pept        complement(617476..618012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00623"
FT                   /product="methionine sulfoxide reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60189"
FT                   /db_xref="GOA:A0A0H3CEZ5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEZ5"
FT                   /protein_id="ADF60189.1"
FT                   /translation="MTNVPEGMEIALFAMGCFWGVERLYWQLPGVYSTAAGYTGGYTPN
FT                   PTYREVCSGETGHAEAVRVVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRSAI
FT                   YPLTPEQEAAALASKERFQQAMRDAGDTREVTTEITTAKPFYYAEDDHQQYLHKNPYGY
FT                   CGIGGIGVCLPPQLA"
FT   gene            618343..620076
FT                   /locus_tag="ECL_00624"
FT   CDS_pept        618343..620076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00624"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60190"
FT                   /db_xref="GOA:A0A0H3CFX9"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFX9"
FT                   /protein_id="ADF60190.1"
FT                   /translation="MTKIRQLCLVSVLLTSGVASAANVRLQVEGLSGALEKNVRAQLST
FT                   IESDEVTPDRRFRARVDDAIREGLKALGYYEPTIDFDLRPPPKKGRQVLIARVSPGEPV
FT                   LIGGTNVVLRGGARTDRDYLDLLSTRPKIGTVLNHGDYDSFKKSLTSVSLRKGYFDSQF
FT                   NKSQLGIALGRRQAFWDIDYDSGERYRFGDVTFEGSQIREEYLQNLVPFKKGDYYHSRD
FT                   LAELNRRLSATGWFNSVVVAPEFEKARKTKVLPLHGVVSPRTENTIETGAGYSTDVGPR
FT                   VRATWKKPWMNSYGHSLTTSASISAPEQQLDFSYKIPLLKNPLEQYYLVQGGFKRTDLN
FT                   DTESDSTTLAVSRFWDLSSGWQRAINLRWSLDHFTQANVTNTTMLLYPGVMISRTRSRG
FT                   GLMPTWGDSQRYSIDYSNTMWGSDVDFSVIQAQNVWIRTLYDKHRFVMRGNLGWIETGD
FT                   FDKVPPDLRFFAGGDRSIRGYKYKSIAPKDDDGKLIGASKLATGSLEYQYNVSGKWWGA
FT                   MFVDGGEAVSDIRRSDFKTGAGVGVRWQSPVGPIKLDFAVPVGDKEEHGLQFYIGLGPE
FT                   L"
FT   gene            620073..623849
FT                   /locus_tag="ECL_00625"
FT   CDS_pept        620073..623849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00625"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60191"
FT                   /db_xref="GOA:A0A0H3CGB9"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGB9"
FT                   /protein_id="ADF60191.1"
FT                   /translation="MSLWKKISLGVLIFIVLLLGTVAFLVGTTTGLHLLFNAANRWVPG
FT                   LEIGQVTGGWRDLRLKNIRYEQPGVAVNAGEFHLAVRLGCLRDSKLCVNDLSLKDVNVA
FT                   IDSEKMPKSAPVEEEDSGPLNLSTPYPIALYRVALDNVNVKIDDTTVSVMDFTSGLRWQ
FT                   EKNLTLTPTTLQGLLIALPKVADVAQEEIVEPKIQNPQPEEKPLGETLKDLFSKPVLPE
FT                   MTDVHLPLNLNIEAFKGEQLRLTGDTDLTVYNMLLKVSSIDGNMKLDALDIDTNQGSVN
FT                   ASGHALLRDNWPVDITLNSALNIDPLKGEKVKVKVGGALRDKLDVGVNLSGPVDMVLRA
FT                   QTQLAEAGLPLNLEVVSKQLYWPFTGEKQFQADDLKLKLSGKMTDYTLSFRTAVKGQDV
FT                   PPATITLDAKGNEQQVNLDKLTVAALEGKTELTALLDWQQAISWRGELKLSGINTAKEV
FT                   PDWPSKLDGLIKTRGSLYGGTWQMDVPEIKLTGNVKQNKVNVEGSLKGNSYLQWVIPGL
FT                   HVALGRNTADIKGELGVKDLNLDATIDAPNLDNALPGLGGTAKGLLKVRGTVDAPQLLA
FT                   DITASNLRWQELSIARVRVDGDVKSTDQIGGNLNLRVERISQPDVNINLVTLDAKGNEK
FT                   QHDLQLRVQGEPVSGQLHLTGSFDRKAERWKGTLDNTRFNTPVGPLVLSRAIALDYRNA
FT                   EQKISIGPHCWTNPNAELCVPQTIDAGAEGRAQITLNRFDLAMLKPFMPDTTQASGVFS
FT                   GKADVAWDTTKDGLPQGSVTLSGRNVKVTQDVNNAPLPVAFDTLNLSADLHNNRAELGW
FT                   LIRLTNNGQFDGKVQITDPQGRRNLGGNVSIRNFNLAMVNPIFSRGEKAAGMLNANLRL
FT                   AGNAQSPQLFGQMQLNGVDIDGNFMPFDMQPSHITMNFNGMSSTLNGSVLTQQGQINLS
FT                   GDADWSQLDNWRARIAAKGSKVRITVPPMVRLDVSPDIVFEATPSLFTLDGNVDVPWAR
FT                   IVVHEVPESAVGVSSDEVMLDDNLKPINQQSAGIPINSNLTVHVGNNVRLNAFGLKARL
FT                   TGDLKVAQDRQGLGLNGQINIPEGRFHAYGQDLIVRKGELLFSGPPDQPLLNIEAIRNP
FT                   EATENDVIAGVRVTGSADEPKAEIFSDPAMSQQEALSYLLRGQGLDSGQSDSAAMTSML
FT                   VGLGVAQSGQVVGKIGETFGVSNLALDTQGVGDSSQVVVSGYVLPGLQVKYGVGIFDSL
FT                   ATLTLRYRLMPKLYLEAVSGVDQALDLLYQFEF"
FT   gene            623906..624196
FT                   /locus_tag="ECL_00626"
FT   CDS_pept        623906..624196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60192"
FT                   /db_xref="GOA:A0A0H3CI09"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="InterPro:IPR039126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI09"
FT                   /protein_id="ADF60192.1"
FT                   /translation="MTNALLLGNYNIENYQLYSLGHYPGAVPGEGTVHGEVYRIDNATL
FT                   AELDALRTRGGEYARQLIQTPYGSAWMYVYQRPVEGLTRIVSGNWLDRDQY"
FT   gene            complement(624238..624531)
FT                   /locus_tag="ECL_00627"
FT   CDS_pept        complement(624238..624531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60193"
FT                   /db_xref="GOA:A0A0H3CEA6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA6"
FT                   /protein_id="ADF60193.1"
FT                   /translation="MGYIKAFDCYGKDSKWQYLCILAFQLAWFLGYLWIPYRSDYAILL
FT                   FLLFFLPVISSNTRCINYYGRSRALCLLWLIAPYIMLFVPLFLTRRRDTEES"
FT   gene            complement(624509..624979)
FT                   /locus_tag="ECL_00628"
FT   CDS_pept        complement(624509..624979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60194"
FT                   /db_xref="GOA:A0A0H3CEZ8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEZ8"
FT                   /protein_id="ADF60194.1"
FT                   /translation="MNKKTHIVSLFILIIAAFIFGRSTYTEYLAWYYGSNNLIFSEVNS
FT                   ALLSSLCNGFFFVLSACIIYASLTLLKRIPRNIVVSCLLQFCINIGLYTLFVAVERGYS
FT                   KLHTLGPGATDITYGYFLGALLTSTLLTVAIVSVIHAKFLSSKHKDGLHKGV"
FT   gene            complement(624976..625560)
FT                   /locus_tag="ECL_00629"
FT   CDS_pept        complement(624976..625560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60195"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFY4"
FT                   /protein_id="ADF60195.1"
FT                   /translation="MSSINIDVARPTGIYFIIERLYSRDGLMPSFGEISPSLTQVHRTV
FT                   IQLKRKQDMFMDGVKVIPKDITLWQQIKYITGSKVTTKDTDTLVYTTDFIGSLVATTPL
FT                   GNIELENIPRFLTTESIHSLPQAVSYGRDPIPQVLLYGRKDIVFFMDNGGKGTPTAIAK
FT                   YNHNTRDLAIIKDQLEASKTMKELLSKGAKL"
FT   gene            complement(625779..626309)
FT                   /locus_tag="ECL_00630"
FT   CDS_pept        complement(625779..626309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00630"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60196"
FT                   /db_xref="GOA:A0A0H3CGC5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGC5"
FT                   /protein_id="ADF60196.1"
FT                   /translation="MSLLNVPAGKELPEDIYVVIEIPANADPIKYEVDKESGALFVDRF
FT                   MSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGAVIRCRPVGVLKMTDESGEDA
FT                   KLVAVPHTKLSKEYDHIKDVNDLPELLKAQITHFFEHYKDLEKGKWVKVDGWDNAEAAK
FT                   AEIIASFERAAKK"
FT   gene            626670..627575
FT                   /locus_tag="ECL_00631"
FT   CDS_pept        626670..627575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00631"
FT                   /product="ABC transporter periplasmic-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60197"
FT                   /db_xref="GOA:A0A0H3CI14"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033893"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI14"
FT                   /protein_id="ADF60197.1"
FT                   /translation="MAMAAPLTVGFSQVGSESGWRAAETNVAKSEAQKRGITLKIADGQ
FT                   QKQENQIKAVRSFIAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKSL
FT                   YMTTVTANNVLEGQLIGDWLVKQVDGKPCNVVELQGTVGASVAIDRKKGFAEAISKAPN
FT                   IKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPG
FT                   KDILTGSIDGVPDIYKAMIDGEANASVELTPNMAGPAFDALEKFKKDGTMPEKVTVTKS
