(data stored in ACNUC13767 zone)

EMBL: CP001936

ID   CP001936; SV 1; circular; genomic DNA; STD; PRO; 2451061 BP.
XX
AC   CP001936; ACVH01000000-ACVH01000111;
XX
PR   Project:PRJNA33157;
XX
DT   26-FEB-2010 (Rel. 103, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Thermoanaerobacter italicus Ab9, complete genome.
XX
KW   .
XX
OS   Thermoanaerobacter italicus Ab9
OC   Bacteria; Firmicutes; Clostridia; Thermoanaerobacterales;
OC   Thermoanaerobacteraceae; Thermoanaerobacter.
XX
RN   [1]
RP   1-2451061
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Hemme C.L., Woyke T.;
RT   "Complete sequence of Thermoanaerobacter italicus Ab9";
RL   Unpublished.
XX
RN   [2]
RP   1-2451061
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Cheng J.-F., Bruce D., Goodwin L.,
RA   Pitluck S., Chertkov O., Detter J.C., Han C., Tapia R., Land M., Hauser L.,
RA   Kyrpides N., Mikhailova N., Hemme C.L., Woyke T.;
RT   ;
RL   Submitted (12-FEB-2010) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; edda95209ac009eae7ead554c32fc4d6.
DR   BioSample; SAMN02598495.
DR   EnsemblGenomes-Gn; EBG00001099439.
DR   EnsemblGenomes-Gn; EBG00001099440.
DR   EnsemblGenomes-Gn; EBG00001099441.
DR   EnsemblGenomes-Gn; EBG00001099442.
DR   EnsemblGenomes-Gn; EBG00001099443.
DR   EnsemblGenomes-Gn; EBG00001099444.
DR   EnsemblGenomes-Gn; EBG00001099445.
DR   EnsemblGenomes-Gn; EBG00001099446.
DR   EnsemblGenomes-Gn; EBG00001099447.
DR   EnsemblGenomes-Gn; EBG00001099448.
DR   EnsemblGenomes-Gn; EBG00001099449.
DR   EnsemblGenomes-Gn; EBG00001099450.
DR   EnsemblGenomes-Gn; EBG00001099451.
DR   EnsemblGenomes-Gn; EBG00001099452.
DR   EnsemblGenomes-Gn; EBG00001099453.
DR   EnsemblGenomes-Gn; EBG00001099454.
DR   EnsemblGenomes-Gn; EBG00001099455.
DR   EnsemblGenomes-Gn; EBG00001099456.
DR   EnsemblGenomes-Gn; EBG00001099457.
DR   EnsemblGenomes-Gn; EBG00001099458.
DR   EnsemblGenomes-Gn; EBG00001099459.
DR   EnsemblGenomes-Gn; EBG00001099460.
DR   EnsemblGenomes-Gn; EBG00001099461.
DR   EnsemblGenomes-Gn; EBG00001099462.
DR   EnsemblGenomes-Gn; EBG00001099463.
DR   EnsemblGenomes-Gn; EBG00001099464.
DR   EnsemblGenomes-Gn; EBG00001099465.
DR   EnsemblGenomes-Gn; EBG00001099466.
DR   EnsemblGenomes-Gn; EBG00001099467.
DR   EnsemblGenomes-Gn; EBG00001099468.
DR   EnsemblGenomes-Gn; EBG00001099469.
DR   EnsemblGenomes-Gn; EBG00001099470.
DR   EnsemblGenomes-Gn; EBG00001099471.
DR   EnsemblGenomes-Gn; EBG00001099472.
DR   EnsemblGenomes-Gn; EBG00001099473.
DR   EnsemblGenomes-Gn; EBG00001099474.
DR   EnsemblGenomes-Gn; EBG00001099475.
DR   EnsemblGenomes-Gn; EBG00001099476.
DR   EnsemblGenomes-Gn; EBG00001099477.
DR   EnsemblGenomes-Gn; EBG00001099478.
DR   EnsemblGenomes-Gn; EBG00001099479.
DR   EnsemblGenomes-Gn; EBG00001099480.
DR   EnsemblGenomes-Gn; EBG00001099481.
DR   EnsemblGenomes-Gn; EBG00001099482.
DR   EnsemblGenomes-Gn; EBG00001099483.
DR   EnsemblGenomes-Gn; EBG00001099484.
DR   EnsemblGenomes-Gn; EBG00001099485.
DR   EnsemblGenomes-Gn; EBG00001099486.
DR   EnsemblGenomes-Gn; EBG00001099487.
DR   EnsemblGenomes-Gn; EBG00001099488.
DR   EnsemblGenomes-Gn; EBG00001099489.
DR   EnsemblGenomes-Gn; EBG00001099490.
DR   EnsemblGenomes-Gn; EBG00001099491.
DR   EnsemblGenomes-Gn; EBG00001099492.
DR   EnsemblGenomes-Gn; EBG00001099493.
DR   EnsemblGenomes-Gn; EBG00001099494.
DR   EnsemblGenomes-Gn; EBG00001099495.
DR   EnsemblGenomes-Gn; EBG00001099496.
DR   EnsemblGenomes-Gn; EBG00001099497.
DR   EnsemblGenomes-Gn; EBG00001099498.
DR   EnsemblGenomes-Gn; EBG00001099499.
DR   EnsemblGenomes-Gn; EBG00001099500.
DR   EnsemblGenomes-Gn; EBG00001099501.
DR   EnsemblGenomes-Gn; EBG00001099502.
DR   EnsemblGenomes-Gn; EBG00001099503.
DR   EnsemblGenomes-Gn; EBG00001099504.
DR   EnsemblGenomes-Gn; EBG00001099505.
DR   EnsemblGenomes-Gn; EBG00001099506.
DR   EnsemblGenomes-Gn; EBG00001099507.
DR   EnsemblGenomes-Gn; EBG00001099508.
DR   EnsemblGenomes-Gn; EBG00001099509.
DR   EnsemblGenomes-Gn; EBG00001099510.
DR   EnsemblGenomes-Gn; EBG00001099511.
DR   EnsemblGenomes-Gn; EBG00001099512.
DR   EnsemblGenomes-Gn; EBG00001099513.
DR   EnsemblGenomes-Gn; EBG00001099514.
DR   EnsemblGenomes-Gn; EBG00001099515.
DR   EnsemblGenomes-Gn; EBG00001099516.
DR   EnsemblGenomes-Gn; EBG00001099517.
DR   EnsemblGenomes-Gn; EBG00001099518.
DR   EnsemblGenomes-Gn; EBG00001099519.
DR   EnsemblGenomes-Gn; EBG00001099520.
DR   EnsemblGenomes-Gn; EBG00001099521.
DR   EnsemblGenomes-Gn; EBG00001099522.
DR   EnsemblGenomes-Gn; EBG00001099523.
DR   EnsemblGenomes-Gn; EBG00001099524.
DR   EnsemblGenomes-Gn; EBG00001099525.
DR   EnsemblGenomes-Gn; EBG00001099526.
DR   EnsemblGenomes-Gn; EBG00001099527.
DR   EnsemblGenomes-Gn; EBG00001099528.
DR   EnsemblGenomes-Gn; EBG00001099529.
DR   EnsemblGenomes-Gn; EBG00001099530.
DR   EnsemblGenomes-Gn; EBG00001099531.
DR   EnsemblGenomes-Gn; EBG00001099532.
DR   EnsemblGenomes-Gn; EBG00001099533.
DR   EnsemblGenomes-Gn; EBG00001099534.
DR   EnsemblGenomes-Gn; EBG00001099535.
DR   EnsemblGenomes-Gn; EBG00001099536.
DR   EnsemblGenomes-Gn; EBG00001099537.
DR   EnsemblGenomes-Gn; EBG00001099538.
DR   EnsemblGenomes-Gn; EBG00001099539.
DR   EnsemblGenomes-Gn; EBG00001099540.
DR   EnsemblGenomes-Gn; EBG00001099541.
DR   EnsemblGenomes-Gn; EBG00001099542.
DR   EnsemblGenomes-Gn; EBG00001099543.
DR   EnsemblGenomes-Gn; EBG00001099544.
DR   EnsemblGenomes-Gn; EBG00001099545.
DR   EnsemblGenomes-Gn; EBG00001099546.
DR   EnsemblGenomes-Gn; EBG00001099547.
DR   EnsemblGenomes-Gn; EBG00001099548.
DR   EnsemblGenomes-Gn; EBG00001099549.
DR   EnsemblGenomes-Gn; EBG00001099550.
DR   EnsemblGenomes-Gn; EBG00001099551.
DR   EnsemblGenomes-Gn; EBG00001099552.
DR   EnsemblGenomes-Gn; EBG00001099553.
DR   EnsemblGenomes-Gn; EBG00001099554.
DR   EnsemblGenomes-Gn; EBG00001099555.
DR   EnsemblGenomes-Gn; EBG00001099556.
DR   EnsemblGenomes-Gn; EBG00001099557.
DR   EnsemblGenomes-Gn; EBG00001099558.
DR   EnsemblGenomes-Gn; EBG00001099559.
DR   EnsemblGenomes-Gn; EBG00001099560.
DR   EnsemblGenomes-Gn; EBG00001099561.
DR   EnsemblGenomes-Gn; EBG00001099562.
DR   EnsemblGenomes-Gn; EBG00001099563.
DR   EnsemblGenomes-Gn; EBG00001099564.
DR   EnsemblGenomes-Gn; EBG00001099565.
DR   EnsemblGenomes-Gn; EBG00001099566.
DR   EnsemblGenomes-Gn; EBG00001099567.
DR   EnsemblGenomes-Gn; EBG00001099568.
DR   EnsemblGenomes-Gn; EBG00001099569.
DR   EnsemblGenomes-Gn; EBG00001099570.
DR   EnsemblGenomes-Gn; EBG00001099571.
DR   EnsemblGenomes-Gn; EBG00001099572.
DR   EnsemblGenomes-Gn; EBG00001099573.
DR   EnsemblGenomes-Gn; EBG00001099574.
DR   EnsemblGenomes-Gn; EBG00001099575.
DR   EnsemblGenomes-Gn; EBG00001099576.
DR   EnsemblGenomes-Gn; EBG00001099577.
DR   EnsemblGenomes-Gn; EBG00001099578.
DR   EnsemblGenomes-Gn; EBG00001099579.
DR   EnsemblGenomes-Gn; EBG00001099580.
DR   EnsemblGenomes-Gn; EBG00001099581.
DR   EnsemblGenomes-Gn; EBG00001099582.
DR   EnsemblGenomes-Gn; EBG00001099583.
DR   EnsemblGenomes-Gn; EBG00001099584.
DR   EnsemblGenomes-Gn; EBG00001099585.
DR   EnsemblGenomes-Gn; EBG00001099586.
DR   EnsemblGenomes-Gn; EBG00001099587.
DR   EnsemblGenomes-Gn; EBG00001099588.
DR   EnsemblGenomes-Gn; EBG00001099589.
DR   EnsemblGenomes-Gn; EBG00001099590.
DR   EnsemblGenomes-Gn; EBG00001099591.
DR   EnsemblGenomes-Gn; EBG00001099592.
DR   EnsemblGenomes-Gn; EBG00001099593.
DR   EnsemblGenomes-Gn; EBG00001099594.
DR   EnsemblGenomes-Gn; EBG00001099595.
DR   EnsemblGenomes-Gn; EBG00001099596.
DR   EnsemblGenomes-Gn; Thit_R0001.
DR   EnsemblGenomes-Gn; Thit_R0002.
DR   EnsemblGenomes-Gn; Thit_R0003.
DR   EnsemblGenomes-Gn; Thit_R0004.
DR   EnsemblGenomes-Gn; Thit_R0005.
DR   EnsemblGenomes-Gn; Thit_R0006.
DR   EnsemblGenomes-Gn; Thit_R0007.
DR   EnsemblGenomes-Gn; Thit_R0008.
DR   EnsemblGenomes-Gn; Thit_R0009.
DR   EnsemblGenomes-Gn; Thit_R0010.
DR   EnsemblGenomes-Gn; Thit_R0011.
DR   EnsemblGenomes-Gn; Thit_R0012.
DR   EnsemblGenomes-Gn; Thit_R0013.
DR   EnsemblGenomes-Gn; Thit_R0014.
DR   EnsemblGenomes-Gn; Thit_R0015.
DR   EnsemblGenomes-Gn; Thit_R0016.
DR   EnsemblGenomes-Gn; Thit_R0017.
DR   EnsemblGenomes-Gn; Thit_R0018.
DR   EnsemblGenomes-Gn; Thit_R0019.
DR   EnsemblGenomes-Gn; Thit_R0020.
DR   EnsemblGenomes-Gn; Thit_R0021.
DR   EnsemblGenomes-Gn; Thit_R0022.
DR   EnsemblGenomes-Gn; Thit_R0023.
DR   EnsemblGenomes-Gn; Thit_R0024.
DR   EnsemblGenomes-Gn; Thit_R0025.
DR   EnsemblGenomes-Gn; Thit_R0026.
DR   EnsemblGenomes-Gn; Thit_R0027.
DR   EnsemblGenomes-Gn; Thit_R0028.
DR   EnsemblGenomes-Gn; Thit_R0029.
DR   EnsemblGenomes-Gn; Thit_R0030.
DR   EnsemblGenomes-Gn; Thit_R0031.
DR   EnsemblGenomes-Gn; Thit_R0032.
DR   EnsemblGenomes-Gn; Thit_R0033.
DR   EnsemblGenomes-Gn; Thit_R0034.
DR   EnsemblGenomes-Gn; Thit_R0035.
DR   EnsemblGenomes-Gn; Thit_R0036.
DR   EnsemblGenomes-Gn; Thit_R0037.
DR   EnsemblGenomes-Gn; Thit_R0038.
DR   EnsemblGenomes-Gn; Thit_R0039.
DR   EnsemblGenomes-Gn; Thit_R0040.
DR   EnsemblGenomes-Gn; Thit_R0041.
DR   EnsemblGenomes-Gn; Thit_R0042.
DR   EnsemblGenomes-Gn; Thit_R0043.
DR   EnsemblGenomes-Gn; Thit_R0044.
DR   EnsemblGenomes-Gn; Thit_R0045.
DR   EnsemblGenomes-Gn; Thit_R0046.
DR   EnsemblGenomes-Gn; Thit_R0047.
DR   EnsemblGenomes-Gn; Thit_R0048.
DR   EnsemblGenomes-Gn; Thit_R0049.
DR   EnsemblGenomes-Gn; Thit_R0050.
DR   EnsemblGenomes-Gn; Thit_R0051.
DR   EnsemblGenomes-Gn; Thit_R0052.
DR   EnsemblGenomes-Gn; Thit_R0053.
DR   EnsemblGenomes-Gn; Thit_R0054.
DR   EnsemblGenomes-Gn; Thit_R0055.
DR   EnsemblGenomes-Gn; Thit_R0056.
DR   EnsemblGenomes-Gn; Thit_R0057.
DR   EnsemblGenomes-Gn; Thit_R0058.
DR   EnsemblGenomes-Gn; Thit_R0059.
DR   EnsemblGenomes-Gn; Thit_R0060.
DR   EnsemblGenomes-Gn; Thit_R0061.
DR   EnsemblGenomes-Gn; Thit_R0062.
DR   EnsemblGenomes-Gn; Thit_R0063.
DR   EnsemblGenomes-Gn; Thit_R0064.
DR   EnsemblGenomes-Gn; Thit_R0065.
DR   EnsemblGenomes-Gn; Thit_R0066.
DR   EnsemblGenomes-Gn; Thit_R0067.
DR   EnsemblGenomes-Gn; Thit_R0068.
DR   EnsemblGenomes-Gn; Thit_R0069.
DR   EnsemblGenomes-Gn; Thit_R0070.
DR   EnsemblGenomes-Gn; Thit_R0071.
DR   EnsemblGenomes-Tr; EBT00001553869.
DR   EnsemblGenomes-Tr; EBT00001553870.
DR   EnsemblGenomes-Tr; EBT00001553871.
DR   EnsemblGenomes-Tr; EBT00001553872.
DR   EnsemblGenomes-Tr; EBT00001553873.
DR   EnsemblGenomes-Tr; EBT00001553874.
DR   EnsemblGenomes-Tr; EBT00001553875.
DR   EnsemblGenomes-Tr; EBT00001553876.
DR   EnsemblGenomes-Tr; EBT00001553877.
DR   EnsemblGenomes-Tr; EBT00001553878.
DR   EnsemblGenomes-Tr; EBT00001553879.
DR   EnsemblGenomes-Tr; EBT00001553880.
DR   EnsemblGenomes-Tr; EBT00001553881.
DR   EnsemblGenomes-Tr; EBT00001553882.
DR   EnsemblGenomes-Tr; EBT00001553883.
DR   EnsemblGenomes-Tr; EBT00001553884.
DR   EnsemblGenomes-Tr; EBT00001553885.
DR   EnsemblGenomes-Tr; EBT00001553886.
DR   EnsemblGenomes-Tr; EBT00001553887.
DR   EnsemblGenomes-Tr; EBT00001553888.
DR   EnsemblGenomes-Tr; EBT00001553889.
DR   EnsemblGenomes-Tr; EBT00001553890.
DR   EnsemblGenomes-Tr; EBT00001553891.
DR   EnsemblGenomes-Tr; EBT00001553892.
DR   EnsemblGenomes-Tr; EBT00001553893.
DR   EnsemblGenomes-Tr; EBT00001553894.
DR   EnsemblGenomes-Tr; EBT00001553895.
DR   EnsemblGenomes-Tr; EBT00001553896.
DR   EnsemblGenomes-Tr; EBT00001553897.
DR   EnsemblGenomes-Tr; EBT00001553898.
DR   EnsemblGenomes-Tr; EBT00001553899.
DR   EnsemblGenomes-Tr; EBT00001553900.
DR   EnsemblGenomes-Tr; EBT00001553901.
DR   EnsemblGenomes-Tr; EBT00001553902.
DR   EnsemblGenomes-Tr; EBT00001553903.
DR   EnsemblGenomes-Tr; EBT00001553904.
DR   EnsemblGenomes-Tr; EBT00001553905.
DR   EnsemblGenomes-Tr; EBT00001553906.
DR   EnsemblGenomes-Tr; EBT00001553907.
DR   EnsemblGenomes-Tr; EBT00001553908.
DR   EnsemblGenomes-Tr; EBT00001553909.
DR   EnsemblGenomes-Tr; EBT00001553910.
DR   EnsemblGenomes-Tr; EBT00001553911.
DR   EnsemblGenomes-Tr; EBT00001553912.
DR   EnsemblGenomes-Tr; EBT00001553913.
DR   EnsemblGenomes-Tr; EBT00001553914.
DR   EnsemblGenomes-Tr; EBT00001553915.
DR   EnsemblGenomes-Tr; EBT00001553916.
DR   EnsemblGenomes-Tr; EBT00001553917.
DR   EnsemblGenomes-Tr; EBT00001553918.
DR   EnsemblGenomes-Tr; EBT00001553919.
DR   EnsemblGenomes-Tr; EBT00001553920.
DR   EnsemblGenomes-Tr; EBT00001553925.
DR   EnsemblGenomes-Tr; EBT00001553928.
DR   EnsemblGenomes-Tr; EBT00001553930.
DR   EnsemblGenomes-Tr; EBT00001553933.
DR   EnsemblGenomes-Tr; EBT00001553934.
DR   EnsemblGenomes-Tr; EBT00001553937.
DR   EnsemblGenomes-Tr; EBT00001553939.
DR   EnsemblGenomes-Tr; EBT00001553941.
DR   EnsemblGenomes-Tr; EBT00001553943.
DR   EnsemblGenomes-Tr; EBT00001553945.
DR   EnsemblGenomes-Tr; EBT00001553948.
DR   EnsemblGenomes-Tr; EBT00001553950.
DR   EnsemblGenomes-Tr; EBT00001553952.
DR   EnsemblGenomes-Tr; EBT00001553954.
DR   EnsemblGenomes-Tr; EBT00001553957.
DR   EnsemblGenomes-Tr; EBT00001553960.
DR   EnsemblGenomes-Tr; EBT00001553961.
DR   EnsemblGenomes-Tr; EBT00001553964.
DR   EnsemblGenomes-Tr; EBT00001553965.
DR   EnsemblGenomes-Tr; EBT00001553968.
DR   EnsemblGenomes-Tr; EBT00001553971.
DR   EnsemblGenomes-Tr; EBT00001553973.
DR   EnsemblGenomes-Tr; EBT00001553975.
DR   EnsemblGenomes-Tr; EBT00001553977.
DR   EnsemblGenomes-Tr; EBT00001553979.
DR   EnsemblGenomes-Tr; EBT00001553981.
DR   EnsemblGenomes-Tr; EBT00001553982.
DR   EnsemblGenomes-Tr; EBT00001553983.
DR   EnsemblGenomes-Tr; EBT00001553986.
DR   EnsemblGenomes-Tr; EBT00001553988.
DR   EnsemblGenomes-Tr; EBT00001553991.
DR   EnsemblGenomes-Tr; EBT00001553993.
DR   EnsemblGenomes-Tr; EBT00001553995.
DR   EnsemblGenomes-Tr; EBT00001553997.
DR   EnsemblGenomes-Tr; EBT00001553998.
DR   EnsemblGenomes-Tr; EBT00001554000.
DR   EnsemblGenomes-Tr; EBT00001554003.
DR   EnsemblGenomes-Tr; EBT00001554005.
DR   EnsemblGenomes-Tr; EBT00001554008.
DR   EnsemblGenomes-Tr; EBT00001554010.
DR   EnsemblGenomes-Tr; EBT00001554013.
DR   EnsemblGenomes-Tr; EBT00001554015.
DR   EnsemblGenomes-Tr; EBT00001554016.
DR   EnsemblGenomes-Tr; EBT00001554017.
DR   EnsemblGenomes-Tr; EBT00001554018.
DR   EnsemblGenomes-Tr; EBT00001554019.
DR   EnsemblGenomes-Tr; EBT00001554020.
DR   EnsemblGenomes-Tr; EBT00001554021.
DR   EnsemblGenomes-Tr; EBT00001554022.
DR   EnsemblGenomes-Tr; EBT00001554023.
DR   EnsemblGenomes-Tr; EBT00001554024.
DR   EnsemblGenomes-Tr; EBT00001554025.
DR   EnsemblGenomes-Tr; EBT00001554026.
DR   EnsemblGenomes-Tr; EBT00001554027.
DR   EnsemblGenomes-Tr; EBT00001554028.
DR   EnsemblGenomes-Tr; EBT00001554029.
DR   EnsemblGenomes-Tr; EBT00001554030.
DR   EnsemblGenomes-Tr; EBT00001554031.
DR   EnsemblGenomes-Tr; EBT00001554032.
DR   EnsemblGenomes-Tr; EBT00001554033.
DR   EnsemblGenomes-Tr; EBT00001554034.
DR   EnsemblGenomes-Tr; EBT00001554035.
DR   EnsemblGenomes-Tr; EBT00001554036.
DR   EnsemblGenomes-Tr; EBT00001554037.
DR   EnsemblGenomes-Tr; EBT00001554038.
DR   EnsemblGenomes-Tr; EBT00001554039.
DR   EnsemblGenomes-Tr; EBT00001554040.
DR   EnsemblGenomes-Tr; EBT00001554041.
DR   EnsemblGenomes-Tr; EBT00001554042.
DR   EnsemblGenomes-Tr; EBT00001554043.
DR   EnsemblGenomes-Tr; EBT00001554044.
DR   EnsemblGenomes-Tr; EBT00001554045.
DR   EnsemblGenomes-Tr; EBT00001554046.
DR   EnsemblGenomes-Tr; EBT00001554047.
DR   EnsemblGenomes-Tr; EBT00001554048.
DR   EnsemblGenomes-Tr; EBT00001554049.
DR   EnsemblGenomes-Tr; EBT00001554050.
DR   EnsemblGenomes-Tr; EBT00001554051.
DR   EnsemblGenomes-Tr; EBT00001554052.
DR   EnsemblGenomes-Tr; EBT00001554053.
DR   EnsemblGenomes-Tr; EBT00001554054.
DR   EnsemblGenomes-Tr; EBT00001554055.
DR   EnsemblGenomes-Tr; EBT00001554056.
DR   EnsemblGenomes-Tr; EBT00001554057.
DR   EnsemblGenomes-Tr; EBT00001554058.
DR   EnsemblGenomes-Tr; EBT00001554059.
DR   EnsemblGenomes-Tr; EBT00001554060.
DR   EnsemblGenomes-Tr; EBT00001554061.
DR   EnsemblGenomes-Tr; EBT00001554062.
DR   EnsemblGenomes-Tr; EBT00001554063.
DR   EnsemblGenomes-Tr; EBT00001554064.
DR   EnsemblGenomes-Tr; EBT00001554065.
DR   EnsemblGenomes-Tr; EBT00001554066.
DR   EnsemblGenomes-Tr; EBT00001554067.
DR   EnsemblGenomes-Tr; EBT00001554068.
DR   EnsemblGenomes-Tr; EBT00001554069.
DR   EnsemblGenomes-Tr; EBT00001554070.
DR   EnsemblGenomes-Tr; EBT00001554071.
DR   EnsemblGenomes-Tr; EBT00001554072.
DR   EnsemblGenomes-Tr; EBT00001554073.
DR   EnsemblGenomes-Tr; EBT00001554074.
DR   EnsemblGenomes-Tr; EBT00001554075.
DR   EnsemblGenomes-Tr; EBT00001554076.
DR   EnsemblGenomes-Tr; EBT00001554077.
DR   EnsemblGenomes-Tr; EBT00001554078.
DR   EnsemblGenomes-Tr; EBT00001554079.
DR   EnsemblGenomes-Tr; Thit_R0001-1.
DR   EnsemblGenomes-Tr; Thit_R0002-1.
DR   EnsemblGenomes-Tr; Thit_R0003-1.
DR   EnsemblGenomes-Tr; Thit_R0004-1.
DR   EnsemblGenomes-Tr; Thit_R0005-1.
DR   EnsemblGenomes-Tr; Thit_R0006-1.
DR   EnsemblGenomes-Tr; Thit_R0007-1.
DR   EnsemblGenomes-Tr; Thit_R0008-1.
DR   EnsemblGenomes-Tr; Thit_R0009-1.
DR   EnsemblGenomes-Tr; Thit_R0010-1.
DR   EnsemblGenomes-Tr; Thit_R0011-1.
DR   EnsemblGenomes-Tr; Thit_R0012-1.
DR   EnsemblGenomes-Tr; Thit_R0013-1.
DR   EnsemblGenomes-Tr; Thit_R0014-1.
DR   EnsemblGenomes-Tr; Thit_R0015-1.
DR   EnsemblGenomes-Tr; Thit_R0016-1.
DR   EnsemblGenomes-Tr; Thit_R0017-1.
DR   EnsemblGenomes-Tr; Thit_R0018-1.
DR   EnsemblGenomes-Tr; Thit_R0019-1.
DR   EnsemblGenomes-Tr; Thit_R0020-1.
DR   EnsemblGenomes-Tr; Thit_R0021-1.
DR   EnsemblGenomes-Tr; Thit_R0022-1.
DR   EnsemblGenomes-Tr; Thit_R0023-1.
DR   EnsemblGenomes-Tr; Thit_R0024-1.
DR   EnsemblGenomes-Tr; Thit_R0025-1.
DR   EnsemblGenomes-Tr; Thit_R0026-1.
DR   EnsemblGenomes-Tr; Thit_R0027-1.
DR   EnsemblGenomes-Tr; Thit_R0028-1.
DR   EnsemblGenomes-Tr; Thit_R0029-1.
DR   EnsemblGenomes-Tr; Thit_R0030-1.
DR   EnsemblGenomes-Tr; Thit_R0031-1.
DR   EnsemblGenomes-Tr; Thit_R0032-1.
DR   EnsemblGenomes-Tr; Thit_R0033-1.
DR   EnsemblGenomes-Tr; Thit_R0034-1.
DR   EnsemblGenomes-Tr; Thit_R0035-1.
DR   EnsemblGenomes-Tr; Thit_R0036-1.
DR   EnsemblGenomes-Tr; Thit_R0037-1.
DR   EnsemblGenomes-Tr; Thit_R0038-1.
DR   EnsemblGenomes-Tr; Thit_R0039-1.
DR   EnsemblGenomes-Tr; Thit_R0040-1.
DR   EnsemblGenomes-Tr; Thit_R0041-1.
DR   EnsemblGenomes-Tr; Thit_R0042-1.
DR   EnsemblGenomes-Tr; Thit_R0043-1.
DR   EnsemblGenomes-Tr; Thit_R0044-1.
DR   EnsemblGenomes-Tr; Thit_R0045-1.
DR   EnsemblGenomes-Tr; Thit_R0046-1.
DR   EnsemblGenomes-Tr; Thit_R0047-1.
DR   EnsemblGenomes-Tr; Thit_R0048-1.
DR   EnsemblGenomes-Tr; Thit_R0049-1.
DR   EnsemblGenomes-Tr; Thit_R0050-1.
DR   EnsemblGenomes-Tr; Thit_R0051-1.
DR   EnsemblGenomes-Tr; Thit_R0052-1.
DR   EnsemblGenomes-Tr; Thit_R0053-1.
DR   EnsemblGenomes-Tr; Thit_R0054-1.
DR   EnsemblGenomes-Tr; Thit_R0055-1.
DR   EnsemblGenomes-Tr; Thit_R0056-1.
DR   EnsemblGenomes-Tr; Thit_R0057-1.
DR   EnsemblGenomes-Tr; Thit_R0058-1.
DR   EnsemblGenomes-Tr; Thit_R0059-1.
DR   EnsemblGenomes-Tr; Thit_R0060-1.
DR   EnsemblGenomes-Tr; Thit_R0061-1.
DR   EnsemblGenomes-Tr; Thit_R0062-1.
DR   EnsemblGenomes-Tr; Thit_R0063-1.
DR   EnsemblGenomes-Tr; Thit_R0064-1.
DR   EnsemblGenomes-Tr; Thit_R0065-1.
DR   EnsemblGenomes-Tr; Thit_R0066-1.
DR   EnsemblGenomes-Tr; Thit_R0067-1.
DR   EnsemblGenomes-Tr; Thit_R0068-1.
DR   EnsemblGenomes-Tr; Thit_R0069-1.
DR   EnsemblGenomes-Tr; Thit_R0070-1.
DR   EnsemblGenomes-Tr; Thit_R0071-1.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001936.
DR   SILVA-SSU; CP001936.
DR   StrainInfo; 161379; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085036
CC   Source DNA and organism available from Christopher L. Hemme
CC   (hemmecl@ou.edu)
CC   Contacts: Christopher L. Hemme (hemmecl@ou.edu)
CC      Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Thermoanaerobacter italicus Ab9, DSM 9252
CC   Culture Collection ID :: DSM 9252
CC   GOLD Stamp ID         :: Gi02024
CC   Greengenes ID         :: 38062
CC   Isolation Site        :: Mud, thermal spa; Italy, Abano Terme
CC   Isolation Country     :: Italy
CC   Latitude              :: 45.360542
CC   Longitude             :: 11.789381
CC   Oxygen Requirement    :: Anaerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Thermophile
CC   Temperature Optimum   :: 70C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water, Mud
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2451061
FT                   /organism="Thermoanaerobacter italicus Ab9"
FT                   /strain="Ab9"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:580331"
FT   gene            424..1755
FT                   /locus_tag="Thit_0001"
FT   CDS_pept        424..1755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   tpd:Teth39_0001 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01331"
FT                   /db_xref="GOA:D3T4Q7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4Q7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ADD01331.1"
FT                   /translation="MYGDHRQIWERIVEVIKSELTPTSYNTWLVHIKPLAIIDNVLFLS
FT                   TPNTFTKNIINGRYINIIYDAASKASNKLYEIKILSEDEEEYREIKESIEKENSTESTT
FT                   LSTLNPKYTFDTFVVGNSNKLAHAACLAVAQAPAKAYNPLFIYGGVGLGKTHLMHAIGH
FT                   FINKHQSGYKIMYVTSETFTNELVNSIKDDKNEEFRNKYRNIDVLLIDDIQFIAKKERT
FT                   QEEFFHTFNTLYEANKQIVISSDRPPKEIPTLEERLRSRFEWGLIADIQPPDYETRIAI
FT                   LKKKAQTENLNIPDEVLAYVAEKIQSNIRELEGALIRIVAFSNLTKANIDLELAKQALK
FT                   EIVSNKTREITVKLIQEEVCRYYNIKLEDFRSRKRTKNIAYPRQIAMYLARELTDLSLP
FT                   KIGEEFGKDHTTVIHAYEKISNEIKEDELLSRQIEELKKRIKGY"
FT   gene            1991..3103
FT                   /locus_tag="Thit_0002"
FT   CDS_pept        1991..3103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: tpd:Teth39_0002 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01332"
FT                   /db_xref="GOA:D3T4Q8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4Q8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADD01332.1"
FT                   /translation="MKFVCDKNSLFEGVNIAIRGVSSRTTLPILQGIKISALKDQVKFS
FT                   GTDLDIGIECQIPAMVEEEGEIVVPAKIFSELVRKLPEGDVKIESDSQNTVNVICDSIN
FT                   FTIAGSDAVEFPEIPQVSKENSFKLTKNILKDLIKKTVFCIAHEQTRPILTGVLFEVFP
FT                   NEIKAVALDGFRMAIYTYQSEEKFFEEGIEKYSIVIPGKTLEEIYKILEDEETEIDIYH
FT                   TANQVLFQIENTKVISRLLEGSFINYNAVLPKDYKTEVVVKREVLTESIERASLIAESK
FT                   NNLIKFEIGDKFITVSSNSEKGKMVEKIEVNVKGMFLEIAFNSRYLLDSLRAIDEEEIT
FT                   LYFINSINPLIIKPIGSKDYLYMILPVKLN"
FT   gene            3124..3330
FT                   /locus_tag="Thit_0003"
FT   CDS_pept        3124..3330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding
FT                   S4 domain protein; KEGG: tpd:Teth39_0003 RNA-binding S4
FT                   domain-containing protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01333"
FT                   /db_xref="GOA:D3T4Q9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4Q9"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADD01333.1"
FT                   /translation="MIEVPIETEYITLGQFLKYMKICETGGQAKQFILEGKVKVNGAIE
FT                   LKRGKKLRKNDIIEVEGKTYIIK"
FT   gene            3341..4429
FT                   /locus_tag="Thit_0004"
FT   CDS_pept        3341..4429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: tex:Teth514_0004 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01334"
FT                   /db_xref="GOA:D3T4R0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4R0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADD01334.1"
FT                   /translation="MYVKELFVDNFRNLEKQRIEFCEGINIFYGLNAQGKSNLLESIRL
FT                   LSMGRSFRGSKSTELVRFGENYFYVKAIICQENNDKKIEFGYKKDGNKVIKVNSNKIKS
FT                   ISELLGQLLTVIFSPEDLNIIKEGPSHRRKYLDSCISIIEKNYLYNLMQYNKILMNRNK
FT                   LLKNIKEGKSKNILEIFDNQLVEYGAKIIMVRQNYLKNLEINIKKFLLEISNEKAEIVY
FT                   LNSVGLKDASDEETVKKRLKEKLSKNIDLDLKYLTTQVGPHREDFKIIINGYDSRVYSS
FT                   QGQQRTAALCLKLSEFEILKKATNEKPVLLLDDVMSELDENRKKYVLEKLKGFQTFITH
FT                   TTKRDLKGDCYFKISNGVVIKE"
FT   gene            4441..4698
FT                   /locus_tag="Thit_0005"
FT   CDS_pept        4441..4698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01335"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4R1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0005"
FT                   /protein_id="ADD01335.1"
FT                   /translation="MYVHLGGNVVVSDKDIIAIFDMDVVTTSEATLQFLKIAEEEGFIV
FT                   RISSEKPKSFIITERDKRSVIYLSPISAFTLIKRTQKIDA"
FT   gene            4711..6966
FT                   /locus_tag="Thit_0006"
FT   CDS_pept        4711..6966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0006"
FT                   /product="Alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /note="KEGG: tpd:Teth39_0006 alpha-glucosidase; PFAM:
FT                   glycoside hydrolase family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01336"
FT                   /db_xref="GOA:D3T4R2"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="InterPro:IPR030458"
FT                   /db_xref="InterPro:IPR032513"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4R2"
FT                   /inference="protein motif:PRIAM:3.2.1.20"
FT                   /protein_id="ADD01336.1"
FT                   /translation="MIKTSEGIIVRNEKRKLELRVLSDKIINVFVSDKEEKRKDTIAIE
FT                   RKEYDIPKFTLKEELESILIETNSLKVKIDKNDLSVSFLDKNENIINEDYKGGVKFSET
FT                   DVRCYKKLREDHFYGFGEKAGYLDKKGERLEMWNTDEFMTHNQTTKLLYESYPFFIGMN
FT                   DYHTYGIFLDNSFRSFFDMGQESQEYYFFGAYGGQMNYYFIYGQDIKEVVENYTYLTGR
FT                   ISLPPLWVLGYQQSRYSYTPQERVLKIAKTFREKDIPCDVIYLDIDYMEGYRVFTWNKD
FT                   TFKNYKEMLKQLKEMGFKVVTIVDPGVKRDYDYHVYREGIEKGYFVKDKYGITYVGKVW
FT                   PGEACFPDFLQEEVRYWWGEKHREFIKDGIDGIWNDMNEPAVFETPTKTMPEDNIHILD
FT                   GEKILHKEAHNIYANYMAMATRDGLLRIKPNERPFVLTRAGFSGIQRYAAMWTGDNKSL
FT                   YEHLLMMMPMLINIGLSGQPFAGADVGGFEGDCNEELFIRWIEAAIFTPFLRVHSAIGT
FT                   KDQEPWSFGKKAEDISRKYIKMRYELLPYLYDLFYTASQKGYPIMRPLVFEYQDDENTH
FT                   KIYDEFLLGDNLLIAPVYLPSKEKREVYLPKGIWYDYWTGKEFKGESYYLVDAPIDIVP
FT                   LFVKEGGILLKQQPQSFVGEKEIKEIIIEIYKGEEGHYLHYEDDGKSFDYTKGIYNLFE
FT                   IGFKYQRGKIDIKFDRIHSGYEKGVKKYKFVLKNFDEIEEVKINGKKVDKEKCEVIL"
FT   gene            complement(6989..7720)
FT                   /locus_tag="Thit_0007"
FT   CDS_pept        complement(6989..7720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0007"
FT                   /product="CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /note="PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase; KEGG: tex:Teth514_0007 glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01337"
FT                   /db_xref="GOA:D3T4R3"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4R3"
FT                   /inference="protein motif:PFAM:PF07685"
FT                   /protein_id="ADD01337.1"
FT                   /translation="MKLVIGHMYPDLLNLYGDLGNILTLKRRSEWRNIETEVKSITVDS
FT                   NTNFTDIDILFLGGGSDREQKIVSDDLTIKKGKNLKSAIEDGLTVLGICGGYQLLGNYY
FT                   QTSKGEKIEGVGVLDMWTVAGTKRMIGNVVIDANINEKNFKMVGFENHSGKTYLGKSSP
FT                   LGKVIIGRGNNGEDKTEGCIYKNVYGTYLHGPVLPKNPEFADILIETALKRKYGKVELT
FT                   PLDDSLEQQAKQSLIERFVKK"
FT   gene            complement(7732..9072)
FT                   /locus_tag="Thit_0008"
FT   CDS_pept        complement(7732..9072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0008"
FT                   /product="domain of unknown function DUF1727"
FT                   /note="PFAM: domain of unknown function DUF1727; Mur ligase
FT                   middle domain protein; KEGG: tex:Teth514_0008 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01338"
FT                   /db_xref="GOA:D3T4R4"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4R4"
FT                   /inference="protein motif:PFAM:PF08353"
FT                   /protein_id="ADD01338.1"
FT                   /translation="MKFLSVNLGKLVNISCKITGKGGTSLPGKIALKSDSRLIKKLIEP
FT                   LKESKVMITGTNGKTTTSGLIAHILNTAGKSVVHNKEGANMKTGIATALIKSSDFLGNL
FT                   KKEAAVFEVDEANMPIVIEDINPNIVIITNFFRDQLDRYGELDITVEKVKNALLKLPQE
FT                   SIILLNADEPFTASIGDEIKSKVFYYGIDDNIEGINSSSFEQKYCPICGHKYEYRRIYY
FT                   GQLGDYYCPNCGKKRPNPHFKATNIFLNEDGINFNLYYKDKIFTFKSRLIGIYNVYNLL
FT                   AAISASILLNIDFNTISKATENYWPIEGRLQKTKIKNKKAIINLIKNPIGFESTLNMLS
FT                   QFSKPLNLLISINDNYADGRDVSWLWDVNLEDFLSKTKVNYIITSGLRAEDMAVRLKYA
FT                   NFDINKVKVINSVDKALDTISELTKEELIAVLPNYTSLYDVNKYLNS"
FT   gene            complement(9086..9193)
FT                   /pseudo
FT                   /locus_tag="Thit_0009"
FT                   /product="hypothetical protein"
FT   gene            9426..11327
FT                   /locus_tag="Thit_0010"
FT   CDS_pept        9426..11327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0010"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: tex:Teth514_0009 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01339"
FT                   /db_xref="GOA:D3T4R5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3T4R5"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADD01339.1"
FT                   /translation="MAKDETYTASQIQILEGLEAVRKRPGMYIGSTGSRGLHHLVYEVV
FT                   DNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDIHPKVGKPAVEVALTMLHAGGK
FT                   FNNDAYKVSGGLHGVGVSVVNALSEKLEVVVKQRGKIFRQTYERGVPKTELEIIGETEE
FT                   TGTTITFKPDKEIFEETVFNYDVLAQRLRELAFLNKGINIRLIDERDGKEEVFNYEGGI
FT                   ISFVKYLNRNKEVLHEEPIYMEAKNTDYEVEVCMQYNDTYTENIFSFANNIDTREGGTH
FT                   LVGFKSALTKVINDYARKYGIIKDNEKNLQGEDVREGLTAIVSVKLKNPQFEGQTKTKL
FT                   GNSEMRSIVENVVIEKLSAFLEENPSVAKVIVEKATQAARAREAARKARELTRRKSALE
FT                   NTTLPGKLADCSEKDPSKCELFLVEGDSAGGSAKTGRNSRFQAILPLRGKILNVEKARL
FT                   DKILSNEEIRAMITALGTGIGDEFDISKLRYHKVVIMTDADVDGSHIRTLLLTFFYRFM
FT                   RPLIENGNVYIAQPPLYKITKGKKVYYAYSDKELDRILNEIGRENYTVQRYKGLGEMNA
FT                   DQLWDTTMDPEKRTILKVTLEDAIAADEIFTILMGDKVEPRREFIERYAKTVRNLDI"
FT   gene            11340..13757
FT                   /locus_tag="Thit_0011"
FT   CDS_pept        11340..13757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0011"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: tex:Teth514_0010 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01340"
FT                   /db_xref="GOA:D3T539"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D3T539"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ADD01340.1"
FT                   /translation="MSEDKVIPVDIEDEMKKSYIDYAMSVIVGRALPDVRDGLKPVHRR
FT                   ILYAMNELGLTPDKPYKKSVAVVGEVLGKYHPHGDAAVYDTLVRLAQDFSMRETLIDGH
FT                   GNFGSIDGDPPAAMRYTEARLSKIALEMLTDINKETVDFVPNFDETLKEPVVLPSRFPN
FT                   LLVNGSQGIAVGMATNIPPHNLGEVIDGIIAYIDNPYISVDELMKYIKGPDFPTGGVIL
FT                   GRDGIKETYETGRGKIVVRAKAEIEEHHGKTRIVITEIPYMVLKAKLIEKIAELVREKH
FT                   IEGISDLRDESDRNGMKVVIELKKDVNPKVILNKLYMHTQMQQTFGAIMLALVDGEPKI
FT                   LNLKQIIEKYVDHQADVVTRRTKFDLRKAEERAHILEGLKIALDHIDEVINIIRSSKTE
FT                   AIAKQNLMDKFGLSEKQAQAIVDMRLGRLTGLERQKVEDELKELMEKIKELKGILADER
FT                   KVLEIIKKELLEIKDKYATPRKTNIVAKEEELDLEDLVQLEDVVVTMTHYGYIKRMPLD
FT                   TYKAQKRGGKGILGISTREDDFVRDIFITTTHDRLLFFTNKGKVYSLRTIDIPETGRQA
FT                   KGTAIVNLIQIAQGEKVTAVIPLKKSQDIKYVVMCTKKGIIKKTSIEEFRSIKRNGIIA
FT                   ITLEENDELINTKLTNGEREIIIGTAKGYAIRFNEKDIRPMGRVAKGVIAISLREDDEV
FT                   VEMDLVHPGSEILVVTEKGFGKRTDLEEYRLQTRAGKGIIAIRLSEKTGKLVSIRSVNP
FT                   EDEFMIISANGILIRMKVSEISKMHRDTRGVTLMKLDDGDRVVSTARIENEE"
FT   gene            complement(13786..14799)
FT                   /locus_tag="Thit_0012"
FT   CDS_pept        complement(13786..14799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0012"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   tex:Teth514_0011 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01341"
FT                   /db_xref="GOA:D3T540"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T540"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ADD01341.1"
FT                   /translation="MSILHTPLKIKDITIKNRIMMSPMCMYTASTEGMPNDWHIVHYAT
FT                   RAIGGVGLIMQEATAVESRGRITDRDLGIWNDEQAKELKKIVDICKANGAAVGIQLAHA
FT                   GRKCDILYEDVIGPSPIKAGDNYKLPRELSIEEIKSIVKAFGEAARRAHLAGYDVVEIH
FT                   AAHGYLIHEFLSPLSNKRKDEYGGSIENRARFLIEVIEEVRKNWPQTKLIFVRVSADDY
FT                   IEGGINIDMMVDYINMIKDKVDLIDVSSGGLLSADINLYPGYQVKYAETIKKRCNIKTS
FT                   AVGLITTQELAEEILSNKRADLVALGRELLRNPYWVLHTYTSREDWPKQYERAFKK"
FT   gene            15410..15913
FT                   /locus_tag="Thit_0013"
FT   CDS_pept        15410..15913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0013"
FT                   /product="acetolactate synthase, small subunit"
FT                   /note="KEGG: tex:Teth514_0012 acetolactate synthase, small
FT                   subunit; TIGRFAM: acetolactate synthase, small subunit;
FT                   PFAM: Acetolactate synthase, small subunit-like; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01342"
FT                   /db_xref="GOA:D3T541"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:D3T541"
FT                   /inference="protein motif:TFAM:TIGR00119"
FT                   /protein_id="ADD01342.1"
FT                   /translation="MHIISVLVNNHPGVLSRVVGLFSRRGYNIESLAVGTTEREDISRI
FT                   TLTVGEDEYTVTQVIRQLNKLVDVLKVQNIGARDNVSRELLLVKVGYDSNTRDDIMHIV
FT                   DTFRAKVIDISIDSLIIELTGDSEKINAFINLINKFDVKELVRTGLVSLERGNKTLKEY
FT                   KGEL"
FT   gene            15913..16908
FT                   /locus_tag="Thit_0014"
FT   CDS_pept        15913..16908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0014"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="TIGRFAM: ketol-acid reductoisomerase; KEGG:
FT                   tex:Teth514_0013 ketol-acid reductoisomerase; PFAM:
FT                   Acetohydroxy acid isomeroreductase catalytic domain
FT                   protein; acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01343"
FT                   /db_xref="GOA:D3T542"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T542"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ADD01343.1"
FT                   /translation="MAKMYYDKDADLNLLKNKKIAIIGFGSQGHAHALNLRDSGLDVVV
FT                   GLYKGSKSKERAEKEGLTVLTVEEAAKVADIIMMLIPDEKQAKVYKESIEKNLTEGKAL
FT                   AFAHGFNIHFKQIIPPKNVDVFMVAPKGPGHLVRRVYQEGKGVPNLVAVYQDYTGKAFE
FT                   IALAYAKGIGGTRAGVIETTFREETETDLFGEQAVLCGGVTELMKAGFETLVEAGYQPE
FT                   IAYFECVHEMKLIVDLIYEGGFSYMRYSISDTAEFGDYMTGKRIITEETRKEMKKVLSE
FT                   IQSGKFAKEWLLENQVGRPQYNAMKDKEASHLIEKVGKSLREMMAWIKKE"
FT   gene            16927..18120
FT                   /locus_tag="Thit_0015"
FT   CDS_pept        16927..18120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0015"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   tpd:Teth39_0015 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01344"
FT                   /db_xref="GOA:D3T543"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T543"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ADD01344.1"
FT                   /translation="MGVKRVIVFDTTLRDGEQTPGVNFNINEKFEIAKQLATLGADVIE
FT                   AGFPAASNGDFEGVKNVADKIKGVTIAGLARAVKEDIDRASNALKNAERSRLHVFIATS
FT                   DIHLKYKLKMSREETLKRAVEMVKYAKGKFDEIEFSAEDASRTDWDFLVKVFSEVIEAG
FT                   ANVINIPDTVGYAMPREFGELVKYIKNNVPNIDGVIISAHCHNDLGLAVANSLSAIENG
FT                   ATQVEVAVNGIGERAGNAALEEVIMALNTRKDYFGLVHGINTKEIYNTSKLVSKLTGID
FT                   IPPNKAIIGANAFRHQAGIHQHGIINNRATYEIMKPEDIGINPDTFALGKLSGRNAFEL
FT                   KAKQLGYNLSPGELNEAFRRFKDLADRKKVIIDEDIRFVVEETLEEFRSFKEGEAWA"
FT   gene            18111..19367
FT                   /locus_tag="Thit_0016"
FT   CDS_pept        18111..19367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0016"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="KEGG: tex:Teth514_0015 3-isopropylmalate dehydratase
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; 3-isopropylmalate dehydratase; homoaconitate
FT                   hydratase family protein; PFAM: aconitate hydratase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01345"
FT                   /db_xref="GOA:D3T544"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D3T544"
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /protein_id="ADD01345.1"
FT                   /translation="MGLTLTQKILSAKIGREVKAGELIEVDVDMVLGNDVTAPVAIREF
FT                   EKIGKEEVFDKTKIALVPDHFVPNKDIKSAEQVNIMRKFAKKHGIVNFFEVGQMGIEHA
FT                   LLPEKGLVLPGDVVIGADSHTCTYGALTCFSTGVGSTDMAAAMATGKAWFKVPEAIKFV
FT                   LKGNLQKWVSGKDIILYIIGKIGVDGALYKSMEFTGNIKTLSMDDRFTIANMAIEAGAK
FT                   NGIFDFDEITEAYVKGRAKREYKVFERDEDAEYSEVYEINLDEIRPQVAFPHLPENTRS
FT                   IDEVGKVKIDQVVIGSCTNGRLSDMEIAYKILKGKKVHPDVRLLIFPATQEIYLECVKR
FT                   GYIEEFIKAGAAISTPTCGPCLGGHMGILARGERALATTNRNFVGRMGHPESEVYLSSP
FT                   AVAAASAIAGYIVSPEEVE"
FT   gene            19367..19849
FT                   /locus_tag="Thit_0017"
FT   CDS_pept        19367..19849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0017"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="KEGG: tex:Teth514_0016 3-isopropylmalate dehydratase
FT                   small subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   small subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01346"
FT                   /db_xref="GOA:D3T545"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:D3T545"
FT                   /inference="protein motif:TFAM:TIGR02084"
FT                   /protein_id="ADD01346.1"
FT                   /translation="MQGKAIKYGDNIDTDVIIPARFLNTSDPQELAQHCMEDLDKDFKN
FT                   KVKEGDILVVGENFGCGSSREHAPIAIKASGISCIIAKSFARIFFRNAINIGLPILECK
FT                   EAVDGIEEGDMVLVDTDNGIIKNLTKGTEFKAQPFPEFIKEIMKYGGLINYVRKKV"