FT                   TLYLPDTAKEELEKKKNMGY"
FT   gene            627682..629184
FT                   /locus_tag="ECL_00632"
FT   CDS_pept        627682..629184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00632"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60198"
FT                   /db_xref="GOA:A0A0H3CEA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEA9"
FT                   /protein_id="ADF60198.1"
FT                   /translation="MTTEQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENG
FT                   AGKSTLIKALTGVYHADRGTIWLEGNAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADN
FT                   LFIGREPRRFGLLRRKEMEARATKLMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLS
FT                   AKVLILDEPTASLDTQEVEMLFTLMRQLRNQGVSLIFVTHFLDQVYEVSDRITVLRNGS
FT                   FVGCRETRELPQIELVKMMLGRELESNALQRAGRTLLSEKPVAAFSDFGKKGVISPFNL
FT                   EVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTAQIKGKPQTLRSPHQASCLGVGFC
FT                   PEDRKTDGIIAAASVRENIILALQAQRGWLRPIPRKEQNAIAERFIRQLGIRTPSAEQP
FT                   IEFLSGGNQQKVLLSRWLLTKPQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVI
FT                   SSELEELVGYADRVIIMRDRKQVAEIPLDKLSVPAIMNAIAA"
FT   gene            629282..630220
FT                   /locus_tag="ECL_00633"
FT   CDS_pept        629282..630220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00633"
FT                   /product="ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60199"
FT                   /db_xref="GOA:A0A0H3CF03"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF03"
FT                   /protein_id="ADF60199.1"
FT                   /translation="MVLLVDSLVAPHFFQIIVQDGRLFGSPIDILNRAAPVALLAIGMT
FT                   LVIATGGIDLSVGAVMAIAGATAASMTVAGHSLPVVLLAALGTGVLAGLWNGILVAVLK
FT                   IQPFVATLILMVAGRGVAQLITSGQIVTFNSPNLAWLGSGKLLFFPTPVIIALVTLVVF
FT                   WIFTRKTALGMFIEAVGINIRAARNAGVNTRLMVMLTYVLSGVCAAIAGVIVAADIRGA
FT                   DANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVIGALIIQGMNTGILLSGFQPELNQ
FT                   VVKAVVVLCVLIVQSPRFVSIIKGIRGHDKT"
FT   gene            630201..631208
FT                   /locus_tag="ECL_00634"
FT   CDS_pept        630201..631208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00634"
FT                   /product="inner membrane ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60200"
FT                   /db_xref="GOA:A0A0H3CFY8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFY8"
FT                   /protein_id="ADF60200.1"
FT                   /translation="MAMIKRNLPLMITLGVFVLGYLYCLTQFPGFASTRVICNILTDNA
FT                   FLGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKAIGFWGISPLVAFPLVLVMGCAFG
FT                   AFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPVYDTLSSLAWKIPGGGR
FT                   LSAMGLLMLGVVVIGIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYMLSTGL
FT                   ATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAIQGLIQ
FT                   TYINFDGTLSSWWTKIAIGILLFIFIALQRGLTVLWENRQSSPVTRVNTSVTER"
FT   gene            631302..632873
FT                   /locus_tag="ECL_00635"
FT   CDS_pept        631302..632873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00635"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60201"
FT                   /db_xref="GOA:A0A0H3CGC9"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGC9"
FT                   /protein_id="ADF60201.1"
FT                   /translation="MLKTLSIRTGLLSLLAVMTLLLLIVSGIGIYALTQSSSSLQRINH
FT                   LQGEQMVQLNSGYTLILRARNEAGQAVRMMEIGLLDDAAKSVKSINQEIALAQKTLKGV
FT                   IDAGVADPQGQQLLDKVAASLAAYNQQGINPMLKALNEQSADSYYDLLESKLIPVAKQF
FT                   DNDMQAFQMWSDARGKAEVSAVQSSKTRVLVLIVVAALLTAGIIVLAWLVLRHMLLKPL
FT                   SASIAQLENVAAGDLTHTLNAPASQEFNRLNAAIEGMRQSLMHSVLRVRDASSQIDTGS
FT                   RELTAGNRDLAERTESTATSLEQTAASMEEITATVKLNADNAEQAHQLAKSVSDTADHG
FT                   SEMVCYVIEKMRDISGSSARIADILSVIDGIAFQTNILALNASVEAARAGEQGRGFAVV
FT                   AGEVRNLASRSADAAKEIRSLISDSQTHVNEGSELAQQAGETMDEIATEVLRMTKLMRE
FT                   IATASQEQSRGIEQVNIAVNQMDETAQQNAALVQQSSAATRSLEEQSRQLMEAMSSFKL
FT                   TTQSVA"
FT   gene            complement(632841..633203)
FT                   /locus_tag="ECL_00636"
FT   CDS_pept        complement(632841..633203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00636"
FT                   /product="LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60202"
FT                   /db_xref="GOA:A0A0H3CI19"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI19"
FT                   /protein_id="ADF60202.1"
FT                   /translation="MTKNYSRANTGIDLNLIPVFIEVVRCGSMAKASVRLEMSRPAVSL
FT                   ALKRFSQLFAEPLFIRKGLYLEPTEKALTLTHHLEILLGNIHDNISAINLSENNTLVQN
FT                   VQGRGILCDTLRRQFK"
FT   gene            complement(633349..634347)
FT                   /locus_tag="ECL_00637"
FT   CDS_pept        complement(633349..634347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00637"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00637"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60203"
FT                   /db_xref="GOA:A0A0H3CEB1"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB1"
FT                   /protein_id="ADF60203.1"
FT                   /translation="MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGASGAENVQGEVQQKLDLFANEKLKAALRARDIVAGIASEEEDEIVVFEGCEHAK
FT                   YVVLMDPLDGSSNIDVNVSVGTIFSIYRRVTPVGTPVTEEDFLQPGSQQVAAGYVVYGS
FT                   STMLVYTTGCGVHAFTYDPSLGVFCLCQERMRFPEKGNTYSINEGNYIKFPTGVKKYIK
FT                   FCQEEDKATQRPYTSRYIGSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYECNPMAF
FT                   LAEQAGGKASDGKERILDIVPESLHQRRSFFVGNNHMVEDVERFIREYPDA"
FT   gene            634545..635918
FT                   /locus_tag="ECL_00638"
FT   CDS_pept        634545..635918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00638"
FT                   /product="putative ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60204"
FT                   /db_xref="GOA:A0A0H3CF08"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF08"
FT                   /protein_id="ADF60204.1"
FT                   /translation="MRIHILGICGTFMGGLAMLARSLGHEVTGSDANVYPPMSTLLEKQ
FT                   GISLIQGYDASQLDPAPDLVIIGNAMTRGNPCVEAVLERNIPFMSGPQWLHDFVLRDRW
FT                   VVAVAGTHGKTTTAGMATWILEACGYKPGFVIGGVPGNFDVSARLGESPFFVIEADEYD
FT                   CAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRIILPEN
FT                   DINLKQTMAMGCWSEQELVGEQGHWQAKKLNVDASEWEVWLDGEKVGEVKWGLVGEHNM
FT                   HNGLMAIAAARHVGVQPADAANALGSFINARRRLELRGEAHGVTVYDDFAHHPTAILAT
FT                   LAALRGKVGGTARILAVLEPRSNTMKMGICKDDLAPSLGRADEVFLLQPQHIPWQVAEV
FT                   ADACIQPAHWSADVDALADMVVKAAQPGDHILVMSNGGFGGIHQKLLDGLAKKAEAAE"
FT   gene            complement(636021..636572)
FT                   /locus_tag="ECL_00639"
FT   CDS_pept        complement(636021..636572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00639"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60205"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFZ2"
FT                   /protein_id="ADF60205.1"
FT                   /translation="MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKQLGAE
FT                   MVELGKNALDKIPLDQDLRDAIELAQKIKKEGRRRQLQLIGKMLRQRDVDPIRQALDKL
FT                   KNRHNQQVALFHKLEQIRDRLIEQGDDAVPEVLNLWPDADRQQLRSLIRNAKKEKEGNK
FT                   PPKSARLIFQYLRELSENEE"
FT   gene            636680..638020
FT                   /locus_tag="ECL_00640"
FT   CDS_pept        636680..638020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00640"
FT                   /product="putative peptide maturation protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60206"
FT                   /db_xref="GOA:A0A0H3CGD4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGD4"
FT                   /protein_id="ADF60206.1"
FT                   /translation="MKVTSQVEAQRKILEEAVSTALTLASGKSDGAEVAVSKTTGISVS
FT                   TRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSPDAIARTVQAALDIARYTSPDPY
FT                   AGVADKDLLAFDAPDLDLFHPAEVTPDEAIELAARAEQASLQADKRITNTEGGSFNSHY
FT                   GIKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYAYTIGRALGDLQSPEWVGKAC
FT                   AERTLSRLSPRKLSTMKAPVIFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLGKQIL
FT                   PEWLTIEEHPHLLKGLASTPFDSEGVRTERRDIVKDGILTQWLLTNYSARKLGLKSTGH
FT                   AGGIHNWRIAGQGLNFEQMLKEMGTGLVVTELMGQGVSGITGDYSRGAAGFWVENGEIQ
FT                   YPVSEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMKIAGQ"
FT   gene            638061..638447
FT                   /locus_tag="ECL_00641"
FT   CDS_pept        638061..638447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00641"
FT                   /product="cytochrome b562"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60207"
FT                   /db_xref="GOA:A0A0H3CI24"
FT                   /db_xref="InterPro:IPR009155"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI24"
FT                   /protein_id="ADF60207.1"
FT                   /translation="MRKHLLAIVAASTLVLGSSAFAADLEDNMDILSQNLKVVQKTDNA
FT                   AEMKSALTKMREAALDAQKATPPKLESKAADSAEMKDYRHGFDVLVGQIDGALKLANEG
FT                   KVKEAQAAADQFVATRNTYHKKYR"
FT   gene            639107..639427
FT                   /locus_tag="ECL_00642"
FT   CDS_pept        639107..639427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00642"
FT                   /product="PRD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60208"
FT                   /db_xref="GOA:A0A0H3CEB4"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR020044"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB4"
FT                   /protein_id="ADF60208.1"
FT                   /translation="MNDVGDHAEQTEKLANTMLQQVYALLARHNIIPNAVQEQMLTSHV
FT                   RAMAHRSVTGEPLPEVEAELFDEISPDSMRLAREVVAHFGNLPDEEAWLLSVHFEVAKD
FT                   NL"
FT   gene            639438..639800
FT                   /locus_tag="ECL_00643"
FT   CDS_pept        639438..639800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60209"
FT                   /db_xref="InterPro:IPR020034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF12"
FT                   /protein_id="ADF60209.1"
FT                   /translation="MEQITVVIGDRLGKGQKVAAGVEKAGGRAVVVPGMAADMKLGDVM
FT                   KAENATFGISFCGSGGAGAITAQTKYGYKAKYGMRSVDEGVTAINEGCNVLGFGFMDKE
FT                   ELGERLVQAWQKKHGA"
FT   gene            639803..640102
FT                   /locus_tag="ECL_00644"
FT   CDS_pept        639803..640102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00644"
FT                   /product="putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00644"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60210"
FT                   /db_xref="InterPro:IPR020037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CFZ6"
FT                   /protein_id="ADF60210.1"
FT                   /translation="MKEQFTTTVRVKGKGDAKARAFADALNHVQAAVMKASPHILLRIE
FT                   PQDVQVVQAQEAVRKEAFLFFFLRRERRTYSVELDVTVNVTAINLDQVDFVTQR"
FT   gene            640125..640901
FT                   /locus_tag="ECL_00645"
FT   CDS_pept        640125..640901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60211"
FT                   /db_xref="GOA:A0A0H3CGD9"
FT                   /db_xref="InterPro:IPR020042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGD9"
FT                   /protein_id="ADF60211.1"
FT                   /translation="MFLIILIKSLIIGGLVGVGVGAGAARMFHAPTTQGMGAFRTLGEL
FT                   NSCEGDPASHFSFGLGFFFNAWASSVAAGAFTQDVDHRIIPNWGAAALMIKNRNVGETL
FT                   HDPRKMAIACGIIGMIVVTFLNLTASSVPAALQVTAVKVLVPAANLLVNTVMPVIFWLA
FT                   AIDAGKKSGFWATIFGGAAQLIMGNAVPGLVLGILIGKGVEESGWNHVTKVMMAAIVLL
FT                   FVLSGFFRGFDMKMIESFHLTVPNWLDMIHNSLSGK"
FT   gene            640915..641556
FT                   /locus_tag="ECL_00646"
FT   CDS_pept        640915..641556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00646"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60212"
FT                   /db_xref="GOA:A0A0H3CI28"
FT                   /db_xref="InterPro:IPR025456"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI28"
FT                   /protein_id="ADF60212.1"
FT                   /translation="MEQNKGFWYADWSFPIFVGLLSSGVFAGTHMYYLYGIGAFNEVAF
FT                   VAMLKAGIDTGVYGAVAAFGASFLFARIIEGSLVGILDIGGAIQTGVGLGVPALLLGAG
FT                   IMFPVTNFIASLITGLVIGLAIGYVIILARKFTINQSNSTYGADVMMGAGNASGRFLGP
FT                   LIILSAMTASIPIGVGSLLGALLFYIWQKPITGGAILGAMILGWLFPVAL"
FT   gene            641599..642732
FT                   /locus_tag="ECL_00647"
FT   CDS_pept        641599..642732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00647"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60213"
FT                   /db_xref="GOA:A0A0H3CEB7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR020043"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEB7"
FT                   /protein_id="ADF60213.1"
FT                   /translation="MFDLLLRRARLSDDTLTDIAILDGKIAATGDIDAPARKTVELNGD
FT                   VFVSAGWIDSHVHCYPNSPIYHDEPDSVGIATGVTTVVDAGSTGADDVDDFYEITRKAS
FT                   TEVFALLNISRVGLIAQNELANMANIDAEAVKQAVKRHPDFIVGLKARMSSSVVGENGI
FT                   TPLERAKAIQKENGDLPLMVHIGNNPPNLDEIAELLSSGDIITHCYNGKPNRILTPSGE
FT                   LRASITSALKRGVRLDVGHGTASFSFEVAKRAIAMGILPHTISSDIYCRNRINGPVGSL
FT                   SSVMSKFLAIGMSLPQVIDCVTANAADGLRLTRKGRIEPGLDADLTLFTLKRQPTVLTD
FT                   AENDSLQAEHILVPLAAIRAGKGYMTEQGSTEHAFDL"
FT   gene            642716..643834
FT                   /locus_tag="ECL_00648"
FT   CDS_pept        642716..643834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00648"
FT                   /product="putative pyridoxal phosphate-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00648"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60214"
FT                   /db_xref="GOA:A0A0H3CF17"
FT                   /db_xref="InterPro:IPR006337"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF17"
FT                   /protein_id="ADF60214.1"
FT                   /translation="MPSIYEKYHLKQVINTSGRMTALGVSTPRPEVVQAAMDGMNHYFE
FT                   MKDLVNKTGEYIAKLLDVEGATVVSCASAGIAQSVAAVLVKDSDWLLENLHVTPIENNE
FT                   IVLPKGHNVNFGAPVGTMVALGGGKLVEAGYANECSADQLAAAITPRTAAILYIKSHHC
FT                   VQKSMLSVEQAAVVARKHDLPLIVDAAAEEDLHTYYRSGADLVIYSGAKAIEGPTSGLV
FT                   IGKTQYVEWVKRQTAGIGRAMKVGKEGILGLTCAIEHYLTATKESGAEMVAKMTPFIDA
FT                   LNTLNGVTARVVWDSAGRDIARTEIKFDEAVTGIGTGELVNALKQGEYAIYFRGYKANE
FT                   GIIEADVRSVNADQLNIVYRRISEVLGQEKKA"
FT   gene            643831..644571
FT                   /locus_tag="ECL_00649"
FT   CDS_pept        643831..644571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00649"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00649"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60215"
FT                   /db_xref="GOA:A0A0H3CG01"
FT                   /db_xref="InterPro:IPR010763"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG01"
FT                   /protein_id="ADF60215.1"
FT                   /translation="MKLTPNFYRDRVCLNVLAGSKANASAIYEAAEGHVLVGVLSKNYP
FT                   DVPSAVADMREYAALIDNALSVGLGAGDPNQSAMVSEISRQVQPQHVNQVFTGVATSRA
FT                   LLGQNDSVVNGLVSPTGTVGMVKISTGPLSSAAPDGIVPVETAIALLKDFGGSSVKYFP
FT                   MGGLKCRDEYLAVAEACARHDFWLEPTGGIDLENYEAILQIALDAGVSKIIPHIYSSII
FT                   DKASGDTRPEDVRTLLAMTKKLVK"
FT   gene            644698..645834