FT   gene            19852..20919
FT                   /locus_tag="Thit_0018"
FT   CDS_pept        19852..20919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0018"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; KEGG:
FT                   tpd:Teth39_0018 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01347"
FT                   /db_xref="GOA:D3T546"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D3T546"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ADD01347.1"
FT                   /translation="MFKIAVLPGDGIGPEVIEEGLKVLSAIEKKYKLKFDVKKYHFGGE
FT                   AIDKYGVPYPEETKNACLSSDAVLLGAVGGPKWDNLEGDKRPEAGLLALRKSLGVYANL
FT                   RPAVLYPPLKEASPLKNELLKEGLDILVVRELTGGIYFGPRGTVTIDYGFKAYDTEVYQ
FT                   TSEIERIAVIAFEAALKRKKKVTSVDKANILDSSRLWRKTVDEVSKRYPEVELNHMYVD
FT                   NCAMQLVKNPSQFDVILTSNMFGDILSDEAAQIVGSIGVLPSASLREDKVGLYEPIHGS
FT                   APDIAGTKKANPLATILSVAMMLEYSFNLLDAANDIKDAVNKVLEAGYRTFDLGEGIIL
FT                   NTQEMGDKVVEYIKG"
FT   gene            20916..22595
FT                   /locus_tag="Thit_0019"
FT   CDS_pept        20916..22595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0019"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; KEGG:
FT                   tpd:Teth39_0019 dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01348"
FT                   /db_xref="GOA:D3T547"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D3T547"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ADD01348.1"
FT                   /translation="MRILISESIKKGVEKAPHRSLLYALGLTYEEIKRPIIGVANSKNE
FT                   IIPGHIHLDKIAEAVKAGIRMAGGTPIEFSTIGVCDGIAMNHKGMKYSLGSRELIADSI
FT                   EIMATAHGFDGLVLIPNCDKIVPGMLMAAARLNIPAIVVSGGPMLAGKCNGDVCDLSSV
FT                   FEAVGAHKIGKISDEDLYKIELNACPTCGSCSGMFTANTMNCLTEALGMGLPGNGTIPA
FT                   VYSERIRLAKQAGMKIMELVERGIKPSDILTKEAFINAFSLDMALGGSTNTILHLKAIA
FT                   HEAGVEISLDEINDISGRVPNLCKLSPAGKYHIEDLYFAGGVSAVLKELTKANLINTEV
FT                   LTVTGKTLGENIKDAKILNHDVIRPIDNPYSSTGGLVIMYGNIAREGAVVKASAVAEEM
FT                   LRHEGPAKVFDSEEEAIKAIYGGKIQKGDVVVIRYEGPKGGPGMREMLSPTSALAGMGL
FT                   DKDVALITDGRFSGATRGASIGHVSPEAMEGGEIAILQDGDIIEIDIPARKINVKLSEE
FT                   EIKERLKKWVRPEPKIKTGYMARYAKQVTSASTGAVFKGGAL"
FT   gene            22592..24256
FT                   /locus_tag="Thit_0020"
FT   CDS_pept        22592..24256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0020"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="KEGG: tex:Teth514_0019 acetolactate synthase, large
FT                   subunit, biosynthetic type; TIGRFAM: acetolactate synthase,
FT                   large subunit, biosynthetic type; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein; thiamine
FT                   pyrophosphate protein central region; thiamine
FT                   pyrophosphate protein domain protein TPP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01349"
FT                   /db_xref="GOA:D3T548"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:D3T548"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ADD01349.1"
FT                   /translation="MILKGAQVVIEVLKEVGIDTIFGIPGGAVIPIYDALYDSDLRHIL
FT                   ATHEQMAAHMADGYARVTGRVGVCFATSGPGSTNLVTGIANAYMDSVPVVAITGQVPTN
FT                   LIGKDAFQEVDITGITMPITKHNFIVKSPDKLTDTIRQAFAIAKSGRPGPVLVDIPKDI
FT                   QNADIEYVKGMGDSIDIKNDINGVVSQKELDKAIELILQSKKPVIFAGGGVIWGEASDE
FT                   LVEFAEKTNIPVATSLMGLGAFPEDHPLSLGLIGMHGSRFANLAVYKSDLVIAIGTRFS
FT                   DRVAGKAGGLAPNAKIIHIDIDPAELGKNVEVEVAIIGKVKEVLRLLMNKLSFIERKEW
FT                   LEEISFLREKHGLKYKNDEVLRPQWIVEKIQQLSNDDLIIATEVGQNQMWAAQYYKFKR
FT                   PRTFVTSGGLGTMGFGLPAAIGAQVGKPDKRVVNIAGDGSLRMNIHALETAAVYNIPVI
FT                   TVLLNNRTLGMVRQWQNLLYNKRFSQTDLNANLNFANLANDFGVEGIRVTTKEEFEKAF
FT                   KKAYSQKRPFMIECIIDKDEMVLPFIPAGGTVENTIG"
FT   misc_binding    24254..24368
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 115.80"
FT   gene            24453..25535
FT                   /locus_tag="Thit_0021"
FT   CDS_pept        24453..25535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0021"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="1.1.1.193"
FT                   /EC_number="3.5.4.26"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibD;
FT                   2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase; KEGG: tex:Teth514_0020 riboflavin biosynthesis
FT                   protein RibD; PFAM: bifunctional deaminase-reductase domain
FT                   protein; CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01350"
FT                   /db_xref="GOA:D3T549"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D3T549"
FT                   /inference="protein motif:TFAM:TIGR00326"
FT                   /protein_id="ADD01350.1"
FT                   /translation="MEEYMKRALTLAEKGWGYTNPNPLVGAVIVKNGKIIGEGYHEYFG
FT                   GPHAEVNALKNAVEDVKGSTMFVTLEPCSHYGKTPPCVEEIIKSGIKKVYIAMEDPNPK
FT                   VSGNGIKRLKEAGIEVHVGMMEKEARKLNEIFFKYITTKFPFVILKSAMSIDGKIACYN
FT                   GNSKWITNEKSRKFAHKIRGRVSAIMVGVNTVIKDNPMLTTRLEGYKNPVRIIVDSRGR
FT                   IPLNSNVIRDKTAKTIIATTELMPNNKRKKLEDMDIEVIILKNDNGKVPLKELMIKLGE
FT                   RGIDSVLIEGGGTLNWSAFKEGIVDKVMFFISPRIIGGKNALTPVEGIGFSSIENSIEL
FT                   KDVEIDRIDDDILITAYVRK"
FT   gene            25546..26169
FT                   /locus_tag="Thit_0022"
FT   CDS_pept        25546..26169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0022"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: riboflavin synthase, alpha subunit; KEGG:
FT                   tex:Teth514_0021 riboflavin synthase, alpha subunit; PFAM:
FT                   Lumazine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01351"
FT                   /db_xref="GOA:D3T550"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:D3T550"
FT                   /inference="protein motif:TFAM:TIGR00187"
FT                   /protein_id="ADD01351.1"
FT                   /translation="MFTGIIEETGTVKNITHGTFTKIVIKCSKVLEETKIGDSIAVNGV
FT                   CLTVTNISDESFAADVMPETMRASNLKDLKIGSIVNLERALQVGRRMGGHIVTGHIDCV
FT                   GKIIEKRQEKNAFIFKIAINEKFTKYIARKGSIAVDGISLTVVEDGYDYFTVSVIPHTM
FT                   LKTTLGYKGVGDSVNIEVDILSKYVEKLIGKKDIKDLLKENGFI"
FT   gene            26207..27397
FT                   /locus_tag="Thit_0023"
FT   CDS_pept        26207..27397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0023"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="KEGG: tex:Teth514_0022 GTP cyclohydrolase II;
FT                   TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase; GTP
FT                   cyclohydrolase II; PFAM: 34-dihydroxy-2-butanone
FT                   4-phosphate synthase; GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01352"
FT                   /db_xref="GOA:D3T551"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D3T551"
FT                   /inference="protein motif:TFAM:TIGR00506"
FT                   /protein_id="ADD01352.1"
FT                   /translation="MFDRIEDAIEDIKQGKMIIVVDDENRENEGDLVMAAEKVTGENIN
FT                   FMIKYGRGLVCVPMTEKRLNELGIYQMVENNTDHKETAFTISVDYKECTTGISAFERAL
FT                   TVKKLVDDNSKPDDFTKPGHIFPLRAKDGGVLVRAGHTEAAVDLAVLAGLKPAGVICEI
FT                   IKDDGNMARLPDLLEFAKKFGLRIISIEDLIKYRMKNEILVRRVAQAKLPTKYGNFEIV
FT                   GYEEILTGKQHVALIKGNVNKEPVLVRIHSECLTGDILGSLRCDCGDQLHAAMERIGQE
FT                   GGVLVYLRQEGRGIGLLNKIKAYHLQDQGLDTVEANIKLGFPPDLREYNIAAQILKDIG
FT                   VKKIRIMTNNPQKITELSDYGLDVVERVSIEICPNHYNEKYLKTKKEKMGHLILEV"
FT   gene            27483..27947
FT                   /locus_tag="Thit_0024"
FT   CDS_pept        27483..27947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0024"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.9"
FT                   /note="TIGRFAM: 6,7-dimethyl-8-ribityllumazine synthase;
FT                   KEGG: tex:Teth514_0023 riboflavin synthase; PFAM:
FT                   67-dimethyl-8-ribityllumazine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01353"
FT                   /db_xref="GOA:D3T552"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:D3T552"
FT                   /inference="protein motif:TFAM:TIGR00114"
FT                   /protein_id="ADD01353.1"
FT                   /translation="MKIYEGKLIAQGKKFGIVVSRFNEFITNKLLEGALDALKRHGALN
FT                   ENIEIAWVPGAFEIPLIAKKMAESKRYDAVIALGAVIRGETPHFDYVANEVSKGIAKIS
FT                   LDTEVPVIFGVLTTDTIEQAIVRAGTKGGNKGFEAAVTAIEMANLMEEIK"
FT   gene            complement(27966..29030)
FT                   /locus_tag="Thit_0025"
FT   CDS_pept        complement(27966..29030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0025"
FT                   /product="sporulation integral membrane protein YtvI"
FT                   /note="KEGG: tex:Teth514_0024 hypothetical protein;
FT                   TIGRFAM: sporulation integral membrane protein YtvI; PFAM:
FT                   protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01354"
FT                   /db_xref="GOA:D3T553"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="InterPro:IPR014227"
FT                   /db_xref="UniProtKB/TrEMBL:D3T553"
FT                   /inference="protein motif:TFAM:TIGR02872"
FT                   /protein_id="ADD01354.1"
FT                   /translation="MNNYLKYSNIIKKIILIVSVFIIFYLVIFKIIPFLMPFVVALIFA
FT                   VIIDPGVNFLEKKLKVPRGLASFILLLILIGVIGSLIAITVTQLIYELSSLAEISTNYA
FT                   NTINDAILNLVDRIRTYYISLPPNITSLIESNMHSILNYISLFAKNLATWLLNFATKLP
FT                   NFFFMTLITLVATFFISKDKNLILDFIKRQIPSHWAQHAKNIQIDLLKTFFGYLRAVAA
FT                   IMLITFLEVSIGLVIIGFDYPFLLGLFVTIVDALPVLGSGSVMIPWALYNIIIIKNYMV
FT                   GIYLLILYILVVVVRQMIEPKIVGQSIGLHPLVTLLSMFIGVKLFGALGLIIGPVFVVV
FT                   FKALQRAEIIPPWK"
FT   gene            complement(29115..29285)
FT                   /locus_tag="Thit_0026"
FT   CDS_pept        complement(29115..29285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01355"
FT                   /db_xref="UniProtKB/TrEMBL:D3T554"
FT                   /inference="similar to AA sequence:KEGG:Teth39_0027"
FT                   /protein_id="ADD01355.1"
FT                   /translation="MREIEYLLDLAEIKDTEYKNLLTLLSLIDLLVEKGIITQHELAQK
FT                   SKEIAKIKTAL"
FT   gene            29423..29953
FT                   /locus_tag="Thit_0027"
FT   CDS_pept        29423..29953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0027"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="TIGRFAM: signal peptidase I; KEGG: tpd:Teth39_0028
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01356"
FT                   /db_xref="GOA:D3T555"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D3T555"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADD01356.1"
FT                   /translation="MDKNVQKEILSWIFTIALAFLIALFIRTYVFELVDVPTGSMLDTI
FT                   QLNDKFIVNKFIYKFEPVKRGDIVVFRFPDNPKVNFVKRVIGIGGDVIEIKNGVLIRNG
FT                   EVVKEPYIKEPMKGNFGPYVVPPGHYFMLGDNRNESMDSRFWQHKYVSKDQILGKIVFR
FT                   IWPPNRVGSMSGK"
FT   gene            30226..31497
FT                   /locus_tag="Thit_0028"
FT   CDS_pept        30226..31497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0028"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG:
FT                   tpd:Teth39_0029 seryl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Seryl-tRNA synthetase,
FT                   class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01357"
FT                   /db_xref="GOA:D3T556"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D3T556"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ADD01357.1"
FT                   /translation="MIDVKRIRSNPEAIKRAIELKKDKADIDKFLKLDERRRQMLVELE
FT                   ALKNRRNVESDNIAKLKREGKDVSDLIAEMKELSSKIKEMEQEVKEVEEQLEGILWTIP
FT                   NIPHESVPTGDSDEDNVEVRRWGETRKFDFEPKPHWEIGEELDILDFEAAARVTGSRFT
FT                   FYKGLGARLERALINFMLDLHVEKHGYTEVFPPFMVHRRSMLGTGQLPKFEEDAFKVYG
FT                   TDYFLIPTAEVPVTNMYRDTIIDGDKLPIYHCAYSACFRQEAGSAGRDTRGLIRQHQFN
FT                   KVELVKFTEPDKSYEELEKMTKDAEEVLQLLGLPYRVVAICTGDLGFTASKKYDIEVWM
FT                   PSYGRYVEVSSCSNCEDFQARRANIKYRPKDGGKAQYVHTLNGSGVAVGRTFAAILENY
FT                   QQEDGSVVIPEVLRPYMKVDVIKK"
FT   gene            31580..31669
FT                   /locus_tag="Thit_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            31580..31669
FT                   /locus_tag="Thit_R0001"
FT                   /product="tRNA-Ser"
FT   gene            31702..31795
FT                   /locus_tag="Thit_R0002"
FT                   /note="tRNA-Ser2"
FT   tRNA            31702..31795
FT                   /locus_tag="Thit_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(31822..33042)
FT                   /locus_tag="Thit_0029"
FT   CDS_pept        complement(31822..33042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0029"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="KEGG: tte:TTE0026 transcriptional regulator;
FT                   TIGRFAM: cell envelope-related function transcriptional
FT                   attenuator, LytR/CpsA family; PFAM: cell envelope-related
FT                   transcriptional attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01358"
FT                   /db_xref="GOA:D3T557"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D3T557"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ADD01358.1"
FT                   /translation="MKKTLKIIIFIVIGIILSVSVGTYIFYKNIHVPASHEKDTSAVNK
FT                   NKSQNNKIENIKRKNILFVGSDENNLSDTILIINYDPLNKKINILSIPRDTYYPRPGFN
FT                   APEEKKINAAFSEEKIDGLKNAVENLLNIKIDNYVILNYEGFKKIIDTIGGVEVDVPFN
FT                   MKYDDNSANPPLHIDLKKGRQVLDGEKAIQFIRYRHGYVDGDLGRIKAQHQFLEALLKK
FT                   ILQPSILPKVPSLAITISQYLKTDLSASEITQYAYQFIKDKPSTIDAIALPGEGGYEGN
FT                   TSYFFVDSIKTQEIVKELFTDEVSSLNTSTTSLFENTNIKVEILNGAGIEGLATKYAEI
FT                   LKNEGFNVVKIGNVIGMTFNSSHVYARTDEEKAKKVAKALFITNVEKDISPDVKVDVTV
FT                   ILGKDKK"
FT   gene            33260..35989
FT                   /locus_tag="Thit_0030"
FT   CDS_pept        33260..35989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0030"
FT                   /product="protein of unknown function UPF0182"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   amt:Amet_0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01359"
FT                   /db_xref="GOA:D3T558"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D3T558"
FT                   /inference="protein motif:PFAM:PF03699"
FT                   /protein_id="ADD01359.1"
FT                   /translation="MKKPNIFLISLIILIFAILGIIVSLVNFIVDFQWFSDLHYLDVFF
FT                   KKFLTQFTMGVPIFILVFMVLYFYANKIIRDYVNFAQDIIVKKNVNIYSRVGIVISLLT
FT                   ALFITLYAATNWWNDLLFFINSVNFNETDPIFHKDISFYMFKLPLLYDIYNLLIVFIPV
FT                   MIVVIIIAYGLIYLSDKTRFYEISDRDGNLFKAIYNKDILIKAFKEIVLLGFIFFVLMG
FT                   IGYYLKTFKLLYSTKGIVFGATYTDIHVSLQFYRALAIVSFVAAILLLVGFYRKNIKYI
FT                   VAAPAIIIILAAIMVLTETAVQNLIVSPNELDKEKKYINYNIEYTKKAFGLDRVTEKNY
FT                   DMKKELTPKVLEENKATIDNIMINDYRPVKQAYNQLQAIRLYYKFNDIDIDRYTINGKY
FT                   RQVFLAAREMDHESLSPQAKTWINLHLKYTHGYGVVMSLVNDVTPTGQPAMIIKNVPPS
FT                   TNTDIKIDRPEIYFGELTNNYAIVNTKTGEFDYPSGDKNVQTNYKGTTGIPMTFINRIL
FT                   FSIYTGDARILLSTDITKDSKILIYRNIEQRVSKIAPFLLYDDDPYIVIDNGKLYWIID
FT                   AYTYSTNYPYSQPYGSMGINYIRNSVKVVIDAYNGDVKYYISDNNDPLVKVYSKIFPTL
FT                   FRDIKEMPYGLKQHIRYPQFLFDIQAEVYKNYHMTDPQVFYNKEDAWDIAKEKFEDKIE
FT                   YQESQYMIMKLPGETKEEYILMIPYTPATKANMVAWMAARMDGKNYGKLIVYKFPKNTI
FT                   IYGPLQIENMIDQDPNISKELSLWNQQGSTVNRGNLLSIPIDDSMLYVEPLYIQSQNQN
FT                   ALPEVKRVIVAYKDQIVMEDTLKNALNKLFNLNAQQISQQTVPSNTANDTQKQLIEKAH
FT                   ETYQNAMEAVKNGNWTDFGKYMDELKQILNELNESVKK"
FT   gene            36058..36134
FT                   /locus_tag="Thit_R0003"
FT                   /note="tRNA-Arg1"
FT   tRNA            36058..36134
FT                   /locus_tag="Thit_R0003"
FT                   /product="tRNA-Arg"
FT   gene            36482..36886
FT                   /locus_tag="Thit_0031"
FT   CDS_pept        36482..36886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0031"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbh:CLC_2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01360"
FT                   /db_xref="InterPro:IPR024307"
FT                   /db_xref="UniProtKB/TrEMBL:D3T559"
FT                   /inference="similar to AA sequence:KEGG:CLC_2199"
FT                   /protein_id="ADD01360.1"
FT                   /translation="MELSIEEIKNYFDFNNKKDDGQTHNHEFLGSTKLAAEDKKRKEGK
FT                   EEQHNHRFAGVTSQVIPDGDSHVHAILVSTDFYEDHHHEIGVITGPAIDVGDNKHVHFV
FT                   EGKTTVDDDHYHEFIFATLIEDPISDFEHY"
FT   gene            37074..37520
FT                   /locus_tag="Thit_0032"
FT   CDS_pept        37074..37520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0032"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   tpd:Teth39_2202 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01361"
FT                   /db_xref="GOA:D3T560"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D3T560"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADD01361.1"
FT                   /translation="MINKFMKAAILEANKSYQLREVPVGAVIVKDDQIIGRGFNQKEAT
FT                   NDVTAHAEIMAIKEACKTLGSWRLDDCSIYVTLEPCPMCAGAILEARIKRVYIGTESDK
FT                   SGAAGTVINLLNNPDLGSKTEVYFGIMEDECKMLLENFFKTLRE"
FT   gene            37525..37615
FT                   /locus_tag="Thit_R0004"
FT                   /note="tRNA-Ser3"
FT   tRNA            37525..37615
FT                   /locus_tag="Thit_R0004"
FT                   /product="tRNA-Ser"
FT   gene            37628..37722
FT                   /locus_tag="Thit_R0005"
FT                   /note="tRNA-Ser4"
FT   tRNA            37628..37722
FT                   /locus_tag="Thit_R0005"
FT                   /product="tRNA-Ser"
FT   gene            37984..38074
FT                   /gene="ffs"
FT                   /locus_tag="Thit_R0006"
FT   ncRNA           37984..38074
FT                   /gene="ffs"
FT                   /locus_tag="Thit_R0006"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            38385..40280
FT                   /locus_tag="Thit_0033"
FT   CDS_pept        38385..40280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0033"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="TIGRFAM: PAS sensor protein; metal dependent
FT                   phophohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; histidine kinase HAMP region domain protein;
FT                   PAS fold domain protein; KEGG: tex:Teth514_0032 putative
FT                   PAS/PAC sensor protein; SMART: metal-dependent
FT                   phosphohydrolase HD region; PAS domain containing protein;
FT                   PAC repeat-containing protein; histidine kinase HAMP region
FT                   domain protein; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01362"
FT                   /db_xref="GOA:D3T561"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D3T561"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADD01362.1"
FT                   /translation="MISDYNKKLFFVLFGFSMTVYALSIVHFLSGFENKIFIGGVILLI
FT                   SMGLSAILSKVLSRPLEKLNEGVKKIADGDFNFRLNITNSKEFAELSKNLNSVATELSQ
FT                   SYIKLKEQTENLMRQNKELQEFNAELEASYEQLEALAHELEVSERKYRLLVDNIRDILW
FT                   LTDKNFIIEFVNSRVVRYLNYTPQELIGKSLLEIVDEESKETLKEMMAGKINFSEINFK
FT                   SKEGLLVITETHVKRLKTDGEVVGIQGISRDITEVYHVKQQIAEKNNEILAINDVGKLL
FT                   TSGSDMKEVLNAIVEKVANMLNSPLCTIREYDKKSQKFILLIKGGKLRNYPILNEIELP
FT                   REDMNDLINLKEIKIKRVEEFPHDKNLAPIFAAKEVFSAVIVPLVSRNETIGILTVWTS
FT                   TKTVKNMSLLRSIASAVSVAIENSRLYDEIKKLFIKTIEALAYAVEAKDVYTKGHSMRV
FT                   SQYAALIGEYIGLSREKIEQLRIAGILHDVGKIGTSDAILLKAGKLTDEEYKVIKSHPE
FT                   ISRKILMPIDLPEEILEAVSKHHERYDGKGYPYGLKGEEIPIEAAILGVADAFDAMTSD
FT                   RSYRKGMNVEEAINELLKYKGTQFHPEVVDAFISLYMNEKHRLEEIKNQVFSNAS"
FT   gene            40339..41886
FT                   /locus_tag="Thit_0034"
FT   CDS_pept        40339..41886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0034"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: AAA ATPase; TIGRFAM: DNA polymerase III,
FT                   subunits gamma and tau; KEGG: tex:Teth514_0033 DNA
FT                   polymerase III, subunits gamma and tau; PFAM: AAA ATPase
FT                   central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01363"
FT                   /db_xref="GOA:D3T562"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T562"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ADD01363.1"
FT                   /translation="MYQSLYRKYRPKSFKEVVGQEHIVKTLKNQIKLNRIGHAYLFTGT
FT                   RGTGKTSIAKIFAKAVNCLNNAEGEPCNSCDICHAINNNTTMDVLEIDAASNNSVNDVR
FT                   ELRESVIYAPSQTKYKVYIIDEVHMLSTGAFNALLKTLEEPPSHVIFILATTEPDKLPD
FT                   TILSRCQRFDFKRIPTRLIAQNLDRICNDSGIKIEDKGLKTIALYGNGSMRDAISLLEQ
FT                   CISYKEGFITYEDVCEMLGVANDEMLFSLLDCINAKDVAASLKQLDKILSYGIDLGNFL
FT                   KSLTYILRDMVLYKTGGEELKEILYNNPETIKEKVQNFGIAFLTNALEKFTNLQREIKY
FT                   AISPLTLLEITILRLIKPEISYDMLSLLSRVEQIEDKLTKGQFFLKEEKEEDENKEINT
FT                   LPKKVKTTQIEQEDIDLEKVWIEVKETIKKERIALYAFIEKGTPYFKNGTIVVEYPEEN
FT                   ALFKEELNKAENKSFIEEIVKKLVGKSIHLKFELKKNEEELLVQQVKEFFGEDIEII"
FT   gene            41953..42288
FT                   /locus_tag="Thit_0035"
FT   CDS_pept        41953..42288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   tpd:Teth39_2199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01364"
FT                   /db_xref="GOA:D3T563"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D3T563"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADD01364.1"
FT                   /translation="MAKGGFPGGFNINNMIKQAQQMQEEIKKMQEQLVQKTVEATAGGG
FT                   MVKAVANGRKELVSIEINPDVVDKEDVETLEDLVLAAVNQALRNAEEMIASEMAKITGG
FT                   LNIPGLF"
FT   gene            42298..42897
FT                   /locus_tag="Thit_0036"
FT   CDS_pept        42298..42897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0036"
FT                   /product="recombination protein RecR"
FT                   /note="TIGRFAM: recombination protein RecR; PFAM: TOPRIM
FT                   domain protein; Zinc finger C4-type, RecR; KEGG:
FT                   tpd:Teth39_2198 recombination protein RecR; SMART: Toprim
FT                   sub domain protein; Helix-hairpin-helix DNA-binding class
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01365"
FT                   /db_xref="GOA:D3T564"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D3T564"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ADD01365.1"
FT                   /translation="MSYYSASLAKLIEELSKLPGIGPKTAQRLAFFIINMPIEEVKSLS
FT                   QSIIDAKEKIKYCKICYNITDTEVCNICNDEERDNSLICVVSHPMDVVAMEKIREYKGV
FT                   YHVLHGVISPIEGIGPEDIKIKELLDRVKNGNVKEVILATNPDIEGEATAMYIAKLLKS
FT                   LGVKVTRIAHGVPVGGDLEYTDVVTLSRALEGRREL"
FT   gene            43063..43464
FT                   /locus_tag="Thit_0037"
FT   CDS_pept        43063..43464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0037"
FT                   /product="CrcB protein"
FT                   /note="KEGG: tpd:Teth39_2197 CrcB protein; TIGRFAM: CrcB
FT                   protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01366"
FT                   /db_xref="GOA:D3T565"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D3T565"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADD01366.1"
FT                   /translation="MEYIYMGIGGFFGAVLRYLITIYFTKMHRTVFPIETFMINILGSF
FT                   LLSFITNFTMDKYKINTNLRLAITTGFIGAFTTFSTFSMETINLLKAREIYIALNYVIL
FT                   SIIGGLLMSYLGFEFADKIFEFLEEREKE"
FT   gene            43461..43847
FT                   /locus_tag="Thit_0038"
FT   CDS_pept        43461..43847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0038"
FT                   /product="CrcB protein"
FT                   /note="KEGG: tex:Teth514_0037 CrcB protein; TIGRFAM: CrcB
FT                   protein; PFAM: Camphor resistance CrcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01367"
FT                   /db_xref="GOA:D3T566"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:D3T566"
FT                   /inference="protein motif:TFAM:TIGR00494"
FT                   /protein_id="ADD01367.1"
FT                   /translation="MIKSTLYVGIGGFFGAILRYEISRHIKERRQIIIPIETFIINVLG
FT                   SFLLNFLSSPKINVNLDDDVKLFLTTGFLGAFTTYSTFSHETIDLIKNKKYFQAFKYMS
FT                   LTIIFGLIGGVLGYYIGNCVGNLI"
FT   gene            43902..45074
FT                   /locus_tag="Thit_0039"
FT   CDS_pept        43902..45074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0039"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tpd:Teth39_2195 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01368"
FT                   /db_xref="GOA:D3T567"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D3T567"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADD01368.1"
FT                   /translation="MNLNYNDLLSAISLALDVQEYKNMGHARRVAYISLRIAKMLNLNE
FT                   EDIKKIYYSAFLHDIGKGDVYEDFNTDEWWKHSVRGSEVVKKLPFGKHFSEIIRYHHEN
FT                   YDGSGYFKLKGDAIPLGAQIIFISDQLDIRYTSLVGKEREYNIRNNIKEFIKNSSGKMF
FT                   NPLVANALFELTRQEKFWLDYKYFDIKSVLKTVEPKDTISIEIDELEDIAEVFAQIIDN
FT                   RSRFTYNHSRGISDLAYHMAKVIGYDEETRRKIKIAGLLHDLGKLAVPNFILDKPDKLT
FT                   EEEFMVIKSHTYYTKKILKEIGGIDDIAEWAANHHEKLDGSGYPEGLKGDEIGEIDRHI
FT                   AVCDMYQALTEDRPYRKGLEPKQAIDIIARSVKDNKVSRKSFEILKEVVC"
FT   gene            45124..45396
FT                   /locus_tag="Thit_0040"
FT   CDS_pept        45124..45396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01369"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D3T568"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2194"
FT                   /protein_id="ADD01369.1"
FT                   /translation="MGMLFDYLKEIAVTKNIYDYNSENYQLVNEVKQTIKELKDAEIYF
FT                   QNVTDPDLVDYAIYRLESLKRKYIYLLKRAREEGINFDNFSSLLS"
FT   gene            45452..45724
FT                   /locus_tag="Thit_0041"
FT   CDS_pept        45452..45724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0041"
FT                   /product="pro-sigmaK processing inhibitor BofA"
FT                   /note="KEGG: tpd:Teth39_2193 sigmaK-factor processing
FT                   regulatory BofA; TIGRFAM: pro-sigmaK processing inhibitor
FT                   BofA; PFAM: sigmaK-factor processing regulatory BofA"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01370"
FT                   /db_xref="GOA:D3T569"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:D3T569"
FT                   /inference="protein motif:TFAM:TIGR02862"
FT                   /protein_id="ADD01370.1"
FT                   /translation="MNISIEYNIIIAYLIGLFLLYFLGWLLVVPKKFLLKIIINGIIGG
FT                   LILLIINLLGKSIGLYIAINPVTALVAGFLGIPGIILLIILQYIA"
FT   gene            45806..46069
FT                   /locus_tag="Thit_0042"
FT   CDS_pept        45806..46069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01371"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR012452"
FT                   /db_xref="UniProtKB/TrEMBL:D3T570"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2192"
FT                   /protein_id="ADD01371.1"
FT                   /translation="MTVKSDMEKAIATAQAALGTYAQFASSTEDPAAKQMFQQMQQDMQ
FT                   RHVTMLTNRLNYINNHNKLNQQSQATQQATQQNQQNVLTNKK"
FT   gene            46430..48017
FT                   /locus_tag="Thit_R0007"
FT   rRNA            46430..48017
FT                   /locus_tag="Thit_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            48105..51156
FT                   /locus_tag="Thit_R0008"
FT   rRNA            48105..51156
FT                   /locus_tag="Thit_R0008"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            51191..51299
FT                   /locus_tag="Thit_R0009"
FT   rRNA            51191..51299
FT                   /locus_tag="Thit_R0009"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            51307..51381
FT                   /locus_tag="Thit_R0010"
FT                   /note="tRNA-Asn1"
FT   tRNA            51307..51381
FT                   /locus_tag="Thit_R0010"
FT                   /product="tRNA-Asn"
FT   gene            51393..51467
FT                   /locus_tag="Thit_R0011"
FT                   /note="tRNA-Gly1"
FT   tRNA            51393..51467
FT                   /locus_tag="Thit_R0011"
FT                   /product="tRNA-Gly"
FT   gene            51591..52328
FT                   /locus_tag="Thit_0043"
FT   CDS_pept        51591..52328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0043"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tpd:Teth39_2190 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01372"
FT                   /db_xref="GOA:D3T571"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T571"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD01372.1"
FT                   /translation="MLNGKVAIVTGGAGDIGREICIELAKEGASIAIHYNNSYDKAVGL
FT                   KEYIKNNFSYAEIFKADISDRQQVNNMIDSIYNKFGRIDYLINNAGIAQIKPFIEITEE
FT                   DWDKMMNVNLKGIFNCTQSVLRYMLPQKYGSIINISSIWGISGASCEVHYSASKGGIIA
FT                   FTKALAKELGPSKIRVNCIAPGVIDTRMNNILNKEEKEHLIEDIPLMSMGKPQDVANAV
FT                   LFLLSDKSNFITGQVITVDGGFI"
FT   gene            complement(52352..53074)
FT                   /locus_tag="Thit_0044"
FT   CDS_pept        complement(52352..53074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0044"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: tpd:Teth39_2189 pseudouridine synthase; PFAM:
FT                   RNA-binding S4 domain protein; pseudouridine synthase;
FT                   SMART: RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01373"
FT                   /db_xref="GOA:D3T572"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D3T572"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADD01373.1"
FT                   /translation="MAKMRIDKLLSNIGIGTRKEVKKFIKEGLVLVNGNTVKDAGLIVD
FT                   TEFDEILFDGEKINYKEFIYIMMNKPKGVISATYDPIEKTVIDLLPQELKARNPFPAGR
FT                   LDKDTEGLLFITNDGNLAHKLLSPKKNVIKKYYAEILGFVNERDIKAFKEGIVLEDGYK
FT                   TLPADLEILLSSEVSKVYVYIREGKYHQIKRMFESVGKKVVYLKRLAMGSLTLDENLKP
FT                   GQWRELSEEELSLLKKSI"
FT   gene            53367..54413
FT                   /locus_tag="Thit_0045"
FT   CDS_pept        53367..54413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0045"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: tpd:Teth39_2188 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01374"
FT                   /db_xref="GOA:D3T573"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3T573"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADD01374.1"
FT                   /translation="MTAIKRKKVTMKDIAERLNLSINAVSLALNDKVGVSEETRKIVLK
FT                   TADEMGYFDENPSFIAKNHFRNICLLIEERNFRDTHFYTKVILGIENEAKKNNYDILVN
FT                   FMNQDDFQVPSSVETRKVSGILVVGTIKDEHLEKLLKYDIPTVLVDHASFTISTDAVLT
FT                   QNMPGSYMATQYLIRKGHTQIGFFGEIDFSLSFKERWLGFNEAMRNAGLNVDPIFNVNP
FT                   GYCVIGQVEQYVLSKNYKEVANIISKLDKLPTAWVCSNDSAAITLYNALSILGIKVPDD
FT                   ISVVGFDDIDICNIVTPHLTTIRINKELMGAKAVKRLLWRMENPKEPCDHIRMEVKLIE
FT                   RESVKEIY"
FT   gene            54475..56325
FT                   /locus_tag="Thit_0046"
FT   CDS_pept        54475..56325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0046"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: tpd:Teth39_2187 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01375"
FT                   /db_xref="GOA:D3T574"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3T574"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADD01375.1"
FT                   /translation="MSKKIKKFIALLVIVFFTASIFVGCGQSNSTQQESQEAKQQEEVK
FT                   KTGELRLATDWPYPFHGNPFGPGGIGGAWWFAYEPFAYYIPQTGEYIPRLAESWKVEGN
FT                   KVTVNLRKDAKFSDGEPFTSKDVINTVNLIQAMWQWPYDIESVEAPDDNTVIFTLSKTA
FT                   SSSFVHTLLTDGAMASLAPVHVYGDFAKSAQEVADLGKKIFYLQAEGKSVPEDVKTEYD
FT                   KKSEKLRKQVNDFSPFKTLGKLPVVGAFEPVKVTQSEMVLEANKYYWAYPQMKIDKVVF
FT                   KKWSSNEFVWASLISNEIDAAHPTMPKDVVEQLSTLNPKLHVITVSDLSDIALVFNFKK
FT                   PLFKDVNLRKAIAYVLDKNKIRDVSVWQANSYEDYADGILKSMEAKWITQDTLQKLTKY
FT                   NTDAAVAEEILKNAGYKKVGDTWQQSNGQPVAFTLSVYGPHNDWVLAAKEVAQQLNNFG
FT                   FKVEMKLIPEGMRDQVMRSGDYDAAIEFGSAWWGYPHPLTGYQRLYDGDVSAITNFPAK
FT                   DKYSTPWGELSPYDLTLELQKNLQDQNKAIEIIQQLAYITNEYLPVIPLYEKVLPIYYN
FT                   DGYRVKGWPAEDDAIWSLAPGGIERVYDLLITTGKLVPAK"
FT   sig_peptide     54475..54567
FT                   /locus_tag="Thit_0046"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.689 at
FT                   residue 31"
FT   gene            56341..57327
FT                   /locus_tag="Thit_0047"
FT   CDS_pept        56341..57327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0047"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_2186
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01376"
FT                   /db_xref="GOA:D3T575"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T575"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01376.1"
FT                   /translation="MNYFINKTLYLLIVFVIAISGVFVLVNNMPGDPAYGLAVSIAQQR
FT                   NMQIEQALEIAHKMMGIDPHESIFIRYGKFVSNLLKGNFGYSAFYNTSVNEIIAESLPW
FT                   TLFVISLATFLSFTIGIFLGAFAAQKRATITEGIISTVSSIIQAIPPFILAVLILFVFS
FT                   VRLKVLPLGGAYPVDIKPSFSLEFISKIFLHALGPMLAIAIPQMASWTLAMRGNTSQIM
FT                   EEDFIRFAEARGLRDSVIAAKYVRNNAMLPLVASLAISVGYMLGGQTLVESIFNYPGIG
FT                   FYFGKAIAVRDFGLLTGLFTLIVIGVILATFIADFVYALIDPRVKLK"
FT   gene            57324..58205
FT                   /locus_tag="Thit_0048"
FT   CDS_pept        57324..58205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0048"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_2185
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01377"
FT                   /db_xref="GOA:D3T576"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T576"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01377.1"
FT                   /translation="MKKENIANFYYDYIQPLLTNKKSLIGLMILLFYILMATIGPVVVP
FT                   LDMNSNFAERYQKPSLKHPFGTDYFGVDIFQQIVHGSRSVISLTLLASFFAVLIGTVIG
FT                   VARGYLEGIAGKIIDAIIMVFLVIPSFPALLILAAIFVNYDLNVVEIALLVAIWLWAPL
FT                   AKQISAQVLSIKSKEFIEASKMLNMPLSYILFSDIAKLLIPYIFINFVMQIKGAMEFSV
FT                   GLMFLGLARFDPTHWGIMLNYALYQAGALYTAKGFHYLFFIILNIVLLIYGGILLSQGV
FT                   EEVFNPRLRGNE"
FT   gene            58207..59187
FT                   /locus_tag="Thit_0049"
FT   CDS_pept        58207..59187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0049"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_2184 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01378"
FT                   /db_xref="GOA:D3T577"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T577"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADD01378.1"
FT                   /translation="MNPIIKVEDLKAVYLVREGTIKAADGISFEVPENSVTAIVGESAS
FT                   GKSTIIEAMTKTLPPNGRILSGKVLYNGKDILTLSNEELRKIKWKEIALVPQAAQQSLN
FT                   PTMKIIDHFKDTVEAHRVNWNHNELIKKASEKLKMVRLNPEAVLYAYPLQLSGGMKQRV
FT                   LIALALLLEPKVLILDEPTSALDVLTQAHIIQLLKELKKMLNITLIFVTHDIAVAAELA
FT                   DNVAVIYGGNLIEYNSTFQIFKNPLHPYTNGLINSIMAVNADMSKVKPIPGDPPSLLNP
FT                   PSGCRFHPRCEHAMEICKKEKPQLIKTENGAQAACYLYQGRRKVK"
FT   gene            59184..60164
FT                   /locus_tag="Thit_0050"
FT   CDS_pept        59184..60164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0050"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_2183 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01379"
FT                   /db_xref="GOA:D3T578"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T578"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADD01379.1"
FT                   /translation="MKQVIKIDHISKIFSRGFFKKQHKLVLSDINLEISQGDRLVIVGE
FT                   SGMGKTTLARIMANLELPSEGEVLWFEKNIQKLREKEKKLLRGKVQYIHQDPYASLHPA
FT                   KTIYKIIADPLRNAQKINGKEVYEKTKQLLEKVGLTPAEYFFNKYPHHLSGGGRQRLAI
FT                   ARALTTEPQVIIADEPISMIDMSLRAAIIKLFKDLNDLYGIAVILVLHDIGAAKYFTYE
FT                   KGEIAVLYGGKIVEKGKGREVLTNPVHPYTKVLINSSPIADPEIARNRVVEQLRSYEVP
FT                   VRTPESKWCPFAHACNYYTEKCLEEDPQLIVIDSSHEVACHVFGK"
FT   gene            60176..60346
FT                   /locus_tag="Thit_0051"
FT   CDS_pept        60176..60346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_1791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01380"
FT                   /db_xref="GOA:D3T579"
FT                   /db_xref="UniProtKB/TrEMBL:D3T579"
FT                   /inference="similar to AA sequence:KEGG:Teth514_1791"
FT                   /protein_id="ADD01380.1"
FT                   /translation="MKNKFYMFLSILVIVLAFIWISFFQKNGVELVLVVLSLGFSVFTI
FT                   LLILLYEKKKK"
FT   gene            60365..62248
FT                   /locus_tag="Thit_0052"
FT   CDS_pept        60365..62248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0052"
FT                   /product="Beta-galactosidase trimerisation domain protein"
FT                   /note="PFAM: Beta-galactosidase trimerisation domain
FT                   protein; glycoside hydrolase family 5; KEGG:
FT                   tpd:Teth39_2182 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01381"
FT                   /db_xref="GOA:D3T580"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3T580"
FT                   /inference="protein motif:PFAM:PF08532"
FT                   /protein_id="ADD01381.1"
FT                   /translation="MAKFADEFIIGANYWPRNHGIEMWKEWNYDEIKSEFIEAKSLGIN
FT                   VMRINLFWEDFQPKPDVISEEAVKKFDELIKICHEVDMKIAPTFFVGHMSGENWDVPWR
FT                   EGRNIYSDSFMLRYQIKLVRFFAERYKDESAILFWDLSNEPDNYVKAESRHDAWLWNYV
FT                   LSNEIKKYDKNRPVTLGIHQASLLTDNNFYPEDLQEGNDFLCMHAYPIYTDTCIDPVNS
FT                   IRSTYMAPFASKLTQAMGGKEVLLEEFGATTLMMSEDIEGDYYRVVLYSLLANESIGAM
FT                   AWCFGDFSVGERLPYNSTPFETQFGITAVDGRVKKAGLEIKAFSEFMNKIEYKDLKHKK
FT                   CNAAIIIPDKYYSALFVGNDYTPERNFRILLNSFILAKEAGIDVELARADGDFSKYKML
FT                   ILPSAYRKGHLNYDQWVKIMDFVKNGGTLYVSYDGISVEGFDEVFGIETQYSMVPKNET
FT                   VSVHCEELGIDLNYKALKFNKRLIAKPTTGRVIANDDENNPAIVINKYGKGNAVLVTYP
FT                   IELYLSYMPDVYKTDRSYLIYKYAKELSGIEYNVKVESPYIEVKEFDYDGKTLVLFINH
FT                   EDIDIDTKINVKEKTKNSEKIQDLISGRQINLEYLTIEANGVVAILLEKGV"
FT   gene            62257..63165
FT                   /locus_tag="Thit_0053"
FT   CDS_pept        62257..63165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0053"
FT                   /product="glycosidase PH1107-related protein"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   tpd:Teth39_2181 glycosidase, PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01382"
FT                   /db_xref="GOA:D3T581"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D3T581"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADD01382.1"
FT                   /translation="MFRLTRLSDKPILSPVKEHEWERGAVFNAAVIYEDNKFHLFYRAS
FT                   NNKFVLNTEKPEERYKFISSIGYAVSENGINFKRFDKPVLVGETPQEAWGVEDPRITKI
FT                   DNKYYMLYTGFGGRDWLDFRICMVWSFDLKNWKGHKIVLDEPNKDAALLSEKINGKYVL
FT                   FHRRMPDIWIAYSDDLVNWYDHKIIMSPKPHTWESKKIGIAGPPLKREDGWLLIYHGVD
FT                   DKNVYRLGAALLDLKDPSKVVARQKEPILEPELDWEINGLVPNVVFSCGAIEANDMYYV
FT                   YYGAADTHIGVAAIEKRKVKF"
FT   gene            63180..64079
FT                   /locus_tag="Thit_0054"
FT   CDS_pept        63180..64079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0054"
FT                   /product="glycosidase PH1107-related protein"
FT                   /note="PFAM: glycosidase PH1107-related; KEGG:
FT                   tpd:Teth39_2180 glycosidase, PH1107-related"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01383"
FT                   /db_xref="GOA:D3T582"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D3T582"
FT                   /inference="protein motif:PFAM:PF04041"
FT                   /protein_id="ADD01383.1"
FT                   /translation="MIRLKRLSDKPVLVPKAENEWERAAVFNTAAIYDNGLFHLIYRAT
FT                   DIGPHAKYGKYTSRLGYAVSKDGINFMRLDKPVMSNETEQELRGLEDPRIVKIDGIYYM
FT                   MYTGFGDRFDDDYRICLATSKNLIDWERKGVVLDEPNKDASLFPEKVEGKYVMLHRRYP
FT                   DIWIAFSDDLKNWYDHKPILKPIPNTWESTRVGIGGPPIKTKDGWFLIYHAADDNNVYR
FT                   LGAVLLDLEDPSKVIARQKQPILEPELKWEKEGYIPNVVFSCGNAVKDDTIYVYYGGAD
FT                   TVIGVATLEMKDIIFNRL"
FT   gene            64286..65332
FT                   /locus_tag="Thit_0055"
FT   CDS_pept        64286..65332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0055"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein; KEGG:
FT                   tex:Teth514_1787 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01384"
FT                   /db_xref="GOA:D3T583"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3T583"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADD01384.1"
FT                   /translation="MKALLLAGGLGTRLRPLTDDLPKPMVPIMGRPLLESIILNLKKSG
FT                   IDEVVISTYYKSQYIEDYFRQKEDLGVKIHYITEESPLGTGGAIKNAEKFFDDTFLILN
FT                   SDIVSDVNYADLIKYHKRKRAQVTIASIEVRDTSQYGVIEFDEKGFITAFKEKPKSGES
FT                   NSKYINAGVYVFEPDVLKEIPENTVVSVERETYPTLLEKGYRMAIYKFNGYWIDIGTID
FT                   KYKKVHEDILRGKSRFISTNFSRGIILGDNVKIHPTARVIGPAYIGNNTEIDAYATVGP
FT                   YTVIGNNCRIGQESKVSKSILWNNVKVRRFARLDNAVVTSECIVEVNMEIKNTVFTANR
FT                   LASSTMTT"
FT   gene            65365..66537
FT                   /locus_tag="Thit_0056"
FT   CDS_pept        65365..66537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0056"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   tpd:Teth39_2178 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01385"
FT                   /db_xref="GOA:D3T584"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3T584"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ADD01385.1"
FT                   /translation="MNITGRNVAFLSTYPPRECGIATFTQDLVNEIKKIKLINFAGVIA
FT                   INDNKVYEYDSDVKYQLQQFVREDYVRLARKLNNSNIDLLVIEHEYGIFGGKWGEYLLD
FT                   LVDNLNIPFVLTVHTVLSNPDEKQLMILRKLGEKSIRVVTMAKNTIPLLEKIYHIPSCK
FT                   ITVIPHGVPSLPVLPKETLKEKYGFQGRKIISTFGLINPGKGIEYGIEAISIVAQKYKE
FT                   VLYLILGQTHPNIKREFGEEYRERLQKLVRELGIEKNVKFVDKYLTKKEILEYLKMSDI
FT                   YMTPYLNKEQAVSGTLAYAAGLGKVIISTPYMYAEEILGEGRGLLANFRDANSLAKHIE
FT                   YVFENPEKRLQIESAIKKLGNAMMWNNVAYRYVIMILSVLDSRSKEEIVI"
FT   gene            66558..67607
FT                   /locus_tag="Thit_0057"
FT   CDS_pept        66558..67607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2177 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01386"
FT                   /db_xref="GOA:D3T585"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:D3T585"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2177"
FT                   /protein_id="ADD01386.1"
FT                   /translation="MKVSTKFQHLFNLTDDTGILQHSLYSIPDLTKGYTTDDNTRALIA
FT                   ASMLYEVYKDEKYLELLRRYLSFLIYAQNSKGYFRNFMNYNREFIEEVGSEDCFGRCLW
FT                   SLGYLLNTNLSNGFKNVALALLKKALPNVANLNFLRGNAYSLIGLSLLYNSDVTEFNKE
FT                   KIKNLMISISKKIVQRYRQNKDGEWKWFENVMTYSNAVIPWSLLKVYTVTKDEEVLEVA
FT                   KESMEFLAKVTFKNDYFKPVGCKGWYKKGNEKPAEFDEQPIEACETALMYTEAYKIFKE
FT                   EKYREKAFKCYKWFLGENSRNVSLVDEETGGCYDGLTKDGVNLNEGAESVISLIITEMI
FT                   VNHTDIVFK"
FT   gene            67661..68638
FT                   /locus_tag="Thit_0058"
FT   CDS_pept        67661..68638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0058"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: tpd:Teth39_2176 D-alanine--D-alanine ligase;
FT                   PFAM: D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01387"
FT                   /db_xref="GOA:D3T586"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D3T586"
FT                   /inference="protein motif:PRIAM:6.3.2.4"
FT                   /protein_id="ADD01387.1"
FT                   /translation="MKIGVLWRKFRNVEFQRKLMPDKVYDDAYDEAYHHYMAIKEAGFD
FT                   SVLIEWKEDPLETYETIKKEKVDLIFNASSMKEVAFLEVFNIPYVGSGLDLVATDKRMR
FT                   KDIVAFHGLPTPKYVVAKNSQEIPPVGHLRFPLFVKPISGRGSAGIDEENIVYDKDKLP
FT                   QVVSKITEKIGQAALIEEFIEGKEVTVGIIGYKHPQVLPLLEVGYNNVKTNTYEHKMFD
FT                   NEIIKCPMEVSKEVEEKIKETALNIYKVLNAKDFARIDMILSKDNVPYFLELNTFAGLT
FT                   MSSSKGEKHVHHGYMGYMAKAAGLTRGEFIGKIIESAIERYKLK"
FT   gene            68781..69548
FT                   /locus_tag="Thit_0059"
FT   CDS_pept        68781..69548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0059"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   tpd:Teth39_2175 3-ketoacyl-(acyl-carrier-protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01388"
FT                   /db_xref="GOA:D3T587"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T587"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADD01388.1"
FT                   /translation="MDFNDKVVIVTGGGQGIGRCIVQTFADKGAKVVIADIDDEAGIEN
FT                   EEYIKSKGGDSLFVHTDVSLEKDVGNLVDKTIKTYGKIDILINNAGVGARGTIYTRPME
FT                   EWDRVINVNLRGTYMCSKYVAPHMRDNGGGVIINIASTRAFMSEPHTEPYSASKGGIIA
FT                   LTHSLAISLGYDKIRVNSISPGWIEVSEWKKSREAKKPQLTEEDHLQHPAGRVGKPEDV
FT                   ANACLFLCSEEASFITGANLIVDGGMTVKMIYV"
FT   gene            69574..70149
FT                   /locus_tag="Thit_0060"
FT   CDS_pept        69574..70149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0060"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tte:TTE0070
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01389"
FT                   /db_xref="GOA:D3T588"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D3T588"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD01389.1"
FT                   /translation="MNKTKEKIFKAAIKTFSKSGFYKSTMEEIAENAGVAKGTLYYHFK
FT                   SKDDILEFLIEEGIKILKQEAIEEIGKLNNAVEKLRKIIFVQTNFLYRNHDFIIVLLSQ
FT                   IWGHGEVPRKFREKLYTYLELIENIIKEGKEQKLIADCDEKIVAAAFFGMISSILALKV
FT                   VEDSNEKFNPQDITDSVFNFALKGLQFQ"
FT   gene            70563..72776
FT                   /locus_tag="Thit_0061"
FT   CDS_pept        70563..72776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0061"
FT                   /product="YhgE/Pip N-terminal domain protein"
FT                   /note="KEGG: gym:GYMC10_5356 YhgE/Pip N-terminal domain
FT                   protein; TIGRFAM: YhgE/Pip N-terminal domain protein;
FT                   YhgE/Pip C-terminal domain protein; PFAM: ABC-2 type
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01390"
FT                   /db_xref="GOA:D3T589"
FT                   /db_xref="InterPro:IPR017500"
FT                   /db_xref="InterPro:IPR017501"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:D3T589"
FT                   /inference="protein motif:TFAM:TIGR03061"
FT                   /protein_id="ADD01390.1"
FT                   /translation="MKAFEVAAKEIEKIIKSRFIRVAVIVVAFMPLLYSFLYLYAFWDP
FT                   YSKLDKLPVAVVNEDRGGVYNGKQQNFGNEVVQKLKNNKEFKWDFVDYKKGIDGVKGKK
FT                   YYFMIVIPEDFTQNITSVDSSTPKKATIEYITNDKKNFLATQIGNKAIESLQTEIANSI
FT                   RKGYIDALFKSVDELGSGLKEASEAENKLATGTLELYNGARKLNENMSAALDGSKQIKD
FT                   GVLDLRNGLNQALNGSTALYNGASLLSQKFSDASNTEALLSGMNSLQNGITGINQGLND
FT                   ASNSAIKLKDGINSLVNGYNQVGQNVSSFADSISQLGSGLSQISTALDSAQVALKDYIA
FT                   KHPEASSDPELQKVLIAIAYSNAGIDSMSQNLNSGLTKVQQLNTALAQLQEASNTINNG
FT                   MDSLASGLSYMSQVSSQLVDGSNKLYSGVAQLSEGINTAGEKLKEISRGLYSLNNGIKS
FT                   LSDGSSKLYNGANSLYNGMVLVKDGTGQLADGAKSLYDNQTLLTQKLNEAAEKIRTGIT
FT                   TAKKDMINEPIILDTRRLYPVKNYGIGFAPYFIPLSLWVGSLILFFLIDIFDKEKYEGM
FT                   NNVSIQLGKFMSLALVGMLQSLVSSFVLVEGLKLDVHNLFYYYLINAVMSLTFIAIIQL
FT                   FVMLFGIAGKFFAVVLLMLQLTSSGGTFPMELLPKFFNVINPYLPMTYGVAGLREAISG
FT                   NNISAILHNISIIAGFGVLFLVFIILLAEKADKMEITQRLKQI"
FT   gene            73039..78570
FT                   /locus_tag="Thit_0062"
FT   CDS_pept        73039..78570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0062"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: tex:Teth514_1781 alpha amylase, catalytic
FT                   region; PFAM: alpha amylase catalytic region; glycoside
FT                   hydrolase family 13 domain protein Ig domain protein region
FT                   domain protein; Fibronectin type III domain protein;
FT                   glycoside hydrolase starch-binding; S-layer domain protein;
FT                   SMART: alpha amylase catalytic sub domain; alpha amylase
FT                   all-beta; Fibronectin type III domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01391"
FT                   /db_xref="GOA:D3T590"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004185"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031319"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D3T590"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADD01391.1"
FT                   /translation="MFNKRALGFLLSFLLIFTAVFGSMPMEFAKAETDTAPATAVVAGN
FT                   FQSKLGDTDWKGDSSITVMTYKGNGFYEYTTHTALPAGDYEYKIVLNGSQWIPDGFGNN
FT                   LKFHLDSDSVVTFYYNYNTSSVTDSTKYTPIPEEKLPRIVGTIQSAIGAGDDWKPETST
FT                   AIMRDYKFNNVYEYTANVPKGYYEFKVTLGPSWDINYGLNGEQNGPNIPLNVAYDTKIT
FT                   FYYDSVSHKIWTDYNPPLTGSDNNIYYDDLKHDTHDPFFRSPFGAIKTGDTVTLRIQAK
FT                   NHDLESAKISYWDDIKKTRKEVPMYKIGQSPDGKYEYWEIKLSFDYPTRIWYYFILKDG
FT                   TKTAYYGDDDEQLGGVGKATDVVNKDFVITVYDKNLDTPDWMKGAVMYQIFPDRFYNGD
FT                   PSNDRLKEYSRGFDPVEYHDDWYDLPDNPNDKDKPGYTGDGIWNNDFFGGDLKGIIDKL
FT                   DYLEELGISVIYLNPIFQSPSNHRYDTTDYTKIDELLGDLDTFKTLMRKAHARGIKVIL
FT                   DGVFNHTSDDSIYFDRYGKYLNTGVLGAYQAWKQGDQSKSPYGDWYEIKPDGTYEGWWG
FT                   FDSLPVIRQINGSEYNVKSWADFIINNPDAISKYWLNPDGDPNAGADGWRLDVANEVSN
FT                   DFWTHFRNSINTVKSNAPMIAEVWDDASSYLLGDSFNSVMNYLFRNAVIDFILDESFDD
FT                   GNVIHNPIDAAKLNQRLMSIYERYPLPIFYSTMNLLGSHDTMRILTVFGYNSADENQNS
FT                   QAAKDLAVKRLKLAAILQMGYPGMPSIYYGDEAGQSGGKDPDNRRTFPWGSEDKDLQDF
FT                   FKKVVNIRNENQVLKTGDLVTLYAKGDVYAFGRRIINGKDIFGKSYPDSVAIVVINKGD
FT                   AKQVSIDTTKFIRDGVTFTDALSGKKYTVHDGQIVVEVGSMDGAILISDPGQNLTAPQP
FT                   IQDLKAVSGNGQVDLSWSAVDKAVSYNIYRSTVKGGLYEKIASNVTQTSYTDTEVTNGL
FT                   KYVYAVTAVDNDGNESALSNEVEVYPAFPIGWAGNMNQVDTHVIGVNNLAEVYAEVWAQ
FT                   GLTDKPGQGENMIAQLGYRYLGDTVGDAVYSAVYNKVEGVEISKDWTWVDAQYVGDSGN
FT                   NDKYMAKFVPDMVGTWEYIMRFSSNQGHDWTYTKGPDGKTDEAKQFTVVPSNDVETPTA
FT                   PVLQQPGIESSRVTLNWSPSADNVAIFGYEIYKSLSEVGPFVKIATVSDSVYNYVDTDV
FT                   LNGTVYYYKIAAIDTSYNRTASNTVRATPDIIPIKVTFNVTVPDYTPDDGVYIAGNFPD
FT                   AFWNPSAQQMTKTGPNTYSITLTLNEGTKIEYKYARGSWDKVEKGEYGEEIDNRKVTVT
FT                   NQGSNTMVVNDTVQRWRDVPIYIYSPKDKTTVDANTSEIEIKGNTYKGAKVTINDESFV
FT                   QQENGVFTKVIPLEYGVNTIKIHVEPSGDKNNELTKDITITVTREKPGHERQPTPTSPT
FT                   EPSQEVSQGRVVVENNTTILKVDENKVAKEIKDTSKQEIQFDLTNIGTTPQKALEIPVT
FT                   VFNLIVEYNKNVVVKLDEVALQFDAKTLTISQEAIDLINKAGTIKLNIHNKGKITASTF
FT                   EPVTDAYDITIKAGDKDIKIGSPVKMTFNIEGAKDIRKVGAYYLNETTNQWEYIGGRID
FT                   RETNTITFEAKHFSTYAAFEYNKQFKDVTKDNWAYDVINVLASRHIIKGIDENTFLPNK
FT                   KITRAEFAALMTRALGIEEKPYKGQFNDVKEGAWYANAIEAAYKAGIILGDGKNMRPND
FT                   PITREEMTAVIMRIYGKLVEYREDNIGNTTFSDNNKISEWSRNVVANAAKLGIVKGYKD
FT                   NTFRPKENATRAEAAAMLYRVLEKTGNI"
FT   gene            complement(78602..78699)
FT                   /pseudo
FT                   /locus_tag="Thit_0063"
FT                   /product="hypothetical protein"
FT   gene            78809..79651
FT                   /locus_tag="Thit_0064"
FT   CDS_pept        78809..79651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0064"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; KEGG: tpd:Teth39_2171 fumarate
FT                   hydratase; PFAM: Fe-S type hydro-lyase tartrate/fumarate
FT                   alpha region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01392"
FT                   /db_xref="GOA:D3T591"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D3T591"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ADD01392.1"
FT                   /translation="MKEIQAKKITEIVKLLCIEANYELPQDIFESLKERIKEEISPLGR
FT                   EILKDIIANAEIAKTQRMPICQDTGIVIVFVEMGQEVHIVNGSLEEAINEGVRLGYEEG
FT                   YLRKSVVKSPILRINTGDNTPAIIHYHICKGDKFSITVMPKGAGSENMSALKMLKPSEG
FT                   VEGIKSFVIETVEKAGPNACPPLIVGIGIGGDFEYAPYLAKKALLRDIGQRNPDKMLAK
FT                   LEEELLREINMLGIGPQGLGGKNTALDVHIETYPTHIASLPVAVNLGCHVTRHATFIL"
FT   gene            79671..80231
FT                   /locus_tag="Thit_0065"
FT   CDS_pept        79671..80231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0065"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /note="KEGG: tpd:Teth39_2170 tartrate/fumarate subfamily
FT                   Fe-S type hydro-lyase beta subunit; TIGRFAM: hydro-lyase,
FT                   Fe-S type, tartrate/fumarate subfamily, beta subunit; PFAM:
FT                   Fe-S type hydro-lyase tartrate/fumarate beta region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01393"
FT                   /db_xref="GOA:D3T592"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D3T592"
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /protein_id="ADD01393.1"
FT                   /translation="MYKRVNTPLTEEIIDQLNAGDLVLLSGEIYTARDEAHKRMIESLK
FT                   KGRELPFEIKNSIIYYVGPCPPKPGQVVGSCGPTTSGRMDKYTPVLIELGLKGMIGKGY
FT                   RSKEVIEAMKRYKAVYFTAIGGAGALLAQKVKKAEIVAYEDLGTEAIYKFFVENFPVIV
FT                   TIDIYGNNLYDIGRKKYKTNLKR"
FT   gene            80237..80797
FT                   /locus_tag="Thit_0066"
FT   CDS_pept        80237..80797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0066"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="KEGG: tpd:Teth39_2169 phage SPO1 DNA
FT                   polymerase-related protein; TIGRFAM: phage SPO1 DNA
FT                   polymerase-related protein; PFAM: Uracil-DNA glycosylase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01394"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D3T593"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ADD01394.1"
FT                   /translation="MALLPLKELYLECLHCTKCDLSKTKTNMVFGEGNLRAKVIFVGEG
FT                   PGRDEDLQGRPFVGRAGQLLNKMLEEVGLKRGEVYIANIVKCRPPNNRVPLQSEVDACL
FT                   PYLRNQVAIIAPKIIVCLGATAAKAIIDKNFKITVMRGQWFERKGVKIIATYHPAAILR
FT                   DPEKLEPAMEDFKKIKEELDKLL"
FT   gene            complement(80856..82064)
FT                   /locus_tag="Thit_0067"
FT   CDS_pept        complement(80856..82064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01395"
FT                   /db_xref="UniProtKB/TrEMBL:D3T594"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2168"
FT                   /protein_id="ADD01395.1"
FT                   /translation="MKVTLGIFLNGQHGTIIAGSGKYLLYERKFSSQTFLNELQHCLTV
FT                   LGLSKKNVSKIYFTPPFSFSTENKTSSIIHLRLVPEQFSDFSVYPQNLQKSVKILQVAP
FT                   QKLLQKLEENEDQIKKAKVISIITPFGLVYPEKENKAVYTINKFNQGIILKSQNYPHLG
FT                   FHKREKSLLIADNFVVAVSPYVQQLKNFFTPYSPGIYWVENEAVYLTEDFLPQTCGKIY
FT                   EFTPLIQIARGAAVSFGYDYALALFKIGSIFKLFQIQNYVEVSELSSPFNFAATSSVQP
FT                   LLDDIKGKLPKALQDVIPIFNFSSCYFSDSYPYRFYQITFSKSLRYIGLLTAPSILTSI
FT                   TVCKQEDLYYNKKRLLKNLHLVNKNHNLLKKPIAFCQETPIRYLTSNHTILKVGLKESN
FT                   SFQ"
FT   gene            complement(82061..83170)
FT                   /locus_tag="Thit_0068"
FT   CDS_pept        complement(82061..83170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0068"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   tpd:Teth39_2167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01396"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:D3T595"
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /protein_id="ADD01396.1"
FT                   /translation="MQEITSDWIEPLWYGSIFLGSGGGGKSELLASVLDKALQNRVIPL
FT                   LTLDELSESNFFCGIGLLGSPELCEENLPSGKEASIAIEELEKYTGLQFNGISIVEGAG
FT                   VNIFYPLLAALQTGLPVIDGDAMGRAFPELQMTTYHLENLPVTPLVLVDGSYNVHLFLE
FT                   KQDTFLLELNTRQIVCQQGGVGYFAGFPYSGSVLKKVLLPSTLTFAREIGECFLHADNY
FT                   HELFNLLLEVTSNSFYGPIVEIFQGTIKNISAYETAKWKAATLISPKGEELQLLFQYEN
FT                   LLAFKNGHIAASVPDLISAIDLNKLKPVNNNEIYEGQPLVLLGLPAPLRLRINKALDVV
FT                   GPQCFGYRTIYVPLEKLYWDYYHEKEVFF"
FT   gene            complement(83179..84738)
FT                   /locus_tag="Thit_0069"
FT   CDS_pept        complement(83179..84738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0069"
FT                   /product="putative sigma54 specific transcriptional
FT                   regulator"
FT                   /note="KEGG: tpd:Teth39_2166 putative sigma54 specific
FT                   transcriptional regulator; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01397"
FT                   /db_xref="GOA:D3T596"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T596"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADD01397.1"
FT                   /translation="MIDSLQETFGFVTELQKECLSFISPSKAGYHVWSPPCTPTCPNIN
FT                   NCPYDLILSFKIEKNNFLVALPKKRSKNLKITPASIIKFLQIVLETSFASEQKTNNISL
FT                   LEQTLQFLAKQSNIEFYLFNNKGQIILSQNSSFVQLSPSDIWEKLGDANDSEGFIKTQW
FT                   GNFYYHLFVKNDKPIGLIIWKIKSFQKNVNFCPSSKDYSFAIIGKNYHFTEIKKLIRQI
FT                   AATEHTILLQGESGTGKELFARYIHHLSPRKDDPFIAINCAAIPENLLESELFGYEDGS
FT                   FTGARRGGKPGKFELANGGTIFLDEIGDMPLPLQAKLLRVLEDRQVERIGATISRPVDI
FT                   RVIAATNKNLKELIDAKLFREDLFFRLSVFPVYIPALRERRDDILLLLDFYLKNICLEQ
FT                   DKPFKIFSPETIEILQNYSWPGNIRELKNVVTYAVSLCKDDIITPQYLPKYLQNGVSFN
FT                   KYQFTNVKSEHSFIEDEQLKNQLEILLAKYGKSTQSKKLIAQELGISLATLYRWLKKYR
FT                   IR"
FT   gene            85116..86378
FT                   /locus_tag="Thit_0070"
FT   CDS_pept        85116..86378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0070"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: tpd:Teth39_2165 permease for
FT                   cytosine/purines, uracil, thiamine, allantoin"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01398"
FT                   /db_xref="GOA:D3T597"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D3T597"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ADD01398.1"
FT                   /translation="MEQHALDPIPESEKRPWYSIALIWAGSMICVSSLMVGGAIVQGMP
FT                   LLEAIIAGAIGYTIIIVYMTFQGMQGADLGVPTVVTSSSAFGREGARFIISTILAISCI
FT                   GWFGVQASVCGAAFSQIMNMWLGIYIPVWLSGLVWGIIMLVTAVYGYKALEYLNYIAIP
FT                   ALVFLSIVGLIQVFTIFGIENLINYVPKDRYSWSYAIGLAVGGFAVGGVIAADFSRYAK
FT                   SRKDALTSGLVGVWPAGMFLLVVGALLTVVAGTYDITIALAQLGLGFVGAVILILATWT
FT                   TNTVNAYSGGLAIVSLFNMENKLRPLMTFIAGAIGTVLAIMGILNYFTSFLTVLTASIP
FT                   PIAGSMIADYWICKKGNRNMWEAGIVDINWIGIASLVIGFIVALFMKTGISAINGIISS
FT                   MVCYLVLYYLLKVLKSATALD"
FT   gene            86516..87619
FT                   /locus_tag="Thit_0071"
FT   CDS_pept        86516..87619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0071"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   tpd:Teth39_2164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01399"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR024071"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:D3T598"
FT                   /inference="protein motif:PFAM:PF06032"
FT                   /protein_id="ADD01399.1"
FT                   /translation="MKKDIEKLEKIDLQAVEDIAVGAALLGTGGGGDPYVGKLMAIQSI
FT                   QRNGPVELIDVENIPDDALVVPVAMMGAPTVLVEKVPSGKEIFKAFDSLQSFLGKEVYA
FT                   VLPIEAGGVNSMIPIMVAGERKVPLVDVDGMGRAFPELQMVTYHLYGVSATPMVLADEK
FT                   GNSILLHTINNFWTESLARNATVVMGGSVMIAIYPMSGKDVKQAGIRNVVSYSAQIGKA
FT                   IREARKKGENPIEALLEVTGGYMLFKGKISDVQRRTTGGFVRGEAHIDGIDQYKGEAMI
FT                   IDFQNENLIARRNGKVVATVPDLICTVDAHTALPITTEGLRYGQRVFIIGIPCDEKWRT
FT                   EKGIETVGPRYFGYDVDYIPVEELNRG"
FT   gene            87636..89186
FT                   /locus_tag="Thit_0072"
FT   CDS_pept        87636..89186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0072"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   tpd:Teth39_2163 hydantoinase/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01400"
FT                   /db_xref="GOA:D3T599"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D3T599"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ADD01400.1"
FT                   /translation="MEYRIGIDVGGTNTDAVLVDENLELVESVKVPTTKDVSSGIFEAM
FT                   NKVLYKSKIDRKKIKYAMLGTTHATNAVAERKRLCKTAIIRIGKPATAAIAPLVDWPKD
FT                   LVEAVGNHYYLIAGGNEFDGREISPLDENELRKIAKEIKGKVESIAIVSVFSPVNNKHE
FT                   LRAKEILQEVLGEIPISLSHEIGSLGLLERENATVLNAALVEVARTTANSFKDALKREG
FT                   LTEAKIYLCQNDGTLMSIDYAMRYPILTIACGPTNSMRGAAFLSKLENALVLDVGGTTS
FT                   DIGVISQGFPRESSIAVEIGGVRTNFRMPDLISLALGGGTIIREKNGEIKIGPESVGYR
FT                   ITEEALVFGGKTITATDIAVRLGLAEVGSKEKVKDIPLEFAKRVYAKMQEMVNEAIDKM
FT                   KTSKDPQPLVLVGGGSIIIGNEIHGVSEIIRPNNFGVANALGAAIAQVSGEVDRIYSLS
FT                   EMSREAALNDAKQRAINEAIKAGANPDTIEIVYVEDIPLAYLPGNAVKIRVKAAGSLI"
FT   gene            89388..90116
FT                   /locus_tag="Thit_0073"
FT   CDS_pept        89388..90116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0073"
FT                   /product="Asp/Glu/hydantoin racemase"
FT                   /note="PFAM: Asp/Glu/hydantoin racemase; KEGG: chy:CHY_1338
FT                   hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01401"
FT                   /db_xref="GOA:D3T5A0"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A0"
FT                   /inference="protein motif:PFAM:PF01177"
FT                   /protein_id="ADD01401.1"
FT                   /translation="MKLKIIVPITSDEFNEEVKREIKHYVDPDDYVDVENLDYGPASIE
FT                   CEYDEAMAVPDILNKVKKAQEEGFEGIVIDCFGDPGVHAARELVDIPVCGGFEPPMQIV
FT                   LGLGQNIGVITVLPNVVPMLHDLVAKMGIEKRVKSIRYVNIPVLDLGDKQKLEDALFKE
FT                   SLEAIQKENVHVIVLGCTGMMGVARNLMNRLKEKGYDVPVIDPAFAAVRMVKTYVRMGL
FT                   KHSRLTYMIPPVKLYTWWEK"
FT   gene            90516..92103
FT                   /locus_tag="Thit_R0012"
FT   rRNA            90516..92103
FT                   /locus_tag="Thit_R0012"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            92190..95158
FT                   /locus_tag="Thit_R0013"
FT   rRNA            92190..95158
FT                   /locus_tag="Thit_R0013"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            95193..95300
FT                   /locus_tag="Thit_R0014"
FT   rRNA            95193..95300
FT                   /locus_tag="Thit_R0014"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT   gene            complement(95342..95560)
FT                   /locus_tag="Thit_0074"
FT   CDS_pept        complement(95342..95560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0074"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: tpd:Teth39_2160
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01402"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A1"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ADD01402.1"
FT                   /translation="MMHELITFGEICPLPLLKAIEKYKKMEKGDMLKIVVDHSCSLKNI
FT                   QEYFLKLNCSVEIDEVLNGVWEIYIKK"
FT   gene            complement(95572..96465)
FT                   /locus_tag="Thit_0075"
FT   CDS_pept        complement(95572..96465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0075"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tpd:Teth39_2159 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01403"
FT                   /db_xref="GOA:D3T5A2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADD01403.1"
FT                   /translation="MNINNLRAFYKTVYYKSISSSAKELYLSQPAISQQIKALEKDLKT
FT                   TLLKRSNRGVIPTPAGELVYQYAERILNLYDNMIQDLQCCENDRINRLTISCCPTIGQY
FT                   ALPCALHEFKKKNKNITLHVEHNFSNEVIHHIKEGGTDIGFIEGCYSDENINCIPLGEF
FT                   KMHFVASGNWELKNLPKNKLFYYNFFIIHKNCASRKIIEETLLEYGIDINKLKIEMESP
FT                   SIESIKSSIAAGHGLSILPYISIKKELYTKTLTIVEVDNIEFNYTYSLIYDKKIRKKIK
FT                   SDFIDFIKNSGKTFFC"
FT   gene            96665..97318
FT                   /locus_tag="Thit_0076"
FT   CDS_pept        96665..97318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0076"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: tex:Teth514_0045 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01404"
FT                   /db_xref="GOA:D3T5A3"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A3"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ADD01404.1"
FT                   /translation="MEAVKKSKKKKANQFPYGVVLLVVIVIIGIILSKQSTKLAVYWAF
FT                   GIAFGFVLQKARFCFTASLRDPVLTGSTSLTRAVIVAFMIATIGFAAIQYNAYLRGEAI
FT                   PGNIAPVGIHTVIGATMFGIGMVIAGGCASGTLMRVGEGFMMQWLSIIFFIIGSLWGAK
FT                   DFGWWTKVSIAKSPKVFLPDVFGWGVAFFGQLILLGLLFILAEWYEYKRFNAKN"
FT   gene            97339..97566
FT                   /locus_tag="Thit_0077"
FT   CDS_pept        97339..97566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0077"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: tpd:Teth39_2157
FT                   SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01405"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A4"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ADD01405.1"
FT                   /translation="MAEYRLDCLGEACPVPLLKTQKEMEKLKVGDVLIVEIDHSCAMKN
FT                   VPEWARNMGYNVEIEEVDDGQWEVYIEKTK"
FT   gene            97583..98116
FT                   /locus_tag="Thit_0078"
FT   CDS_pept        97583..98116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0078"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: tpd:Teth39_2156 protein of unknown function DUF395,
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01406"
FT                   /db_xref="GOA:D3T5A5"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A5"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ADD01406.1"
FT                   /translation="MNFQEHPFFKKIIKDAWSYWTGAVLLGLLNIALFAFSGHPWGITT
FT                   TFSYWGAWIFRALGGHPETWTYFQNPSHAKALTQSVFTNTGSVQDIGIILGAFLATLLA
FT                   SQFKIKKIKSHKQVVAAILGGLLMGYGARIAFGCNIGAFFSGVSSMSLHGWVYTVFILI
FT                   GAWIGSKLLVKYFM"
FT   gene            98163..99386
FT                   /locus_tag="Thit_0079"
FT   CDS_pept        98163..99386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0079"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tpd:Teth39_2155 FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01407"
FT                   /db_xref="GOA:D3T5A6"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A6"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ADD01407.1"
FT                   /translation="MEKKKEYYDVVVIGGGPAGMTAAIYCGRARLKTLLIEKSLVGGLA
FT                   TYTSEIENYPGFPEPVAGLELMKLFEQQTKRFGVQIKLTDVKGLRIEEDYKVVSTFRVD
FT                   YYAKAVIIATGGKPRLTGAKGEENFLYDKGISFCATCDAAYYTDKKVMIIGSGDAAIEE
FT                   GIFLTKFAREVHVSVIHDEGIMDANKVAQEKALKNEKMIFHWNTMVEAFEGNERLERVV
FT                   LKNLKTGELIPVDVDGCFLFIGYVPNTEIFKGLIDMTPKGYIITNENMETNIDGVYAVG
FT                   DVRDKFLRQVATAVGDGAIAGVMAEKYIEETDYFTNEILKVKETVLAYVYNAVEAKDRE
FT                   YLMKVEEFHKKYANKLKMCRIDIYKSDRLAKRLYCEKVPCIAVVKEGKVAKHIYDLEDF
FT                   EKELLSCI"
FT   gene            100088..101500
FT                   /locus_tag="Thit_0080"
FT   CDS_pept        100088..101500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0080"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_1868 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01408"
FT                   /db_xref="GOA:D3T321"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:D3T321"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADD01408.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLNREMEFQKTTEVHSISSASEDGRNEV
FT                   QRYTGKMLEMIVERGNMEAAYKRVVANKGSHGVDGMGVDELLPYLKENWATIKQQLLEG
FT                   KYKPQPVRRVEIPKPDGGKRLLGIPTVLDRLIQQAIAQILNKVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGIKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVRSR
FT                   SAGNRVMKSIKKFIESKLKLKVNEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            101644..102591
FT                   /locus_tag="Thit_0081"
FT   CDS_pept        101644..102591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0081"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: tpd:Teth39_2154 ROK
FT                   family glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01409"
FT                   /db_xref="GOA:D3T5A8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A8"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADD01409.1"
FT                   /translation="MGRILCGVDLGGTKISTGLVDEKGTIIKSIKIPTMAEKGPEEVIN
FT                   RIERSIYDVLKETGLKLSDLKGVGIGSPGPLDAKRGVVVSPPNLPGWDNVPIVDILSRK
FT                   LELEVKLENDANAAAIGEHLFGAGRGIDNFVYITVSTGIGGGVIIEGKLYSGENSNAAE
FT                   IGHHTINFDGPRCNCGNYGCFEAFASGTAIARFAQQGIQDGENTMIKDLAKDGVVKSEH
FT                   VFEAAKLGDEFAKVLVDKEAFYLGVGISNIMAFYNPKRVAIGGGVSTQWEMLYDKMMET
FT                   IKEKALKPNAAVCEIVKAELGENVGVLGAAALLL"
FT   gene            102602..103174
FT                   /locus_tag="Thit_0082"
FT   CDS_pept        102602..103174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0082"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: tpd:Teth39_2153 DNA-3-methyladenine
FT                   glycosylase I; PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01410"
FT                   /db_xref="GOA:D3T5A9"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5A9"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ADD01410.1"
FT                   /translation="MNRCPWCLSDELYIKYHDEEWGVPVHEDKKHFEFLVLESAQAGLS
FT                   WITILKKRENYRKAYADFDPIKVSQYDEKKIEELIKNSGIIKNRKKIEASVHNAKRFIE
FT                   IQQEFGSFDRYIWSFVDYKPIINKWERIEDIPSKTELSDKISRELKKRGFIFIGSTIIY
FT                   SYMQAVGIVNDHLISCFRYKELIESFK"
FT   gene            103310..103534
FT                   /locus_tag="Thit_0083"
FT   CDS_pept        103310..103534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0083"
FT                   /product="Sigma-G inhibitor, Gin"
FT                   /note="PFAM: Sigma-G inhibitor, Gin; KEGG: tpd:Teth39_2152
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01411"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B0"
FT                   /inference="protein motif:PFAM:PF10764"
FT                   /protein_id="ADD01411.1"
FT                   /translation="MVLSMESIATRKKCFICEQQSEDGIEVLGKFLCTNCQEKLIDLSP
FT                   FDESYDFYKQKMIDIWEGYMKGIRYENRI"
FT   gene            103601..105025
FT                   /locus_tag="Thit_0084"
FT   CDS_pept        103601..105025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0084"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   tpd:Teth39_2151 Orn/Lys/Arg decarboxylase, major region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01412"
FT                   /db_xref="GOA:D3T5B1"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B1"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ADD01412.1"
FT                   /translation="MTAPLYEAIMDYVKKQIIPFHMPGHKQGRIFPEEYLVNLTKIDLT
FT                   EVPGLDNLHNPEGPILEAQKLAARAFGAKESFFLVNGTTSGIYAAMYAVLNPDDKVLIM
FT                   RNSHKSVYNGLVLTGAVPFYINPEIDYENGIPMGVNIDKLEECLKKNGSIKAVVITYPN
FT                   YYGFCSDIEKISDIIHKYHKILIVDEAHGAHFPFSGNLPLSSLQVGADIVVQSIHKTLS
FT                   SFTQSSILHLNSDRVDTNRLKYFLSLFQSTSPSYLLMSSLDLARDYMEKEGKNRLEKAI
FT                   ILAEYARHEINTLGGVRCLGEEILGSFGIVDFDKTKLTISVKNLGITGPEAEGFLRENF
FT                   NIQVEMADTFNILAMVTLADNKEEVDLLIKGLANMKNLKKDKKLEVEIEDYPDVPEMVL
FT                   KPSEAVRQKTKWASLEDAEGSICADFIIPYPPGVPLVCPGERIKKDMVKYINVLYNKGI
FT                   KILGLNKNNSLLVCEI"
FT   gene            105022..105636
FT                   /locus_tag="Thit_0085"
FT   CDS_pept        105022..105636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0085"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="TIGRFAM: thymidylate kinase; KEGG: tpd:Teth39_2150
FT                   dTMP kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01413"
FT                   /db_xref="GOA:D3T5B2"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B2"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ADD01413.1"
FT                   /translation="MKGKFISFEGIDGCGKTTQIKFLKEYLLKKGYNILVLREPGGTNV
FT                   GEKVRDILLDKYNFISPVTEMLLYASSRAQLVEEKILPAIEEGKIVLLDRFVDSSYVYQ
FT                   GYARGLGIEKVKIVNEIATMGILPDVTIYIDITPEEAMKRRGKREADRLERESWDFHKK
FT                   VREGYIKLVKEYPKRFVFINGMQEIVKVHQDIIDAVKKYLL"
FT   gene            105649..105978
FT                   /locus_tag="Thit_0086"
FT   CDS_pept        105649..105978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0086"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   tpd:Teth39_2149 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01414"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B3"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ADD01414.1"
FT                   /translation="MKLVLAIVQDEDVRRLMDGLTEGGFSFTRIASTGGFLRSGNTTLI
FT                   IGVEDEKLEDVISIIEQKCKTRDRIITSPTPMGGATDIFLPQAVEVTIGGATVFVLNVE
FT                   KFLRI"
FT   gene            105989..106426
FT                   /locus_tag="Thit_0087"
FT   CDS_pept        105989..106426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0087"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   tpd:Teth39_2148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01415"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B4"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ADD01415.1"
FT                   /translation="MRIQEVKSPKISSDIKSEYNKSRVTKKFIDTFDEELDQFHQDKLS
FT                   EILSEIDSAAQKLKESLTLQDLINYKKLVKKFLQEATNGMLKYTKKEYLDGRGRKKIYS
FT                   LVEKVNGKLEKLTEEFLKDSKHLELLKMIDDIRGLLIDIYS"
FT   gene            106435..107409
FT                   /locus_tag="Thit_0088"
FT   CDS_pept        106435..107409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0088"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tpd:Teth39_2147 DNA polymerase III, delta
FT                   prime subunit; TIGRFAM: DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01416"