FT                   /locus_tag="ECL_00650"
FT   CDS_pept        644698..645834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00650"
FT                   /product="putative cycloisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60216"
FT                   /db_xref="GOA:A0A0H3CGE4"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGE4"
FT                   /protein_id="ADF60216.1"
FT                   /translation="MHTRTLLVASLSLLANAAIAQPQYAWVGTYNPNGEGLYRFTVDPN
FT                   TGALGDKTLVSQLPNAAQLAVSHDGKTLYLASEVEQGVVQALRIDDNGELSELNQVSSG
FT                   GAGPVYLSLTPNGQHLLVANYVSGSIAVLPIKADGSLGDATDRHQDQGEPGAAKPEAAA
FT                   EGSFAISDHNGPHAHMIAADPSGKYVFSTDLGLDRIYQYRFDDRAGKLTPNDPPFISAS
FT                   SKGAGPRHFVFTPKGDALWLINEEASTLTHYTLDSNGRLKEGKTLSALPEGYKGTSFAA
FT                   GLALSADGKQLYVANRLHNSIGHFTVTAEGTLTHQDDVWTRGDYPRTLTLDKQGRWLYV
FT                   MNQRSDNITRFRVGQDGKLSFESDYTPVGSPSQMVISP"
FT   gene            645854..647763
FT                   /pseudo
FT                   /locus_tag="ECL_00651"
FT                   /note="BglB family transcriptional antiterminator"
FT   gene            647841..648083
FT                   /locus_tag="ECL_00653"
FT   CDS_pept        647841..648083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00653"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00653"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60217"
FT                   /db_xref="GOA:A0A0H3CI31"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI31"
FT                   /protein_id="ADF60217.1"
FT                   /translation="MATLNVRLDDKLKNEAYAVLEKLNITPTEAVRLLFQYVAETGRMP
FT                   VKTVTISDSEDALIQTVRERLANPQKGIKVSLDDL"
FT   gene            648073..648357
FT                   /locus_tag="ECL_00654"
FT   CDS_pept        648073..648357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00654"
FT                   /product="addiction module antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00654"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60218"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC0"
FT                   /protein_id="ADF60218.1"
FT                   /translation="MTYELEFDPRALKEWSKLGETVKKQFKKKLAGVLVNPRIESARLH
FT                   NLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGKREKLTVYHDANKRL"
FT   gene            complement(648361..648825)
FT                   /locus_tag="ECL_00655"
FT   CDS_pept        complement(648361..648825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00655"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60219"
FT                   /db_xref="GOA:A0A0H3CF21"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF21"
FT                   /protein_id="ADF60219.1"
FT                   /translation="MRYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRLNSGM
FT                   PFTAEVEDRIINDLNDTRIKRQGISLSGGDPLHPQNVPEILKLVKRIRRECAGKDIWVW
FT                   TGYKLDELNAQQREVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR"
FT   gene            complement(648948..651086)
FT                   /locus_tag="ECL_00656"
FT   CDS_pept        complement(648948..651086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00656"
FT                   /product="anaerobic ribonucleoside triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00656"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60220"
FT                   /db_xref="GOA:A0A0H3CG06"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG06"
FT                   /protein_id="ADF60220.1"
FT                   /translation="MTPHVMKRDGCKVPFKSERIQEAILRAAKAAGVDDADYCATVADV
FT                   VSRQMNERSQVDISEIQTAVENQLMSGPYKQLARAYIEYRHDRDVQREKRGRLNQEIRG
FT                   LVEQTNSALLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPRDVVSAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLKGMLTHGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEVLAPFVTASFKKHRKTAEEWQIPDADGYAHSRTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGTSWESRLIQQSILRNRISGLGKNRKTAVFPKLVFAIRDGLNH
FT                   KFGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYEDENGEQV
FT                   HDGRNNLGVISLNLPRIALEAKGNEDAFWALLDERLQLARKALMTRIARLEGVKARVAP
FT                   ILYMEGACGVRLKADDDVSEIFKNGRASISLGYIGIHETINALFGNTHMYDSDALREKG
FT                   IAIVQRLRDAVDQWKEETGYGFSLYSTPSENLCDRFCRLDTAEFGIVEGVTDKGYYTNS
FT                   FHLDVEKKVNPYDKIDFEAAYPPIASGGFICYGEYPNIQHNLKALEDVWDYSYQHVPYY
FT                   GTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDAARVSVTRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRVKHLGNGQIG"
FT   gene            complement(651460..653103)
FT                   /locus_tag="ECL_00657"
FT   CDS_pept        complement(651460..653103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00657"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00657"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60221"
FT                   /db_xref="GOA:A0A0H3CGE9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGE9"
FT                   /protein_id="ADF60221.1"
FT                   /translation="MNTLPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVTQRLDYLKTL
FT                   GIDAIWLTPFYISPQVDNGYDVANYTAIDPAYGTLDDFDELVAQAHERGIRIVLDMVFN
FT                   HTSTQHAWFRESLNKASPYRQFYIWRDGTPEQLPNNWRSKFGGNAWRWHAESEQYYLHL
FT                   FAPEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVINLISKDQAFPNDDIGDGRRF
FT                   YTDGPRIHEYLQEMSRDVFTPRNLMTVGEMSSTSLENCQQYASLDGRELSMTFNFHHLK
FT                   VDYPGGEKWTLAKPDFVALKTLFNHWQQGMHNKAWNALFWCNHDQPRIVSRFGDEGEYR
FT                   VPAAKMLGMVLHGMQGTPYIYQGEELGMTNPHFSRITDYRDVESLNMFAELRANGRDPN
FT                   ELLAILASKSRDNGRTPMQWDASHNAGFTEGEPWIGVCDNYETVNARAALDDPDSVFYT
FT                   YQSLIRLRKTLPVLTWGDYQDLQPEHPSLWCYRRQWQGKTLVVVANLSHQSHEWESDVL
FT                   SGEWQAVMSNYPAPHTATLRPFEAVWWLQA"
FT   gene            complement(653155..654576)
FT                   /locus_tag="ECL_00658"
FT   CDS_pept        complement(653155..654576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00658"
FT                   /product="trehalose(maltose)-specific PTS system components
FT                   IIBC"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60222"
FT                   /db_xref="GOA:A0A0H3CI36"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI36"
FT                   /protein_id="ADF60222.1"
FT                   /translation="MMSKVKQADIDQLIVLVGGRENIATVSHCITRLRFVLNDPAKANP
FT                   KAIEALSMVKGCFTNAGQFQVVIGTEVGDYYQALLATTGHNAADKEQAKKAARQNMKWH
FT                   EQLISHFAEIFFPLLPALISGGLILGFRNVIGDVPMSDGKTLAQMYPALKTIYDFLWLI
FT                   GEAIFFYLPVGICWSAVRKMGGTPILGIVLGVTLVSPQLMNAYLLGQQAPEVWNFGLFT
FT                   IAKVGYQAQVIPALLAGLALGFIETRLKRIVPDYLYLVVVPVCSLILAVFLAHAFIGPF
FT                   GRMIGDGVAFAVRHLMTGSFAPIGAALFGFLYAPLVITGVHQTTLAIDMQMIQSLGGTP
FT                   VWPIIALSNIAQASAVTGIILVSRKHNEREISVPAAISAYLGVTEPAMYGINLKYRFPM
FT                   LCAMIGSGLAGLVCGLNGVMANGIGVGGLPGILSIQPAFWQVFALAMAIAIIVPMALTT
FT                   VVYQRKFRQGALQIV"
FT   gene            complement(654701..655648)
FT                   /locus_tag="ECL_00659"
FT   CDS_pept        complement(654701..655648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00659"
FT                   /product="trehalose repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00659"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60223"
FT                   /db_xref="GOA:A0A0H3CEC4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012771"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC4"
FT                   /protein_id="ADF60223.1"
FT                   /translation="MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSERTRERVEAVMNQ
FT                   HGFSPSRSARAMRGQSDKVVAIIVSRLDSLSENLAVQTMLPAFYEQGYDPIMMESQFSP
FT                   QLVEEHLGMLARRNIDGVVLFGFTGIKEEMLKPWQPSLVLLARDAHGFASVCYDDEGAI