FT                   /db_xref="GOA:D3T5B5"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B5"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ADD01416.1"
FT                   /translation="MYRIYGHETVLNIFKSVISQNKISNAYLLVGEKGLGKRFMAEYFA
FT                   IMVNCKKETEKPCFKCSSCLKLMDKNHPDVFFIEPEENSIKVDTIRYITNEINIRPYEA
FT                   NKKIFIIDQADKMTVSAQNAFLKTLEEPPLYGLFILIASQQQKLLPTIISRCNIVRFGK
FT                   ESKNTIKNYLICEQNIPEKEAEVLAHIADGNFDQANKLTDNEYLNFRKETIQEIEKILT
FT                   IRGFEVIEEFEFFDKNKDNIEEVLKIMLYYVRDLLIYKVTKDASFIKNIDFLNKIQQME
FT                   SQLTINKLNNIINKIEQFNSQINSNVNYQLAVENLLLDMAGGL"
FT   gene            107412..108290
FT                   /locus_tag="Thit_0089"
FT   CDS_pept        107412..108290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0089"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: tpd:Teth39_2146
FT                   PSP1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01417"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B6"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ADD01417.1"
FT                   /translation="MVTVVGVRFKKAGKIYYFDPGDLPIEIGDKVIVETIRGIEFGEVV
FT                   VGIKEVAEEEIVAPLKKVIRIATPEDVEHYYENKKKEAKAFEICLEKIQQHGLEMNLID
FT                   VEYTFDNTKVIFYFTAEGRVDFRELVKDLAAVFRMRIELRQIGVRDEAKIIGGLGPCGR
FT                   PLCCTTFLGEFEPVSIKMAKDQNLSLNPTKISGICGRLMCCLKYEQEMYDKIKAELPKV
FT                   GSTIRVGDKEMKIAEVDVIRRKLKVKVKNAEGIEIIKEYDPEEVEVIEEREEEIEENYE
FT                   EELENMEEIEE"
FT   gene            complement(108408..109631)
FT                   /locus_tag="Thit_0090"
FT   CDS_pept        complement(108408..109631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0090"
FT                   /product="Arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="KEGG: tpd:Teth39_2145 arginine deiminase; PFAM:
FT                   amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01418"
FT                   /db_xref="GOA:D3T5B7"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B7"
FT                   /inference="protein motif:PRIAM:3.5.3.6"
FT                   /protein_id="ADD01418.1"
FT                   /translation="MTKVVTAPRVSSEINKLKMAILHRPGKELERLTPQNLSELLFDDI
FT                   PWVRRIQEEHDNFVKVLQQNNVQVLYLQNLLEEILKEENVKEKFIDELLQVNGVTSPKI
FT                   NNYLKEFLKEKSPNNVAEIAIAGLALNEIKIKKSMMGLAEYIYQDNYFYIKPLPNLYFT
FT                   RDPGAMIDGGLMISSMKTAVRRPETLILKYIYKYHEIFRKNNVPWWYDDSYPHSIEGGD
FT                   VLILSEKVIAVGCSERTTPQAIEQLAHNLFEKGSSVEKILVVQIPINRSYMHLDTVFTM
FT                   VDTNRFVFYPGIKNDLRVFSIIKEEKGFSINQEKDLQTALKNALNLYTIDIIPTGGLNA
FT                   ITSAREQWNDSTNTLAIAPGVIVAYSRNEISNKIMEKEGIKVIPIEGSELSRGRGGPRC
FT                   MTMPLLRE"
FT   gene            109770..110516
FT                   /locus_tag="Thit_0091"
FT   CDS_pept        109770..110516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0091"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: tpd:Teth39_2144
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01419"
FT                   /db_xref="GOA:D3T5B8"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B8"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ADD01419.1"
FT                   /translation="MLKDGERLDELNLKNLVIIQHKDKFKFGMDAVLLANFVTAKKGDK
FT                   IVDLGCGTGIIPILIAAKTYDTFIYGVEIQEDMADMATRSVVINNMEKRIKIIQGDVRG
FT                   IEKTLGYEKFDIVTSNPPYMPVKAGFDKKRKSENIARYEIYGGLEEFIKAASKLLKFGG
FT                   KFFMVHRAERLVDILYFLRKYNLEPKKLRFVYPYVDSKPNLLLIESKKGSQPGLNILPS
FT                   LYVYEKNGEYTKEIVEIYSKEKLEEG"
FT   gene            110519..111337
FT                   /locus_tag="Thit_0092"
FT   CDS_pept        110519..111337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0092"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: tpd:Teth39_2143
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01420"
FT                   /db_xref="GOA:D3T5B9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5B9"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ADD01420.1"
FT                   /translation="MDYGILYLCPTPIGNLEDITLRVLKILKEVDIIAAEDTRQTLKLL
FT                   NHFDIKKPLTSYHEHNKKTKGAKLIDELKKGKSIALVTDAGTPAISDPGEDLVKLCIEE
FT                   DIKVVPLPGPTAAITALVASGLDTSSFVFEGFLPTKSKERKKRLNRISKEERTIILYEA
FT                   PHRLKETLHELKSYVADRKVVIARELTKIHEEFIRGTVDEVLVKLGDEIKGEIVLIIEG
FT                   AQKQQVEEKPEILVQKYLEGGMDKKEAIKRAAKELGIPKSQVYKLIIGKK"
FT   gene            111474..112343
FT                   /locus_tag="Thit_0093"
FT   CDS_pept        111474..112343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0093"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="KEGG: tpd:Teth39_2142 cation diffusion facilitator
FT                   family transporter; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01421"
FT                   /db_xref="GOA:D3T5C0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C0"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ADD01421.1"
FT                   /translation="MDKQKAALLSMISNSALIIMKLVAGVLMHSMVVISAAVDSSIDLI
FT                   ASIIAFFSIRVSVKPADEDHPYGHNKYENISGFIEAILIFFAAVLIIYEAVGRIIAGTY
FT                   VEKLEMGIAVMLFVSFVKGIVSYTLFKVSKKENSIALKADATNLLTDVFTSLGVTTGLV
FT                   IIKVTKLAILDPIISIFVALIIIKTSFDLTKEVLKDLTDSSLPDEEVKEIENIIKANPE
FT                   VTSFHKLRTRKSGTKREVDVHVRVDRNYNIVEAHELSHKVSKQIMDKFPDSHVIIHIEP
FT                   EGKKEEEK"
FT   gene            complement(112379..112630)
FT                   /locus_tag="Thit_0094"
FT   CDS_pept        complement(112379..112630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0094"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: tpd:Teth39_2141 AbrB family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01422"
FT                   /db_xref="GOA:D3T5C1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C1"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADD01422.1"
FT                   /translation="MLKSTGIVRKVDELGRVVIPIELRRTLNIAERDALEIYVDGEQIV
FT                   LKKYEPACIFCGNAENVINYKGKNICKNCLAELKKSVD"
FT   gene            112809..113393
FT                   /locus_tag="Thit_0095"
FT   CDS_pept        112809..113393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0095"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   tpd:Teth39_2140 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01423"
FT                   /db_xref="GOA:D3T5C2"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C2"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADD01423.1"
FT                   /translation="MINYIWFFMIAIGILIGIINGRMAEVSKAIVDSAQSAVTISIGLV
FT                   GVMALWLGIMKIADKSGLTDIIAKLLKPIIIKLFSDVPENHPAISAIIMNISANMLGLG
FT                   NAATPFGIKAMEYLQELNKKDSASNAMCRFLVINTASVQLIPAVMIGIRASLGAQNPAD
FT                   FVIVSVLSTSTALVAGLILNKHLEKMPIFKE"
FT   gene            113399..113920
FT                   /locus_tag="Thit_0096"
FT   CDS_pept        113399..113920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0096"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   tpd:Teth39_2139 nucleoside recognition domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01424"
FT                   /db_xref="GOA:D3T5C3"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C3"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ADD01424.1"
FT                   /translation="MIKIISEWIIPILVFVIPFYGIIKNVKVYEVFVDGAKEGISVVIK
FT                   IFPALVAMLVAIGVLRASGALDLLGEFLMPFTNKIGMPQELVPLALIRPLSGSGALGIA
FT                   AEIMKTHGVDSLIGKMASAMYGSTETTFYVLAVYYGAVGIKKMRHSVISGIFADIIAIL
FT                   SCVFYSRLFF"
FT   gene            114001..115404
FT                   /locus_tag="Thit_0097"
FT   CDS_pept        114001..115404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0097"
FT                   /product="polynucleotide adenylyltransferase/metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: tpd:Teth39_2138 polynucleotide
FT                   adenylyltransferase/metal dependent phosphohydrolase;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   Polynucleotide adenylyltransferase region; metal-dependent
FT                   phosphohydrolase HD sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01425"
FT                   /db_xref="GOA:D3T5C4"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C4"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADD01425.1"
FT                   /translation="MATIPKLIRKLGKEAYNLYIVGGYIRDRILNREAKDYDFVVQENA
FT                   ERIAKLAAEKLGGTFVPFMAEKGTYRVVVGDEILDFTNLRGEDIYIDLAHRDFTMNAMA
FT                   IKLTDYFEFEYIIDPFGGVTDIKNRKIKHVGVMTFKEDPLRALRAIRFAATYKFDIDEA
FT                   TKAKIREEAELIKQVAPERIMNEIFIILKEKNSHKYLRMMEDLKLMENIFEEVAKMKEV
FT                   GKCYYHLTNAWIHSLKTVEEYENIVNSMRFPKGVYDIVSEYLNRKLSSDNKVKDIIKLG
FT                   ALFHDIGKTEALYIDTENRVHFYNHEIKGAEIVKKIASRMKMPKKESSLLKKLVLYHMK
FT                   PLMYYINGGPTNKSLFRFFSELKDDSIAILLLSQADFTATRLNLGKEEEIPKFTDFITR
FT                   LLKRYVEFKETEKPLLSPLDIIINFDVKDGEKLGQILYEIRKNRFYGEIQDKNDAIEFV
FT                   KERMKIEKV"
FT   gene            115739..117640
FT                   /locus_tag="Thit_0098"
FT   CDS_pept        115739..117640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0098"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="KEGG: tex:Teth514_0066 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01426"
FT                   /db_xref="GOA:D3T5C5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C5"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ADD01426.1"
FT                   /translation="MKKTFYITTPIYYPSDKLHIGHSYTTVAADAMARFKRLTGYDVKF
FT                   LTGTDEHGQKIQRIAKEKGMSPKEYVDGIVEWIKNLWKIMDISYDQFIRTTDKYHEEIV
FT                   QKIFTKLYEKGDIYKSEYEGWYCTPCESFWTESQLVDGKCPDCGRPVERVKEEGYFFKL
FT                   SKYGDRLLQYYDEHPDFIQPESRRNEMINFIKSGLEDLFVSRSSFDWGIKVPFDPKHVI
FT                   YVWIDALSNYITALGYSTYHDDDFKKYWPADVHLVGKEIMRFHTIIWPAMLMALDLPLP
FT                   KKVFGHGWLILEGGKMSKSKGNVVDPKELVSKYGVDAVRYFLLREVPFGADGVFSNEAL
FT                   INRINSDLANDFGNLLSRTVTMIEKYFGGILPKPSQKEEVDDDLINTAQNLPKTVEEYM
FT                   DKLQFSNALIEIWKLVRRANKYIDETMPWVLAKDESKKERLGTVLYNLAEALRFIAVLI
FT                   SPFMPNTPKKIFEQLGIEENLTTWESLKFGLLKEGTKVKRGEIIFPRIDVNKELAAVEE
FT                   KAEKEEKKINYITIEEFAKIQLRVAEILEAERVEGSDKLIKMKLRVGEEIRQIVGGIGR
FT                   HYASEELVGKKIIIVYNLEPKKLMGMESQGMLLAASIEGKMSLLTVDKDIESGAKIS"
FT   gene            117653..118420
FT                   /locus_tag="Thit_0099"
FT   CDS_pept        117653..118420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0099"
FT                   /product="hydrolase, TatD family"
FT                   /note="KEGG: tpd:Teth39_2136 TatD family hydrolase;
FT                   TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01427"
FT                   /db_xref="GOA:D3T5C6"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C6"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ADD01427.1"
FT                   /translation="MLVDSHAHLEDDKYDKDREEIIEECKKDLTFLINVGSNLLTSKQS
FT                   IELAHNYDFIYASVGIHPHDAQEEFDKVEEIERLALQEKVVAIGEIGLDYHYNDPPKEF
FT                   QKEVFTKQIKLAKKLNLPIIIHDRDAHEDILDILKKEWTKDLRGVFHSYSGSVEVAFQV
FT                   IEMNFYISLGGPVTFKNAKKPKEVAKAVPIEKLLIETDSPYLTPEPYRGKRNTPVYVKF
FT                   VAEKIAELRGIPYEEATRITAENAIKLFNIPIK"
FT   gene            118608..119639
FT                   /locus_tag="Thit_0100"
FT   CDS_pept        118608..119639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0100"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; protein of unknown function
FT                   DUF348; G5 domain protein; KEGG: tpd:Teth39_2135 3D
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01428"
FT                   /db_xref="GOA:D3T5C7"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C7"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADD01428.1"
FT                   /translation="MDTDDFRKRLGEIFKKPVALLTLAVVLLLIVGAITYASLKKEITL
FT                   QDEDKKIIVTTFKSTVKDLLEEKGIKLKKEDVVTPSLETALKNGMKVTIKRAVPITICV
FT                   GGKAKDIYTAASNVKEVLQQNSITLGPQDKVNMSLDTPVFRYMYIDVTKVTEKIVTQEV
FT                   DIPYQTETVKNDNMERGQVRVVQQGEVGKKQIVVKVIYKNGKEVAKDIIKEKIIKNPVN
FT                   QIVHIGTLGIFTTSRGETFRYREVRTMVATAYDSSEDSTGKKPGDPNYGITATGIKATR
FT                   GVIAVDPRVIPLGTKLYVEGYGFGIAADTGGAIKGNKIDVYFPTREEVMRWGRRYVKVY
FT                   ILK"
FT   gene            119677..120495
FT                   /locus_tag="Thit_0101"
FT   CDS_pept        119677..120495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0101"
FT                   /product="dimethyladenosine transferase"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: tpd:Teth39_2134 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01429"
FT                   /db_xref="GOA:D3T5C8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C8"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ADD01429.1"
FT                   /translation="MKIKGVNVKKKWGQNFMFDKNILTKIVTASGVIPEDFVLEIGTGL
FT                   GTLTEELAKRVKKVISFEIDRELYAVAKEKLNIYDNVIIINEDIMKADLNKIANEYFEG
FT                   KPFKVVANLPYYITSPIIMMLLDCKFVKEITVLVQKEVAERICALPGTKDYGILTVFAN
FT                   FKAKPKMLFNLPPTVFVPPPKVDSSLVKLEVLDDPLVEVKDEELFSNVVKAAFGQRRKV
FT                   LSNALKTLGFPKEIIDKAFTLSNLSPQRRGETLSIEEFAVLANVIYDLTK"
FT   gene            120568..121626
FT                   /locus_tag="Thit_0102"
FT   CDS_pept        120568..121626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0102"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01430"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5C9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2133"
FT                   /protein_id="ADD01430.1"
FT                   /translation="MPINIYKRFYVVFNQEDRGCSIEGKEVSGYLKVEFRGNRGRITAA
FT                   LQNLNPDYSYNVKLLKSNGEVTVVDFGAIKVDDKGRGGGEWTFNGDDVKDSGISWEEFS
FT                   VAFIEAHDGIKTLVPLASVINKKTTNWKVVYKKYLSKVKGEETPAEKSDKNDREIKQEE
FT                   TDTATPQGYESTENETEKGETSQNVLEEVQSETPAFEETSEALTDSSDTQQPETSFNFE
FT                   EEVEEGYIKYLREYVNNIVSFLEEVEPFEKNFEGYRWWKVKTGYREGGFDHYLVGFVND
FT                   EKGELKYIVYGMPGFFTLADQPFGGMTGFVVWKPVKENLRGARDEGYWILHIDAKTGQI
FT                   AVPIEPTPPPLI"
FT   gene            122084..123496
FT                   /locus_tag="Thit_0103"
FT   CDS_pept        122084..123496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0103"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_1868 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01431"
FT                   /db_xref="GOA:D3T321"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:D3T321"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADD01431.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLNREMEFQKTTEVHSISSASEDGRNEV
FT                   QRYTGKMLEMIVERGNMEAAYKRVVANKGSHGVDGMGVDELLPYLKENWATIKQQLLEG
FT                   KYKPQPVRRVEIPKPDGGKRLLGIPTVLDRLIQQAIAQILNKVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGIKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVRSR
FT                   SAGNRVMKSIKKFIESKLKLKVNEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            complement(123578..123814)
FT                   /locus_tag="Thit_0104"
FT   CDS_pept        complement(123578..123814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01432"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2132"
FT                   /protein_id="ADD01432.1"
FT                   /translation="MKEIKINLTSIESVKNFVEKTSKYPFDIDVTSGRYVIDAKSIMGL
FT                   FSLNLENVLTVIPHTTDEESLKKLEEDLKEFIV"
FT   gene            complement(124231..125499)
FT                   /locus_tag="Thit_0105"
FT   CDS_pept        complement(124231..125499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0105"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: tte:TTE0116
FT                   S-layer-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01433"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D2"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ADD01433.1"
FT                   /translation="MLSKSRLFVSIIIIFSLLFYTTAYAKLQPKYSFDDIKQFTWALKA
FT                   IEKMYAKGFIKGVGNKKFNPSKPVTHLEALVMILRTIGYEEQANKISELPKEYKGPKLS
FT                   WGQGFITLAYQKGILTYDELKRFNPNDKAKRYEIAKYLVRALGLEDQAQQNMNKVLNYK
FT                   DWDKIPKDSIGYMYVAVENGLIKGDGEKLKSNESIKRIEMAVLLERLDQSVQNDLNGRD
FT                   VVGSIYAIDSNTITVKVDDGLKTFNVLKNAPVYNGNEYVGIDYLKPGYQIRLILDSKNN
FT                   IIFVEVLNNKIEEVIPIELKKVTNPPEKVLSAVESIKDKPVVKLVKENGIFYIIATRGM
FT                   MRTGGYIVNIQKAQITKASEEAILEVEVKYIDPSPDTIVIQAITYPYDIKSFTYDGKIT
FT                   QISVKTDKNINVSVDIDLASDVK"
FT   sig_peptide     complement(125422..125499)
FT                   /locus_tag="Thit_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.990 at
FT                   residue 26"
FT   gene            complement(125500..126654)
FT                   /locus_tag="Thit_0106"
FT   CDS_pept        complement(125500..126654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01434"
FT                   /db_xref="GOA:D3T5D3"
FT                   /db_xref="InterPro:IPR024449"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2130"
FT                   /protein_id="ADD01434.1"
FT                   /translation="MKAVVVQKEKNKTYVMTEKGEFKCFKNLQNVVVGETIELNENFVA
FT                   FKPTAKILIAASILLVLIFTIINFKSAEVYAYVYVDINPSIEISIDKNGKIINALPLNE
FT                   DGKKILEKLPYKGLDITTFINQTVEESQKLGFLKDDDTVIITTVPIKNSPFINEQIEKA
FT                   VKNIKKINTNIQIETLKSNEAQREEAKKEKTSPGRLILWKKAKSEGINIPKDKLNSPEF
FT                   FKELKQAYAKIKEKDEQTKATTMPQPSPSPSKSKVITDKILKTIEKDLSKEKTTQTIKN
FT                   VKDKEVKSQNNEVKKDENSDNKSNQQGKGTEKNARSKSDNTNNVLTQKEKNEVKPASDD
FT                   KELDTSDKAINENTYKNVKDTKNYPPKDAKKDEEYNEEIREVKE"
FT   gene            complement(126651..127307)
FT                   /locus_tag="Thit_0107"
FT   CDS_pept        complement(126651..127307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0107"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   subfamily"
FT                   /note="KEGG: tpd:Teth39_2129 putative RNA polymerase sigma
FT                   factor SigI; TIGRFAM: RNA polymerase sigma-I factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01435"
FT                   /db_xref="GOA:D3T5D4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014244"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D4"
FT                   /inference="protein motif:TFAM:TIGR02895"
FT                   /protein_id="ADD01435.1"
FT                   /translation="MDIHARVYAAKKDPSEREKLIQEYTPFIIKQLSSFTNRYIDERNS
FT                   DELSIGLIAFNEAIDSFDNTKGSFLSFSSMLIRRRLIDFLRQNRQNTIPLELYVEKVTD
FT                   YEAENRKLEMISFVNLLSIYNITLDDLVKQSPKHSDTRKITTKIAYTICKNNKLLEYLK
FT                   NKKNLPIKDLISILKVSRKTIEKHRKYIIALVIIISEDLPLLKQYISPESEVEKI"
FT   gene            127424..128479
FT                   /locus_tag="Thit_0108"
FT   CDS_pept        127424..128479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0108"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; protein of unknown
FT                   function DUF59; KEGG: tpd:Teth39_2128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01436"
FT                   /db_xref="GOA:D3T5D5"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D5"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADD01436.1"
FT                   /translation="MLTKEQVLNALRKVYDPEIGRSIVDLDMVKNIQIEGDKVTIDINL
FT                   TVKGCPLQDTIKKDTIEEVSKLGGVSEVIVNLGSMTEEERQNLARKLSGGRKPIFENTR
FT                   VIVVGSGKGGVGKSTVAVNLAVALARLGFKVGLLDADVLGFSVPRLLGIVNERPYALDE
FT                   HTILPLERFGIKVISMGNFIDEDTPLIWRGPLLSGVLDQFFNDVYWGELDYLVLDLPPG
FT                   TGDIPLTVMQKLPESKFVLVTTPQASASHVAGRIGYMAKKVNLEVIGIVENMSYFECPN
FT                   CHQRYNIFGEGETEKLAQDLGTEILVKIPITVKVRELSDVGIPPALDDGPEGVPYIELA
FT                   EKVVEKVRPIK"
FT   gene            complement(128503..128859)
FT                   /locus_tag="Thit_0109"
FT   CDS_pept        complement(128503..128859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01437"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D6"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2127"
FT                   /protein_id="ADD01437.1"
FT                   /translation="MRIAATITKEDYVEKLPDGPYIIIFDTQKENIEKYENPGYFLKEG
FT                   RRRAIVDFLLDKKTDVVVTVPEAFCSISYGKAKQKGLKFIRLEKSLPYEEVIKNLSKYV
FT                   ENLTDTIPEEELAK"
FT   gene            129144..129662
FT                   /locus_tag="Thit_0110"
FT   CDS_pept        129144..129662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01438"
FT                   /db_xref="GOA:D3T5D7"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2126"
FT                   /protein_id="ADD01438.1"
FT                   /translation="MFKGIKWQIVLVTFVVVFGFLFASFQLYQNKILPDKISKDVSTVK
FT                   FVKMVTISTDNNGYIMKVRLGEVENLMETYKEIENKVNKYPVKINILLIDNPNEKLNNV
FT                   YYNSQFSIYEGIQKGDYMKMYDTIREISSKNGVKAFVYIDKQNIYLNLRDGSHYLYKII
FT                   PREAYKGES"
FT   gene            129663..131159
FT                   /locus_tag="Thit_0111"
FT   CDS_pept        129663..131159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0111"
FT                   /product="Vesicle-fusing ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="PFAM: AAA ATPase central domain protein; peptidase
FT                   M41; KEGG: tpd:Teth39_2125 microtubule-severing ATPase;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01439"
FT                   /db_xref="GOA:D3T5D8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D8"
FT                   /inference="protein motif:PRIAM:3.6.4.6"
FT                   /protein_id="ADD01439.1"
FT                   /translation="MVKEILLGITIAFTIFAAFLGINVTPLLLLAGIFLLFDYIIENKG
FT                   IISGSKNIIKPESEISFEDIGGQSTAIAELKEALDFVINREKISKMGIRPIKGILLTGP
FT                   PGTGKTLLAKAAAKYTNSSFIATSGSEFIEMYAGVGAQRVRNLFKTAKNIARKEGKNSA
FT                   IIFIDEIDILGVKRGTNESHHEYDQTLNQLLVEMDGIKSDGEVNILVIAATNRPDLLDP
FT                   ALLRPGRFDREVVVDLPDKSGRLQILKIHTKNKPLGEDVNLEAIAENTFGFSGAHLESL
FT                   CNEAAILAMRDNSDVILQKHFVEAVDKVILGEKSDRKPTEEEIFRVSVHEAGHAIISEM
FT                   VNPGSVATVTIVPRGKALGFVRHFDKEDSLIYTKEQLEKDIMIALGGTVAELLILGSRS
FT                   TGSANDFEQAVDIAKKMVYTGLSDLGIVSREDVPKDKVNEEVNKIIKEQEKKVQKMLEE
FT                   KLEYLEKIANILRKEETMSGEKLRELIGHSNFCKNYTFSF"
FT   gene            131610..132944
FT                   /locus_tag="Thit_0112"
FT   CDS_pept        131610..132944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0112"
FT                   /product="electron transport complex, RnfABCDGE type, C
FT                   subunit"
FT                   /note="KEGG: tex:Teth514_0079 electron transport complex,
FT                   RnfABCDGE type, C subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, C subunit; PFAM: Respiratory-chain
FT                   NADH dehydrogenase domain 51 kDa subunit; Soluble ligand
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01440"
FT                   /db_xref="GOA:D3T5D9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5D9"
FT                   /inference="protein motif:TFAM:TIGR01945"
FT                   /protein_id="ADD01440.1"
FT                   /translation="MKLENLTFKGGVTVPHHKDLTEGLPIERAREPEVVYIPLHQHAGA
FT                   PCEPLVKVGDTVKVGQKIGQSDAFVSAPVHSSVSGIVKDITTMFIPTGQRVKCVIIESD
FT                   GKNELDESVKPKGSLEDLSPKEIIEIIREAGITGMGGAGFPTHVKLSPPSDKKIDTILV
FT                   NGAECEPYLTTDHRLMVEYPEKIVFGLKAIMKAVGVERGIIGVEKNKPDAILALREASK
FT                   NEKNIRIATLKVKYPQGDEKRLINAILRRIVPSGGLPMDVGVIVVNAATTKAVADAILE
FT                   GKPLYERVTTITGRGIKEPKNLLVKIGTPLKDLIEQCGGFTEGSPGKIISGGPMMGIAQ
FT                   HSLDVPIIKGTGGILILTKEEARPQQVLPCIKCGKCVEVCPVNLLPLYISSYSLKKNFE
FT                   KAEEYNALDCVECGSCSYICPAKRPLAESIRLAKREIIARKRNLK"
FT   gene            132959..133918
FT                   /locus_tag="Thit_0113"
FT   CDS_pept        132959..133918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0113"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_2123 electron transport complex,
FT                   RnfABCDGE type, D subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, D subunit; PFAM: NQR2 and RnfD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01441"
FT                   /db_xref="GOA:D3T5E0"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E0"
FT                   /inference="protein motif:TFAM:TIGR01946"
FT                   /protein_id="ADD01441.1"
FT                   /translation="MLAKVEEVVLQDKLIVSSSPHIRSNESVKRIMLDVVIALTPAIIG
FT                   SVYLFGLNALKLILISVASSVLSEALIQKLFKRPITITDFSAAITGILIAFNLPASAPW
FT                   WLPVIGSAFAIIVVKQLFGGLGANFMNPALAARAMLMTSWPVHMTNYTGTRPDVVTSAT
FT                   PLSIMKYGTGAELPTLRDMFIGNIPGVIGETSALLLLIGAAYLIIRKVIDWKIPVFYIG
FT                   TTFIMLLLLGVEPKLLPYHILGGGLILGAFYMATDYSSSPVTPLGRIIFAVGAGVLTAI
FT                   IRIKGAYPEGVSYSILLMNVATPLIEKFTKPRVFGKVK"
FT   gene            133919..134500
FT                   /locus_tag="Thit_0114"
FT   CDS_pept        133919..134500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0114"
FT                   /product="electron transport complex, RnfABCDGE type, G
FT                   subunit"
FT                   /note="TIGRFAM: electron transport complex, RnfABCDGE type,
FT                   G subunit; PFAM: FMN-binding domain protein; KEGG:
FT                   tpd:Teth39_2122 electron transport complex, RnfABCDGE type,
FT                   G subunit; SMART: FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01442"
FT                   /db_xref="GOA:D3T5E1"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E1"
FT                   /inference="protein motif:TFAM:TIGR01947"
FT                   /protein_id="ADD01442.1"
FT                   /translation="MKEIAKIGLILLLITAAAGVILGVSNAITSKKIAEIEKIANNAAK
FT                   QEVLQEAESFVTLDEKRLKEIAGSNQNVLEVSEGYDGNSSLVGYVFKITSNGYGGEIQF
FT                   MVGISKKGYITGIKILSHKETPGLGANATKSFFTDAFKGKSVADKLVVVKHPPKADNEI
FT                   QALTGATITSNAIVNGVNMVREIYNSKLAN"
FT   sig_peptide     133919..134002
FT                   /locus_tag="Thit_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.665 at
FT                   residue 28"
FT   gene            134523..135173
FT                   /locus_tag="Thit_0115"
FT   CDS_pept        134523..135173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0115"
FT                   /product="electron transport complex, RnfABCDGE type, E
FT                   subunit"
FT                   /note="KEGG: tex:Teth514_0082 electron transport complex,
FT                   RnfABCDGE type, E subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, E subunit; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01443"
FT                   /db_xref="GOA:D3T5E2"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E2"
FT                   /inference="protein motif:TFAM:TIGR01948"
FT                   /protein_id="ADD01443.1"
FT                   /translation="MKLSKIFSNGLVKENPIYVQALGMCSVLAVTTSAINGLAMGLAVT
FT                   AVLVGSNSVVSLLRKVIPDKIRIPAFIVVIATFVTVVEMFMKAYTPALYNALGIFIPLI
FT                   VVNCIILGRAEAFASKNNLLTSVMDGLGMGAGYTLAVLILGSIREILGSGSLFGIQLFG
FT                   ASFEPALIFIMPPGAFIVLGILIGLFNHARRRKEVSETGTKEEVLDEYIYNID"
FT   gene            135148..135720
FT                   /locus_tag="Thit_0116"
FT   CDS_pept        135148..135720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0116"
FT                   /product="electron transport complex, RnfABCDGE type, A
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_2120 electron transport complex,
FT                   RnfABCDGE type, A subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, A subunit; PFAM: RnfA-Nqr electron
FT                   transport subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01444"
FT                   /db_xref="GOA:D3T5E3"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E3"
FT                   /inference="protein motif:TFAM:TIGR01943"
FT                   /protein_id="ADD01444.1"
FT                   /translation="MNIFIILINTIFVNNYVFARFLGICPFLGVSNKTETATGMGMAVT
FT                   FVITLSSVITYIIHHAILVPLNLEYLQTIVFILVIASLVQFVEIFLKKTSPNLYGALGI
FT                   YLPLITTNCIVLGVAILNIQEGYTLIETIFNALGASIGFAIALLLMAGIREKLEIIDVP
FT                   KVLEGVPIALITAGLISIAFLGFNGLV"
FT   gene            135732..136547
FT                   /locus_tag="Thit_0117"
FT   CDS_pept        135732..136547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0117"
FT                   /product="electron transport complex, RnfABCDGE type, B
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_2119 electron transport complex,
FT                   RnfABCDGE type, B subunit; TIGRFAM: electron transport
FT                   complex, RnfABCDGE type, B subunit; PFAM: Fe-S cluster
FT                   domain protein; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01445"
FT                   /db_xref="GOA:D3T5E4"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E4"
FT                   /inference="protein motif:TFAM:TIGR01944"
FT                   /protein_id="ADD01445.1"
FT                   /translation="MSGILYAIVVLGGLGFLFGSSLSLASKIFALETNPKVKKIREVLP
FT                   GANCGACGYPGCDAYANAIVEGKAPVNACSVGGNSVAKKIAEIMGVDDVEVERKVATVL
FT                   CQGDRSKAKDKYLYNGIRDCRAQNILAGGCKSCPYGCLGCGTCVDVCDYGAIQIINGVA
FT                   VIDKEKCVACKACMEVCPKGIIELVPYNQEVIIKCKSNDPGKVVRGYCSVGCIGCQICV
FT                   RSCPEKAITFENYLAKINYEKCTNCGTCAKKCPTGSIFSSLKQVNEKAQ"
FT   sig_peptide     135732..135809
FT                   /locus_tag="Thit_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.644 at
FT                   residue 26"
FT   gene            136865..137215
FT                   /locus_tag="Thit_0118"
FT   CDS_pept        136865..137215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0118"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   tpd:Teth39_2116 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01446"
FT                   /db_xref="GOA:D3T5E5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD01446.1"
FT                   /translation="MSRILVLDDNKGICSLIEEIFTMDGHEVRSYSDISLFDREIEKFR
FT                   PDIGLFDLHMAKDMLKIIKKVKSIYPNMKGIIMSADEPQEPFTEFPFISKPFDIIALRN
FT                   LVYENLKQEMIV"
FT   gene            137215..137322
FT                   /locus_tag="Thit_0119"
FT   CDS_pept        137215..137322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01447"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01447.1"
FT                   /translation="MFVKGTFVPFYIFLVLALNKCYNEKVMLYNIWAAF"
FT   gene            137352..138203
FT                   /locus_tag="Thit_0120"
FT   CDS_pept        137352..138203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0120"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.40"
FT                   /note="TIGRFAM: fructose-1,6-bisphosphate aldolase, class
FT                   II; ketose-bisphosphate aldolase; KEGG: tpd:Teth39_2115
FT                   fructose-1,6-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01448"
FT                   /db_xref="GOA:D3T5E7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E7"
FT                   /inference="protein motif:TFAM:TIGR01859"
FT                   /protein_id="ADD01448.1"
FT                   /translation="MLVTGIEILKKAHKEGYAVGAFNTSNLEITQAIVEAAEETKSPVI
FT                   IQVSEGGLKYAGIETISSIVRTMAEKASVPVALHLDHGTDFNTVMKCLRNGWTSVMMDA
FT                   SKLPLEENIKVTKTVVEIAHGMGVSVEAEIGKIGGTEDNITVDEREAAMTDPEEALKFA
FT                   KETGIDYLAIAIGTAHGPYKGEPKLDFDRLKKIKEMLNIPLVLHGASGVPEEAIKKAVS
FT                   LGINKINIDTDIRQAFARRLRELIEKDSEVYDPRKILGPCKDAMKEVIKQKMILFGAAG
FT                   KA"
FT   gene            138513..140039
FT                   /locus_tag="Thit_0121"
FT   CDS_pept        138513..140039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0121"
FT                   /product="transcription termination factor Rho"
FT                   /note="TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor RNA-binding; Rho termination
FT                   factor domain protein; KEGG: tpd:Teth39_2114 transcription
FT                   termination factor Rho; SMART: Cold shock protein; AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01449"
FT                   /db_xref="GOA:D3T5E8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E8"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ADD01449.1"
FT                   /translation="MDFDINTLGNLSLMELREIAKKLGIKSITKYRKQELKEKILEKAN
FT                   QANEKNLVQKDNKKEEGLNERQTQKLHESAAEKNTDGTLNYDSNVSRNGHVKSISAENA
FT                   ANGLQAQTISAKDILPIVKELSDPLKELIQTQGDVVAEGILDILPDGYGFLRVENFVQG
FT                   PKDIYISQSQIRRFGLKVGDKVRGITRIPREGEKYSAILYVESINGEDPENAKKRIPFD
FT                   ELTPIFPNEKLRLETSPTEFSMRLVDIIAPIGKGQRGMIVAPPKAGKTTLLKQIANSIS
FT                   HNHPEVILIVLLIDERPEEVTDMKRSIKGEVVYSTFDEPPEHHIKVAEMVLEHAKRLVE
FT                   YKKDVVILLDSITRLARAYNLVTPPSGRTLSGGIDPSALHPPKRFFGAARNIEEGGSLT
FT                   ILATALIETGSRMDDVIFEEFKGTGNMELHLDRKLQERRIFPAIDIYKSGTRKEELLLT
FT                   KEELEAMWILRKAMSNLPATEVTEMLIEKLIRTKSNAEFINMIRAQLYKS"
FT   gene            140102..140311
FT                   /locus_tag="Thit_0122"
FT   CDS_pept        140102..140311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0122"
FT                   /product="ribosomal protein L31"
FT                   /note="KEGG: tpd:Teth39_2113 50S ribosomal protein L31;
FT                   TIGRFAM: ribosomal protein L31; PFAM: ribosomal protein
FT                   L31"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01450"
FT                   /db_xref="GOA:D3T5E9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5E9"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ADD01450.1"
FT                   /translation="MKPNIHPTYYHDAVVRCACGNTFITGSTKKEIRVEICSKCHPFFT
FT                   GQQKIVDTGGRVERFRKRFNLEEK"
FT   gene            140380..140961
FT                   /locus_tag="Thit_0123"
FT   CDS_pept        140380..140961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0123"
FT                   /product="Thymidine kinase"
FT                   /EC_number="2.7.1.21"
FT                   /note="KEGG: tpd:Teth39_2112 thymidine kinase; PFAM:
FT                   thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01451"
FT                   /db_xref="GOA:D3T5F0"
FT                   /db_xref="InterPro:IPR001267"
FT                   /db_xref="InterPro:IPR020633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F0"
FT                   /inference="protein motif:PRIAM:2.7.1.21"
FT                   /protein_id="ADD01451.1"
FT                   /translation="MIYGSLDHGFIEVIVGPMFSGKSEELIRRIKRAQIAKQKVQVFKP
FT                   AIDDRYSIDKVVSHNGTNINAISVVKASEIIEHLEHDIEVIAIDEIQFFDHLLVDVVRE
FT                   IADLGKRVICAGLDMDFRGEPFGPTPDVMAIAESVDKLTAICVKCGNPATRTQRLINGK
FT                   PARYDDPIILVGAYETYEARCRKCHEVPRT"
FT   gene            140977..141903
FT                   /locus_tag="Thit_0124"
FT   CDS_pept        140977..141903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0124"
FT                   /product="protein of unknown function DUF1385"
FT                   /note="PFAM: protein of unknown function DUF1385; KEGG:
FT                   tpd:Teth39_2111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01452"
FT                   /db_xref="GOA:D3T5F1"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F1"
FT                   /inference="protein motif:PFAM:PF07136"
FT                   /protein_id="ADD01452.1"
FT                   /translation="MKKTDIGGQAVIEGVMMRGHNSVATAVRKGDEIIIKKEYVKPLTK
FT                   RNKFFSLPFIRGTFALFDSLIVGIKSLTYSAELFEEKDKENISKFYLFLQKVFGDKLED
FT                   ILMYFSVVISLILSIIIFFIGPTYVADYIKLFTKNTVVINFVEGLLRVAIFILYLVLIS
FT                   QMKDIKRIFEYHGAEHKAIHCLEHEEELTVENARKYTTLHPRCGTNFLFIVMIVSIIIF
FT                   SFLKWPTFYIRILSRIFLLPVVAGISYEIIKLAGRSNNKIIRVFVYPGLLLQKLTTREP
FT                   DDSQLEVAIASLKSVLEDEGGQEFESI"
FT   gene            141890..142729
FT                   /locus_tag="Thit_0125"
FT   CDS_pept        141890..142729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0125"
FT                   /product="protein-(glutamine-N5) methyltransferase, release
FT                   factor-specific"
FT                   /note="KEGG: tpd:Teth39_2110 HemK family modification
FT                   methylase; TIGRFAM: protein-(glutamine-N5)
FT                   methyltransferase, release factor-specific; modification
FT                   methylase, HemK family; PFAM: methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01453"
FT                   /db_xref="GOA:D3T5F2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F2"
FT                   /inference="protein motif:TFAM:TIGR03534"
FT                   /protein_id="ADD01453.1"
FT                   /translation="MKVYEAINWGAKELKGVCDNPRLEAELLLAHCFKINRTALFLRRE
FT                   EEVSKEQLERFLEFINMRKSHIPYQYIVKKQCFMGLEFFVDENVLIPRPETEILVEEAL
FT                   KRLKRGDVVLDIGTGSGAIAVSIAKYFPDCTVYAVDISKKAIEIAKHNAEKQGVLDRIF
FT                   FIESDLFCNLPPNLKFDFIVSNPPYIKKREIELLQEEVKKEPIVALDGGEDGLFFYKKI
FT                   IREAPFYIKSGGKIGFEIGYSQKEEVTTLLEESGFKDVEIIKDLAGIDRVIIAEHKL"
FT   gene            142778..143848
FT                   /locus_tag="Thit_0126"
FT   CDS_pept        142778..143848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0126"
FT                   /product="peptide chain release factor 1"
FT                   /note="KEGG: tpd:Teth39_2109 peptide chain release factor
FT                   1; TIGRFAM: peptide chain release factor 1; PFAM: Class I
FT                   peptide chain release factor; PCRF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01454"
FT                   /db_xref="GOA:D3T5F3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F3"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ADD01454.1"
FT                   /translation="MIDKLQAIEDRYVELSQKISDPNIISNVGEWRKYVKEHAAIEEIV
FT                   LKYREYKKVVEDINSTKELLSSDEKELREMAEEELSHLEEKKEELLEEIKILLIPKDPN
FT                   DEKNVIMEIRAGAGGEEAALFAHDLFRMYSMYAEKKGWKVEIMSSNETDIGGFKEVILN
FT                   ISGKGAYSRLKYESGVHRVQRVPTTEAGGRIHTSTATVAVLPEVEEVDVEINPNDIRID
FT                   VFRSGGHGGQSVNTTDSAVRVTHIPTGIVVTCQDERSQLQNRERALKILRAKLYEMALQ
FT                   EQQKEIAEARKSQVGTGERSERIRTYNFPQGRVTDHRIGLTLYRLQEVLDGDLDEIIDA
FT                   LILNDQAEKLKNVNLN"
FT   gene            144178..144897
FT                   /locus_tag="Thit_0127"
FT   CDS_pept        144178..144897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0127"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: tpd:Teth39_2108
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01455"
FT                   /db_xref="GOA:D3T5F4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F4"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ADD01455.1"
FT                   /translation="MYAFNGMIIGSLVGIIGTGMGGAVTYFLKNPSNRFFSGIMGTAAG
FT                   LMLSIVAFDLLPHAFDIASIPLGTIGILVGAILISFFDMIIENMDIAGSFIKEGVLLAI
FT                   VIALHNFPEGLAVGSSFMVSQSLGVDIALVIALHDFPEGLAMATPFSAGGIPPYKNVIY
FT                   TILAGIPTGIGALIGVVTGGISPYFIGLNLSIAGGAMLYVTCGDVIPEARNVYKGKISV
FT                   LGMILGFIGGIIITKYL"
FT   gene            144925..145989
FT                   /locus_tag="Thit_0128"
FT   CDS_pept        144925..145989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0128"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="KEGG: tex:Teth514_0096 SUA5/YciO/YrdC/YwlC family
FT                   protein; TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01456"
FT                   /db_xref="GOA:D3T5F5"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F5"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ADD01456.1"
FT                   /translation="MTKIIRVDRNNPEIELIDFAAKVIREGGLVAFPTETVYGIGANSF
FT                   DEEAVKKIFMVKGRPQDNPLIVHIAELEQIYDLVEEIPQKAKILMEKFWPGPLTLIFKK
FT                   SQKVPYVNTAGMDTVAIRMPSDTIAHLLIKRAKVPISAPSANVSGKPSPTDASHVVEDL
FT                   DGKVDIIIDGGKCDFGVESTVLDLTEKMPVVLRPGAVTLEMLKEVIGNVEVDPSLLKKP
FT                   KGNLKPKSPGMKYKHYSPNAEVYIVKGHLKKVVKKIQELTEEQLKYGKKVGIMATVQTS
FT                   TQYKKGEIIVVGDRNRPETIAKNLFAVLRQFDKKGVDVIFAESFEYNNIGLAIMNRLEK
FT                   AAGYKEISAEGELI"
FT   gene            145986..146894
FT                   /locus_tag="Thit_0129"
FT   CDS_pept        145986..146894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0129"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; Protein-tyrosine phosphatase,
FT                   low molecular weight; KEGG: tte:TTE0146 ribose 5-phosphate
FT                   isomerase RpiB; SMART: Protein-tyrosine phosphatase, low
FT                   molecular weight"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01457"
FT                   /db_xref="GOA:D3T5F6"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F6"
FT                   /inference="protein motif:TFAM:TIGR00689"
FT                   /protein_id="ADD01457.1"
FT                   /translation="MKVLFVCTGNTCRSPMAEGLFNAKAKTLGKDFEAKSAGVFASEGF
FT                   PASQQAIEVLKRDYNIDISKHRSKNLRRQDLEEANLILTMSNSHKQSILVQYPEYSYKV
FT                   FTLKEYVGLEGEVEDPYGMPIEVYRKTARELEDLISKVITKISEERKGKKVIALGADHG
FT                   GYDLKEAIKKYLDEKGIAYKDFGTVSTDSVDYTDYALKVAEAVASGEYSEGILVCGTGI
FT                   GMCIAANKVPGIRAAHVEDVFSAKAAKEHNNANILCLGGRITGPGLAVMMVDEWLKATF
FT                   QGGRHQRRIDKIAEIERKYSK"
FT   gene            146943..147575
FT                   /locus_tag="Thit_0130"
FT   CDS_pept        146943..147575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0130"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; KEGG:
FT                   tpd:Teth39_2104 uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01458"
FT                   /db_xref="GOA:D3T5F7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F7"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ADD01458.1"
FT                   /translation="MYKNVFVIDHPLIQHKISLIRDENTGSKEFRELVEEIAMLMAYEV
FT                   TRDLPLEEIEVKTPVAMAKTKVIAGKKLGIIPILRAGLGMVDGMLKLIPAAKVGHIGIY
FT                   RDPKTLKPVEYYCKLPPDIAERDLIVVDPMLATGGSACAAIHFLKERGAQNIKLVNLIA
FT                   APEGIEAVHKEHPEIPIYVASIDQGLNEHGYIVPGLGDAGDRLFGTK"
FT   gene            147607..148050
FT                   /locus_tag="Thit_0131"
FT   CDS_pept        147607..148050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0131"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   tpd:Teth39_2103 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01459"
FT                   /db_xref="GOA:D3T5F8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5F8"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ADD01459.1"
FT                   /translation="MRPSWDEYFMQIVDVVKTRSTCLRRQVGAILVVDKHIISTGYNGP
FT                   PTGLAHCEETGCLRDQLGIPSGERPELCRGVHAEQNAIIQAALHGVSTKGATLYVNASP
FT                   CVMCAKMLINAGVKRIVYEEEYPDELAFRLLKEANVDLVKIER"
FT   gene            148108..149148
FT                   /locus_tag="Thit_0132"
FT   CDS_pept        148108..149148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0132"
FT                   /product="Glycosyl transferase, family 4, conserved region"
FT                   /note="PFAM: Glycosyl transferase, family 4, conserved
FT                   region; KEGG: tte:TTE0154 UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01460"
FT                   /db_xref="GOA:D3T5S9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5S9"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ADD01460.1"
FT                   /translation="MKVYLLSFVMAFGVSLIATPMAKKLAFVIGAIDIPNEERRIHTKP
FT                   VPRLGGVAIFLGTITSILLFLPKTDETIGIVTGATIIAALGLFDDKYSLSAKVKLLGQL
FT                   VAAMVLIISGVRIDWLSNPFGDGMIYLKSWLAIPLTLFWVVGITNTMNLIDGLDGLAAG
FT                   IAVISSGSLFIVSLLNGRFATAVISIAIAGAALGFLPYNFNPAKIFMGDTGAMFLGFVL
FT                   AAISIQGAVKSAAAIAIAVPILALGVPIFDTTFAIVRRLINGKPIMEADKGHLHHRLLE
FT                   KGLTQRQVVLIMYGVSLLLGISAILISSSNETKGLIIFILSILFVMWGADKLGLLEKQK
FT                   KGTQVR"
FT   gene            149170..150327
FT                   /locus_tag="Thit_0133"
FT   CDS_pept        149170..150327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0133"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   tte:TTE0155 UDP-N-acetylglucosamine 2-epimerase; PFAM:
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01461"
FT                   /db_xref="GOA:D3T5T0"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T0"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ADD01461.1"
FT                   /translation="MMTLKIVSVFGTRPEAIKMAPLIKALEREKDFESKVCVTAQHREM
FT                   LDQVLRLFNITPDYDLNIMKEKQTLSEITTSVLIGLEEVFNREEPDLVLVHGDTTTTFV
FT                   SALASFYHKIKVGHVEAGLRSFNKWFPYPEEINRRLTGVLTDLHFAPTITAKSNLLKEG
FT                   VDEESIFVTGNTVIDAMVYTVKRDYIFRDEQLNQIDYNNKKVIVVTAHRRENWGKPLEN
FT                   ICNALKNIAQNYEDVYIVYPVHKNPVVRETVFRILGELTNVLLLDPLDTDEMHNLMAKC
FT                   YMVMTDSGGLQEEVPSLGKPVLVLRDVTERPEAVKAGTVKVIGTEEQVVYNEGALLLEN
FT                   KEEYDKMANAVNPYGDGKASLRIIQAIKYAFNLTDKRPEEYKSGE"
FT   gene            complement(150345..150641)
FT                   /locus_tag="Thit_0134"
FT   CDS_pept        complement(150345..150641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01462"
FT                   /db_xref="GOA:D3T5T1"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2102"
FT                   /protein_id="ADD01462.1"
FT                   /translation="MFWVALIVVGLISSLVFHPLFNYKAGESYGEKLNKIYGTYWAALV
FT                   AHLIGAWVGGAYLGKWGWIVADYNVIGGFIGAIVIGYLWYLIAKSQTKSEANK"
FT   gene            151002..151751
FT                   /locus_tag="Thit_0135"
FT   CDS_pept        151002..151751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0135"
FT                   /product="Protein of unknown function DUF1779"
FT                   /note="PFAM: Protein of unknown function DUF1779; KEGG:
FT                   tpd:Teth39_2101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01463"
FT                   /db_xref="InterPro:IPR014794"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T2"
FT                   /inference="protein motif:PFAM:PF08680"
FT                   /protein_id="ADD01463.1"
FT                   /translation="MDKKIIIGIMIFAVLFSLGVQRQAFLSFDDDVELVKRSFLSTGAK
FT                   YEYANINAWSKVNDDFTSFDKINEYVEVTIKNMNLDKQKIKVSRIEENKFRQLVVEYAE
FT                   NTRHINIAVQSLKNGAQSETYMLIDEYLIKGYDNVLKERSLINNSFKLLELKPKVTVCF
FT                   VGTFKGKLNKEKNSSIVKLVLDKLEAQKIEGMEEENIISVSAYSSKLKEYIKLGSEKIN
FT                   LNVAIRYSSFDDKTYLWVATPIIAIEY"
FT   gene            151758..153008
FT                   /locus_tag="Thit_0136"
FT   CDS_pept        151758..153008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0136"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="KEGG: tpd:Teth39_2100 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01464"
FT                   /db_xref="GOA:D3T5T3"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T3"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ADD01464.1"
FT                   /translation="MIRTKFIVEKSPPLKGSVKISGAKNSVLPIIAASLLSSGEIVLDD
FT                   IPTLKDVNVMIELIKHFGAICEFENERLKIKIDIKDVEAPYELVKKMRASFLVMGPILA
FT                   RLGHAKISMPGGCAIGSRPIDLHLKGFQTLGADITIGHGYVEARAQKLTGKKIYLDFPS
FT                   VGATENIMMAAVFADGITIIENAAEEPEIVDLANFLNKMGAKIKGAGTDTIRIEGVKEL
FT                   KGVEHTVIPDRIEAGTFMVAAAMTGGNVLIENVIVDHVRPIIAKLTECGIKIIEEPKGL
FT                   RVKGTKNYKALDIKTLPYPGFPTDMQAQMMAMMTVAKGTSVIIETVFENRFMHVDELKR
FT                   MGANIKIEGRSAVVTGVDHLTGAEVKATDLRAGAALVLAGLIAEGKTEINDIYHIDRGY
FT                   VKMEEKLKNLGAIIYRI"
FT   gene            153179..154303
FT                   /locus_tag="Thit_0137"
FT   CDS_pept        153179..154303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0137"
FT                   /product="alanine dehydrogenase"
FT                   /EC_number="1.4.1.1"
FT                   /note="TIGRFAM: alanine dehydrogenase; KEGG:
FT                   tex:Teth514_0104 alanine dehydrogenase; PFAM: alanine
FT                   dehydrogenase/PNT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01465"
FT                   /db_xref="GOA:D3T5T4"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T4"
FT                   /inference="protein motif:TFAM:TIGR00518"
FT                   /protein_id="ADD01465.1"
FT                   /translation="MKIGVPKEIKTAESRVAITPAGVEAFVKNGHEVYVEKDAGIGSGI
FT                   TNEEYVKAGAKILSTAKEVYDVADMIMKVKEPQPSEYDYLKEGQVLFTYLHLAPDKQQT
FT                   EALLKKKVIGIAYETVQLDNGALPLLTPMSEVAGRMSVTIGAYLLTNLNEGRGIVMGGV
FT                   PGVEPAEVVIIGGGTVGTNAAKVAVGMGARVTILDVNPARLAYLDDIFGGRVTTLMSNS
FT                   FNIAQSVKKADLLIGAVLIPGAKSPKLVTEEMVKTMKKGAVIVDVAIDQGGCVETCDRT
FT                   TSHKDPYFIKHGVVHYSVPNIPGVVSRTSTFALTNVTLPYALEIASKGYKKALLENKAL
FT                   LKGLNVYKGMVTYKPVADAQGLEYVDPIDALNIE"
FT   gene            154489..156192
FT                   /locus_tag="Thit_0138"
FT   CDS_pept        154489..156192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0138"
FT                   /product="pyruvate phosphate dikinase PEP/pyruvate-binding
FT                   protein"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; KEGG: tex:Teth514_0105 pyruvate
FT                   phosphate dikinase, PEP/pyruvate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01466"
FT                   /db_xref="GOA:D3T5T5"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T5"
FT                   /inference="protein motif:PFAM:PF01326"
FT                   /protein_id="ADD01466.1"
FT                   /translation="MSETLSYKNYNPRLSKKNEDRIFGEGHIGGKASGLCFAEEVVEKY
FT                   SDVFKQCVKIPESFFIATDYYQMFLDYNDLNDITEDTPYDEAEIRFRETKFPPEYEKIL
FT                   YEILSKMHYPLAIRSSSLLEDNIKYSFAGKYYTTFIPNRGLDRERVKQLEKAIKEIYLS
FT                   VYRPDAVAYRKKHAPGQKDLMGVIVQRLIGSQKGVYFYPEVSGVGFSRNYRRWTDRIKI
FT                   EDGVVRLVFGLGTKCTGRGYARIFSLTNLRLRPEGNNPKEIAKNSQEAFDVLNLITGEV
FT                   ETYNINEVPQFLTYHDKIGDIAQTYSKRENAILDINILNKSNDVFDKYIFTFENFPRRH
FT                   KGFFSIISNLFKYLEKEMEMAVDIEFAYDLKKDEFYLLQTRPLSSYESFRKVHIPKDIE
FT                   KKCVLLKGDRMLTNGILKNIRYIVYVDHKVYSQYRDKYEIARIIGRLNKSIGDKYILVG
FT                   PGRWGSSNPYLGVPVIYNEISNAAMIVELGIKNGDFMPELSYGTHFFADVDIDNILYMP
FT                   VFDGYKDNIFNEEWFKKGTYIDTAVKIFEGRFDAYLDGDKMIGYVISHEK"
FT   gene            156782..157831
FT                   /locus_tag="Thit_0139"
FT   CDS_pept        156782..157831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0139"
FT                   /product="stage II sporulation protein D"
FT                   /note="KEGG: tpd:Teth39_2097 SpoIID/LytB domain-containing
FT                   protein; TIGRFAM: stage II sporulation protein D;
FT                   SpoIID/LytB domain protein; PFAM: Stage II sporulation D
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01467"
FT                   /db_xref="GOA:D3T5T6"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T6"
FT                   /inference="protein motif:TFAM:TIGR02870"
FT                   /protein_id="ADD01467.1"
FT                   /translation="MKYAIYGVFLIFFSLIILPSIIVFGFNPHRTSSTPENEVKLIDGG
FT                   NLVKVDNLNNKDYHTVSVFITNQNKIQKIDLEEYVKGVVAAEMPAEFEIEALKAQAVTA
FT                   RTYVLSKEIVLGGKGCQLHPGADVCTDSEHCQAWQSEEELRQKWGENFDKYYVKISQAV
FT                   ADTEELVLVYNDALIVPAYHAISGGKTENSEDVWQSKIPYLRSVVSPGEEVASKYKTTV
FT                   VMSKEEFINKLKQKKPSLKLDNSDILNQIKDIERTQAGHIKTLKIGNMTFGGEEIREIF
FT                   DLNSTNFNFEAQGNNIVITVIGYGHGVGMSQYGANALAKQGKKFDEILRYYYTGVEIVK
FT                   IEDLLKIQH"
FT   gene            157899..158717
FT                   /locus_tag="Thit_0140"
FT   CDS_pept        157899..158717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0140"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: tex:Teth514_0107
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01468"
FT                   /db_xref="GOA:D3T5T7"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T7"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ADD01468.1"
FT                   /translation="MRINREKLIRFFDRKGFYIILFLSIVVIAATSIYVTNNNLKKLEE
FT                   LRKAQQEEINSAIESDWSYEEELAQAQEEKEQQNNSTAVISQQTKENFQPMAENDEVKS
FT                   SGKSNSLENSKVTTVMASNSNTSTIKKDNDLSSAKLVLLKPVSGDIILEFAKDKLVFSK
FT                   TLQEWTTHKGVDIGSKLGEPVLAAMDGIVAKVYKDPKLGNTVVIKNGKWETRYANLEDE
FT                   ILVKQQEKVVKGQQIGKIGESAKFEVSEGPHLHFELLENGTPVDPIAYFE"
FT   gene            158847..159107
FT                   /locus_tag="Thit_0141"
FT   CDS_pept        158847..159107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0141"
FT                   /product="sporulation transcriptional regulator SpoIIID"
FT                   /note="TIGRFAM: sporulation transcriptional regulator
FT                   SpoIIID; KEGG: tex:Teth514_0108 regulatory protein, DeoR"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01469"
FT                   /db_xref="GOA:D3T5T8"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T8"
FT                   /inference="protein motif:TFAM:TIGR02844"
FT                   /protein_id="ADD01469.1"
FT                   /translation="MKDYIEERTLEISKYIIEHKATVREAAKVFGVSKSTVHKDVTERL
FT                   PDINFELYKEVREILSKNKAERHIRGGKATKMKYQKMNNKF"
FT   gene            159239..160267
FT                   /locus_tag="Thit_0142"
FT   CDS_pept        159239..160267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0142"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="KEGG: tpd:Teth39_2094 rod shape-determining protein
FT                   Mbl; TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01470"
FT                   /db_xref="GOA:D3T5T9"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5T9"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ADD01470.1"
FT                   /translation="MFAFSKDIGIDLGTASVLVYIKGEGIVLKEPSVVAMDRNTNKILA
FT                   VGEEAQRMVGRTPGNILAIKPLRAGVISDYDVTEKMLRYFINKACKGRSLVRPKIMICI
FT                   PTGVTQVEKRAVIDAAIHAGARKAYLIEEPIAAAIGAGLDISQPSGNMIVDIGGGTTDI
FT                   AVISLGGSVVSKSIKVAGDNFDEAIIRHMRKRHQMIIGERMAEEIKINIGTAYFDGKEE
FT                   KMLVKGRSLISGLPQNVEVTSSEICEALKEPLEEIVAAVHSVLERTPPELAADISDKGI
FT                   VLTGGGALLKGMDRLLRERMNTPVYLSNDPISCVALGTGKALDSLELLEKSETIIDVYK
FT                   IK"
FT   gene            160287..161042
FT                   /locus_tag="Thit_0143"
FT   CDS_pept        160287..161042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0143"
FT                   /product="flagellar basal-body rod protein FlgF"
FT                   /note="KEGG: tex:Teth514_0110 flagellar basal body rod
FT                   protein; TIGRFAM: flagellar basal-body rod protein FlgF;
FT                   fagellar hook-basal body protein; PFAM: flagellar basal
FT                   body rod protein; protein of unknown function DUF1078
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01471"
FT                   /db_xref="GOA:D3T5U0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U0"
FT                   /inference="protein motif:TFAM:TIGR02490"
FT                   /protein_id="ADD01471.1"
FT                   /translation="MLRGLYAASSGMVTQIKIMDVLTNNLANVNTTGYKRDIVITSSFP
FT                   NFEVTRYGGDNIPPDGKIGKMDYGILIDTFHTNFEEGSLTQTNGKLDFAIDGNGFFVID
FT                   TPNGQRYTRDGSFVLSNDGYLVTQEGYIVQGENGPIELLQGDISVDEMGNIINNGQLVD
FT                   RLRIVDFDNYDGLRKEGNNLFFIDNSANVQVIPATGRIKQGFLEQSNVNSVKEMVNMIS
FT                   VMRNYESNQKVVIAFDETLGKAVNEVGKV"
FT   gene            161067..161867
FT                   /locus_tag="Thit_0144"
FT   CDS_pept        161067..161867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0144"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="KEGG: tpd:Teth39_2092 hypothetical protein; TIGRFAM:
FT                   flagellar basal-body rod protein FlgG; fagellar hook-basal
FT                   body protein; flagellar basal-body rod protein FlgF; PFAM:
FT                   protein of unknown function DUF1078 domain protein;
FT                   flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01472"
FT                   /db_xref="GOA:D3T5U1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U1"
FT                   /inference="protein motif:TFAM:TIGR02488"
FT                   /protein_id="ADD01472.1"
FT                   /translation="MMRALWSAASGMTAQQLNVDVIANNLANVNTTAFKRDRAEFKDLI
FT                   YQTLQRENIYGGQGRPVNMQVGVGVRPSAIVKDFTEGSLQQTDNPLDLALDGEGFFAVL
FT                   GPDGTVYYTRDGSFKLSADGNTLMLVTADGYPVLDDRGNPIVFDRTEKDISVSPLGVIS
FT                   VKNANGTTREVATLGIYNFVNPQGLLSVGNNLYEPTEASGQPGTRDDFEGRMGKVMQGF
FT                   LETSNVQVVKEMVDMIAAQRAYEINSKAIQAADEMLGIANNLRR"
FT   gene            161891..162226
FT                   /locus_tag="Thit_0145"
FT   CDS_pept        161891..162226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0145"
FT                   /product="Flagellar protein FlgJ-like protein"
FT                   /note="PFAM: Flagellar protein FlgJ-like; KEGG:
FT                   tpd:Teth39_2091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01473"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U2"
FT                   /inference="protein motif:PFAM:PF10135"
FT                   /protein_id="ADD01473.1"
FT                   /translation="MEINPVDNIDINKLEIYLQKDSSDFERIIQQAIKDKDQQKLKEAC
FT                   QQLEATFIGIMLNEMRKTIPEDSLTGDSLANDVFTSMLYDKYAEMLAQNGSFGLAEQMY
FT                   NQLSKKV"
FT   gene            162370..162798
FT                   /locus_tag="Thit_0146"
FT   CDS_pept        162370..162798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0146"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /note="KEGG: tpd:Teth39_2089 (3R)-hydroxymyristoyl-ACP
FT                   dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01474"
FT                   /db_xref="GOA:D3T5U3"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U3"
FT                   /inference="protein motif:TFAM:TIGR01750"
FT                   /protein_id="ADD01474.1"
FT                   /translation="MENKDIKKILPHRYPFLLVDRIIEIEEGKKAVGIKNVTANEPFFQ
FT                   GHFPDNPIMPGVLIIEALAQVAGIAVMNIEEFRGKLGLFTGIDKCRFKKVVRPGDQLVL
FT                   EVLIDSIKMGLVKAKGIAKVGDEIAATTELMFIMTEEG"
FT   gene            162810..164375
FT                   /locus_tag="Thit_0147"
FT   CDS_pept        162810..164375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0147"
FT                   /product="integral membrane protein MviN"
FT                   /note="KEGG: tex:Teth514_0114 integral membrane protein
FT                   MviN; TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01475"
FT                   /db_xref="GOA:D3T5U4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U4"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ADD01475.1"
FT                   /translation="MSTAKKTVKAAGIIMIITLLSKVFGFLRDMTLAFQFGTSVSMDVY
FT                   NMATVIPMILFAAVTAAIATTVVPIFTEYFQKDGKRKAFDFINNLLGIVLLATIILTIL
FT                   GFLFAPYLVKFVAPAFTGEKFELTVKLTTILLPTMVFIAASNIFTGALQSMEHFTIPAM
FT                   IGIPYNIIVITVAILYGNKFGITAVAYSIIIATFLQALMQLPVLYKLGYRFRVKVDFKD
FT                   EGVKRVVLLAMPVLMGTGIQTINVYVDRVIASFLPDGSIAALNYANRLNMFALGIFSTA
FT                   IATVIYPVLSKHSVTDDTEGFLKSLNFAVSSILYILIPVSVGAMVLRMPIIKVLFERGA
FT                   FDENSTYLTSIALFYYAIGMTAYGLRDVLSRSFYSMKDTKTPMINGAMAVLLNIALNLI
FT                   LVRYLKLGGLALSTSLAAIFAIFLLFTSLKRKVGKIDGKYMFMSFIRAMLASIVMGVLV
FT                   HFMYNNFIVKMPSDKRIYEAIALFITILAGAIIYSVIVLVIDRSAFSYFKKGIRFVNSK
FT                   FVKN"
FT   gene            164397..165515
FT                   /locus_tag="Thit_0148"
FT   CDS_pept        164397..165515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0148"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tex:Teth514_0115 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01476"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U5"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ADD01476.1"
FT                   /translation="MKSKVYFYNLRANKASSSLSSKVARIFDVAGFKNIIDKNDLVAIK
FT                   IHFGEKGNNAYINPIYVRKVVDKIKSYGGKPFLTDTNTLYKGSRSNAIDHLTTAIENGF
FT                   AYAVVNAPIIIADGILSKDSVEVKIDKKHFDTVKIASNIFFANSMIVMSHFKGHELAGF
FT                   GGAIKNLAMGCAPAAGKQQQHSTVQPVVGKGCTACQMCIRNCPVNAISLVNGSAYIDPS
FT                   ICIGCGECVSICQYGVIKPQWGTDMDAFVERMTEYAYGAYSTKKGKIAFINFIMNVTPL
FT                   CDCTPWSDAPIVPDIGILASFDPVAIDQASYDLVNQQFGHKGTALEEAGYGMNPGEDKF
FT                   KALHPETKGELQLKYGEEIGLGTRDYELVELK"
FT   gene            165621..165782
FT                   /locus_tag="Thit_0149"
FT   CDS_pept        165621..165782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01477"
FT                   /db_xref="GOA:D3T5U6"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U6"
FT                   /inference="similar to AA sequence:KEGG:TTE0178"
FT                   /protein_id="ADD01477.1"
FT                   /translation="MEKYFVIISIISVVTLILLLLVLIAFVKWTNRIFGIENEKKGKND
FT                   KDKKEKNN"
FT   sig_peptide     165621..165704
FT                   /locus_tag="Thit_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.894) with cleavage site probability 0.870 at
FT                   residue 28"
FT   gene            165814..166626
FT                   /locus_tag="Thit_0150"
FT   CDS_pept        165814..166626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0150"
FT                   /product="protein of unknown function DUF152"
FT                   /note="PFAM: protein of unknown function DUF152; KEGG:
FT                   tex:Teth514_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01478"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U7"
FT                   /inference="protein motif:PFAM:PF02578"
FT                   /protein_id="ADD01478.1"
FT                   /translation="MEIGFKRNEVKGVVFYTIPSFEKTGLVKHLFTTRIGGVSKGKYAF
FT                   LNLSLKRYDTKEEVYENFKIICDAGGFSYEDMVFSDQVHGDVIRKVTLKDKGKNFGGND
FT                   ISGVDALMTNERGIPLVTFYADCVPLFFLDPVKKVIALAHAGWRGTVFSIGPKTVNAMG
FT                   EEYGSNPEDILVGIGPSIYKCCYEVSDDVANKIRGVIDEWEKVLVKKAEGKWMLDLQLT
FT                   NYLELINCGIPDGNITVSKMCTHCNSEFYSYRRDKGMTGSMAAFMELR"
FT   gene            166768..167001
FT                   /locus_tag="Thit_0151"
FT   CDS_pept        166768..167001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0151"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   tex:Teth514_0118 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01479"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U8"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ADD01479.1"
FT                   /translation="MKVSATEFKTRVGKYLELVDKEEIIITKNGREVAKLIPAKKEGTP
FT                   NADFLYGILSNYPDKNITAEQIREERIRNKYN"
FT   gene            167053..167472
FT                   /locus_tag="Thit_0152"
FT   CDS_pept        167053..167472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0152"
FT                   /product="Nucleotide binding protein PINc"
FT                   /note="SMART: Nucleotide binding protein PINc; KEGG:
FT                   tex:Teth514_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01480"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5U9"
FT                   /inference="protein motif:SMART:SM00670"
FT                   /protein_id="ADD01480.1"
FT                   /translation="MMKVLIDTNVILDVLLKRTPFDVDAYNILKLAEEKKINAYLAAFS
FT                   ITDIYYFINKNLSHNESIKALEALLSIVEVVSITKYDIKKAMNFKEFGDLEDALQMQCF
FT                   KKLKGDLIITRDEKFQKITNKAISPKDFLSNKGLT"
FT   gene            167651..170590
FT                   /locus_tag="Thit_0153"
FT   CDS_pept        167651..170590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0153"
FT                   /product="PTS system transcriptional activator"
FT                   /note="KEGG: tex:Teth514_0120 sigma-54 factor interaction
FT                   domain-containing protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; PTS system fructose subfamily IIA component;
FT                   PRD domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01481"
FT                   /db_xref="GOA:D3T5V0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V0"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADD01481.1"
FT                   /translation="MIDRIFEIIQKEDRRNPLTDEQIASILNIKREDVTQFRLKNNIPD
FT                   SRERRKPYLLEDAKKIISKDPNISDRNLTKELNNLGYNISRFVAAQIKKEILKSESSKT
FT                   LVKSEIFQNIEKQKVDKDHNSNKDTLSFKDIIGSEGSLRVQISLAKAAVLYPPHGLHTL
FT                   IVGPSGSGKSQLAEAMYSFAIESRRFNKNAPFVVFNCADYADNPQLLMAQLFGYVKGAF
FT                   TGADTAKGGLVEKADGGILFLDEVHRLPSEGQEILFYLLDKGKFRRLGETESTREAQIM
FT                   LIAATTENPESSLLLTFRRRIPMVIELPSLSERPPQERYEIIHHFFSKESFRINKSIIV
FT                   KKEAVRALMLYDCPGNIGQLRSDIQVACARSFLNSLGSKSSSLTIDLSDLPNHVKMGII
FT                   RVNKRDPEIERYSNEDIMVYPDKEIKLYPKEDRYMLPDEIYQFIEERFIDLKREGLTKE
FT                   EIDKILGKEIEAELKKFAVNVKSNITISKKELTNIVGEKIVNAVEKAYEIAKKSFKNLE
FT                   DNLFYSLTIHLSAAYERILSGKPIINPQLENIVKEYPVEYSIAKIMAKQINKELEIQLP
FT                   DEEVGFIAMYLRTFSGDKEITKGRVGVVVLTHGHVASGMAEVANKLLGVNHAVGIDMAL
FT                   DESPESVLERTIEVVKRIDEGKGCIILVDMGSLITFGEIITKRTGIPTRVVGRVDTVMV
FT                   LEAVRRAIIPDTNLDEIADALDVDKTYIGRVEGIKSKDKLPKAIVTVCITGEGTALKIK
FT                   KYIEDVLPQLKDDYKIIPVGMLRQEDIEKEILKIREENEVVAFVGTINPGIKSIPFISV
FT                   EDILHGTGIEKLKKILNLKVENSLKEIIDENLILCDVDISMKSDVIDKLVELLQDKGYV
FT                   DDKFLLSVYKRESMGATFLKGGIAIPHGYPEHVTKPAIAIAKLKEPIYWEGEFKADLVF
FT                   MIALKEDSKDYMFYLYKVMTDEKIIDALKRAESPAQIKDIILKNTISAE"
FT   gene            170664..171134
FT                   /locus_tag="Thit_0154"
FT   CDS_pept        170664..171134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0154"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: tte:TTE0181
FT                   phosphotransferase system mannitol/fructose-specific IIA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01482"
FT                   /db_xref="GOA:D3T5V1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V1"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADD01482.1"
FT                   /translation="MNFSEFLHEELIIPKMKANSQEEVFKRLYELLLENGYVKESFLEG
FT                   IKKREQSFPTGLLLNKYNVALPHTDVEHVLKSAVAVATLSKPIAFKNMANPQQDVNVNI
FT                   VFMIALNESGGQVKMLQQIVQLIQNDSLLEELMRAESGKEIIKVIKSVSHEN"
FT   gene            171250..171561
FT                   /locus_tag="Thit_0155"
FT   CDS_pept        171250..171561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0155"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   tpd:Teth39_2080 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01483"
FT                   /db_xref="GOA:D3T5V2"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V2"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADD01483.1"
FT                   /translation="METTEKNKKVRVLVVCADGVATSTVVFVSLREELEKRGIKAEFVQ
FT                   GRVMDVERMTKDGNFDFVVSTAGTSLDVEIPVISGVPFLTGIGREQVFNQILEIINKK"
FT   gene            171586..172965
FT                   /locus_tag="Thit_0156"
FT   CDS_pept        171586..172965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0156"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: tex:Teth514_0123 PTS system galactitol-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01484"
FT                   /db_xref="GOA:D3T5V3"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V3"
FT                   /inference="protein motif:PFAM:PF03611"
FT                   /protein_id="ADD01484.1"
FT                   /translation="MFAMLVKTFGAAVLLPIFILILELILGVKFSKAIRSALYIGVGLN
FT                   GLISILNPYFLGAVGKAVSEMITTKGVHLPYVDTGWALLAAVGYSTKIGALIIPIGIGV
FT                   NLVMLLLRWTNTLDLDIWNFWHWAFVGSMTYYATNNLWFGILAAVAIEMFLLVIADITA
FT                   PTMQKFFNLPGLSFPHASGQGAVLLAPPFKWFFTKIGLTKLQISSRTVREKFGILGDSV
FT                   VIGFIISSIIGFLAWGNRLGDIQTWSQILTLGIGTGAYIYLYPKATGALLEGFVPLNER
FT                   VRDILSRKGIQRELNFGMDSALTVGHPDVITTGLLTMITAVPLVFLLPGNKFLMLADLG
FT                   VTPFFLASAVTAVMGGNIIASYITTVVGIIITLYISSAGSPLFFHTVTSLGISLPDTGA
FT                   AMVGADIRPLHGLFYFLGKTPIGLIVLYVSIFVILFSFKKNPTAWYRAFGYAEDETSEN
FT                   R"
FT   gene            173067..174026
FT                   /locus_tag="Thit_0157"
FT   CDS_pept        173067..174026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0157"
FT                   /product="Phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: tpd:Teth39_2078 phosphoglycerate
FT                   dehydrogenase; PFAM: D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01485"
FT                   /db_xref="GOA:D3T5V4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V4"
FT                   /inference="protein motif:PRIAM:1.1.1.95"
FT                   /protein_id="ADD01485.1"
FT                   /translation="MKKWKVVSTAVTFGKINKEPVERLEEFGCEVVLNPFGRPFTNEEI
FT                   IRYASDADALIVGNDKVPGDVIKKCKRLKIIAKHGVGVDSIDVKTANQLGIVVTNAPGT
FT                   NSEEVADLAFGLLHMLARGLYQANTDTKNGKWIKPVGISLSKKTIGIIGVGTIGTAVAK
FT                   RATGYDMNILGYDIKKNPLALGLGVKYVGLDELLSEADFISLHLPLTNDTLNILNADKF
FT                   KLIKKGAIMINTARSQLIDNEALYNSLIDGTLKGYATDVYDFEPPMHLPLFDLPNVILT
FT                   PHIGGTTVESNKRMGNTAVDNVIAVLKGETPPNIVLVD"
FT   gene            174060..174350
FT                   /locus_tag="Thit_0158"
FT   CDS_pept        174060..174350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0158"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: tpd:Teth39_2077 SAF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01486"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V5"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ADD01486.1"
FT                   /translation="MPSIKKAILLNKADSVATALSQIQKGDVVDIIYNNETVNRLIALD
FT                   DIEIYHKIAVVPIQSGNNVYKYGEVIGKAIKSIEIGQCVHIDNIESVRGKK"
FT   gene            174347..175516
FT                   /locus_tag="Thit_0159"
FT   CDS_pept        174347..175516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0159"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="KEGG: tpd:Teth39_2076 altronate dehydratase; PFAM:
FT                   D-galactarate dehydratase/Altronate hydrolase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01487"
FT                   /db_xref="GOA:D3T5V6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V6"
FT                   /inference="protein motif:PRIAM:4.2.1.7"
FT                   /protein_id="ADD01487.1"
FT                   /translation="MKIKAYKRPDGKYGIRNKVLILPSVGCANETARLISEQVQGTTYI
FT                   TNPKGCGQIGSSVELMHRTLIGLALNPNVYGTIIVGLGCETIQAYDLYEEVKKRSNKPV
FT                   EVISIQREGGTLKTIQKGIKLARKMVEEMSKIEREEVDISNITLATNCGGSDATSGIAA
FT                   NPTLGYCSDILIKEGATVFLGETTEFIGAEHILARRAKNEKVRNNLLTIVKNLENEFIR
FT                   LGIDVRGANPSPGNIKGGLSTLEEKSLGSIMKGGTSIINEVVRYGEIPKEKGLIIMDTP
FT                   GYDIESVTGMVAGGAQICVFTTGRGTPIGNPIIPLIKITGNKQTYENMSDNIDLDVSDI
FT                   IEGKKDIKECGEMLLQEIIDVCNGKLTKAEIYGFSETCIYRNQEIWCSW"
FT   gene            175608..176753
FT                   /locus_tag="Thit_0160"
FT   CDS_pept        175608..176753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0160"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: tpd:Teth39_2075 galactonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01488"
FT                   /db_xref="GOA:D3T5V7"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023592"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V7"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ADD01488.1"
FT                   /translation="MKITSLKVYKVKPRWIFLKIDTDEGISGWGELISGTKTETVVAGA
FT                   YEMGEYLIDKDPRQIEDMWQVIYRSFFRGGPINMTILSGIEMALWDIKGKYYNMPVYEF
FT                   LGGKARDKIMVYSWIGGDRPSDVVEAALDRKNKGFKAIKMNATEELHYIDSYKKIEAVI
FT                   ERVASIRDAIGYEMEIGIDFHGRVHKAMAKVLAKELEKYRPMFIEEPVLPENNEALKEI
FT                   ASHTSIPIATGERLYTRWGFKDVLKSGVVDIIQPDVALTGGILEAKKISAMAEAFDVAV
FT                   APHAPYGPIALAATLQLDICTPNVFIQEQSLGIHYNQGFDLLDFVKNKEIFAYKDGFVD
FT                   IPTGPGLGIEIDEELVKKVDMEGLHWTNPKWRNYDGTVAEW"
FT   gene            176799..177761
FT                   /locus_tag="Thit_0161"
FT   CDS_pept        176799..177761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0161"
FT                   /product="Phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: tpd:Teth39_2074 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01489"
FT                   /db_xref="GOA:D3T5V8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V8"
FT                   /inference="protein motif:PRIAM:1.1.1.95"
FT                   /protein_id="ADD01489.1"
FT                   /translation="MPKYKVVITARSFGESSDEPFNILKGNDCEVVKIPADRPLSAEEL
FT                   IPLVKDADALIVGNDKVTEDVINAGKKLKVISRYGVGYDNVDLNAAKKKGIVVTNTPNA
FT                   NNNSVADLVIGLMLVLARNLLAVDRIVKSGGWKRIMGTEIYGKTLGIIGLGKIGKGVAK
FT                   RAKGFDMNVLCYDVYQDLKFAEEYGITYCSFEELLKQSDIVTIHVPLAPETKGLIGERE
FT                   LGMMKPTAFLINTSRGGIVDESALYNALANKKIAGAALDVMEQEPPINSPLLQLDNVVI
FT                   TSHIGGYTCEAITNMGIVAAKNVVLVLNKKQGAHIVNGE"
FT   gene            177781..178428
FT                   /locus_tag="Thit_0162"
FT   CDS_pept        177781..178428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0162"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: tpd:Teth39_2073
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01490"
FT                   /db_xref="GOA:D3T5V9"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5V9"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADD01490.1"
FT                   /translation="MKSYEVLNKIKEVGICAIVRGTSVDSLYRIADSLIAGGIKAIEVA
FT                   FNTPGAAKMIEKLVGKYSDQVLVGAGTVLDAETARIAILSGASFILSPSLNLEMIKICQ
FT                   RYNVLPVPGISTPTEAVTAWENGAQIVKVFPAGVFGPNYIKQLKGPLSQIEMMAVGAVN
FT                   LDNFKDFIKAGACSVGIGSELLNNKLVEEGKFDEITRRAAAFVNGFKEVIGK"
FT   gene            178502..179662
FT                   /locus_tag="Thit_0163"
FT   CDS_pept        178502..179662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0163"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tpd:Teth39_2072 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01491"
FT                   /db_xref="GOA:D3T5W0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD01491.1"
FT                   /translation="MRKNAYTIAIIYLLMMLIGIVENVKGPLIINIKTFYGVDYTMMGL
FT                   FLSVGSFGFILSTFLGGFLADKIGRKSVLISGLILIITGILGIFAARKFIVFLVFAFVM
FT                   NMGMGLLEIGINAVASIVFIVNQALMMNLLHFFYGVGAIISPNMTAKLLHINFSWQQVY
FT                   LTVGAIIFILMLAALEIKMHGEEKHIARDKIDYIQILSDKRMWLFASMLGFYVASELGI
FT                   GNWAVTFFSAQYKMDNTISSLYLGLFFATFTFGRLVGGFIVERIGYIKSLFIFSLVSSI
FT                   LIASGMAGRNFAFLISVAGFFYSIIFPTTIAIVMKEFKQHVTIIIAIILTISSTINMLA
FT                   NFLIGRLNDIFGVFIGFSAILIFMILVVFMSLILAKTETTDDLEKV"
FT   gene            179781..182528
FT                   /locus_tag="Thit_0164"
FT   CDS_pept        179781..182528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0164"
FT                   /product="PTS system transcriptional activator"