FT                   ITLMQRLYEKGHRHISYLGVPHADVTTGKRRHEAYLAFCKKHNLSAVASLPGLGMKQGY
FT                   EQVASVLTPQTTALVCATDTLALGASKYLQEQRIDDLQVASVGSTPLMKFLHPEIITVD
FT                   PGYAESGRQAAAQLIEQINGRAEPRQIVIPVHLS"
FT   gene            656034..658748
FT                   /locus_tag="ECL_00660"
FT   CDS_pept        656034..658748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00660"
FT                   /product="magnesium-transporting ATPase MgtA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60224"
FT                   /db_xref="GOA:A0A0H3CF26"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF26"
FT                   /protein_id="ADF60224.1"
FT                   /translation="MTMFKNITRQLQALLSRHLPHRLVQRDPLPNGKNFSGATIPASLT
FT                   ERCLNVAAMDENEVWRAFNGHPEGLNAAEVQKIRAVHGDNLIPAQKPAPWWVHLWICYR
FT                   NPFNLLLTVLGIISYATEDLFAAGVIALMVGISTLLNFIQEARSTKAADALKAMVSNTA
FT                   TVSRVINDLGENAWVELPIDQLVPGDLVKLAAGDMIPADLRIIQARDLFVAQASLTGES
FT                   LPVEKVARSRDPQQMNPLECDTLCFMGTTVVSGTAQAIVIATGGNTWFGQLAGRVTEQE
FT                   SEPNAFQKGIGRVSMLLIRFMMVMTPIVLLINGYTKGDWWEAALFALSVAVGLTPEMLP
FT                   MIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLENHTDIAG
FT                   KTSERVLHSAWLNSHYQTGLKNLLDVAVLEGVDEESARSLSGRWQKVDEIPFDFERRRM
FT                   SVVVSEQPDVHQLICKGALQEILNVSTQVHYNGDIVPLDDTMLRRIKRVTDNLNRQGLR
FT                   VVAVASKFLPAREGDYQRIDESDLILEGYIAFLDPPKETTAPALKALKASGITVKILTG
FT                   DSELVAAKVCHEVGLDAGDVVVGSDIEHLSDDELAQLARHTTLFARLTPMHKERIVTLL
FT                   RREGHVVGFMGDGINDAPALRAADIGISVDGAVDIAREAADIILLEKSLMVLEEGVIEG
FT                   RRTFANMLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQNLMYDVSQVAIPFD
FT                   NVDDEQIQKAQRWNPADLGRFMLFFGPISSIFDILTFCLMWFVFHANTPEHQTLFQSGW
FT                   FVVGLLSQTLIVHMIRTRRIPFIQSRAAWPLIVMTGIVMALGIALPFSPLASYLQLQAL
FT                   PLSYFPWLVAILAGYMVLTQMVKGFYARRYGWQ"
FT   gene            658926..661310
FT                   /locus_tag="ECL_00661"
FT   CDS_pept        658926..661310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00661"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60225"
FT                   /db_xref="GOA:A0A0H3CG10"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG10"
FT                   /protein_id="ADF60225.1"
FT                   /translation="MLRYSLLTAGLLLGASAFAAPAGDLPLMPWPAKVERPTTQGALVL
FT                   NNQLSVSVSGDDLGDAVNRLRQRIALQTGWTLQPQADKPEKPTIRIAIAKKVKPQPLPD
FT                   SDESYKLTVDANGVDISANTRFGALRAIETLLQLVQNGAENTSVPWVTIEDSPRFPWRG
FT                   LLLDSARHFIPLADIKRQLDGMAAAKLNVLHWHLTDDQGWRFSSKRYPKLTQLASDGLF
FT                   YTPEQMREIVRYAADRAIRVVPEIDMPGHASAIAVAYPALMSAPGPYEMERHWGVLKPV
FT                   LDPTKEATYAFADAMVSELAAIFPDPYLHIGGDEVDDSQWKANPAIQQFMRDHKLADSH
FT                   ALQAYFNRKLETILEKHHRQMVGWDEIYHPDLPKSILIQSWQGQDALGQVAQNGYKGIL
FT                   STGFYLDQPQSTAYHYRNEIVPQALNGVDVIADTDSAQSWAFSMPRLKGKPVEGSFTLV
FT                   KGESGWRGFIDFAGKSRRAVDNIAWRDDNQVTFTVDTWMGETRPVVSVDNDKLTGYFLV
FT                   GNVRYPISGTRLDEVPKGTPPVVPDIAHQVNLLGGEAALWAENVVAPVLDIRLWPRTFA
FT                   VAERLWSAQDVTDVDNMYTRLQAMDSWSTVSVGLQQHTQQQVQFTRLAGNADTLPLQIL
FT                   AQAVEPAQYYTRQHLKFQAGNYHQFEPLNRFADELNAESATVRQMNKWADRLVSDAEDT
FT                   ESADALRHVFNRWQSNTSDALALSENSYQLKAIKPVIQEVDKLASIGLRLTDLVARQGT
FT                   LDDKEIASIQSELDNAAKVQDEVVIAAVYPLETLLRATRNQ"
FT   gene            complement(661400..662854)
FT                   /locus_tag="ECL_00662"
FT   CDS_pept        complement(661400..662854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00662"
FT                   /product="N-acetylglucosamine-binding protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60226"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR041029"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGF4"
FT                   /protein_id="ADF60226.1"
FT                   /translation="MKLSKIALAMATLTVASSALAHGYIESPASRAYMCKLGQNIDCGS
FT                   VQYEPQSVEKTSGFPGGAMPPDGQLASAGIANYSQLDKQSLNAWTKSPMTAGPHEFVWY
FT                   HTAPHKTTNWRYYITKQNWDPNKPLTRDQFELTPFCTVNGNGQAPAMRKAMTCNVPART
FT                   GYQVIYGVWEIADTSNSFYQAIDVDFGNGGNVTPDDGAGIESEWSKVLSGQIAGNNLNV
FT                   GDKVIARFFDAHGEVTSLRTEITIATAAQGDANQWSYDLAQKINTAHQDIRVGVKDEGG
FT                   DISPVHGANSVFVKEDSALQSVAISYEEQKAEVNETIAVSNLHYSKIENGNATVTFHVN
FT                   THGNVDFEAHVMNHHGAEKGYLKQEMNNANQDVTLTLTGVEAGHHMLKYYATNKDGTLF
FT                   AQDVLNLMLEEEAAADNSTGQHDYIFPDNIASYKAGTVVLQPKDGKTYQCKPFPYSGYC
FT                   VQWSKYATQFEPGTGSHWKEAWVLKH"
FT   gene            complement(662986..663372)
FT                   /locus_tag="ECL_00663"
FT   CDS_pept        complement(662986..663372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00663"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60227"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI41"
FT                   /protein_id="ADF60227.1"
FT                   /translation="MTKVLATENAPAAIGPYVQGVDLGSMIITSGQIPVNPKTGEVPAD
FT                   VAAQARQSLENVQAIVESAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNASFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            complement(663447..663908)
FT                   /locus_tag="ECL_00664"
FT   CDS_pept        complement(663447..663908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00664"
FT                   /product="aspartate carbamoyltransferase regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00664"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60228"
FT                   /db_xref="GOA:A0A0H3CEC8"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEC8"
FT                   /protein_id="ADF60228.1"
FT                   /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTETDQRITIG
FT                   LNLPSGEMGRKDLIKIENTFLTDEQVNQLSLYAPDATVNRIDNYDVVGKSRPSLPERIE
FT                   SVLVCPNSNCISHAEPVSSSFAVKKRADDIALKCKYCEKEFSHYVVLAN"
FT   gene            complement(663921..664853)
FT                   /locus_tag="ECL_00665"
FT   CDS_pept        complement(663921..664853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00665"
FT                   /product="aspartate carbamoyltransferase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60229"
FT                   /db_xref="GOA:A0A0H3CF33"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF33"
FT                   /protein_id="ADF60229.1"
FT                   /translation="MNPLYQKHIISINDLSREELELVLETAAKLKANPQPELLKHKVIA
FT                   SCFFEASTRTRLSFETSMHRLGASVVGFSDSSNTSLGKKGETLADTISVISTYVDAIVM
FT                   RHPQEGAARLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNIAMVGDL
FT                   KYGRTVHSLTQALAKFNGNRFFFIAPDALAMPQYILDMLDEKSIPWSLHASIEEVMGNV
FT                   DILYMTRVQKERLDPSEYANVKAQFVLRASDLEGARDNMKVLHPLPRIDEITTDVDKTP
FT                   HAWYFQQAGNGIFARQALLALVLNRELAL"
FT   gene            664972..665106
FT                   /locus_tag="ECL_00666"
FT   CDS_pept        664972..665106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00666"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00666"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60230"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG15"
FT                   /protein_id="ADF60230.1"
FT                   /translation="MSNTLDHASSRQIVGHYTHPDVRIKQFNARFTQCKRFFMNINAF"
FT   gene            complement(665093..665572)
FT                   /locus_tag="ECL_00667"
FT   CDS_pept        complement(665093..665572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00667"
FT                   /product="ArgR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60231"
FT                   /db_xref="GOA:A0A0H3CGF9"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGF9"
FT                   /protein_id="ADF60231.1"