FT                   /note="KEGG: tpd:Teth39_2071 PTS system transcriptional
FT                   activator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; PRD domain protein; PTS system
FT                   fructose subfamily IIA component; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01492"
FT                   /db_xref="GOA:D3T5W1"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W1"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADD01492.1"
FT                   /translation="MTNKERVFNLIKDLSKDINIKEKKGLTAQEIAKKLNLRRNVASHL
FT                   LNELYKEGKIIKINTRPVYFLDKEVYEKKAKEFKETAKTLDSTVKVSNDDPFTKLIGYN
FT                   GSLKTQVKLCKSAASYPPNGLPILLIGNTGVGKSFIAQLIYEYAKSINAIDENAPYVIF
FT                   NCAEYANNPELLSANLFGYVKGAFTGADKDKPGLLEEADGGYLFLDEVHRLPPEGQEKL
FT                   FLFLDKGIFRRLGETGNWRTAKVRFIFATTEDPEQTLTKTFLRRIPLVVNIPSLYDRPL
FT                   HERLQLIYNFYKNEAKNLGMDILISKQVLNVLLKTKISGNIGQLMNVIKYSCAQAYNHV
FT                   IREKTNILRIHLYDLPKEMQADLDIIKSNFHFNGMLISHSRKDEDLTWDKEDDKEVYDV
FT                   VNKLFELFERYSSKEISEDTFKKDALIYLNEFTDKIIFKNDNTYIDSIVFNAIKSVVEN
FT                   VLNIIQNMYGIKYYGNSVLVLTHFINYLLSDVTYEKYSENIKVVLGVLKNVFPKEFIIA
FT                   NKMVELIEVNLDVKLNQIAVIYFTLYIKSLTKNDNTNLINSIIIAHGYSTASSIASVAN
FT                   RLLGQFVFEAFDMPIEMSTQEIMLKVQDYLKNIDTSKGIIILVDMGSLEEIYKSLTDIV
FT                   EGDIAIINNITTQLALDVGNKIIQNQPIEQIVTESIQRNSSSYKLIKSQKNKRNAIIAT
FT                   CITGIGTAVKIKELLKECFVNEDIEIIAYDYNRLKGNGVKDEIFKDFNVKLIIGTADPG
FT                   IKEIPYLSLEDLIAGKGDVLLSKVLRGVADAEKIQQINQTIVRLFSLQNVLHHLTILNP
FT                   DKIIAQVEKAISDLERFIGVRFSNDLKISLYIHVSVMIERLVMKEPIVFYSSLEEFEQC
FT                   HRQFINFVKSSFSVIEEMYKIEIPTSEIRLIYDIIKDRVTELSV"
FT   gene            182699..183109
FT                   /locus_tag="Thit_0165"
FT   CDS_pept        182699..183109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0165"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: tpd:Teth39_2070 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01493"
FT                   /db_xref="GOA:D3T5W2"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W2"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ADD01493.1"
FT                   /translation="MKEKFVLIITHGNFGKGLLNGIEVIMGKQENVLALGLNLGDNIEF
FT                   LRAEVEKIVREKLRENKEVIIAVDLFGGSPFNVALYVMKNYDVKVITGVNMPMLIELLS
FT                   SLNACDTKELINNIYKVGVDGIKVIEKNSLSL"
FT   gene            183342..184121
FT                   /locus_tag="Thit_0166"
FT   CDS_pept        183342..184121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0166"
FT                   /product="phosphotransferase system PTS sorbose-specific
FT                   IIC subunit"
FT                   /note="PFAM: phosphotransferase system PTS sorbose-specific
FT                   IIC subunit; KEGG: tpd:Teth39_2069 phosphotransferase
FT                   system PTS, sorbose-specific IIC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01494"
FT                   /db_xref="GOA:D3T5W3"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W3"
FT                   /inference="protein motif:PFAM:PF03609"
FT                   /protein_id="ADD01494.1"
FT                   /translation="MQMSLSISQAALIALWIAIVEARALGYSTLMLRFSPLMTGLIVGI
FT                   VMHDIPTAMTITAAIQLIYMGLIAPGGAMPSEPAVATAIAVPVAILGGLTPEAAIAIAV
FT                   PVGLLGSYLYSLRFFINTFIIRLTDKYADELNEKGLTLSIIVLPILVSLVLFFPLMFIA
FT                   LYKGTPLIADLVKTLTVGKAFHVLNVVGGGLPALGIALTLTVIGKRKFLVFFLLAYFMA
FT                   VILKPLNVNTVTYAILGGIIAYLYVLVTHSQVEGQEI"
FT   gene            184140..185027
FT                   /locus_tag="Thit_0167"
FT   CDS_pept        184140..185027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0167"
FT                   /product="PTS system mannose/fructose/sorbose family IID
FT                   component"
FT                   /note="PFAM: PTS system mannose/fructose/sorbose family IID
FT                   component; KEGG: tpd:Teth39_2068 PTS system
FT                   mannose/fructose/sorbose family IID component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01495"
FT                   /db_xref="GOA:D3T5W4"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W4"
FT                   /inference="protein motif:PFAM:PF03613"
FT                   /protein_id="ADD01495.1"
FT                   /translation="MMENIEARDDLKGTQSNSTDSKITKKDLLLSWIRWWYANEIPHSY
FT                   DRMIAPSLLWGLMPILRKLYKKSEDLKEAYKRHLVFYNTQAIWGGGTILGITASLEEAR
FT                   ARALEENKGEDVVTPDVINSTKVGLMGPLAGIGDAIDSGTVQYILIGMFLPWAKAGSAL
FT                   GALIPWIAFVALTFTYGFYFTQLGYRLGRAAAIEIVSGKGIRSIIDGLSILGTFMMGIL
FT                   AALYVSVSTPLKWSLSGKEFVLQDILDKILPGLLPLLTVLLVYLYFSKKGLKIIQALLG
FT                   LVVIFGVLGVIGIL"
FT   gene            185177..185665
FT                   /locus_tag="Thit_0168"
FT   CDS_pept        185177..185665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0168"
FT                   /product="PTS system sorbose subfamily IIB component"
FT                   /note="PFAM: PTS system sorbose subfamily IIB component;
FT                   KEGG: tpd:Teth39_2067 PTS system sorbose subfamily IIB
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01496"
FT                   /db_xref="GOA:D3T5W5"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W5"
FT                   /inference="protein motif:PFAM:PF03830"
FT                   /protein_id="ADD01496.1"
FT                   /translation="MFARVDDRLIHGQVMTKWVKGYNCNSIFIVDNSLANDEFMKQVYM
FT                   MSASAAHVALKILSTEETITLWKKDKFNGFRVILLYKDIISVKETIANGLPIKKLNIGG
FT                   IAKSQDRKFIIPSVSLKKEELEILVELADNFGVEVFFQTVPDSKRVDLEDALKLFGLK"
FT   gene            185788..186750
FT                   /locus_tag="Thit_0169"
FT   CDS_pept        185788..186750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0169"
FT                   /product="Phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="KEGG: tex:Teth514_0136 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding; PFAM: D-isomer
FT                   specific 2-hydroxyacid dehydrogenase NAD-binding; D-isomer
FT                   specific 2-hydroxyacid dehydrogenase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01497"
FT                   /db_xref="GOA:D3T5W6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W6"
FT                   /inference="protein motif:PRIAM:1.1.1.95"
FT                   /protein_id="ADD01497.1"
FT                   /translation="MRKKILITPRSFGKSSNLPFEMLKKYDYEIIKNESGQPYEESQLI
FT                   DLIKDVDGIIVGLDKITSNVLRNAKKLKVITKYGVGVDNIDVDEAERMGIKITYTPDAN
FT                   KESVADLVFALMLGLSREIIKLDNIVRNNRWEKIIGNEIYKKTIGIIGTGAIGRCVAKR
FT                   AMGFDMKILAYDKYPNYEFANSIGMKYVDKKALLEESDFITLHLPLTEETYHFIDEEEL
FT                   KIMKDTAYIVNTSRGGIINENALYNALKNKKIAGAALDVFEIEPPIDSKLLELDNIILT
FT                   PHCGASTKDATDRMGIMAVEGLISILEGMEPKYLYKRQK"
FT   gene            186780..187412
FT                   /locus_tag="Thit_0170"
FT   CDS_pept        186780..187412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0170"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: tpd:Teth39_2065
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; TIGRFAM:
FT                   2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01498"
FT                   /db_xref="GOA:D3T5W7"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W7"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADD01498.1"
FT                   /translation="MEKQQIIEKLKQLKITAVIRNSDINTMFSLADALKKGGIEALEIT
FT                   VEAPGAIDVIKELSKANKYFVGAGTVLDAETARAAIIAGAKFIFTPVMRLDVIKLCNRY
FT                   GIPVIPGATTPTEILTGYEAGADFIKVFPAGVFGPQYLKEILGPLKHIPIFVTGGINKN
FT                   NIKDFILAGATGVSLGGALVDKELIAKGMFDKITEKAIEFVRLVNQV"
FT   gene            187535..188542
FT                   /locus_tag="Thit_0171"
FT   CDS_pept        187535..188542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0171"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: tpd:Teth39_2064 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01499"
FT                   /db_xref="GOA:D3T5W8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W8"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADD01499.1"
FT                   /translation="MGVKIAIVNSSSFGKHFPEHMERLKALGEVERFELPHDMRGKALA
FT                   EKLMGYSVIIASVKPYYDKEFFEHKDKTLLITRHGIGYDTIDIKSATEKGVIVTKVEGI
FT                   VEREAVAENAIALLLDVMKKVRSASLKVKEGKWEERASFIGYEIKDKVAGIIGIGNIGS
FT                   RVCEILKYGFGAKVVAYDPNLSAEEIEKRGAEPVTLEELLKRADIISLNASLNRDNYHI
FT                   LSHKEFAMMKKGTFIVNTARGELIDTEALIKALKEGIVLGAGLDVIEGEPIDENHPLLA
FT                   FDNVIITPHTSAYTYECLKGMGDKVVSDVEKVLRGEIPEGVINKEVLEGRPWKI"
FT   gene            188756..190165
FT                   /locus_tag="Thit_0172"
FT   CDS_pept        188756..190165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0172"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="KEGG: tex:Teth514_0139 6-phosphogluconate
FT                   dehydrogenase; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01500"
FT                   /db_xref="GOA:D3T5W9"
FT                   /db_xref="InterPro:IPR006113"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5W9"
FT                   /inference="protein motif:TFAM:TIGR00873"
FT                   /protein_id="ADD01500.1"
FT                   /translation="MIKADIGLIGLGVMGQNLALNIARNGYAVSVFNKTEEKTREFIDE
FT                   KVKEEKIYPFYTLKNFVESLKKPRKIILIIKAGTPVDDVINELLSYLEKGDLIVDSGNS
FT                   YFMDTSRRLKVLKEKNILFLGMGISGGEYGALYGPSLMPGGTKEAYELIKDVLLKVAAK
FT                   TGDGPCCTYVGNDSAGHFVKMVHNGIEYAIMQLIAEVYDFMRKILNMTNEEIGDVFERW
FT                   NQEELDSYLMEISYKIMKYKDKETGGFLLDYILDKAEQKGTGKWTAQTSLDLGVPTPTL
FT                   NLAVEARVISHYKEERKTLSKLYSKEKNTISVNKEEMIEHLKKTLLFGVFMSFSQGLWL
FT                   IYEASKQYNYGVDLSEILRIWKGGCIIRAKILDFLRDIIRENEKYANLLHSDKSIDFIK
FT                   DKLNSVYQVLEIGRNYRIPLMIINSAVDYYFALTEENLPANLIQAQRDFFGAHTYERVD
FT                   KEGIFHTEWEK"
FT   gene            190320..191663
FT                   /locus_tag="Thit_0173"
FT   CDS_pept        190320..191663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0173"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number="3.6.3.14"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   KEGG: tpd:Teth39_2062 TrkH family potassium uptake protein;
FT                   PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01501"
FT                   /db_xref="GOA:D3T5X0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X0"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ADD01501.1"
FT                   /translation="MIFIIKIKLTPTQVLALGFATIILIGTLLLMLPVATKSGERTDFL
FT                   TALFTATSATCVTGLVVVDTKTYWSVFGQIVIMLLIQIGGLGIMTMSTLFALILGRKIT
FT                   FKERLVMQEAFNTNSLGGIVKFAKYILMVSFLFESIGAIILTLRFLPQMGLKKAVYYGL
FT                   FHSISAFNNAGFDLMGNFKSLTGYVSDWVVNLVVMGLIIFGGLGFYVLLDIYEHRHFNK
FT                   FTLHSKIVITITLLLIAIGTLLIFLFEYNNPKTLEPLDFPTKILAALFQAVTPRTAGFN
FT                   TLSLSDMTIASKFLTIILMFIGASPAGTGGGIKTTTFAVILYTVLSVIQGEEETVLYKR
FT                   TISRNIVYKAVAISFISVFIIFSVTMVLSITETSDFLTVLYETTSAFGTVGLSLGLTPE
FT                   LSTVGRIIIIFTMYTGRVGPLTLALALAKRQRRPKPIIKYAEEKIMVG"
FT   gene            191678..192331
FT                   /locus_tag="Thit_0174"
FT   CDS_pept        191678..192331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0174"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: tpd:Teth39_2061 TrkA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01502"
FT                   /db_xref="GOA:D3T5X1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ADD01502.1"
FT                   /translation="MKQFVVIGLGSFGISLAKTLYEMGNDVLVIDEDEELVQAMNGLVT
FT                   HAVRADATDENVLKSLGVKNFDVAIVAIGKNMESSIMVTMLVKELGVKYVIAKAHNELH
FT                   ARVLYKVGADRVVMPEKDMGIRVARNVFSSNLIDLIEFSKEYSIAEILPIEEWFGKTLK
FT                   EINVREKYGLNVVAVKKFNDEIIVSPGPDYVINEGDVLAVCGKNTDIKRFEIKT"
FT   gene            192496..192618
FT                   /locus_tag="Thit_0175"
FT   CDS_pept        192496..192618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_0401 xylose isomerase-like TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01503"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01503.1"
FT                   /translation="MKRKLKNSVGIWAFGPAATRFDPAGYHTELSNETMEAYIA"
FT   gene            192671..193987
FT                   /locus_tag="Thit_0176"
FT   CDS_pept        192671..193987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0176"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="TIGRFAM: xylose isomerase; KEGG: tpd:Teth39_2060
FT                   xylose isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01504"
FT                   /db_xref="GOA:D3T5X3"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X3"
FT                   /inference="protein motif:TFAM:TIGR02630"
FT                   /protein_id="ADD01504.1"
FT                   /translation="MEYFKNVPQIKYEGPKSNNPYAFKFYNPDEIIDGKPLKEHLRFSV
FT                   AYWHTFTANGTDPFGAPTMQRPWDHFTDPMDIAKARVEAAFELFEKLDVPFFCFHDRDI
FT                   APEGETLRETNKNLDTIVAMIKDYLKTSKTKVLWGTANLFSNPRFVHGAATSCNADVFA
FT                   YAAAQVKKALEITKELGGQNYVFWGGREGYETLLNTDMELELDNLARFLHMAVEYAKEI
FT                   GFEGQLLIEPKPKEPTKHQYDFDAANVYAFLKKYDLDKHFKLNIEANHATLAGHDFQHE
FT                   LRYARINNMLGSIDANMGDMLLGWDTDQFPTDIRMTTLAMYEVIKMGGFDKGGLNFDAK
FT                   VRRASFEPEDLFIGHIAGMDAFAKGFKVAYKLAKDGVFDKFIEERYRSYREGIGLEIVS
FT                   GKADFKTLEEHALNNPKIENKSGKQELLESILNQYLFSE"
FT   gene            194004..195506
FT                   /locus_tag="Thit_0177"
FT   CDS_pept        194004..195506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0177"
FT                   /product="xylulokinase"
FT                   /note="KEGG: tex:Teth514_0154 xylulokinase; TIGRFAM:
FT                   xylulokinase; PFAM: Carbohydrate kinase, FGGY-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01505"
FT                   /db_xref="GOA:D3T5X4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X4"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ADD01505.1"
FT                   /translation="MYFLGIDVGTSAVKIILIEENGNVIGSISKEYPVYYPQPGWSEQN
FT                   PEDWWNATKDGIRELIIKTGVKNYDIKGIGLSGQMHGLVVLDENNNVLMPAILWNDQRT
FT                   QEECDYITQTLGKEKLAKYTGNKALTGFTAPKILWVRKHRPDIYKKIHHILLPKDYIRF
FT                   KLTNEYATDVSDASGTLLFDVENRKWSTEMLDALDIPYNWMPKCYESTEVTGYVIKDVA
FT                   DLTGLKEGTIVVGGGGDQASGAVGTGTVKSGIVSVALGTSGVVFASQDKYVVDGENRLH
FT                   SFCHANGKWHVMGVMLSAAACLKWWVDEINNFGKASVTYDELLEEAEKVRAGSGGLIFL
FT                   PYLMGERTPHSDPYARGCFIGLNMTHNRGHMTRAILEGVAFGLRDSLEIIKELNIPVNE
FT                   VRVSGGGAKSVLWRQVLADIFGVRVDMVNATEGPAFGAAIMAAVGYEVFKDVEEACSKL
FT                   IKVSDSVYPIEENKDKYNEVYKIYRNLYYTLKDTFKDVSGIE"
FT   gene            195519..196676
FT                   /locus_tag="Thit_0178"
FT   CDS_pept        195519..196676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0178"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: gym:GYMC10_3207 oxidoreductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01506"
FT                   /db_xref="GOA:D3T5X5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X5"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADD01506.1"
FT                   /translation="MIKVAIIGTGNISPQHIQGYLQFSDRCKIVALADIYPEKARDKKE
FT                   RFNLEDADVYDDYKKVLERNDVDLVDICTPPYTHAEIAVNALNTGKHVLVEKPMASSLE
FT                   ECDKMIKASEKNNKLLSVVAQNRFTTQFMKLKHVVDSGLAGDIVHAQVDSLWWRGRSYY
FT                   DLWWRGTWEREGGGCTLNHAIHHIDMLIWLMGMPEEVQAVMSNVAHENAEVEDISIAIL
FT                   KYKNGAVGQITSSVVHHGEEQQIVLQGKKARISAPWKVYASIPSSNGFPAGRDEKLEKE
FT                   LQDFYDKLPDLKYKGHTAQVNDVLNAIEMKQNVLVSGNDGRNALELITAIYESASTKQP
FT                   VKLPLSERDPFYTVSGIRANVPYFHKKKTFIENFDDENITFGRII"
FT   gene            196723..197793
FT                   /locus_tag="Thit_0179"
FT   CDS_pept        196723..197793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0179"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: pjd:Pjdr2_5203 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01507"
FT                   /db_xref="GOA:D3T5X6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X6"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADD01507.1"
FT                   /translation="MNKENGMYYMPESQAKKVCNKGDFIFAAIGLDHGHIYGMTKGLIE
FT                   AGAQLKWVYDPDPVKVEAFCRAYPQVKKARSEDEILEDDSVHLVASAAIPSERCDLGLR
FT                   VMDAGKDYFADKPPLTTMEQLERAKKKVKETKRKYAVYYGERLHNEGAVFAGQLVKEGA
FT                   IGRVLQVIGMGPHREGKGRPSWFYEKEKYGGILCDIGSHQIEQFLYYTGAKDAEVQIAR
FT                   IANYNHKQYPNFEDFGDVLLVGDNGATGYFRVDWFTPDGLGTWGDGRLFILGTEGYIEV
FT                   RKYIDVAREGTGDHVYIANKDGERYFHVKGKVGFPFFGELILDCLNRTENAMSQAHIFR
FT                   TIELALKAQNSAIKIE"
FT   gene            197816..199219
FT                   /locus_tag="Thit_0180"
FT   CDS_pept        197816..199219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0180"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="KEGG: tte:TTE1939 glucuronate isomerase; PFAM:
FT                   Glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01508"
FT                   /db_xref="GOA:D3T5X7"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X7"
FT                   /inference="protein motif:PRIAM:5.3.1.12"
FT                   /protein_id="ADD01508.1"
FT                   /translation="MKNFMDENFLLTNDIAVTLYHQYARNMPIYDFHCHLSPKEIYENK
FT                   RFKNITEIWLYGDHYKWRLMRANGIEEKYITGNADDYDKFMAYAKTIPMAIGNPVYHWT
FT                   HLELQRYFGIYDLLNEKTAKSIWEKANEVINKDDFNVRNIIKKSNVKIIITTDDPTDSL
FT                   EYHIKLKEQNEFDVKVLPAFRPDKGLGIEKEDFIPWLKKLEEVTGKEINNYEDFLQALE
FT                   KRIEFFHTVGCRISDHALDYVFYQKASKQEVEKIFKKALIRQHLTKEEIDSFKTYTLIF
FT                   LGKKYAELKWVMQLHIGAMRNNNTKMYKILGPDTGYDSISDFKIAYPLARLLDSLDVED
FT                   SLPKTILYTLNPAANYVIATIIGNFQGGKIAGKMQFGAAWWFNDNKDGMIEQMKALANT
FT                   GLLSRFVGMVTDSRSFLSYARHEYFRRILCNLLGEWVENGEVPNDIELLGKIVQGVSFN
FT                   NVKEYIGII"
FT   gene            199269..199922
FT                   /locus_tag="Thit_0181"
FT   CDS_pept        199269..199922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0181"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /note="KEGG: cbe:Cbei_1836
FT                   keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase; TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01509"
FT                   /db_xref="GOA:D3T5X8"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X8"
FT                   /inference="protein motif:TFAM:TIGR01182"
FT                   /protein_id="ADD01509.1"
FT                   /translation="MNKWEVLETIMQEGIIAVIRSETKEKAIKVAEALKKGGIKMLEIT
FT                   MTVPGSIDIIKELSEKYKGQDIVIGAGTVLDRETTRLCILSGARFIVSPHLDIEIIKLC
FT                   NTYKILVIPGISSVKDIIKALEYGVDIMKLFPGEIMGPQAIKAFKGPIPQADFIPTGGV
FT                   NLNNLKDWIKAGAVAVGVGSNLTRGQEEENYELIEKTAKEYVKEVKRVKAQMKI"
FT   gene            200050..201687
FT                   /locus_tag="Thit_0182"
FT   CDS_pept        200050..201687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0182"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: tte:TTE1940
FT                   mannitol-1-phosphate/altronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01510"
FT                   /db_xref="GOA:D3T5X9"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5X9"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ADD01510.1"
FT                   /translation="MLLTRDGIKDIDKWRHAGIKLPNYDVEKVAEKTKQNPTWLHFGAG
FT                   NIFRGFIALLQQNLLDKGLSKTGIIAVESYDYEIIEKIYVPYDNLSLLVIMHADGTLEV
FT                   EVIGSISDKILADPLREDWVKLKNIFANPSLQIVSFTITEKAYNLKDFSGEYIKEVKED
FT                   IENGPEKPHGLMAKIVSLIYTRYLKGQYPIALLSLDNFSGNGERLFSSIKTITEEWVKK
FT                   GFIEGKFLDYLTNPAKVSFPLSMIDKIVPRPSEEIKKKLEDLGIEKMDIIKTGKNTIIA
FT                   PFVNAEKIHYLVIEDKFPNGRPPLEEAGVIFTDKETVEKVERMKVTTCLNPLHTTLAIF
FT                   GCLLNYNTIADEMRDPCLKKLVEKIGYEEGLPVVVHPGVLDPKEFLREVIEVRFSNPYM
FT                   PDTPQRIATDTSQKMAIRFGETIKSYKQREDLNVTDLKYIPFVIAGWCRYLMGVDDEGK
FT                   AMTLSPDPLLEDLKSHVSKIKLGDVDSIQDNLKPILSNEHIFGLNLYEVGLGEKIENYF
FT                   KELIIGPGAVRRTLEKYLENVNIYRKNY"
FT   gene            201703..202650
FT                   /locus_tag="Thit_0183"
FT   CDS_pept        201703..202650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0183"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: tpd:Teth39_1972
FT                   ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01511"
FT                   /db_xref="GOA:D3T5Y0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y0"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADD01511.1"
FT                   /translation="MPTVVTLGEAMVVFTSEEYIPLEYATSFKKGLGGAEANFAVGVRR
FT                   LGVDVGWISRIGKDPFGNFIIKNLKSEGVDVSGVKIDEDHPTGIYFKEKRNSIIANVYY
FT                   YRKGSAASFMVPEDLDEGYIASAKILHITGITPALSDTCRATVYKAIEIAKSHNITISF
FT                   DPNIRLKLWKDNEYKRVLLDIAQYADIVLPGLEEGKMLFGITEPESIAKKFLDMGAKIV
FT                   ALKLGNKGAMLVTQEQTIYQLSSKVKEVDPVGAGDGFDAGFIVGLLRGWELKECLRLAN
FT                   DVGAIVVSTKGDMEGLPTMEEVEIFRGNMVHIER"
FT   gene            202685..203758
FT                   /locus_tag="Thit_0184"
FT   CDS_pept        202685..203758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0184"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="TIGRFAM: mannonate dehydratase; KEGG: ate:Athe_0856
FT                   mannonate dehydratase; PFAM: Mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01512"
FT                   /db_xref="GOA:D3T5Y1"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y1"
FT                   /inference="protein motif:TFAM:TIGR00695"
FT                   /protein_id="ADD01512.1"
FT                   /translation="MKMVFRWFGENDDSVTLEQIRQIPGVTGVVGALFDIPVGEVWPLE
FT                   RILDLKRKVEAFGLELEVIESVNVHEDIKLGLPSRDRYIENYKETIKNLGLAGIKVLCY
FT                   NFMPVFDWIRTDLSKKLPDGSEVMAYDDRIIKDLDPIKLVQEMESGSRGYSLPGWEPYR
FT                   LKELKRLFELYQDMDEEKLFDNLKYFLENVIPVCEKYDVKMAIHPDDPPWSVFGLPRIV
FT                   TNKENLEKIINLVDSPYNGLTLCSGSLGANPENNIPELIRYFGKKGRIHFAHVRNIKIV
FT                   SERAFHETSHLSSDGSFDMFEIMKAYYDIGFDGYMRPDHGRMIWGEKARPGYGLYDRAL
FT                   GIAYLNGLWEAINKMRG"
FT   gene            203967..204935
FT                   /locus_tag="Thit_0185"
FT   CDS_pept        203967..204935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0185"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC0556 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01513"
FT                   /db_xref="GOA:D3T5Y2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01513.1"
FT                   /translation="MNVEVTNKEFIELPSMNEKSNFKKTLKAIRKDWQLYSLLILPLAH
FT                   YLIFRYIPMYGNIIAFRKFYPGGPVYGSEWVGLRYFKMFLTDPTFWNVFKNTVILGLEY
FT                   LVISFPFPIVFALLLNELHNQLFKRFTQTVSYLPHFISVVIVAEMIIELLSPSRGVVNI
FT                   ILKHFTGNTINFLAEPAWFRTIYIVSGIWQEMGWGAIIYLAALSNINPELYEAAIIDGA
FT                   NKWQQIKYITIPGIMPTIMILLILNIGGFMSVGFEKILLLYNPMTYSTADVISTYLYRM
FT                   GLESNNFSYAAAIGLFDSIIALMLLTIANYLSKKFTETSLW"
FT   gene            204949..205821
FT                   /locus_tag="Thit_0186"
FT   CDS_pept        204949..205821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0186"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcl:ABC0557 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01514"
FT                   /db_xref="GOA:D3T5Y3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01514.1"
FT                   /translation="MRVSRGEKIFNVINIIIMVIVIIATLYPFWYLVSVSFSSEKFVYS
FT                   GAVTLFPKGFTLKTYKVLLAEKDFWISYKNTVIYTVLGTFISLFLSTLLAYPLSKKNLK
FT                   GRNIILGLVVFTMFFSGGLIPTYLLVNALGMRNTIWAVVIPGAINTYYVIIMKTFFEGL
FT                   PAELEEAAAIDGMDTFGILLYIILPLSMPVMATMTLFYAVGIWNNWFGPFIYLDQKELF
FT                   PVALYLRNIIVGSQSTMVNSTNDVNDIAQIQATVKAASVILTALPIIMVYPFLQKYFVK
FT                   GVMIGSLKG"
FT   gene            205931..207604
FT                   /locus_tag="Thit_0187"
FT   CDS_pept        205931..207604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0187"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bcl:ABC0558 sugar ABC transporter substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01515"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADD01515.1"
FT                   /translation="MSKKFKILIVAILVLSLLTTLFAGCSSKNSSQTQQKETQQAAQNT
FT                   NSSDPENKHFYSEKPLEFTMLYSEHPAYPYKEDWLLWKAIKDMTNVSLKLTVVPMSDYA
FT                   QKRSLLISTGEAPEIIPKTYPGQEIPFIPSGAILPVSDYINEMPNFQKQIKEWNLQDDI
FT                   NTLKQRDGKFYVLPGLHELYTPQYTIAIRADIFEKNNIPIPNSWDELYAALKKLKELYP
FT                   NSYPFSDRWQGKALLNLALPTFGIPTSSSDGLINWPTSGVLFDRDNDEFKFYPITEEWK
FT                   NMLSYFRKLVNEGLLDPESFTQTDDQAVEKFVTGKSFVITTNTQEVINMRNRMNETLGK
FT                   GNYKVTLILPPAGPAGAVVTGSRLENGIMISKNALKDPNFHDMLKFIDWLWYSEEGQTL
FT                   TKWGVEGVTYKKVDGKFELMPDVTAGFLGLNPNGTKDLRKDFGFGNGVFILMYGGPKDL
FT                   AYSYMTDEAKEFIEGVNKTRKLLPPAPPVLFDETQREQANMINQPLMDYVSQMTLKFIL
FT                   GQASLEKDWDNYVQQCRAKGADKLTQLTNEVYKSTKDMLK"
FT   sig_peptide     205931..206017
FT                   /locus_tag="Thit_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.442 at
FT                   residue 29"
FT   gene            207707..208723
FT                   /locus_tag="Thit_0188"
FT   CDS_pept        207707..208723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0188"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="PFAM: glycoside hydrolase family 10; KEGG:
FT                   csc:Csac_2408 endo-1,4-beta-xylanase; SMART: glycoside
FT                   hydrolase family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01516"
FT                   /db_xref="GOA:D3T5Y5"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y5"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ADD01516.1"
FT                   /translation="MNQYNESEIISLKEVYKDYFLIGAAVEVEDLEDGLHRQLLLKHFN
FT                   SLTAENAMKFERIHPKEDEFNFKDADKIVEFAMENNLKVRGHTFVWHNQTPEWVFKDKT
FT                   GNEVSKELLLERLKFHINTVCNHYKNKIYAWDVVNEAIEDKEDYVLRKSPWYRIIGKEY
FT                   VELAFKFVREADPEVELYYNDYNNEKPYKLYKTYDFLKSLLDKGIPIDGIGIQGHWDIY
FT                   DEGLFDNLKRAIELYASLGLKIQITELDISMFEFENKTREVLIPTAEMLEFQALTYKKL
FT                   FEIFRSYKGIITSVTFWGISDKHTWKDNFPVKGRKDWPLLFDEKQNPKKAFFEIVDF"
FT   gene            208763..210835
FT                   /locus_tag="Thit_0189"
FT   CDS_pept        208763..210835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0189"
FT                   /product="Alpha-glucuronidase"
FT                   /EC_number="3.2.1.139"
FT                   /note="KEGG: gtn:GTNG_1770 alpha-glucuronidase; PFAM:
FT                   Glycosyl hydrolase 67 middle domain protein; glycosyl
FT                   hydrolase 67 C-teriminal domain protein; glycoside
FT                   hydrolase family 67"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01517"
FT                   /db_xref="GOA:D3T5Y6"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR011395"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y6"
FT                   /inference="protein motif:PRIAM:3.2.1.139"
FT                   /protein_id="ADD01517.1"
FT                   /translation="MLKISDVDKKSKAYNCWLNYENCSVGEYQDFCNYIKVKSTHPIIN
FT                   TAIEELKFGLNKLMKKEPLILNYSPKSSYIFVGTLEDLKNEKLDVQIKNEILKEDGFAV
FT                   KIVKEGDTDVLAIIGQNEKGVLYGVFYLLRAICSGNSLNEIEIEDGPYNLLRIINHWDN
FT                   LNGEIERGYAGQSIFFKDNKVVEDLSRVKDYARLLASIGINGVVLNNVNVHKYETELIT
FT                   DKFLPDVSRIADVFRLYGIKIYLSINFAAPVEIGDLPTADPLDERVKKWWKEIVENIYR
FT                   YIPDFGGFLVKADSEFRPGPFTYGRNHAEGANMLAEALKPHGGLVFWRAFVYNCMVDWR
FT                   DRTQDRAKAAYENFKPLDGQFMDNVVLQIKYGPMDFQIREPVSPLFGAMEKTNVALELQ
FT                   ITQEYTGQQKDLCYLPTMWKEILDFDTYAKGKGSTVAKVVNGSLFGMKYGGIVGVSNIG
FT                   DSKSWTGHPLAQANLYGFGRLAWNPLLSPKEIAEEWTKLTFGHDEQVINTIVSMLMASR
FT                   DIYEKYTAPLGVGWMVNPGHHYGPNPEGYEYSHWGTYHYADYKGIGVDRTVATGTGYTA
FT                   QYKEPIASMYENIETCPDELLLFFHHVPYTHKLKSGKTVIQHIYDTHFEGAEEAKGLKE
FT                   KWLTLRGKIDEEIFEMVLERLEMQIKNAIEWRDVVNTYFYRKTGIRDVHNRKIYE"
FT   gene            210890..212935
FT                   /locus_tag="Thit_0190"
FT   CDS_pept        210890..212935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0190"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: dge:Dgeo_2690 glycoside hydrolase family
FT                   protein; PFAM: glycoside hydrolase family 52"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01518"
FT                   /db_xref="GOA:D3T5Y7"
FT                   /db_xref="InterPro:IPR000852"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y7"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADD01518.1"
FT                   /translation="MESISFYAHHSAFGAFSSFIVGKLGKGGGVVLNDVHPPNNNVYVG
FT                   YKQGKKIKLLPFLKVNSIRPEEAFTGEKAKNNAKYDIEFFSEKEINREMGWASDTWIAD
FT                   KLRFSIITPFGYVNSPEAMEEKEKKLAFAPVIFIQLTMDNRGNKLDTELIFGLEGTKRL
FT                   LSDTMDSRYLGIAFDRKYGFATWNSEDVREYLRLSLLDSWGNDIYQNHRLGKEGALLFK
FT                   VPAGEIRTYTIVLATYQDGIITTGIETEFYYTTLFKSLEDVLEFGLKNANYYLDMAKQR
FT                   DKELRESGLNEYRQFLIAYATHAYYANSQLMTRKDGVPLWIVNEGEYLMINTFDLTIDH
FT                   LFWELKFHPWTIKNTLGLYVEKYSYFDQAGRSFTHDMGVANNFSPQGYSSYELPNLHGV
FT                   FSYMTHEELLNWIITGAVYAFKTNDNEWLEQNLNVFVDCFNSLVARDKNNDGIMDVDTS
FT                   RCENGSEITTYDSLDVSLGQARNNLYLGVKTWAAYVLLNKIFKEYNLDDYAAASLKKAQ
FT                   QAASTIVSKFDEQNRYIPAVFEQGNTSRIIPAIEALIYPYYIGDVDTVSETGPFKELII
FT                   ALKHHIVTVLKPGCCIDPISGGWKLSSTSKNTWNSKIFLSQHIVKKILRLDFGDKEIEW
FT                   DRVHTRWQQISCSEEGPVDQVNSDNGTARGSRLYPRLVTSILWMEE"
FT   gene            212993..213949
FT                   /locus_tag="Thit_0191"
FT   CDS_pept        212993..213949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0191"
FT                   /product="Acetyl xylan esterase"
FT                   /note="PFAM: Acetyl xylan esterase; KEGG: cce:Ccel_0210
FT                   acetyl xylan esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01519"
FT                   /db_xref="GOA:D3T5Y8"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y8"
FT                   /inference="protein motif:PFAM:PF05448"
FT                   /protein_id="ADD01519.1"
FT                   /translation="MPFYDMPLEELKKYMGKNPCPPDIDEYWDNAIKEAEKIDLNIELK
FT                   KIDYPDDSVEAYNLYFTSTNNARIYALYVKPKKASKEKSPCILEFHGYGMNSKTIDTKL
FT                   KWANAGFHVLSMDCRGQGGKSTDPGGVIGNTLRGHIIRGIEDRDTLMFKHIFIDTYLLS
FT                   KIAESFDDIDRDNIMTTGASQGGGLALACAALNPNIKKVAACYPFLCDYKRAWELNCDS
FT                   AYTEIREWFRLFDPLHEREEEIFTRLGYIDLQHLGKRIKGKVLVSVGLEDHICPPSTIF
FT                   AMYNKLNTDKQMLIYPDYGHEYIPDWDDKAFRFLVNK"
FT   gene            214085..218452
FT                   /locus_tag="Thit_0192"
FT   CDS_pept        214085..218452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0192"
FT                   /product="Cellulose 1,4-beta-cellobiosidase"
FT                   /EC_number="3.2.1.91"
FT                   /note="PFAM: glycoside hydrolase family 10;
FT                   Carbohydrate-binding CenC domain protein;
FT                   Carbohydrate-binding family 9; S-layer domain protein;
FT                   KEGG: pjd:Pjdr2_4255 endo-1,4-beta-xylanase; SMART:
FT                   glycoside hydrolase family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01520"
FT                   /db_xref="GOA:D3T5Y9"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Y9"
FT                   /inference="protein motif:PRIAM:3.2.1.91"
FT                   /protein_id="ADD01520.1"
FT                   /translation="MSQKKKALKILSLIVFFAMICGIIGDYPIKVLAGGNSSINLVANG
FT                   DFENGTLDEWTKHGNPTLEVTTEQAIGNYSMKVTGRTNSYEGPAYSFLGKMENGATYNV
FT                   SFKVRVVAGQIAAGHQDPKITVTMRRVYTPSVEGDTGSYYDTIVWQKPVSEDAWTTLTG
FT                   SYTLTYNGTLKELFMYIESPDPTLEYYIDDVIVTPVNTPQVGNIIENGTFESGDTTGWV
FT                   GTGQAVISAVKEEAHSGNYSLETAGRTADWMGPSYNLTGKIVPGKQYSVDFWVKYNNGN
FT                   DTEQFKATVKVTPTTGSPQYIQVNNPVSVKKREWAEIKGSFTVPDGDYSSISIYVETPG
FT                   STIDFYIDDFEVIGEIAAAPIKIQEDIPDLYSVFLDCFPIGVAVEPGRLVNTDPHSQLT
FT                   AKHFNMLVAENAMKPVSLQPQEGIFTFSNADKIVDFAIAHNMKMRGHTLLWHNQVPDWF
FT                   FQDPSDPTKTASRELLLERLKTHIFTVLGHFKEKYGSNNPIIAWDVVNEVLDDNGQLRN
FT                   SKWLQIIGPDYIEKAFEYAHEADPNVKLFINDYNIENNGAKTQAMYELVKSLKEKGVPI
FT                   DGIGMQMHININSNVESIKASIEKFKSLGVEIHITELDMNMLGDVSQDALLKQARLYKQ
FT                   IFDLLKQEKDHITAVVFWGVSDDVTWLKQPNAPLLFDTKLQAKPAYWAIVDPSKVAADR
FT                   QVISVSQGSPVIGTEIDKIWSTEKWFYANNFVKNLDGATAKFKLLWDTKNLYVLVQVDD
FT                   TTPSKNDSIEIFVDKNQESVSQTEIRHYTIRRDNSGNTDILHYVQEETNGYVVQMAIPI
FT                   DDLNPQIGTKIGFDIKVNDDKGEGQIDTIAVWNDYSNSGKTEYYGLLLLSKASQITEAV
FT                   YGTPIIDGKIDDIWDKASTIYTNVWVQGTSGPTAKARTMWDENYLYVLAEVTGAKLNKS
FT                   NPNPWEQDSVEFFVDENNYKSPYYQSGIGQYRVNFDNEQSFGNSTNSEGFKSATSITSS
FT                   SSYIVEVAIPFKTIKPTDGHILGFDVQVNGADESGNRMSIVLWNDPSGNSWKDASGFGN
FT                   LILVDTRLILPTPRPQPAPTPTEPTEASHEVSQGKVVVENNTTIMVVDETKISKDIKDT
FT                   SKKEIQFDLTNIGKTDAKALEIPVSVINLVVANNKNITIKLNDVTLKFDPNSLVVSKNT
FT                   IDLINQVGAVRLTIQEKGRQTPPPLTPVSNAYDVKIKAGDKEIKVDSPVKVTFEIKDAK
FT                   DIRKVGVYYLNETTGKWEYVGGKIDKKTNTVTAEVIHFSTYGAFEYDKQFKDVSKDFWA
FT                   YDAVNVLASRHIIRGVDDETFAPNAKITRAEFAAFMIRALGIPEEPYKGEFEDVKEGAW
FT                   YANAIEAAYRAGIMVGDGKNMRPKEPITREEMTAVIMRVYSKLTGYKEENIGNTTFTDN
FT                   NKISEWARNAVANVVKLGIVRGYEDNTFKPKDNATRAEAAAMLYRVLEISSTI"
FT   gene            218599..219303
FT                   /locus_tag="Thit_0193"
FT   CDS_pept        218599..219303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0193"
FT                   /product="protein of unknown function DUF624"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   csc:Csac_1811 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01521"
FT                   /db_xref="GOA:D3T5Z0"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z0"
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /protein_id="ADD01521.1"
FT                   /translation="MFGNFFNQMYFGNPRKPDLKPEDIPKKGIPLFIDIFCSNFWQLTS
FT                   LNLLLIIFSIPIITIGPAFAGFNHVLRNYVFRKNVWLWNDFKDGAFKNLKQSLIITLIN
FT                   MLVAFVLINNYKIYSIMNNDFIKKSGIIITGLIGLMYLLMNIYIFPMMVTYDLKTKHIF
FT                   KNAFIFSVIEFPRTLGILLICLFVLFVSIILAFIPLVLISFSLMGLIINVFDRMIFEKY
FT                   IDNKNQVTGNDN"
FT   gene            219481..219659
FT                   /pseudo
FT                   /locus_tag="Thit_0194"
FT                   /product="hypothetical protein"
FT   gene            219800..221221
FT                   /locus_tag="Thit_0195"
FT   CDS_pept        219800..221221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0195"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tpd:Teth39_2058 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01522"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADD01522.1"
FT                   /translation="MITIVIMVVGLLSGCGQNSQTGQSESTQPKEKVLKIWSFTNEAKV
FT                   FATAFKEKHPDVKIEFTMIPMTEGEYQLKLKSALQSGEGPDVVALESDFVREFVESDYL
FT                   VDLSDLLPFAEEVKTYQFTIDIGTDENGVVKAFSYQATPGLMYYRRSLAKEYFGTDDPV
FT                   KIQELVADLSKFEEAAKIVKEKSNGNTYMIASTADLGRVIIENRDKPWIVDSKLVIDPK
FT                   VEELFDIAKNFRQNGYEAQATQWQESWFAGMNDSLVDAKGNPKQIFAYFLPTWGLSYVL
FT                   QPNSAPAKGESDGGKTAGKDTSGDWAAIPGPMPYRWGGTWFGVTKDSENVELAKEFIKF
FT                   VTLNEETLKNWALGVYTNEYLKKIDPSVGDELQQPAGDFVSSQKVVEEIASQFGDTSAA
FT                   KFLGGQNPYEVFAEAARRIDLGGRTKNIQATDFVVQDALWDPLDAYASGEISKDEALKR
FT                   FKEAVKNALPDVNVD"
FT   gene            221299..222225
FT                   /locus_tag="Thit_0196"
FT   CDS_pept        221299..222225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0196"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_2057
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01523"
FT                   /db_xref="GOA:D3T5Z2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01523.1"
FT                   /translation="MVLVESGIKVRKSNSKINKNYYGYIFTAPFIIVFLLFSFYPLIYT
FT                   FYLSLTDMTIMSKTYNFVGLNNFKQLFSDDFFIKSVLNTWKIWLMNFIPQLGIAMLLAV
FT                   WFMNNRLKIKFVGLWRTVYYLPNLLMPVAIAALFYNLFSRYGPVNQIAVRAGILEEAFD
FT                   FFRSPGWTQSIVAFIQWWMWFGVTILYLMAGMSSISPSYYEAALVDGASSWDMFTKITL
FT                   PLLKPVLIYVLVTSLAGGMQMFDIPYLLTDGRGSPNGSIMTMSVLMYMKFSSGKGFIGA
FT                   GASVAVMIFIITAISASIIIRLLREKE"
FT   gene            222254..223096
FT                   /locus_tag="Thit_0197"
FT   CDS_pept        222254..223096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0197"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_2056
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01524"
FT                   /db_xref="GOA:D3T5Z3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01524.1"
FT                   /translation="MSYTIKTKLTKTFIYIFLVILFLITIVPVWILLINATRSTPEIQQ
FT                   GVSLLPSNNLLNNWKYLTGKGANIWRGFINSALISIPATLLTVYFSMMTAYAIQVYDFA
FT                   YKKILYNIIILLTIIPTQMASIIGFYKYMSMLNLLNSYIPLIIPAIAAPPMVFFASQYL
FT                   ESTLVKDLIESARIEGASEIGIFHRIILPIAKPGAFTMGILSFVASWNNFFTPFMLISK