FT                   /translation="MTEYGDYSPKEQLQLTVCQRLIAEKSYLSQEEIRRDLQERGFETI
FT                   SQSTVSRLLKLLGVIKIRNAKGLKIYSLNPLLRPAPDAARTVSEMVVSVEHNSEFILIH
FT                   TVAGYGRAVARILDYHQLPEILGVVAGSSIVWVAPRVVKRTALVHKQINYLLRTH"
FT   gene            complement(665648..667051)
FT                   /locus_tag="ECL_00668"
FT   CDS_pept        complement(665648..667051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00668"
FT                   /product="C4-dicarboxylate anaerobic carrier"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00668"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60232"
FT                   /db_xref="GOA:A0A0H3CI46"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI46"
FT                   /protein_id="ADF60232.1"
FT                   /translation="MGKFKFPSAYTILFFLIAVVAVLTWIIPAGQYHMAMNEALGKDVP
FT                   VAGTYAHVAAHPQGLVSVLMAPIAGLYDPESGQAGAIDVALFILIIGGFLGIVTKTGAI
FT                   DAGIERVTTRLRGREEWMIPILMALFAAGGTIYGMAEESLPFYTLLVPVMLAARFDPVV
FT                   AASTVLLGAGIGTLGSTINPFATVIAANAAGIPFTNGIVLRVALLVIGWIICVAWVMRY
FT                   ARKVRQDPSLSIVADKQEENRAHFLGNKDAQTLEFTPVRKIILVIFALAFAVMIYGVAV
FT                   LGWWMAEISAVFLASAIIVGLIARMSEEELTSTFINGARDLLGVALIIGIARGIVVIMD
FT                   KGMITHTILHSAEGLVSGLSTVAFINVMYWLEVVLSFLVPSSSGLAVLTMPIMAPLADF
FT                   ANVNRDLVVTAYQSASGIVNLVTPTSAVVMGGLAIARVPYVRYLKWVAPLLGILTVVIM
FT                   VALSLGAVL"
FT   gene            complement(667099..668103)
FT                   /locus_tag="ECL_00669"
FT   CDS_pept        complement(667099..668103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00669"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00669"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60233"
FT                   /db_xref="GOA:A0A0H3CED3"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CED3"
FT                   /protein_id="ADF60233.1"
FT                   /translation="MTINLKNRNFLKLLDYTPAEIQYLIDLAIELKAAKKAGREKQTLV
FT                   GKNIALIFEKTSTRTRCAFEVGAFDQGAQVTYLGPSGSQIGHKESMKDTARVLGRMYDG
FT                   IEYRGYGQAIVEELGEYAGVPVWNGLTDEFHPTQILADLMTMLEHSPGKTLPELSFAYL
FT                   GDARNNMGNSLMVGAAKMGMDIRLVAPKSFWPEAGLVEQCRAIAKETGARITLTDDVEE
FT                   GVQGADFLYTDVWVSMGEPKEAWAERVSLMKPYQINAQVMKATGNPNVKFMHCLPAFHN
FT                   EHTKVGREIEMAYGLKGLEVTEEVFESPNSIVFDEAENRMHTIKAVMVATLGD"
FT   gene            complement(668196..669107)
FT                   /locus_tag="ECL_00670"
FT   CDS_pept        complement(668196..669107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00670"
FT                   /product="carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60234"
FT                   /db_xref="GOA:A0A0H3CF37"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF37"
FT                   /protein_id="ADF60234.1"
FT                   /translation="MERKPTLVVALGGNALLKRGEPLEAEIQRKNIDLAARTIAGLTEQ
FT                   WRVVLVHGNGPQVGLLALQNSAYDKVAPYPLDVLGAESQGMIGYMLQQALKNSLPQREV
FT                   SVLLTQVEVDAADPAFSNPTKYIGPVYSEAQAKTLQAEKGWVFKADGSYFRRVVPSPQP
FT                   KRIVESDAIAALIQRDHLVICNGGGGVPVVENANGYHGIEAVIDKDLSAALLARQIEAD
FT                   ALLILTDADAVYLDWGKPTQRPLAQVTPELLKGMAFDAGSMGPKVAACREFVEACNGIA
FT                   GIGALADGAEILAGEKGTLIRN"
FT   gene            complement(669117..670337)
FT                   /locus_tag="ECL_00671"
FT   CDS_pept        complement(669117..670337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00671"
FT                   /product="arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60235"
FT                   /db_xref="GOA:A0A0H3CG20"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG20"
FT                   /protein_id="ADF60235.1"
FT                   /translation="MEKHYVGSEIGQLRSVMLHRPNLSLKRLTPSNCQELLFDDVLSVE
FT                   RAGEEHDIFANTLREQGVEVLLLTDLLTQTLDIAEAKAWLLETQISDYRLGPTFASDVR
FT                   GWLADMPHRELARRLSGGLTYGEIPAAIKNMVVDTHTANDFIMKPLPNHLFTRDTSCWI
FT                   YNGVSINPMAKPARQRETNNLRAIYRWHPAFADGEFIKYFGDENINYDHATLEGGDVLV
FT                   IGRGAVLIGMSERTTPQGVEFLANSLFKHRQAERVIAVELPKHRSCMHLDTVMTHIDVD
FT                   TFSVYPEVVRKDAQCWTLTPDGRGGLLRTQETDLLHAIEKALGINQVRLITTGGDAFEA
FT                   EREQWNDANNVLTIRPGVVIGYERNVWTNEKYDKAGITVLPIPGDELGRGRGGARCMSC
FT                   PLERDGI"
FT   gene            671010..671462
FT                   /locus_tag="ECL_00672"
FT   CDS_pept        671010..671462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00672"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00672"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60236"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGG4"
FT                   /protein_id="ADF60236.1"
FT                   /translation="MIIGNIHHLQAWLPEPLRLAIEHVKAHVTDATPPGKHDINGNNLF
FT                   YLVSEDMTQPFAERRAEYHARYLDIQIVLKGQEGMTFSTLPHGTPDTDWLADKDIAFLP
FT                   EGEQEKTVVLSEGDFVVFWPGEVHKPLCAVGAPAKVRKVVVKMLVE"
FT   gene            671675..672583
FT                   /locus_tag="ECL_00673"
FT   CDS_pept        671675..672583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00673"
FT                   /product="putative dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00673"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60237"
FT                   /db_xref="GOA:A0A0H3CI50"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI50"
FT                   /protein_id="ADF60237.1"
FT                   /translation="MPQSALFTGIIPPVSTIFTADGQLDKQGTAALIDDLIAAGVDGLF
FT                   FLGSGGEFSQLSAEERKTIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADG
FT                   IVVINPYYWKVSEANLIRYFEQVADSVTLPVILYNFPALTGQDLTPALVKILADSRSNI
FT                   VGIKDTIDSVAHLRSMIHTVKAAHPHFTVLCGYDDHLFNILLLGGDGAISASGNFAPQV
FT                   SVNLLKAWRDKDVAKAAEYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPISTHVLPPA
FT                   SALDEPRKAQLKTLLQQLKLC"
FT   gene            672598..674565
FT                   /locus_tag="ECL_00674"
FT   CDS_pept        672598..674565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00674"
FT                   /product="phage predicted dehydratase"
FT                   /note="similar to CP4-6 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00674"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60238"
FT                   /db_xref="GOA:A0A0H3CED8"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR017798"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CED8"
FT                   /protein_id="ADF60238.1"
FT                   /translation="MTIEKIFTPQDDAFYAVITHAAGPQGALPLTPQMLMESPSGNLFG
FT                   MTQNAGMGWDANKLTGKEVLIIGTQGGIRAGDGRPVALGYHTGHWEIGMQMQAAAKEIT
FT                   RNGGIPFAAFVSDPCDGRSQGTHGMFDSLPYRNDAAIVFRRLIRSLPTRRAVIGVATCD
FT                   KGLPATMIALASMHNLPTILVPGGATLPPTVGEDAGKVQTIGARFANHELSLQEAAELG
FT                   CRACASPGGGCQFLGTAGTSQVVAEALGLALPHSALAPSGQAVWLEIARQSARAVSELD
FT                   NRGITTRDILTDKAIENAMVIHAAFGGSTNLLLHIPAIAHAAGCTIPDVEHWTRVNRRV
FT                   PRLVSVLPNGPDYHPTVRAFLAGGVPEVMLHLRDLGLLHLDAMTVTGQTVGENLDWWQA
FT                   SERRKRFRQCLREQDGVDPDDVILPPEKAKARGLTSTVCFPTGNIAPEGSVIKATAIDP
FT                   SVVGADGVYRHTGRARVFVSEAQAIKAIKQEEIKQGDIMVVIGGGPSGTGMEETYQLTS
FT                   ALKHISWGKTVSLITDARFSGVSTGACFGHVSPEALAGGPIGKLRDNDIIEIAVDRLTL
FT                   TGSVNFIGTAENPLTPEEGARELAVRQTHPDLHPHDFLPDDTRLWAALQSVSGGTWKGC
FT                   IYDTDKIIEVINAGKKALGL"
FT   gene            674790..676172
FT                   /locus_tag="ECL_00675"
FT   CDS_pept        674790..676172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00675"
FT                   /product="phage predicted sugar transporter"
FT                   /note="similar to CP4-6 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60239"