FT                   VEKYTLPMMVKLLRGDMYRTEYGAIYLGLAITVIPIIIVYAMFSKYIISGISLGSVKD"
FT   gene            223120..225483
FT                   /locus_tag="Thit_0198"
FT   CDS_pept        223120..225483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0198"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tpd:Teth39_2055 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01525"
FT                   /db_xref="GOA:D3T5Z4"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z4"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ADD01525.1"
FT                   /translation="MMKASYLDPKQPVEKKVENLLAQMTIEEKIAQLSGIWVYEILDDM
FT                   MKFSYEKANRLMTHGIGQITRLGGASNLSPQETVKIANQIQKYLVENTRLGIPALIHEE
FT                   SCSGYMAKGATIFPQTIGVASTWNPKLVEKMASVIREQMKAVGARQALAPLLDVTRDPR
FT                   WGRTEETFGEDPYLVMHMGVSYIRGLQTENLKEGVIATGKHFVGYGNSEGGMNWAPAHI
FT                   PMRELYEIFLYPFEAAVKEAKLGSIMPGYHELDGIPCHKSKQLLTDILRKNWGFDGIVV
FT                   SDYFAINQLYEYHRLASNKKEAAKLALEAGVDVELPSTDCYGLPIKELIEQGDIDIDFV
FT                   NDAVRRILKAKFLLGLFENPYVDEKRVVEIFDTQEQRQLAYKIAQESIVLLKNESNLLP
FT                   LKKDLQSIAVIGPNADNIRNMIGDYAYPCHIESLLEMREKDNVFNTPLPEGLEAKDIYV
FT                   PIVSVLQGIKEKVSPKTKVIYAKGCDVISDDTAGFNKAVEVAKQADVAIVVVGDRAGLT
FT                   DGCTSGESRDRADLNLPGVQEELIKAVYETGTPVIVVLINGRPMSISWIAEKIPAIIEA
FT                   WLPGEEGGRAIADVIFGDYNPGGKLPISIPRSVGQLPVYYYHKPSGGRTNWKGDYVESS
FT                   TKPLYPFGYGLSYTEFLYSNLSISHPKVATQGGIIEISADVKNIGKVKGDEVVQLYIHR
FT                   EFLSVTRPVKELKGFKRITLDVGEQKTVIFQLSSEQLGFYNEEMEYVVEPGRVEVMIGS
FT                   SSEDIRLFGSFEIVGEVKKTDKKFMTQVRVENKL"
FT   gene            225596..226798
FT                   /locus_tag="Thit_0199"
FT   CDS_pept        225596..226798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0199"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: tex:Teth514_0159 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01526"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z5"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADD01526.1"
FT                   /translation="MITADQLLVKQINKSIVLNTIRKKGNVSRADIAHITGLNKSTVSF
FT                   LVDELINEGFVREEGPGESKGGRKPIILSINNKAGCIIGIDLDVNYILIVLTDLMANVI
FT                   WEKKVDVKIGESQQAIIERLIELIDEAILNAPETIRGILGIGIGVPGIVDYKKGTVLMA
FT                   PNLKWENVPLKQIIENKFKIKVHIDNEANVGAIGEKWFGAGIKYNNLVYVSAGIGIGTG
FT                   IIINGELYRGTVGLAGEMGHMTINILDHQCSCGNTGCWENYASEKALFDYIHTQLIMGK
FT                   SDNYINKDNFNTLSALDIINYAQKGSEIAVEALKEIGRKLGVGIVNVINTFNPELVIIG
FT                   NTLSLARGLILDEILKEVEKKCLVYRYHKVKIKTSKLQFHAGAIGAVSLVISELFAYPG
FT                   L"
FT   gene            complement(226886..227146)
FT                   /pseudo
FT                   /locus_tag="Thit_0200"
FT                   /product="hypothetical protein"
FT   gene            227236..228813
FT                   /locus_tag="Thit_0201"
FT   CDS_pept        227236..228813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0201"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: tex:Teth514_0182 glycoside hydrolase family 3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01527"
FT                   /db_xref="GOA:D3T5Z6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z6"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ADD01527.1"
FT                   /translation="MKVNDMTLEEKIGQMLMVGFPLPIYDDHIEELISEYKIGNVILFS
FT                   RNVKDKVQLQSLCNNIQMNMIKHTGIPALIAIDQEGGMVTRIYKDATYLPGNMAIAATN
FT                   NPENAYKIGEIEGKELRALGININFAPVLDVNNNPSNPVIGVRSYGENPEKVAEFGINY
FT                   IKGLQKENVIATAKHFPGHGDTSVDSHFDLPLVSHNKERLYRIELYPFKKAIENGVEAI
FT                   MTAHILFLALEKNKLPATLSHNILTNILRKELRFNGVIITDCMEMNAIAKYFGTAKAAA
FT                   MAIKAGADIVLVSHTKKLQIEVFNEIKEAVLRGEISIERIDESIERIIQLKEKYKLFEN
FT                   PYPDKNKIKTIVGCKEHQEIAKNISLNSITIVKDENNLLPIKKQKILAVSPETVPVSGV
FT                   DDTLMDKVSFAKAFVQKFGGVEKTIPVNPDEDLINTIKEEAKDKEIVVVGAYNASLNEG
FT                   QVRLVNSLWEVNKNIIVVALRNPYDLLKFKDVPTYVCAYEYTPLSVESVLEVLSGNYVA
FT                   KGELPVSL"
FT   gene            228855..229823
FT                   /locus_tag="Thit_0202"
FT   CDS_pept        228855..229823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0202"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   tex:Teth514_0183 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01528"
FT                   /db_xref="GOA:D3T5Z7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADD01528.1"
FT                   /translation="MDIQYINLTEGKAEEIFFLWNKEIGDNFPMRKELLRQNTFEDVNV
FT                   LLEGSWIAIDTKNDRTVGFIVSKIWKEDMECLKIKKGVGHIQVILVDHDYRNKGIGSEL
FT                   LKRAEKALNEAAVKTVLLGQDPWHYFPGIPSEFEKTREWFERRGYVNYGEEYDMYCDLS
FT                   KKNEVILPDLLDVKFKLLDLAEKYKFLSFLKKNFPGRWEYEAIHYFKRGGEGREFVVAE
FT                   KNGEIIGFCRINDINSPFIAQNVYWAPLFNKELGGIGPLGIDKKERGKGLGLAIVQAGM
FT                   YFLYNRGIRNVVIDWTELVDFYSRLECKIWKKYTVYKKELK"
FT   gene            229859..231007
FT                   /locus_tag="Thit_0203"
FT   CDS_pept        229859..231007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0203"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; KEGG: tpd:Teth39_2028
FT                   N-acetylglucosamine-6-phosphate deacetylase; PFAM:
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01529"
FT                   /db_xref="GOA:D3T5Z8"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z8"
FT                   /inference="protein motif:TFAM:TIGR00221"
FT                   /protein_id="ADD01529.1"
FT                   /translation="MKSILLKHGEIYTHDEIIYNGDLLISEGKILEIGKNLNTNDAEVI
FT                   DLKGKKIVPGFIDIHIHGGVGHDTMDANYEALNAISVHLARHGVTSFCATTMTMDVPYI
FT                   LNALKNINETMKKGTAGAQILGTYVEGPFISKEHKGAQDEKYIIPPDKNLFDEFLEIAG
FT                   GNIKVIALAPEKDPEGSFIEHVTKKGVKVSLGHTNATYEEMKNGVEHGATIAVHTYNGM
FT                   KGLHHREPGALGEVFLDDRIYSEIIVDFIHTHPASVKLLIKIKGTDKVILISDAMSACG
FT                   LGDGEYKLGGQKVFVKNGEARLESGSLAGSTLTLDKAVKNITSLGVPLFEACKMASLNP
FT                   AKAIGVDDRKGIIEVGKDADIVVLNNDLTVYMTIIEGKVFMG"
FT   gene            complement(231135..232301)
FT                   /locus_tag="Thit_0204"
FT   CDS_pept        complement(231135..232301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0204"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   tpd:Teth39_2027 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01530"
FT                   /db_xref="GOA:D3T5Z9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3T5Z9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADD01530.1"
FT                   /translation="MNVDKYISNVVKSIPPSGIRKFFDLVTNSKDIISLGVGEPDFVTP
FT                   WEIRKEGINALDRGSTTYTSNLGLLELRTAISYFLKTHYNLTYNPEKEIMVTIGASEAI
FT                   DLGLRALLNDGDEVLVPEPSYVSYAPCVTLTRGIPVFVPTDEKNNFILTPDDLKPKITP
FT                   KTKVLILPYPNNPTGAIMKKEELEEIVDIIIEHDLIVISDEIYSELTYEGKHVSIASLP
FT                   GMRERTILINGFSKAFAMTGWRLGYIAAEHGFIEAMNKIHQYTTICAPITAQYAAIKGI
FT                   YECEEDIVKMRETYDKRRKFIVNGFREMGLDCFEPKGAFYIFPSIKKTGMTSQEFCEKL
FT                   LKEEKVAVVPGDAFGPSGEGFIRVSYAYSIDKIARALERIESFVKRIL"
FT   gene            complement(232298..232786)
FT                   /locus_tag="Thit_0205"
FT   CDS_pept        complement(232298..232786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0205"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: tpd:Teth39_2026 AsnC family transcriptional
FT                   regulator; PFAM: Transcription regulator, AsnC-type-like;
FT                   SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01531"
FT                   /db_xref="GOA:D3T600"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T600"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ADD01531.1"
FT                   /translation="MDKAIEILDLLCENSRLTEKQMAAITGLSEEEVKNTIKSLEDKKV
FT                   LLKYTALVDWEKAGREVVTALIDVKVAPQQGLGFNAIAERICQFEEVKSVSLISGTYDL
FT                   SVEVEGKTMKEIALFVAERLAPIDGVLSTTTHFILKRYKKDGVFYEEGQDDKRLVITP"
FT   gene            232997..233260
FT                   /locus_tag="Thit_0206"
FT   CDS_pept        232997..233260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0206"
FT                   /product="FeoA family protein"
FT                   /note="KEGG: tpd:Teth39_2025 FeoA family protein; PFAM:
FT                   FeoA family protein; SMART: FeoA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01532"
FT                   /db_xref="GOA:D3T601"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D3T601"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ADD01532.1"
FT                   /translation="MAENTIINLIQLKENHEGEIILIKAGRTAMQRLNEMGLVPGTKVK
FT                   LVRKGPLRGPVELEVRNSHLVIGYGLASKIYVKTLDGKGDMR"
FT   gene            233257..235230
FT                   /locus_tag="Thit_0207"
FT   CDS_pept        233257..235230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0207"
FT                   /product="ferrous iron transport protein B"
FT                   /note="KEGG: tex:Teth514_0188 ferrous iron transport
FT                   protein B; TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: GTP-binding protein
FT                   HSR1-related; Ferrous iron transport protein B domain
FT                   protein; nucleoside recognition domain protein; Ferrous
FT                   iron transport B domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01533"
FT                   /db_xref="GOA:D3T602"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:D3T602"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ADD01533.1"
FT                   /translation="MKKEIVIALAGNANVGKSVIFNQLTGLTQIIGNWPGKTVERAEGV
FT                   LRFKGRTIKIVDLPGIYSLSAYSQEEIVSREFIAFEKPDVVINVVDASNLERNLFFTVQ
FT                   LLELHVPMVMALNQVDYAIKKGIDINVKKLEELLGIPVVKTIATKGKGLEKLIDKVLEV
FT                   VDSNKETTVKDYDIKQEKILKYGNEISEYVMRIYNILLKHNVINIINLFHPLWISLKLI
FT                   EEDSDIIEKLKREPDGKKAYEEIQKELEGLKAKTDSPLVTLVTAARYDIASFIAKQTVS
FT                   EIHHRITWTDLIDNVALHKIFGYISMFAIVFISFYGIFKFGEYLSGVLEGFFDVLRPLV
FT                   YNLHIPNMYKDVLWNGLAEGLISAITIVLPYILPFYVFLSILENTGYLARIAFLMDEIM
FT                   HKVGLHGKALIPILMGFGCNVPAVLGTKILETDREIFVASFMSTLVPCSARIVIILGTI
FT                   GVLMGPQYALAVFALDVLVIYIAAYFADKIAHGKPYDLIMELPGYRVPALKPTLKQIWI
FT                   RIKDFLYVALPIIVVGSLVLEILKYTGIFKYVTYVTDPIVVKWLGLPSIVGIVLIFGVL
FT                   RKELTLIMLLALSGTSHISQILTPKQMIVFGVVTMLYIPCIATIAALKRTIGWKKTWWV
FT                   VFVDIFVAILVGGILNQILTFI"
FT   gene            235262..235597
FT                   /pseudo
FT                   /locus_tag="Thit_0208"
FT                   /product="hypothetical protein"
FT   gene            complement(235695..236423)
FT                   /locus_tag="Thit_0209"
FT   CDS_pept        complement(235695..236423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0209"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tex:Teth514_0189 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01534"
FT                   /db_xref="GOA:D3T603"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T603"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01534.1"
FT                   /translation="MSTVFELKNVYYSYNKSVPALIDITFEVKKGEKLILLGANGSGKS
FT                   TLLKLMDNLISPDSGEIWAFGKLLGDKKTFDEYEFRKKVGFVFQDSDVQLFSTTVFDEI
FT                   AFAPLQMGLKEDEVQKIVEETLISFGIEKLKDRPPHRLSGGEKKKVALASVMVINPEVL
FT                   LLDEPTNGLDPRSKKWLLVKLQELNKKGTTIVIATHDLDMAATLSDRIIVLNENHSIEA
FT                   IGKPDEILKDKELLLKVNLI"
FT   gene            complement(236435..237250)
FT                   /locus_tag="Thit_0210"
FT   CDS_pept        complement(236435..237250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0210"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="KEGG: tpd:Teth39_2022 cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01535"
FT                   /db_xref="GOA:D3T604"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D3T604"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADD01535.1"
FT                   /translation="MDNFLEKTILSIQNAFEDMFYSDTISAKKGIMQSLDTRIKLVSVF
FT                   ILIIIVNFGKTISFMTIFLIYTLLLAYFSKIPIRAYVMRVSAVSIFFTGIVLIPSLFNV
FT                   VKEGHPLVYFTKNFYVTKEGLYSAIIFMMRSFISLSFVYILALSTKWVEILKGLRSFKL
FT                   PRIFTATLEMALRYIFLLLEIATNMFLARKSRNVGKSNSSEGRKFVASAMANVLIRSQQ
FT                   LSDEVYNAMISRGYNGDYKTLTPFKITFYDYIWTGFNITFLFILWYIHP"
FT   gene            complement(237243..237560)
FT                   /locus_tag="Thit_0211"
FT   CDS_pept        complement(237243..237560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01536"
FT                   /db_xref="GOA:D3T605"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:D3T605"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2021"
FT                   /protein_id="ADD01536.1"
FT                   /translation="MKKFYIAAIVIILLTPLGLLAPGSAWGEWGLDEIKNMIGYVPEGM
FT                   NRFSEVIKAILPDYSIPGFDANFFQQALGYIFSAVVGIAAIVLIFAILGRIMGKPQKKN
FT                   G"
FT   sig_peptide     complement(237477..237560)
FT                   /locus_tag="Thit_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            complement(237557..238249)
FT                   /locus_tag="Thit_0212"
FT   CDS_pept        complement(237557..238249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0212"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: tex:Teth514_0192 cobalt transport protein
FT                   CbiM"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01537"
FT                   /db_xref="GOA:D3T606"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:D3T606"
FT                   /inference="protein motif:PFAM:PF01891"
FT                   /protein_id="ADD01537.1"
FT                   /translation="MHIPEGYISPQTCAVMGAAMVPVISVAAKKVNESFDKKDISTLAI
FT                   GSAFAFTIMMFNVPIPGGTTSHAIGATLLAITLGPWAASISLTIALFIQALLFGDGGIL
FT                   ALGANSFNIAFIAPFVGYGIYKLMLALKLSKVISSAIGGYVGINAAALATAIELGLQPL
FT                   LFHTANGTPLYFPYGLNVAIPAMMFAHLTVAGIVEAIITGLVVYYLQKADEENILYKFS
FT                   SKLRGDNR"
FT   gene            complement(238263..238694)
FT                   /locus_tag="Thit_0213"
FT   CDS_pept        complement(238263..238694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0213"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein
FT                   DNA-binding domain protein; KEGG: tpd:Teth39_2019 nickel
FT                   responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01538"
FT                   /db_xref="GOA:D3T607"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:D3T607"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ADD01538.1"
FT                   /translation="MGVISLEEITRFGVSMESKLLYQFDELIKKKSYSNRSEAIRDLIR
FT                   DFIIENQLEAENTETIGTITYVFNHEVREINDKLTNIQHKHYQNIISTMHVHLDKHNCL
FT                   EIMVLKGTAKEITKIADEIISTKGVKHGKLVMTTTGKNL"
FT   gene            238861..239331
FT                   /locus_tag="Thit_0214"
FT   CDS_pept        238861..239331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0214"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   tpd:Teth39_2018 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01539"
FT                   /db_xref="GOA:D3T608"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D3T608"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ADD01539.1"
FT                   /translation="MPLNVVLVEPEIPQNTGNIARTCVLTGSRLHLVKPLGFSIEEKYV
FT                   KRAGLDYWPLLDLTVYDNLEQFLEENKGKKFYLATTKAKRYYHEVKYEDNSYILFGKET
FT                   AGLPKWLIEKYYEDCIRIPMHEVISTRSLNLSNSVAIVLYEALRQLGFPNMK"
FT   gene            239349..240518
FT                   /locus_tag="Thit_0215"
FT   CDS_pept        239349..240518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0215"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: tpd:Teth39_2017 DNA-directed DNA polymerase;
FT                   PFAM: UMUC domain protein DNA-repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01540"
FT                   /db_xref="GOA:D3T609"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D3T609"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ADD01540.1"
FT                   /translation="MKRKIIHVDMDAFFASVEQHDNPEYKGKPVIVGGLSGRGVVSTCS
FT                   YEARKYGIHSAMPMYMARKLCPHGIFLSVRRKRYEEVSKQIFDILYSITPLVEPVSIDE
FT                   AYLDVTDIDKNPEVIAKEIKKKVKETTGLTISAGVSYNKFLAKLASDWNKPDGFTVITE
FT                   DMIPDILKPLPVSKVYGIGEKSEERLKSMGINTIGDLLKLSQENLVEIFGKVGVEIYLR
FT                   IRGIDERPVETMREIKSIGKEKTLEKDTKDKKLLLHYAKLFSDIISEELFRAGLYARTV
FT                   TVKIKTSDFAIHTKSKTLNKYIRLSEDIYNVAYEIIENIKLDQYIRLIGLSVSNLSAVK
FT                   YEQLSFLDKSVVKSIKAENIVREINKKIGQEIVKKASELLNNKTKQWRD"
FT   gene            240519..241889
FT                   /locus_tag="Thit_0216"
FT   CDS_pept        240519..241889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0216"
FT                   /product="MATE efflux family protein"
FT                   /note="KEGG: tpd:Teth39_2016 MATE efflux family protein;
FT                   TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01541"
FT                   /db_xref="GOA:D3T610"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D3T610"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ADD01541.1"
FT                   /translation="MEAKERHKRNIAKEIIELAWPSITEQMLIMTVGMVSTIFVGRVGT
FT                   NAIAAVGMINSLIFFFQAIFAGLAIGSTVIVARLIGEEDEGSARVAVMQSLIMSIAVSI
FT                   GFTVLGYIFAVPLIKIFFGSVSPDVFKLALIYYKIVILGIPFMIVEIVIAGALRGAGDT
FT                   KTPMYITAIVNVINLLLNSILVFGVHFHSGYVVPPLGVKGSALSATISRTIGGFLQLYI
FT                   LYFGKRRINLDIKEKIRLNFDMMMRIIRVGIPASLEQVIMQGGFLVVQIIVSTMGTVSM
FT                   AVYQIGMNANSLAFMPIFGFSLAATSLVGRSLGAKRLMLAEIYAKVSRNIAVVVISIIG
FT                   FFMFIFSRQLAALYTTDPVVIKISSDIIKIFAVVEPLLAILNVMAGVLRAAGDIPYIVL
FT                   STFIGLWLFRVTIGYTLGKVFGIGIYGIWIGICIDFVVRSVMYSYRFKAGRWKYIKV"
FT   gene            241982..243748
FT                   /locus_tag="Thit_0217"
FT   CDS_pept        241982..243748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0217"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="KEGG: tex:Teth514_0198 RND family efflux transporter
FT                   MFP subunit; TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01542"
FT                   /db_xref="GOA:D3T611"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D3T611"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ADD01542.1"
FT                   /translation="MKKKYLYVIIAVLISGIVTFYFVNRAKSSQPRQFSYATVTRGNIS
FT                   MKVTGTGNITNDVRVITLKGNGTVKKVYFKEGDTVKKGDLLYEIENESLKQQIEEAKLN
FT                   VDLAAQQLKSDLESYNKSIANLKITSPSDGIVDSILVQKGQNVSAGTQVATIADYSHVT
FT                   VRVPFNSVQIKNIKVGQKADIFLYDSLTTITGTVEYVSHQAVPHNTMEYYYVTVGLDNP
FT                   GALSDGMKVQVSIHTDNGVEKALEDSTLTVKNTVTVIAKTSGTVEKINVTEGENVKKGT
FT                   LLVELSSDNISDTQIQNDKLALTQAQNNYNELLEQLENLKIYSPIDGKIVSQNIEEGDV
FT                   LGSSTSDSTTNGSQSSQLTFVPISDVSELSNYESEAETAVIVGNGNYTVNLSVDEADIK
FT                   NIKVGQKAEITTDDLPGKTFTGTVTAISQLPTVENGVSSYTVTIELDSNSDLMLGMSVN
FT                   ISIIVAEKENVLLLPLQAVQTNDDKKYVILYTDDLKNQKNKDNTTKTSLENNIRFIETG
FT                   IYNDSYIEITSGLEEGDKVLIPTTSSSTNTNSQRAGFGIMGGPGGGPVPGANPPRNKPS
FT                   QSGSRSSGTSSK"
FT   gene            243767..244456
FT                   /locus_tag="Thit_0218"
FT   CDS_pept        243767..244456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0218"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_2014 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01543"
FT                   /db_xref="GOA:D3T612"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T612"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01543.1"
FT                   /translation="MSNVLIKVRNLTKIYKMGENEVKALDGISFDIEKGEFVSIVGQSG
FT                   SGKTTLMNILGCLDVKTSGEYFLNGIDTSKLSDNELADLRCREIGFVFQNFNLLQKMTA
FT                   LENVELPMIYKGVPAKERRERAEMLLEMVGLKERMHHRPNQLSGGQQQRVAIARALAND
FT                   PPLILADEPTGNLDSKNGSEIMKIIKELNENGNTVVLITHDPNIAAQAKRIIRIKDGHI
FT                   LENEVLP"
FT   gene            244456..245631
FT                   /locus_tag="Thit_0219"
FT   CDS_pept        244456..245631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0219"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   tpd:Teth39_2013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01544"
FT                   /db_xref="GOA:D3T613"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D3T613"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADD01544.1"
FT                   /translation="MRYVQVVKIALRSVLSNKMRSFLTMLGIIIGVTAVIALVSIGQGS
FT                   TRSVTSQIQSMGSNLIMVNVMGRGGESSLTYDQAIVLKDSNFIAAISPVISTSVTAMYG
FT                   NNSVDNTTVNGVNGDYQSIRDIQVAAGRFILPMDDEGRNRVAVLGSNVARELFGFTDPI
FT                   GKTIKLNGQNFTVVGILSQKGSSIAGSDDDSIFIPLKTMFYFAKNRDIRQIYIEATSPD
FT                   TVELAKNEINSKLLTIFKGDTNAFRIIDQSQILSTVNSVTATLSLLLGGIAGISLLVGG
FT                   IGIMNIMLVSVTERTREIGIRKALGAKKKDVLLQFIIESLTLSGLGGIVGIIVGYVLSM
FT                   VLGSAMNINAKPSLSTVLISFSFSVIVGLFFGVYPANKAANLNPIEALRYE"
FT   gene            245749..246156
FT                   /locus_tag="Thit_0220"
FT   CDS_pept        245749..246156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0220"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="KEGG: tte:TTE0259 hemerythrin; TIGRFAM:
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01545"
FT                   /db_xref="GOA:D3T614"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D3T614"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADD01545.1"
FT                   /translation="MKWTESLSVGNELIDSQHKELIKKVNDVLEACNQKKGKEKIEEVM
FT                   KFLKDYTVKHFNDEEALMKKYQYPSYEEHKKIHEDFVKKVDELDKKIKKEGINLSIIML
FT                   VNKTLVDWLINHISKEDKKVGEHIKKLKGDF"
FT   gene            246158..246556
FT                   /locus_tag="Thit_0221"
FT   CDS_pept        246158..246556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0221"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="KEGG: tte:TTE0259 hemerythrin; TIGRFAM:
FT                   hemerythrin-like metal-binding protein; PFAM: Hemerythrin
FT                   HHE cation binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01546"
FT                   /db_xref="GOA:D3T615"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:D3T615"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ADD01546.1"
FT                   /translation="MKWTESLSVGNDYIDEQHKEWIRRINDLLEAYNQKRGKEKVGEAM
FT                   EFVKEYTVTHFGAEQELMKKYKYPEYEIHKQIHDNFIKEVNELDEKIKKEGPTLTNLMT
FT                   VNRTLVDWVLNHISKVDKKLGEYIKSQM"
FT   gene            246639..247367
FT                   /locus_tag="Thit_0222"
FT   CDS_pept        246639..247367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0222"
FT                   /product="5-carboxymethyl-2-hydroxymuconate
FT                   Delta-isomerase"
FT                   /EC_number="5.3.3.10"
FT                   /note="KEGG: tpd:Teth39_2012
FT                   5-carboxymethyl-2-hydroxymuconate delta-isomerase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01547"
FT                   /db_xref="GOA:D3T616"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D3T616"
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /protein_id="ADD01547.1"
FT                   /translation="MRLVRIDKVPNKYGIIKGDKVITFGSEGFYSYNLEEVKLLPPCLP
FT                   TKAICVGLNYRDHIEEMGDKEPEEPTLFIKPSTAVIGSDDFIVLPEMSERVDYEGELAV
FT                   VIGKKAKYVSEKDALDYVLGYTIANDVTARDLQAKDGQWTRAKSFDTFLPIGPWIETDL
FT                   DPSSLDITTYVNGEVKQKSNTKHLIFNVPKLISFISHIMTLNPGDVILTGTPSGVGPLK
FT                   SGDIVTIEIEGIGKLTNRVK"
FT   gene            247515..250976
FT                   /locus_tag="Thit_0223"
FT   CDS_pept        247515..250976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0223"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /note="TIGRFAM: ATP-dependent nuclease subunit B; KEGG:
FT                   tpd:Teth39_2011 ATP-dependent nuclease subunit B-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01548"
FT                   /db_xref="GOA:D3T617"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D3T617"
FT                   /inference="protein motif:TFAM:TIGR02773"
FT                   /protein_id="ADD01548.1"
FT                   /translation="MSIRFIYGRAGTGKTSFCLNDIKRKLSDGKSHPLILFVPEQFTFE
FT                   AEKYLLDTIEKDEKIRAQVLSFKTLANRVFTEVGGLTHQHLTSCGRSMLIYKIMEDAQE
FT                   DLKIYSQASKQQGFIKKISETITELKRFEVSPDKLLEIAETIDYLGLREKLRDISLIYS
FT                   KFEESLHQNYIDQEDELALLAEKLEYSSQFEGAEFWIDGFTGFTPKQYRVIEKLLKKAS
FT                   RVNVTLCMDTSCNFSEIDTTDLFYTTKKTEDKLLEICQRNNISYEKPVDLNGGTPKRFR
FT                   ESEELSFLEKHFFSYPYKVYPSETKDISLFKAVNVYSEVEETARDIIRLVRDKGLRYSE
FT                   IVVAARDLNRYHKLVKAIFSQYGIPYFIDLKIEIKNNPIIVFITSLFDIHLKRWSYESV
FT                   FRYLKTGFANLEIEDISLIENYVLANGIKGDKWKEEAWNYRLDYRFDRLTMEEEEKEII
FT                   EKVNEIKEKITIPLQGFYKKFSKSKNVREACGTLYDFLVEMGLPQKIQKLIEKFKEEKE
FT                   YDTANQYAQVWDIVVDVLDQLVEVIGGEKVTVEQFAKILSIGFDEYQIGTIPPALDEVL
FT                   VTSVDRMKSHNAKALYIIGVNDGIFPASHFDERILTDEDREILTSHDVELDNDTKTKVF
FT                   EEQFLVYTALTSTSKFLRISYPIADHEGKSMRPSIIISRLKKIFPKIKQFSNVVEMDTA
FT                   EENLNRVSTPSPTFNEMITAIKKWDVTDKIHPLWLDVYKWYAKNDRWKPRLTRALEGIY
FT                   YTNQVEKVPAHKMKKLYGDKLRFSVSRLEKYAACPFAYFVQYGLKARERKIYSFEPPDL
FT                   GIFMHNILDRFSKALEEEELTWQEVDKEWCDEAVSIIVDDMIQKIPGYILNSSPRYKFL
FT                   AERLKRILSNAVWIVSEHIKRSSFKPVDHEVAFGDNQKYPPIKIELSNGEEINLIGRID
FT                   RIDIFKKEDEAYIRIIDYKSGNKTLDLSDVFYGLELQLLIYLDAILESAIKEGTTLNPA
FT                   GVFYFKIDYPIIKADKDMSDEDLQKEIFKRLRLEGLVLKDEQIIKEMDKSIEGTSYIIP
FT                   ATINKDGSIGKNTKGATKEQFELLRKHVKKTIQRLTEEMLEGNISISPYKKDKETPCKY
FT                   CPYSSICQFEKNFKDNDYRVIKTKDVEEIWSMLEQEVKTDGDYVDS"
FT   gene            250954..254646
FT                   /locus_tag="Thit_0224"
FT   CDS_pept        250954..254646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0224"
FT                   /product="recombination helicase AddA"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: recombination helicase AddA; KEGG:
FT                   tpd:Teth39_2010 UvrD-like DNA helicase, C terminal; PFAM:
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01549"
FT                   /db_xref="GOA:D3T618"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR014152"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D3T618"
FT                   /inference="protein motif:TFAM:TIGR02785"
FT                   /protein_id="ADD01549.1"
FT                   /translation="METTWTHEQQLAINTRGNNLLVAAGAGSGKTAVLVERIIRLITDK
FT                   ENPVDIDRLLVVTFTNAAASEMRERIADALISKLDQNPEDRRLSNQLTLLNKATITTIH
FT                   SFCLEVVRNNFFLIDLDPNFRIGDDTETLLLKLEAAEELFEELYQKEDNQDFLMLIESY
FT                   GGTRDDKPLVDVLLRLYNFVKSLPWPEKWLMEMLLNFEVKEDFNFEKSQWAQVILDSLK
FT                   VEISGLLNGMYVAIDKLHAEIGLQSYLDNFEIEAGNLEKLLECENWEEFRKQINAIKFD
FT                   RLPKAGKDADPKVKEEVTKIRNEVKAKIKEIRNKFFSDDIEKIEEEIKVLYPIMKALVD
FT                   LILLFDKKYADKKREKGIIDFNDIEHFALKILTEVDEKGKMKPSEVALMYREKFQEIFV
FT                   DEYQDSNLIQEVILSTIAREDTPNRFMVGDVKQSIYRFRQANPYIFFEKYNTYSSKEED
FT                   KNKKILLYKNFRSRSQIIDAVNFIFKKIMSKNVGEIDYTDEEKLNYGADFGTPPLGAIV
FT                   GGPVEIHLIEKNDEISEEEEVEVYEEEEEEVIDNIQGEARVASQRIKELVNQSERGIFM
FT                   VYDKNLKNYRPVEYRDIVILLRATERWAPVFLEELINAGIPAFADTGTGYFETTEIKTI
FT                   ISLLQVIDNPMQDIPLLAVLRSPIFSFTPEELIDIRLEEPNKTIYEALKKAAQRQDELG
FT                   QKIVFFLKSLKKWQEKAIYMPVDEFLWYLYQDTGYYAYVGAMPQGVQRQANLRILFERA
FT                   KQYEETSFKGLFNFINFINRLKVSSGDMGSAKIVGENENVVRIMSIHKSKGLEFPVVIV
FT                   AGLGKQFNLKDLSQSVLYHHLLGLGPEFVDFKRRISYPSIVKEAIKNKIKLESLSEEMR
FT                   VLYVALTRAKEKLILVGSVKDIKEKVKKWCNIAMLGNKVPEYEVLKGKSYIDWIGPAVI
FT                   KHPDLKPLRDFAHVQCAALEEDRSQWQVRIWDKKDVIIDKEKAEEETSFLEKLKDIDLN
FT                   SPSSEFYDEVARRLNYVYPYEKACHLPAKLSVTEIKRILNEEVIDEDTTSIFEKTVLKT
FT                   PAFLEERKGLTAVEKGVVMHLVMQKLDLNGDLTAEGIKKQIKNMVDREILTEAQAKEVD
FT                   VKKIEAFFKTPLGMRMLNSQNVRREVPFHIKLKSTEVYKDLPEDYENEFIAVQGIVDCF
FT                   FEEEGEIVLVDYKTDYVTEETLEATKEKYKVQIELYGKALEKITGKKVKEKYIYLFFNG
FT                   KILKY"
FT   gene            254657..255874
FT                   /locus_tag="Thit_0225"
FT   CDS_pept        254657..255874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0225"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="KEGG: tpd:Teth39_2009 nuclease SbcCD, D subunit;
FT                   TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01550"
FT                   /db_xref="GOA:D3T619"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D3T619"
FT                   /inference="protein motif:TFAM:TIGR00619"
FT                   /protein_id="ADD01550.1"
FT                   /translation="MRILHTSDWHLGKSLENFSRMEEQEKFLEDFVQIVEENNVDLVII
FT                   AGDVYDSSNPPAKAEMLFYSTLKRLSSGERVILVIAGNHDNPERLSAASPLAYEHGVIL
FT                   LGTPKSIVHKGDFGKFKILDSGEGYLEIEIKGEKAVIIALPYPSEKRLNEIFTEEMEEG
FT                   KRQKSYSERIGEIFKRLSEKYRDDTINIAVSHIFVSGGEEAGSERPIQLGGSFAVEIRH
FT                   LPQKAQYIALGHLHRPQKVSSTLNAYYSGSALQYSKSEINHSKCAYLVDIKAGTSPIVK
FT                   EVYFKNYKPIEIFKCDNIDEAIEICKEYQDKNIWAYFEIKTDSPLPPSKIKEMKQILPN
FT                   IVEIKPILPEDEAQVEDYEITEKSMLELFEEFYLKERGVTPSQDLIDLFVSIVKEEDEE
FT                   DETFEA"
FT   gene            255855..259388
FT                   /locus_tag="Thit_0226"
FT   CDS_pept        255855..259388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0226"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: tex:Teth514_0205 SMC
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01551"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D3T620"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ADD01551.1"
FT                   /translation="MRPLKLRISGLNSFVEEQVIDFERLTERGLFGIFGPTGSGKSTII
FT                   DAITLSMYGKIPRNSREFINTNSISTSVSYEFEIGIGAERKRYIVERNIKKDLKTGGYK
FT                   TTLARIREMGEKGEKVLCEGDREVQKKIAEILGLTAEDFTRSVVLPQGKFSDFLKLTGK
FT                   DRRDMLERIFGLEKYGNNLLKKIREVKNEKNLILNRVSGELSRYEGVSSEALQEMTKKL
FT                   EILKGQEEKLAAEKNRLDLEKEKLKAIWEKQQELNQYLQKKELLEGKIEEIERKKVKIK
FT                   KAEKALSVKPYIDAVNETNSKIAQNKEEVEKYTKELTVIEENLKKIEKEYDIALQKKEE
FT                   KIPLLIEKEEKLKRALQIQKEVKTINEEREKLLKTYRAVEKEIEKLKKELEILSNDIEI
FT                   TKKVLEDKDKKIEELKISSGQREKIFSALEVQKEFERIEKDKREKEVKIFELEEAIKRQ
FT                   QKEHERLKNLIKQKEEEIQALEEKIRNLEGHMPPTSDELLIMQQQLEEQKSKFLEAKEN
FT                   DELRQNIKGILDEISDLKGKLKEQIKKLEDDIKTKSKQLENLTKEIEEIQRQNIAGELA
FT                   KDLEEGMPCPVCGSVHHVKLAQKIDEELINEKRAFEEIFKREIEEFQNQLLKLKGELVA
FT                   LEAKEEFHKKEYDRLEEKLKGIDIKAFEQNVGQLQLRFEKAKLKTERWNKEKEEINALL
FT                   KKLGEEKAQLDLEEARLKESLGKDVKALKELKVSVEELSRAYSCILDQLESLRTELEIR
FT                   DFKQKVIEINEKDREVEKLQKESELLEKKLEELVNKKEILSNKINELLIKKAQIVEIGK
FT                   EKSKYLQERQKEIDILSEGKEIENYLKEVQRERENILKEEKILKEQFENEKKKRQETEN
FT                   KKVSALENQILLNNMLKDQFEKLNASISKNGFKDEKEVMECFLDEGTIKSLEEEIKNFE
FT                   NEYISICSNIERLDSTLNGQRIEEEVWRNLEEKIKETEQALTEKRKEIGATQKTLEDIQ
FT                   NNLQKVEELTEQKKELEQLLDMLEDLDKLFQGNHFVEFVATRQLKLITFSASKRLKEIT
FT                   RGRYALELDSDNNFVMRDDFNGGTRRSVDTLSGGETFLTSLSLALALSSHIQLKGRAPL
FT                   EFFFLDEGFGSLDSELLDVVMTSLERLRNDKMVVGIISHVEELKNRVPVKLIIIPPSTA
FT                   GEGSKVRIEYS"
FT   gene            complement(259613..260275)
FT                   /locus_tag="Thit_0227"
FT   CDS_pept        complement(259613..260275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0227"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Peroxiredoxin-like; KEGG:
FT                   tpd:Teth39_2006 putative peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01552"
FT                   /db_xref="GOA:D3T621"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D3T621"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ADD01552.1"
FT                   /translation="MEEIRMKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADF
FT                   TPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWVEWIKDNTNIAIPFPVIADD
FT                   LGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKALQTA
FT                   DQYGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK"
FT   gene            complement(260279..260713)
FT                   /locus_tag="Thit_0228"
FT   CDS_pept        complement(260279..260713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0228"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: tpd:Teth39_2005
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01553"
FT                   /db_xref="GOA:D3T622"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T622"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADD01553.1"
FT                   /translation="MKMTYTIEQLKDYLKRHDIKPSTIRIKVLEYLLNNRIHPTADDIY
FT                   QYLINEIPTLSKTSIYNTLELFMEKGVVNALSLKEKELRYDINVYFHGHFKCEICGKVY
FT                   DFPVSEEIINVEELKGFVIKNVDINVYGICKKCNEKNKEA"
FT   gene            complement(260730..260906)
FT                   /locus_tag="Thit_0229"
FT   CDS_pept        complement(260730..260906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01554"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T623"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2004"
FT                   /protein_id="ADD01554.1"
FT                   /translation="MEVKELVLKILKESSEPLRPGDIAQKANLDKKEVDKAIKELKKED
FT                   LIISPKRCYYAAK"
FT   gene            complement(261205..262248)
FT                   /locus_tag="Thit_0230"
FT   CDS_pept        complement(261205..262248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0230"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   tpd:Teth39_2044 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01555"
FT                   /db_xref="GOA:D3T3R7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3T3R7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADD01555.1"
FT                   /translation="MVHNNDTTKKRSFKHLSSYERGEIYALLKEGRSIRYIAKKLNRSP
FT                   STISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAEN
FT                   KILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRK
FT                   KQNRKNKRIMGKSIDFRPKEVESREVFGHWEIDTLIGKKSNDKVLLTLIERKTRHEIIF
FT                   LLDAKDNKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHP
FT                   YSSWERATNERHNGLIRRFIPKGKSIKDLSIDTIKRVENWLNNLPRKLLNYKTPKEYFY
FT                   EELAKIC"
FT   gene            262594..263559
FT                   /locus_tag="Thit_0231"
FT   CDS_pept        262594..263559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0231"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.12"
FT                   /note="TIGRFAM: galactose-1-phosphate uridylyltransferase;
FT                   KEGG: tpd:Teth39_2003 galactose-1-phosphate
FT                   uridylyltransferase; PFAM: galactose-1-phosphate uridyl
FT                   transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01556"
FT                   /db_xref="GOA:D3T625"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR005850"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D3T625"
FT                   /inference="protein motif:TFAM:TIGR00209"
FT                   /protein_id="ADD01556.1"
FT                   /translation="MSEIRYDLITGKRVIIATERGKRPHDFNVNYEEKKNNTCPFCPGN
FT                   EEMTPPTLVEIKDKKGNWLVRGFENKFAAVNTDLKSFEAPSLYKAEYGYGVAEVIVESP
FT                   EHDVTFGSLSLEQMQKVFMAIIERYKKIAQDDKIKYIQVFKNFGARGGASLEHGHWQII
FT                   ATSFIPDVVEKEVAGTQEYIKKKGKCPYCEIVKYEKEEGKRIISENENFIVIAPYASQY
FT                   PYECWIIPKEHQERFEELKEENVASLTKILKTLIVKYEREFNFPPYNIVVHTLPIYDTR
FT                   NYHWHFEIAPRLTVAAGFELGTGVYINPVPPELAASVLRI"
FT   gene            263585..265162
FT                   /locus_tag="Thit_0232"
FT   CDS_pept        263585..265162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_2002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01557"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D3T626"
FT                   /inference="similar to AA sequence:KEGG:Teth39_2002"
FT                   /protein_id="ADD01557.1"
FT                   /translation="MYISKTFNFEDIPTKLKDILKNINKDNFKKFRWFQEKAYDILDIF
FT                   LFDYAILSKKEAEVIIAAIIAFVVKASTSNKEIMLLYYVPLIITPYFRNNDLIDIIESP
FT                   NLKAFIYDGIDDINYVKFLNKALNEETVIKFESGAKLIPYNLKKDDIYSARRLSNKSSN
FT                   SLTFLQKNEIIKTYRKFVKGVNPDLEMTFELKNAGFGNVQDIRGYFLYEDSSGERYTVA
FT                   IIVEHIKNMGDMWQYTQEYLSSVISTLSDYDKIEESYVEGYLSDYLEEVREIARIIADM
FT                   HIKLSYIDKEDFAKRNVEISDVEEIVKSIKNNFTKLLNFVKLSTFDEQITSMIEEIIKQ
FT                   QEFLMSKLEEFKNSAVLGKYIRCHGDLHLEQILKTEEGYVIIDFEGEPTKPIEMRRKKI
FT                   SPLKDVAGMVRSFSYAAYAAYFNYLNAKGKFQDEKIEKALLWWERAVTETFVENYLELV
FT                   TREAPDIIPDGENFDKALAIFKLDKALFEGIYEVNNRPSWFRIPLKGILECIEDLKLEK
FT                   HGSEVNYG"
FT   gene            265155..266321
FT                   /locus_tag="Thit_0233"
FT   CDS_pept        265155..266321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0233"
FT                   /product="glycogen synthase"
FT                   /note="KEGG: tpd:Teth39_2001 glycogen synthase; TIGRFAM:
FT                   glycogen synthase; PFAM: glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01558"