FT                   /db_xref="GOA:A0A0H3CF41"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF41"
FT                   /protein_id="ADF60239.1"
FT                   /translation="MMQLTMKDKIGYGLGDTACGFVWQATMFLLAYFYTDVFGLSAGIM
FT                   GTLFLVSRVLDAVTDPLMGLLVDRTRTRYGQFRPFLLWGAIPFGIVCMLTFYTPDFSAQ
FT                   GKIIYACVTYILLTLVYTFVNVPYCAMPGVITADPKERHALQSWRFFLAAAGSLAISGI
FT                   ALPLVSIIGKGDEQVGYFGAMCVLGLTGVVLLYVCFFTTKERYTFEVQPGSSVAKDLKL
FT                   LLGNGQWRIMCAFKMMATCSNVVRGGATLYFVKYVMDHPEMATQFLLYGSLATMFGSLC
FT                   SSRLLGRFDRVKAFKWIIVAYSLISLLIFVTPAEHIALIFALNILFLFVFNTTTPLQWL
FT                   MASDVVDYEESRSGRRLDGLVFSTYLFSLKIGLAIGGAVVGWILAYVNYSASSSVQPVE
FT                   VLTTIKILFCVVPVVLYVGMFIMLSFYKLTDARVEAISQQLIKHRAAQGEAVPDAATAA
FT                   SH"
FT   gene            676184..677794
FT                   /locus_tag="ECL_00676"
FT   CDS_pept        676184..677794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00676"
FT                   /product="phage predicted xylosidase/arabinosidase"
FT                   /note="similar to CP4-6 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00676"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60240"
FT                   /db_xref="GOA:A0A0H3CG25"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG25"
FT                   /protein_id="ADF60240.1"
FT                   /translation="MEITNPILTGFNPDPSLCRQGEDYYIATSTFEWFPGVRIYHSRDL
FT                   KNWSLVSTPLDRVSMLDMKGNPDSGGIWAPCLSYADGKFWLLYTDVKIVDSPWKNGRNF
FT                   LVTAPSIEGPWSDPIPMGNGGFDPSLFHDDDGRKYYLYRPWGPRHHSNPHNTIVMQEFD
FT                   PQTGTLSPERKTLFTGTPLCYTEGAHLYRHAGWYYLMVAEGGTSYEHAVVVLRSKTIDG
FT                   PYELHPDVTMMTSWHLPENPLQKSGHGSLLQTHTGEWYMAYLTSRPLRLPGVPLLASGG
FT                   RGYCPLGRETGIARIEWRDGWPYVEGGKHAQLTVKGPQVAEQPASIQGNWREDFDGSTL
FT                   DPELQTLRIPFDDTLGSLTARPGYLRLYGNDSLNSTFTQSTVARRWQHFTFRSETRMQF
FT                   SPVHFQQSAGLTCYYNSKNWSYCFVDYEEGKGRTIKVIQLDHNVPSWPLHEQPIPVPES
FT                   AESIWLRVDVDTLVYRYSYSFDGETWHTVPVTFEAWKLSDDYIGGRGFFTGAFVGLHCE
FT                   DISGDGCHADFDYFTYEPV"
FT   gene            complement(677799..678557)
FT                   /locus_tag="ECL_00677"
FT   CDS_pept        complement(677799..678557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00677"
FT                   /product="phage predicted DNA-binding transcriptional
FT                   regulator"
FT                   /note="similar to CP4-6 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00677"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60241"
FT                   /db_xref="GOA:A0A0H3CGG8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGG8"
FT                   /protein_id="ADF60241.1"
FT                   /translation="MPIIQSVERALQILDLFNEQATELKITDISKMMGLSKSTLHSLLK
FT                   TLQLHGYIDQNPENGKYRLGMKLVERGHFVVGSIDIRQKAKGWLTELSQRTGQTTHLGI
FT                   LDGREGVYIEKIEGKLAAIAYSRIGRRLPVHATAIGKVLIAWLGETELNALLEGYQYTT
FT                   YTPSTLASREALMAALAQTREQGYALDSEENEQGVRCVAVPVWNHESRVIAALSLSTLT
FT                   SRVDDAGLANFREQLQQAGLQLSRALGYPA"
FT   gene            complement(678728..679732)
FT                   /locus_tag="ECL_00678"
FT   CDS_pept        complement(678728..679732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00678"
FT                   /product="phage ornithine carbamoyltransferase 2, chain F"
FT                   /note="similar to CP4-6 prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00678"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60242"
FT                   /db_xref="GOA:A0A0H3CI55"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI55"
FT                   /protein_id="ADF60242.1"
FT                   /translation="MSDLYKKHFLKLLDFTPAQFTSLLTLAAQLKADKKNGKEVQKLTG
FT                   KNIALIFEKDSTRTRCSFEVAAFDQGARVTYLGPSGSQIGHKESIKDTARVLGRMYDGI
FT                   QYRGHGQEVVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKAFNEMTLVYAG
FT                   DARNNMGNSMLEAAALTGLDLRLVAPKACWPEESLVAECSALAQKHGGKITLTEDVAAG
FT                   VKGADFIYTDVWVSMGEAKEKWAERIALLRGYQVNAQMMALTGNPNVKFLHCLPAFHDD
FT                   QTTLGKQMAKEFDLHGGMEVTDEVFESAASIVFDQAENRMHTIKAVMVATLGG"
FT   gene            679897..680322
FT                   /locus_tag="ECL_00679"
FT   CDS_pept        679897..680322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00679"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00679"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60243"
FT                   /db_xref="GOA:A0A0H3CEE1"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEE1"
FT                   /protein_id="ADF60243.1"
FT                   /translation="MANPEHLEEQREETRLIIEELLEDGSDPDALYTIEHHFSADDFDA
FT                   LEKMAVEAFKLGYEVTEPEELEVEEGDTVICCDILSEGALKAELIDAQVEQLMNLAEKF
FT                   DVEYDGWGTYFEDPNGEDGEEGDDEDYVDEDDDGVRH"
FT   gene            680369..681127
FT                   /locus_tag="ECL_00680"
FT   CDS_pept        680369..681127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00680"
FT                   /product="tRNA--hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60244"
FT                   /db_xref="GOA:A0A0H3CF44"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR010386"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF44"
FT                   /protein_id="ADF60244.1"
FT                   /translation="MDYPQILAPVLNFLQCPTPQAWIDKARDPANLPLLLTDHMVCELK
FT                   AAQTALLLVRKYVADESGADALLDWLKPYEQFTFRDGPEPDFIALHRQIGKSVMPKTDD
FT                   PWGQALIDSMVLLIKEELHHFWQVREAMLARDIPYVKITASRYAKGMLKEVRTHEPLTL
FT                   IDKLICGAYIEARSCERFAALAPFLDDDLQKFYLSLLRSEARHYQDYLTLAQQVSDDDI
FT                   SPRIKLFGEIEATLISTPDNEFRFHSGVLV"
FT   gene            681158..681880
FT                   /locus_tag="ECL_00681"
FT   CDS_pept        681158..681880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00681"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60245"
FT                   /db_xref="GOA:A0A0H3CG30"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG30"
FT                   /protein_id="ADF60245.1"
FT                   /translation="MNKTWTRIVIVVIAAAAVAFWVFFDRQRAPERQMDNALNAMPAWQ
FT                   VIKEQEPALHQRILDQMAALQKAGEPEQQIIDTIQPQILHLQMTRLQNAPDANVVNYMT
FT                   INMEQTAAIQKVSDDACFRFLYPMVKGGINPMRMLDKDLMARRMQADADMMRAAYGKNR
FT                   HIVTQAEREAAVEDVRPIMKALADKYGEDIQLLQMPEKAVGKEKLSCDMVQEMWAKVLA
FT                   LPEQKAARVIRLAVSELD"
FT   gene            681986..682070
FT                   /locus_tag="ECL_tRNA013"
FT   tRNA            681986..682070
FT                   /locus_tag="ECL_tRNA013"
FT                   /product="tRNA-Leu"
FT   gene            682285..683406
FT                   /locus_tag="ECL_00682"
FT   CDS_pept        682285..683406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00682"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00682"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60246"
FT                   /db_xref="GOA:A0A0H3CGH4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGH4"
FT                   /protein_id="ADF60246.1"
FT                   /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKYG
FT                   SMEVPEVKRLKSLEEENARLKKLLAEAMLDKEAASGGSWAKVLTTDQKREAVMLMCDAT
FT                   GLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRITELALERRRFGYRRIWQLLRREGL
FT                   HVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVMDALSTGRRI
FT                   KCLTCVDDFTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQGPEFTCRALDQ
FT                   WAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDIVHARKIINDWRQDYNE
FT                   CRPHSTLNYQTPSEFAAGWRKGHSENEDSDVTN"
FT   gene            683567..683791
FT                   /locus_tag="ECL_00683"
FT   CDS_pept        683567..683791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00683"
FT                   /product="putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00683"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI62"
FT                   /protein_id="ADF60247.1"
FT                   /translation="MARGAMGESGLWSDDAIERQLSHSERNNVRAAYIHTSEHLDERRL
FT                   MVQWWADYLKANESKAVTPYDFAKINKKN"
FT   gene            complement(683846..684856)
FT                   /locus_tag="ECL_00684"
FT   CDS_pept        complement(683846..684856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00684"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00684"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60248"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEE5"
FT                   /protein_id="ADF60248.1"
FT                   /translation="MTYITRESNETSTIKCEGKMKRNIRVIPKNVYSKLKRLGNTVVAG
FT                   TSIAITESQLKNGMLEHLGIYYDNGVNAYEASVIPDPLQGKYSLKNVFGEEIVRRDLPK
FT                   ETHYTEIESPNWGDSSNGTHTVRLPHEKYPRDIIPPKLIAIEINHKQSSGSHFIFNFRV
FT                   TRILEKKSSTFDDDLLFDLNLLQENLGKCGVENADKPISTYADTLIVSWDIFPPGSKEE
FT                   VLSRIFRGKNITPDKKNVAENRYDFFMSLEPKKIVTGNSTFSNYLGAMLEDDLVVFENI
FT                   EYGNAIYILYDNWDEISKLSRIDLLSGRAGNNFDRIIHSGNWKDEVRKKVATGRL"
FT   gene            685382..685939
FT                   /locus_tag="ECL_00685"
FT   CDS_pept        685382..685939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00685"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60249"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF48"
FT                   /protein_id="ADF60249.1"
FT                   /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLDD
FT                   EAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVPLR
FT                   CPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRIWRK
FT                   LHLAVDSKTHEIICADLSDVAP"
FT   gene            685988..686383
FT                   /locus_tag="ECL_00686"
FT   CDS_pept        685988..686383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00686"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00686"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60250"
FT                   /db_xref="GOA:A0A0H3CNJ0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CNJ0"
FT                   /protein_id="ADF60250.1"
FT                   /translation="MSNTNTNFEMTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSHV
FT                   ARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTMEV
FT                   EILKEAVEYGQSRKWIAHAPLLPKDGE"
FT   gene            686386..686934
FT                   /locus_tag="ECL_00687"
FT   CDS_pept        686386..686934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00687"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00687"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60251"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGH7"
FT                   /protein_id="ADF60251.1"
FT                   /translation="MVSRTMGVSRAQLSLRINRSADWQDRRCNRRNEEADAEILSAILN
FT                   IISDMPSYGYRRVWGILRKQRRTEGQPPVNAKRLYRIMSEHNLLLLHHKPERPKREHKG
FT                   KIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAASTGGYDSSTVQDVML
FT                   RSVEKRFGDRLPRHRRCSG"
FT   gene            687246..687704
FT                   /locus_tag="ECL_00688"
FT   CDS_pept        687246..687704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00688"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00688"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60252"
FT                   /db_xref="GOA:A0A0H3CI68"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI68"
FT                   /protein_id="ADF60252.1"
FT                   /translation="MAGQDHCADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRL
FT                   CHDELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAE
FT                   TAMYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
FT   gene            complement(687764..688843)
FT                   /locus_tag="ECL_00689"
FT   CDS_pept        complement(687764..688843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00689"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00689"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60253"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CEE9"
FT                   /protein_id="ADF60253.1"
FT                   /translation="MNVGHLNFFKVNKCGLYKVNDDNTYGLELSETFDLIQNWVGTKSL
FT                   ALTIPWDPKEKPNRSKCYCKDIYKDANTGDFLIMLWKSDTDSTGSLLGASEDGEIGSSS
FT                   VVKYTNSYKGKKVIWGRPCFYWIIPEIETIVSIKFDHSVCDSELFQDYVHASITNRVKH
FT                   SKRVKNKTEKGYIRLSNTDDEDLYKYMYRFDMKLRSLETTHTELGKLVPKITHIVRRET
FT                   IIINPNDARADWLKTFSTLVPFVSGKKNTRTRQIEIKAEAKPSLKEVKEIIEKYSAEDR
FT                   EKRLWDNVGFATDKGITWVDKYRMRDIINIPSEDYSTYSAAYIYEQISHKRKEFISPIL
FT                   KELKALQSQSRKKKASGED"
FT   gene            complement(689251..689814)
FT                   /locus_tag="ECL_00690"
FT   CDS_pept        complement(689251..689814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00690"
FT                   /product="phage polarity suppression protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60254"
FT                   /db_xref="InterPro:IPR010006"
FT                   /db_xref="InterPro:IPR038395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CF51"
FT                   /protein_id="ADF60254.1"
FT                   /translation="MTTLTLQKAFEACQANKSAWLQRRDELKQAEQAYREQLAGNDHSG
FT                   RSLQTLREIIDVKKWEINQAAGRYIRSHEEVQRISIRNRLNDFMQAHGAELAAALAPEL
FT                   MNYSGQHAAIQRCAMQHSLDYLREALLVWLTAGEKINYSVQDYDILTAIGFRPDAASRD
FT                   DCREKFTPAQNLNYTRRRAELAAQ"
FT   gene            complement(689843..690061)
FT                   /locus_tag="ECL_00691"
FT   CDS_pept        complement(689843..690061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00691"
FT                   /product="bacteriophage gene regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60255"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CG41"
FT                   /protein_id="ADF60255.1"
FT                   /translation="MFHCPFCKTSAHARTSRYLSENVKQRYHQCVNVECSATFRTLESV
FT                   DGIIRSPVTEPVTPVPAPAATVNRAGA"
FT   gene            complement(690064..690807)
FT                   /locus_tag="ECL_00692"
FT   CDS_pept        complement(690064..690807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00692"
FT                   /product="putative phage capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00692"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60256"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CGI1"
FT                   /protein_id="ADF60256.1"
FT                   /translation="MKPETVITDLQNVAAQQSAESSQRITDKLSAFTAARDTHAASMQE
FT                   LKEIDTSIERCKQERQTALSESAEAEQDWRSRFRTLRGNLTPEMKAEHSRRIASRELAD
FT                   EFTGLIAELETDRTRAMLNACSTASKYLSAHDDAFTTYAGAEWAQAVNTLPAALIRAFL
FT                   LRIRALEMQGDSAPQSVAIGELRDALSRQGSLYHFDMKQEPVLSVTGMHRPQINGVDME
FT                   LLRSPVKRMMLARKLAGNGETKAEV"
FT   gene            690852..691025
FT                   /locus_tag="ECL_00693"
FT   CDS_pept        690852..691025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00693"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00693"
FT                   /db_xref="EnsemblGenomes-Tr:ADF60257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CI71"
FT                   /protein_id="ADF60257.1"
FT                   /translation="MTQHLDSLQLWQFWHKHHLKPGLPEKGLSKTLLIVCFFTDNCSPL
FT                   FTINKNISNTVS"
FT   gene            691347..691613
FT                   /locus_tag="ECL_00694"
FT   CDS_pept        691347..691613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECL_00694"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:ECL_00694"
FT                   /db_xref="Ensemb