FT                   /db_xref="GOA:D3T627"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011875"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D3T627"
FT                   /inference="protein motif:TFAM:TIGR02149"
FT                   /protein_id="ADD01558.1"
FT                   /translation="MDKLKVTMFTNEYPPNIYGGAGVHVDYLVRELSKLMKVDVRCFGD
FT                   QDYTADNLKVRGYKEWDKLKENSDPRYQKVLGPFSIDLAMVKDEIDSDILHCHTWYTFM
FT                   AGFLAKKLYDKPLVVTIHSLEPLRPWKEEQLGNGYKLSSWMERTGIEAADRVIAVSQGS
FT                   KEDILKYYNIPEEKVEVIYNGIDLNQYQKTDRNIARKKYGIEGKYILFVGRISRQKGIT
FT                   HLIDAVKYLPKDIKVVLCASSPDTQEVLEEVEQKVKLYDNIIWINKMVEKEEIIELYSN
FT                   AEVFACPSIYEPFGIINLEAMACKTPVVASATGGIKEVVVHEETGFLVEPGNSEELAKY
FT                   INILLNNKDLAIKFGENGRKRVEEMFSWESIARKTYEMYKDVIEKYKK"
FT   gene            266446..267849
FT                   /locus_tag="Thit_0234"
FT   CDS_pept        266446..267849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0234"
FT                   /product="protein of unknown function UPF0236"
FT                   /note="PFAM: protein of unknown function UPF0236; KEGG:
FT                   tte:TTE0402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01559"
FT                   /db_xref="InterPro:IPR009620"
FT                   /db_xref="UniProtKB/TrEMBL:D3T628"
FT                   /inference="protein motif:PFAM:PF06782"
FT                   /protein_id="ADD01559.1"
FT                   /translation="MKKNIFEDIILQNALNFTREVVEIFSDLLNKGMNITELAARIKEL
FT                   TDKLGREAIEAIIEELDKIIKEDKRRKEKWVVERKDKKRLTTILGDIEYERTYYKSRED
FT                   GRYTYLVDDALEIGRHDRIEKGVKIKLVENAIEESYERSSKKACPEELSKQTVLNAIRE
FT                   IGEVEVKREIKEKKEIRVLYIEADEDHVPLQDGSNETPRLIYIHEGKEEKNGRNVLRNV
FT                   HYKAYVGEKAEDIWIDVANYIEENYKEEKIEKIYIAGDGAPWIKEGLKWIVKSRFVLDR
FT                   YHLNKYVLKATSKEPKYREKIWRAINEGDKEGVKKIFDELIKAAEEEREKEKIKEARKY
FT                   ILNNWEGIKIYSEDKDVIGCSAEGHISHVFSVRLSRNPLGWSREGLKLMAKLRVFSKNG
FT                   GDLREVEWGKRKNINEGSYKLTKKQIKEAVRRVKTSTNEKINNITVLNIGKVTPIYRVL
FT                   RAIKYAQVI"
FT   gene            268007..268627
FT                   /locus_tag="Thit_0235"
FT   CDS_pept        268007..268627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0235"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   tpd:Teth39_2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01560"
FT                   /db_xref="GOA:D3T629"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D3T629"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADD01560.1"
FT                   /translation="MEGQSFLYNAIINYGYIALFIGLLIEGTGAPGPVQILFFAAAYLA
FT                   TKGEMNLFYVIVIATLGNITGNVIAYLVGYYKGRPVVEKYGKYLKITVKDLEAMDKWFA
FT                   KYGGFTVLLGRLIGLPRTPAIWASGITRMNFTAYVIFSAIADFIWSTFWTVVSYLAAVQ
FT                   LIKINFFVKSYSAWVYFASTIGFIIFLYMVWRILLWMKERYLT"
FT   gene            complement(268725..269462)
FT                   /locus_tag="Thit_0236"
FT   CDS_pept        complement(268725..269462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0236"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   tpd:Teth39_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01561"
FT                   /db_xref="GOA:D3T630"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D3T630"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ADD01561.1"
FT                   /translation="MKGKVLQTLSFMLVFIAMGLMISIQFKTVQGSNRTSTPTVATNYA
FT                   RSEELTQQLKKVQEEKANLEQQLEELTKRFKEYEDAASKNDAALKNLQQDIEKYKSLAG
FT                   LTDMEGPGVIVTVNDSDLQPRDGEDPNLYLVHDEDLLNIVNELKAGGAEAIAINDQRLI
FT                   ATSEIRCVGPTININSTRYAPPYVIKAIGDPETLKAALNIKGGIIDTLKFYGIKVDIQT
FT                   SDRIVIPKYSEPIKFFYAKPVTN"
FT   gene            269764..270699
FT                   /locus_tag="Thit_0237"
FT   CDS_pept        269764..270699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0237"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="KEGG: tpd:Teth39_1997 L-lactate dehydrogenase;
FT                   TIGRFAM: L-lactate dehydrogenase; PFAM: Lactate/malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01562"
FT                   /db_xref="GOA:D3T631"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T631"
FT                   /inference="protein motif:TFAM:TIGR01771"
FT                   /protein_id="ADD01562.1"
FT                   /translation="MNKISIIGSGFVGATTAYTLALSGFVKTIVLIDINKDKAEGDALD
FT                   ISHGVPFISPVEVYAGDYGDAAGSDIIIITAGAAQKPGETRLDLVKRNTMIFKDIVAKL
FT                   IKVNDTAIYLIVTNPVDILTYVTYKISGLPYGRVLGSGTVLDSARFRYLLSKHCNIDPR
FT                   NIHGYIIGEHGDSELAAWSITNIAGIPIDDYCNLCGKACEKDFRDEIFNDVVRAAYTII
FT                   EKKGATYYAVALAVKRIVEAILKDEHSILTVSSPLTGQYGVTNVALSLPSVVGRNGIVN
FT                   ILELPLSQEEIDAFRRSAEIIKGVIQELDI"
FT   gene            270784..271242
FT                   /locus_tag="Thit_0238"
FT   CDS_pept        270784..271242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01563"
FT                   /db_xref="UniProtKB/TrEMBL:D3T632"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0217"
FT                   /protein_id="ADD01563.1"
FT                   /translation="MQKITQQEIILSSFVEAQNLEKILLDKVREYGKESVDNQIKGLLK
FT                   QIEIMIKNHKEDIQKAQKTMHISSLVKKNMSQEPLDMLQDLLKNLVNIQAFYNETVVNV
FT                   TNPYVRQLFTQMRDDVMRFISILQIEIESLESKPSIPNNTVLNTPEMS"
FT   gene            271244..272326
FT                   /locus_tag="Thit_0239"
FT   CDS_pept        271244..272326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0239"
FT                   /product="dehydrogenase (flavoprotein)-like protein"
FT                   /note="KEGG: tex:Teth514_0218 dehydrogenase
FT                   (flavoprotein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01564"
FT                   /db_xref="GOA:D3T633"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3T633"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0218"
FT                   /protein_id="ADD01564.1"
FT                   /translation="MKVAIIGAGVSGLAAAITFQRYGIIPDIFEKKCKIGDLYNHVGGL
FT                   LKVINRPIKDPLHYLKNVYGIEIKPINTIDKIVMKGPTVTASVNGNNLGYMILKGQDAN
FT                   SLENQLYNKLEIPVNFNIEADYKKLKDNYDYLIIATGSSQIPKELGCWQELVTTWVRVA
FT                   SVLGNFDTKTLIMWINTLYTKSGYVYLIPYNEKRAVLAMVVPYISKEELQYYWDTFLKV
FT                   EKMNVDIVNMVDLEHISGNCFPHQYENLLFVGNAGGAIEPFLGFGTFNSIVSGAIAAKS
FT                   IVQGVDFEREIRFLSEANIKMLEFRKALDLIDNDKLDKLIKILTFPPVKKIVYHTNFNV
FT                   IKYGSIFMRYTMNKMNNKPL"
FT   gene            272348..273415
FT                   /locus_tag="Thit_0240"
FT   CDS_pept        272348..273415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0240"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   tex:Teth514_0219 dehydrogenase (flavoprotein)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01565"
FT                   /db_xref="GOA:D3T634"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3T634"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ADD01565.1"
FT                   /translation="MRVAIIGAGVAGLCCAYTLGKLGISCDIYERKHTIGSLYSYGELL
FT                   LHIAHRPCKDPLKFIAKEFGILIEPLNEVRKIVIKSPKREAFIEGKQLGYIVKRGQEQE
FT                   SIENQLAKKINAKINFSINADYRELAKSYDYVVVATGSSMIAKQLTEVKNVVSTRIKGG
FT                   IALGDFEPNTVYLWLNTMYARSGFGYLVPLSKSNASIILVATYTQKEEIENMWHTFLYQ
FT                   EKLDYEMIETFETELDISITDKHQIDNMFLIGNAGGVLDPFLGFGLLNAVESAVYAAES
FT                   IKHGGDYEKKVKRITDRVDKLIGFRKMMDSIKNEDYDRIVKVIENPIVKRVMYRTNLDV
FT                   IKYLHYFIKHQRPSN"
FT   gene            complement(273424..273852)
FT                   /locus_tag="Thit_0241"
FT   CDS_pept        complement(273424..273852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0241"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   tex:Teth514_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01566"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="InterPro:IPR025707"
FT                   /db_xref="UniProtKB/TrEMBL:D3T635"
FT                   /inference="protein motif:PFAM:PF03479"
FT                   /protein_id="ADD01566.1"
FT                   /translation="MGYKSVSIERRFIGRFQYGKDLLEEINKIITSENIRSGEIRIIGA
FT                   VSKAVFSYYDAQSKNYIYISKDEHMEILNATGNISVKDGKPFAHVHITLADKNGNAFGG
FT                   HLMEGTIVFAAEFVISDYGENKLERIYDETTGLQLWNI"
FT   gene            274102..275109
FT                   /locus_tag="Thit_0242"
FT   CDS_pept        274102..275109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0242"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: tex:Teth514_0222
FT                   periplasmic binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01567"
FT                   /db_xref="GOA:D3T636"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3T636"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADD01567.1"
FT                   /translation="MKTLNENFFRLIDKVILILVILIAALSIFLYKLEKVEEPIFAKTS
FT                   QYHFYMVAQNSVDPFWKEVKMGAMDAAKRYNVAIEFNAPKFNNIQEELQYLDIAILSKV
FT                   DGIITHVSNSKEFVDLIEEAYKAGIPVITIENDAKDSKRQAFIGTNSFQLGEEAGKLMI
FT                   KATKGKANIAIIVSNDYQLDTVNQNLKINGFLDAIKDYPQMKVVKVYTSKLGTLSAEEI
FT                   TQSIISSKQNINAIYTTDSVDTIGTAQVIVDFNKVGEIAIVGYGDTADILRYIDKGIIY
FT                   GTVMSDPYRIGYESVKSMVEIKEKNNVSTFVDIGVNVITKHNVKEYFKRIQLME"
FT   gene            275119..276627
FT                   /locus_tag="Thit_0243"
FT   CDS_pept        275119..276627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0243"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="KEGG: tex:Teth514_0223 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: histidine
FT                   kinase internal region; histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01568"
FT                   /db_xref="GOA:D3T637"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3T637"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADD01568.1"
FT                   /translation="MKKDVWRFTGIRRKLIVYYLLITVLMGITSFYSYYNAKSVINRLK
FT                   SIFVDYIYLNNLNADVNTLETEVEKYLSTKSSDALLNYYTLYNKLQEQASAILNEKNYD
FT                   QDGLMLKDIGNMIESLLNETDEAINAKRGRISSEYIAHFTRSIRISEYIKLYINNLLNS
FT                   KLQEGSLKYASISKNMEFISYLNVFLIIGSILFNIFLAIFFTYRITKPLMDLSYLAVRV
FT                   SKGDFDVRPVEIETNDEISILAEAFNKMVVSIRNYIGEIKNQAEVEKKLKEQEMQNLKM
FT                   RNILKEAELKALQSQINPHFLFNTLNAAAQLAMMEGADKSSEFIENVAKLFRYNLKKLD
FT                   TTVTLQDEINNVKTYMYILKTRFGDRVDFKVEVDEKVLDVEMPCTIIQPVVENAFIHGL
FT                   EDVEEGGFIKLTVKRDDDKVLIEVVDNGRGMSKEKVKAILSADYEDLSKKHVTGIGLHN
FT                   IINRLRLFYNISAIQDVIEIDSKIGEGTKVTLKIPLMKGDKEND"
FT   gene            276620..278233
FT                   /locus_tag="Thit_0244"
FT   CDS_pept        276620..278233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0244"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: tex:Teth514_0224 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain; response regulator
FT                   receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01569"
FT                   /db_xref="GOA:D3T638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:D3T638"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD01569.1"
FT                   /translation="MIRLFIADDEQIVIDSIKFIIEKNDVKADIIGFAKSGREAIEKVE
FT                   ILKPDVVFMDIKMPGIDGIEAIKQIKERHKDIIFVIITAYEYFNYAKEAIDLGVLDYLL
FT                   KPLNRNKVVEAIKKAIEVIEKRREAMLKELELKEKLNKIIPYLEGQFLYTTLFSGITYD
FT                   DLSFYEEIFGIKLQRGYAMIVTVDDVDNNLKGQTLKLSIDKQNFYDHFKTIVKNIKKCL
FT                   VGYFFIDKVFVYFPVVEEDSFEIKNDSIETAQKIIEAINQKVKIPYRIGIGRAYNFENI
FT                   LKSYYEAEMALKMEKNELIAHFDDIAMPQNRFKPYPINKERLFIDRLMAGDLQGSFTIF
FT                   NEIYEWMVLEYQEDVDKIKSKLIEIIGVIKRNLSYYVEEEKFIENRELEEILKINDVDK
FT                   IKFIFINTLKNLFDSIKTINKEKMDTLMTKIIRFIENNFNKDITLDDVAKEVNMSYHYF
FT                   SKFFKDQTGKNFVDYLTNLRVTKARELLEDESVSIKEVCYKVGYSDPNYFSKIFKKATG
FT                   MTPTEYRLAIYKKGGVVGGE"
FT   gene            278223..279302
FT                   /locus_tag="Thit_0245"
FT   CDS_pept        278223..279302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0245"
FT                   /product="monosaccharide-transporting ATPase"
FT                   /note="KEGG: tex:Teth514_0225 monosaccharide-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01570"
FT                   /db_xref="GOA:D3T639"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3T639"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0225"
FT                   /protein_id="ADD01570.1"
FT                   /translation="MESKNVIKVIVAIVLMIIFGVLVFLTVKHVVAYREVKSVNSNLDK
FT                   KGHKIKIGFSLGTLKEERWIKDRDIVMAKLRELGAEVLVQNANNDDQDQLKQVRYLLDQ
FT                   KIDVLIIVPNDLEKASYAVSLAQKEGVKVISYDRLVTKSNVDLYISFNNIKVGKLMAEY
FT                   LVKRVPRGNYLIINGATTDNNTKMIKEGYDSVLKPRIESGDIKIVKEDWAPNWMTEYAF
FT                   NSTDELLQKGVKIDAVIAGDDALAGGIIEALSEHRLAGKVLVAAQDADLAACQRIVEGT
FT                   QAMTVYKPIDKLAEATAKMAMKLARGEKLDVKNTIYDGKYYVPYYVLEPIAVDKTNIDD
FT                   TVIKDGFHNRDEVYRNVFK"
FT   gene            279478..280563
FT                   /locus_tag="Thit_0246"
FT   CDS_pept        279478..280563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0246"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="KEGG: ate:Athe_0105 D-xylose ABC transporter,
FT                   periplasmic substrate-binding protein; TIGRFAM: D-xylose
FT                   ABC transporter, periplasmic substrate-binding protein;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01571"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3T640"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ADD01571.1"
FT                   /translation="MVKSKKLLAFFLVMILTLSVVLAGCTSSKTNETTNTTSSNGSSST
FT                   ETKKIKIGFSLPTMREERYQRDRDAFVEEAEKLGAEVLVQGANNDENLQNSQVENLITQ
FT                   GIDVLVLDPQNAVSAATLVEKAHQAGIKVISYDRLILNSEPDVYISFDNERVGELQGEF
FT                   LTKLVPKGTYFIFAGAPTDNNATLFKKGAMKYIQPLVDKGDIKIAFDQAIKDWDPNEAL
FT                   KLAENALTANKNKVDAILAPNDGTAGGIIQALAEQKLAGKVPITGQDAELAAVKRIVEG
FT                   TQSMTVFKDVRVLARKAAQIAVMLAQGKEVKDIPEINKTVNNQKIDVPSLLLTPVVITK
FT                   DNIDKELIDSGWFTREQVYGK"
FT   sig_peptide     279478..279570
FT                   /locus_tag="Thit_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.386 at
FT                   residue 31"
FT   gene            280623..282140
FT                   /locus_tag="Thit_0247"
FT   CDS_pept        280623..282140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0247"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: ate:Athe_0106 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01572"
FT                   /db_xref="GOA:D3T641"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T641"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01572.1"
FT                   /translation="MSEYILEMRNITKEFPGVKALDNVNFKVKRGEIHALVGENGAGKS
FT                   TLMKILSGVYPYGTYKGDIIIDGEVKQFRNIKDSEKSGIAIIYQELTLVKYMTVGENIF
FT                   LGEEPVKGGIIDWMKVYSETYRLLKELQINVNPYTKVMNLGIGHQQMVEIAKALSKKAR
FT                   ILILDEPTSALTESETEHLLNILKDLKKNGVTCIYISHKLNEVFEIADSITVLRDGKTI
FT                   MTDKKENFTENKVISLMVGRELTQRFPRAKHTPGEVVFEVKNYTVYDHEIPGKKIIDNV
FT                   SFKARRGEILGIAGLMGAGRTELAASIFGAFKGRKEGEIYLNGKKIEINTPSDAIKHGI
FT                   AYLSEDRKRFGLVTLMDVQENIALPNYDRLSKFSIINNNAKIKHAEKYVKELKIKTPTI
FT                   RQRVANLSGGNQQKVVIAKWLMSDPKVLILDEPTRGIDVGAKFEIYNLMNKLVDMGVCV
FT                   IMISSELPEILGMSDRILVIHEGKINGEFPIEEADQEKIMYCATGGK"
FT   gene            282143..283309
FT                   /locus_tag="Thit_0248"
FT   CDS_pept        282143..283309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0248"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ate:Athe_0107 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01573"
FT                   /db_xref="GOA:D3T642"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3T642"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADD01573.1"
FT                   /translation="MMESKVSKTTEKRILNHFKIDIRSYTMILALLGIWIIFSILTHGD
FT                   FLSPRNLSMLARQMSITAILASGMVLVIVAGHIDLSVGSVAGFTGAIAAILQVIYHWDT
FT                   VPTIIVTLMAGLAIGVWQGFWIAYRKVPAFIVTLSSMLVFRGGILLITKGVTISPLKQD
FT                   FTVVGQGYIPPLFSVILAVVAGVLYVIMDLKNRNSRIKYGLSVSSWGIELAKIAGVLIF
FT                   IALFTSVMISYEGIPVPVLLVLVIVILLTFVAQNTTFGRYVYAIGGNKEAAAYSGINIA
FT                   KTNMTIFLIMGVLSAIAGIVLTSRLNAATTSAGNLFELDAIASAIIGGTSTLGGEGTVP
FT                   GAILGALIMASIDNGMSLMNIDYSILTIVKGLVLVLAVWVDISTKKRG"
FT   gene            complement(283361..284815)
FT                   /locus_tag="Thit_0249"
FT   CDS_pept        complement(283361..284815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0249"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="KEGG: tex:Teth514_0229 glycine dehydrogenase subunit
FT                   2; PFAM: Glycine cleavage system P-protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01574"
FT                   /db_xref="GOA:D3T643"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:D3T643"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ADD01574.1"
FT                   /translation="MKEYNKLIFELSKEGRKAYTLPRLDVEEKTLEEILPEQMIRKEEI
FT                   ELPEVSEVDIIRHYTLLSNKNYGVDTGFYPLGSCTMKYNPKINEDMASLTGFTALHPYQ
FT                   PVETVQGALKLMYELENMLSEITGMDKFTLQPAAGAHGELTGLMIIKAYHEHRNDKKRK
FT                   KIIVPDSAHGTNPASATVAGFDVIEIKSTKEGAIDLEALKTVLNEEVAGLMLTNPSTLG
FT                   LFEENIVEIARLVHEAGGLLYYDGANMNAIMGITRPGDMGFDVVHLNLHKTFSTPHGGG
FT                   GPGSGPVGVKKELADFLPVPVIEFKDGMYTLNYDRPLSIGKVRSFYGNFNVLVKAYSYI
FT                   LTMGAEGLKRASEMAVLNANYLKEKLKNHYKVAVDKVCMHEFVLAGLLEKVNDIRTLDV
FT                   AKRLIDYGFHPPTIYFPLIVEEAIMIEPTETENKETLDAFIEAMIKIAEEAKENPQLLK
FT                   EAPHNTPVRRVDEVLAARNPVLKWSK"
FT   gene            complement(284816..286156)
FT                   /locus_tag="Thit_0250"
FT   CDS_pept        complement(284816..286156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0250"
FT                   /product="Glycine dehydrogenase (decarboxylating)"
FT                   /EC_number="1.4.4.2"
FT                   /note="KEGG: tpd:Teth39_1990 glycine dehydrogenase subunit
FT                   1; PFAM: Glycine cleavage system P-protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01575"
FT                   /db_xref="GOA:D3T644"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:D3T644"
FT                   /inference="protein motif:PRIAM:1.4.4.2"
FT                   /protein_id="ADD01575.1"
FT                   /translation="MFPYLPISSNDEKEMLKSIGKSSVEELFENIPKEVRLNRSLNLAK
FT                   PMSEIELKRHIKRYAEQNRNLEELISFLGAGVYDHYIPSIVKHIISRSEFYTVYTPYQP
FT                   EISQGTLQAIFEYQTMICNLTEMEVTNASMYDGATACAEAAIMACENTKRKTILVSKTV
FT                   NPETRKVLKTYMHFRDIQVIEIEDTEGVTDIENLKNKIGSNAAAVIVQYPNFFGIIEDL
FT                   QQIEKITHENKAMLITYVHPIPLGILKSPGEIGADIAVGDGQSLGNGLNFGGPYLGFLA
FT                   TTQKLVRKIPGRIVGQTKDVDGKRAFVLTLQAREQHIRREKATSNICSNHSLNALTAAV
FT                   YLATMGKKGIKEVAYQCTQKAHYAFSVLTASGKYKPAFTKPFFMEFAIKSEIDIDIINQ
FT                   KLLENGILGGYNLHRDYDKYKNTMLLAFTEKRTKEEIDRLKALLEVI"
FT   gene            complement(286161..286541)
FT                   /locus_tag="Thit_0251"
FT   CDS_pept        complement(286161..286541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0251"
FT                   /product="glycine cleavage system H protein"
FT                   /note="KEGG: tex:Teth514_0231 glycine cleavage system
FT                   protein H; TIGRFAM: glycine cleavage system H protein;
FT                   PFAM: glycine cleavage H-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01576"
FT                   /db_xref="GOA:D3T645"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D3T645"
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /protein_id="ADD01576.1"
FT                   /translation="MEVLEGLYYSKDHEWVKVEGDKAYIGITDYAQHSLGNIVYIELPE
FT                   VGAELNAGDVLGVVESVKAASDVYTPVDGKVLEVNNAIVDDPSLVNNDPYGSWMILVEL
FT                   KDRSQLENLMTAEEYKKFLDEE"
FT   gene            286702..288119
FT                   /pseudo
FT                   /locus_tag="Thit_0252"
FT                   /product="hypothetical protein"
FT   gene            complement(288297..289421)
FT                   /locus_tag="Thit_0253"
FT   CDS_pept        complement(288297..289421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0253"
FT                   /product="glycine cleavage system T protein"
FT                   /EC_number="2.1.2.10"
FT                   /note="TIGRFAM: glycine cleavage system T protein; KEGG:
FT                   tpd:Teth39_1988 glycine cleavage system
FT                   aminomethyltransferase T; PFAM: glycine cleavage T protein
FT                   (aminomethyl transferase); Glycine cleavage T-protein
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01577"
FT                   /db_xref="GOA:D3T646"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D3T646"
FT                   /inference="protein motif:TFAM:TIGR00528"
FT                   /protein_id="ADD01577.1"
FT                   /translation="MDSLKKTPLFDLYKKYNGKIIDFAGWALPVQFESIISEHEAVRNA
FT                   AGLFDVSHMGEIIVKGREAFAFLQNLITNDLSKLKENQVLYTFMCNYNGGVVDDLLVYK
FT                   YSDEHFLLVVNAANIEKDYKWMKDNKGVYAVEINNISDEISELAIQGPKAEEVLQKLTD
FT                   TDLSQIKFFYFKDNVKIAGINSLISRTGYTGEDGFEIYIPNKYAIELWEKIIEVGKEYG
FT                   LKPAGLGARDTLRFEAGLPLYGNELSEEITPLEAGFEFFVKFDKGNFIGKDALLKQKEE
FT                   GVKRKIVGFEMIDNGIPRHGYEVRADNQKIGYVTTGYFSPTLKKNIGLALIDSKYAQLG
FT                   NQIEIVIRNKPLKASIISKNFYKKNYKIGDCKMR"
FT   misc_binding    complement(289496..289566)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   42.31"
FT   misc_binding    complement(289569..289674)
FT                   /bound_moiety="glycine"
FT                   /note="gcvT element as predicted by Rfam (RF00504), score
FT                   55.38"
FT   gene            289776..290756
FT                   /locus_tag="Thit_0254"
FT   CDS_pept        289776..290756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0254"
FT                   /product="lipoyltransferase and lipoate-protein ligase"
FT                   /EC_number="2.7.7.63"
FT                   /note="TIGRFAM: lipoyltransferase and lipoate-protein
FT                   ligase; KEGG: tex:Teth514_0233 lipoyltransferase and
FT                   lipoate-protein ligase; PFAM: Lipoate protein ligase-like;
FT                   biotin/lipoate A/B protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01578"
FT                   /db_xref="GOA:D3T647"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:D3T647"
FT                   /inference="protein motif:TFAM:TIGR00545"
FT                   /protein_id="ADD01578.1"
FT                   /translation="MLYIYNKNTNPYFNLAAEEYILKEFQEECFMLWRNEPSIIIGKNQ
FT                   NTLAEINLDYVRQHKIPVVRRLSGGGAVFHDLGNLNFTFIVNEDVSSFSDFKRFTQPII
FT                   DVLRKLSINAEFSGRNDITIDGKKISGNAQYYYKNRILHHGTLLFSSSITDLSAALKVR
FT                   PVKFEDKGVKSVSKRVTNISEHLKEPITIEQFIDLIMNHIREQTGGSEMYEFTQEDIKK
FT                   IEKLVREKYSTWEWNFGTSPDYKFKNEKKFAGGTVEVNLNVEKGIIKDVKICGDFFGKY
FT                   DVSEVENLLKGVKHSEEEIKKVLSNIDINDYLANITVDNLIEVMF"
FT   gene            290936..292591
FT                   /locus_tag="Thit_0255"
FT   CDS_pept        290936..292591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0255"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /note="KEGG: tex:Teth514_0234 dihydrolipoamide
FT                   dehydrogenase; TIGRFAM: dihydrolipoamide dehydrogenase;
FT                   PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; biotin/lipoyl
FT                   attachment domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01579"
FT                   /db_xref="GOA:D3T648"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3T648"
FT                   /inference="protein motif:TFAM:TIGR01350"
FT                   /protein_id="ADD01579.1"
FT                   /translation="MDIEIKVPAFSDTMKSGRITKWYVEEGQYVEKGACLCDIAVNKVN
FT                   FEVYSDYEGIISKIVCHPGSTVEPGDVIAIVTQSEEVKPSVTQEEIKYEYKEYDLAVIG
FT                   AGPGGYVAAIKAAKKGAKVALFEKDKLGGTCLNRGCIPTKAYARIAEVYDILKRAGEFG
FT                   FDVKVNSFDYTQVVKRKDGIVGELVEGINALLKANGVDLFYAEAKVDKEKNVLFGENKI
FT                   KAKNIIIATGSSPAELPIEGINSKNVMNSDTILEMTSLPQSLCIIGGGVIGMEFAFIMN
FT                   QFGIKVSVVEMMPDILPTLDKEVSSFIRAIAQKRGIRIYTSSTVERIDEEENGGSIVTV
FT                   KNGENIKRIYADKVFVSIGRKLNTDIGPITELLEFEGRAIKVDKHMRTNVEGVYAIGDV
FT                   TGKMMLAHVASAQGEVAVDNIFGESSTLDYMKIPAAVFTEPEIGYFGYTEEEARNKFQE
FT                   VKVGRFNFEHNGRAKTYGETEGFAKVISNEKGEVVGAWVVGSGASELIHILSTACQEGV
FT                   NAEALKKVVYAHPTRSETIMEAVKDIFGESIHKV"
FT   gene            292680..293123
FT                   /locus_tag="Thit_0256"
FT   CDS_pept        292680..293123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0256"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: tpd:Teth39_1985
FT                   OsmC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01580"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D3T649"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ADD01580.1"
FT                   /translation="MAIETFKAVSRKLPEGLAVESEVRGFKIILDEPKELGGTNKGMNP
FT                   VEALLCALGSCQTIVASVFAKAKGINLQDFWVELEGDLDTDGFMGKAGVRPGFQEIRFK
FT                   MHIKTDAPKEKVEEFAKFIEKTCPVGDSLANPVKLVLSDVIVE"
FT   gene            complement(293224..294093)
FT                   /locus_tag="Thit_0257"
FT   CDS_pept        complement(293224..294093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01581"
FT                   /db_xref="InterPro:IPR006842"
FT                   /db_xref="InterPro:IPR010106"
FT                   /db_xref="UniProtKB/TrEMBL:D3T650"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1950"
FT                   /protein_id="ADD01581.1"
FT                   /translation="MKGRNQMSQKYDIAMKNIFSDMADDIMSYFLGLTSVKIDELNIEF
FT                   AKIEKRESDMIFKCTTDTGDIAVHIEFQSSNDNKMPYRMLRYAIEVIEKYNLMPYQVVI
FT                   YLGRHELKMVDSINFNFSKENLLNYRYKIIDIGNIKFSEITQTNYYDLYSLLPLIDKKR
FT                   REEEGEKYLEKCVKAIKNMQVDIDKKRNIAFKAEILAGIVYKKEVIERVFREVEKMFRL
FT                   EESETYKMIIEKGIEKGIEKGIEKGIEKGKKEGKIAVAKKLLEKGMDIDEIAEITELSK
FT                   EEIKKLLN"
FT   gene            294253..295419
FT                   /locus_tag="Thit_0258"
FT   CDS_pept        294253..295419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0258"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   tpd:Teth39_1984 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01582"
FT                   /db_xref="GOA:D3T651"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3T651"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADD01582.1"
FT                   /translation="MNFEDRVAKRAKSIEISTIRYFFNMAKEVPGAISLAIGEPDFVTP
FT                   EHIREAAKKALDEGKTGYTVNPGLIELRQEISNYLKKRYNLSYNPETEILVTIGATEAI
FT                   YVALNTLAEEGDEVLIPEPSFVAYNPCTILAGAKSVFVPTYEEDDFVLRADVLEKYITD
FT                   KSKVLILPYPNNPTGAVMPKEAMEKIAEVVKKHDLIVVTDEIYSELIYSGFEHVSFASL
FT                   KDMWERTVTINGFSKSYAMTGWRLGYIAAPEYFVKHMTKVHQYSVTAAATMCQYAGIEA
FT                   IKNGDEDILKMREEYDRRRKYLLQSVREMGLDCFEPKGAFYIFPSIKKTGLTSEEFAKR
FT                   LLFEAKVAVVPGNAFGENGEGYVRMAYATSMENLEEAVKRMKEFMSKF"
FT   gene            295563..297701
FT                   /locus_tag="Thit_0259"
FT   CDS_pept        295563..297701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0259"
FT                   /product="PTS modulated transcriptional regulator, MtlR
FT                   family"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; PRD domain protein;
FT                   Helix-turn-helix type 11 domain protein; phosphotransferase
FT                   system lactose/cellobiose-specific IIB subunit; KEGG:
FT                   tex:Teth514_0237 transcriptional antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01583"
FT                   /db_xref="GOA:D3T652"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D3T652"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADD01583.1"
FT                   /translation="MIIITLNERCTQILVKLINSNAPIKISDLAKIFNVSSRTIRYDLD
FT                   TIDEFLKYNNLPQLMRKPNVGVKFSELLEQRNKVLSLLDNLNIYYYNLSQKERVNIILS
FT                   ELIQQKDYITINSIADKLMVSRSTIIKDLKDVREWLTRHGLQLKSVPKYGIKVVGDEKQ
FT                   LRRAAIELLTEVIDVNKALDIVKSPIYTRSSVGIDKQITKLFEDIDIPYIEECIQIAER
FT                   ELETVFSDAAFSGLVIHIAIAIKRIQLGKDIIMPKEELKALEITKEFAVASNIAKMLED
FT                   HFKVSIPHDEIGYITVHLLGSNVTKTRPYANENWVEYQLLTEKIIRNVSSKINQDLSGD
FT                   RQLFEGLLDHLRPTVYRLRHGLKLKNPILDEIKANYRKLFEIVKESLKPLEDYTGKELN
FT                   DEEIGYFTIHFGAAIEKLNIAKAPKLNILVVCGTGIGTAKLLSSRLQSVFDVNIVDTVA
FT                   YHQVKEILKEKDIDLIVSTVPIPYEGIKAIEVNPLLTEKDIELLKSLIIKPKVQHTVID
FT                   DLIKIIEKHCVINNREKLMEDLSKFLNKASYENARGVVQPVLKDLLTKETIKLNVEAKD
FT                   WEEAVRIGGELLEKSGAIEPRYIDAMINTVKEIGPYIVIAPGIAMPHARPEAGAKKIGM
FT                   SLITLKNPVNFGNKENDPVKIVVCLCAIDHSSHLKALSELVELLGDERFISTLLNSSSQ
FT                   DEIFNYIRSNKEGGEELD"
FT   gene            297908..298144
FT                   /pseudo
FT                   /locus_tag="Thit_0260"
FT                   /product="hypothetical protein"
FT   gene            298167..299186
FT                   /locus_tag="Thit_0261"
FT   CDS_pept        298167..299186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0261"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: bcl:ABC3502 6-phosphofructokinase; PFAM:
FT                   phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01584"
FT                   /db_xref="GOA:D3T653"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D3T653"
FT                   /inference="protein motif:PRIAM:2.7.1.11"
FT                   /protein_id="ADD01584.1"
FT                   /translation="MKPIKRIAVIVSGGDAPGINSVLFGMISKNNDIEIYGFNGGYDGI
FT                   LNSEPIYFKDINLRQANVSGNSILQTSRSAAPRTKEGRAKIIKRLKSLGIDTLIVCGGD
FT                   GSLKAAELLTEEGMPCLGIPLTIDNDIYGTEFTIGYNTAVKRVVDVLYNLHQTAHNMPG
FT                   RIFMVEVFGGKSGHIALAGALAGGADIVIIPEMTRRPEDIASRIKEILKSKNDYVIIVC
FT                   SESVYDTRDYIPGDQGISMEIGKKIEELIGMRVRHSVLGYFQRGGDPDPADSLLALQMG
FT                   SFAIESIKNGKSGYMVGWNHHRCVLVPLSKVVSNRKELDNNLLKIALEKEMIIGNEIM"
FT   gene            299415..299705
FT                   /locus_tag="Thit_0262"
FT   CDS_pept        299415..299705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0262"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: bcl:ABC3503
FT                   PTS system, mannitol-specific enzyme II, B component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01585"
FT                   /db_xref="GOA:D3T654"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D3T654"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADD01585.1"
FT                   /translation="MLKILVVCGAGLGSSFVCQMSVESVLKELNVTAILDHADITSVAG
FT                   SGADIIICAKNFEQQVRRYDTSATIISLNGLVDKKEIKEKLVPVLKEKCEL"
FT   sig_peptide     299415..299474
FT                   /locus_tag="Thit_0262"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.812) with cleavage site probability 0.393 at
FT                   residue 20"
FT   gene            299724..301004
FT                   /locus_tag="Thit_0263"
FT   CDS_pept        299724..301004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0263"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   KEGG: lrl:LC705_00388 PTS system, ascorbate-specific IIC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01586"
FT                   /db_xref="GOA:D3T655"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="UniProtKB/TrEMBL:D3T655"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ADD01586.1"
FT                   /translation="MVIVNFIIKNILTQAPITIALISLIGLILQRKQVGEVISGTFKTL
FT                   LGFLVLSAGSGIIVESLTYFGKIFTKGFRMQGIVPSIEAINGQAMNNLHLGNEIALTFL
FT                   AIFAVNIIIARLTKWKYIFLTGQAILWMATMTTVFGRFAGLSGVPLVIVGGIVGGIFAV
FT                   AMPAIAQPIVRKITGSDDIALGHFCTIGYMFTAGVSKLVGDKTKSTEDIKLPKGFEFLQ
FT                   DTYLSVGLVMIPLYTIAALFAGAKFGSQLSGNVNYVVYAFLQAVQFIVGVYVLLAGVRL
FT                   LLAEIVPAFRGIALKVVPDAKPALDCPVLFPYAPNAVTIGFVGTTIGSVIAMFVLPMFG
FT                   LAMILPGMLTNFFAGGTAGVFANAVGGRRGAIIATIAHGFFITLLPALLVISFNKMGFI
FT                   NTTATDVDTVAAALLYAWIITPILKAF"
FT   gene            301740..302132
FT                   /locus_tag="Thit_0264"
FT   CDS_pept        301740..302132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lrl:LC705_00389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01587"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D3T656"
FT                   /inference="similar to AA sequence:KEGG:LC705_00389"
FT                   /protein_id="ADD01587.1"
FT                   /translation="MFFKKNKMKETSSTLKRENTGKLDKNELIEEAKNLTNTIDSVSGE
FT                   ERSKVLNRIGSLYFEADKIDDAIKYYEISISESKSLGKAYTELLKLYNIKRKEAINKKD
FT                   DESLKHYMDKIDSLLQLSKDVIRGRS"
FT   gene            302466..303517
FT                   /pseudo
FT                   /locus_tag="Thit_0265"
FT                   /product="hypothetical protein"
FT   gene            304274..305125
FT                   /locus_tag="Thit_0266"
FT   CDS_pept        304274..305125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0266"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /note="TIGRFAM: ketose-bisphosphate aldolase; KEGG:
FT                   bcl:ABC3505 fructose-bisphosphate aldolase; PFAM:
FT                   ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01588"
FT                   /db_xref="GOA:D3T657"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T657"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ADD01588.1"
FT                   /translation="MYVTLKEILKNTRRDKFAVGAFNIHCLEMVPSMIEAAKAKNSPII
FT                   LQVSPTTCKYIGASLLSAVVKELAKETDINVTLHLDHAKDFNTIKEAVDNGFSSVMIDA
FT                   SALPLEENIKKTKEVVKYAAQHGVSVEAELGTIGGTEEGVALNNGKIKYTRPQDAVKFI
FT                   EATGIDALAIAIGTSHGQYKSKAKLRFDILKDIYNVTNIPLVLHGGTGVSEEDLKKCIS
FT                   AGISKVNIGTELNIAWVTAAKESFGKAKVNDSCRDLLIPANYAVQKVIEHKIDVLGSSN
FT                   RK"
FT   gene            complement(305071..306605)
FT                   /pseudo
FT                   /locus_tag="Thit_0267"
FT                   /product="hypothetical protein"
FT   gene            306854..307513
FT                   /locus_tag="Thit_0268"
FT   CDS_pept        306854..307513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: drm:Dred_1825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01589"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6H6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01589.1"
FT                   /translation="MIKKLVSLLLVVLFLTVLSFSLAFADDLNNVKDMTMKSKLELLQK
FT                   KYNIVLSDVKVLPPGIEPQKFSSVEEFEKYLMERQVNNKNFINLKEVRNEPNEQINNNN
FT                   IVSTLDSSGKLIHRKHVHFSAWLNILVKFDYVYNNYYQRNQFTSCNSVDSWYDGYSVPT
FT                   GYEWEQKDYSAQILDGGRTLAVTITGVEKQYILIENVLQIMSSTVNYYDEFYYNEI"
FT   sig_peptide     306854..306931
FT                   /locus_tag="Thit_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            307855..308049
FT                   /locus_tag="Thit_0269"
FT   CDS_pept        307855..308049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hhe:HH1413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01590"
FT                   /db_xref="GOA:D3T6H7"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6H7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01590.1"
FT                   /translation="MELKKRLLKIVGIIFTIIGLFSIIIIIKSIVSMDMKSFANIANIL
FT                   DIFVSLLFLYIGYIILRYS"
FT   gene            308414..310733
FT                   /pseudo
FT                   /locus_tag="Thit_0270"
FT                   /product="hypothetical protein"
FT   gene            complement(309077..309906)
FT                   /pseudo
FT                   /locus_tag="Thit_0271"
FT                   /product="hypothetical protein"
FT   gene            311072..312241
FT                   /locus_tag="Thit_0272"
FT   CDS_pept        311072..312241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0272"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   tex:Teth514_0241 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01591"
FT                   /db_xref="GOA:D3T6H8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6H8"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ADD01591.1"
FT                   /translation="MENFVFSSPTKIIFGKGTEHQVGEEVKNYSSKVLLCYGGGSIKKT
FT                   GLYDKVVDSLKEAGIEFIELSGVKPNPRLGLVQEGIKLCRENNLNFILAVGGGSVIDTA
FT                   KAIAMGVPYDGNVWDFFIGRAKLERALPVGVILTIPATGSEASDATVITNENGWYKRGF
FT                   HHDLIRPKFAIMNPELTYTLPNYQTACGVADIMAHVMERYFTNVKNVDLTDRLCEATLK
FT                   TVINNVRIVLKDPTNYNARAEIMWAGTIAHNDLLSTGRIGDWASHKIEHELSAIYDIAH
FT                   GAGLAIVFPAWMKYVYKHNINRFVQFAVRVWDVDLPYENLEDIALEGIKRMTEFFKEIG
FT                   LPVTLKEAGISDDRFEEMANKCTDNGNKKIGNFVKLGKEDVINIYKLAK"
FT   gene            312409..314934
FT                   /locus_tag="Thit_0273"
FT   CDS_pept        312409..314934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0273"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="KEGG: tte:TTE0314 membrane carboxypeptidase
FT                   (penicillin-binding protein); TIGRFAM: penicillin-binding
FT                   protein, 1A family; PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01592"
FT                   /db_xref="GOA:D3T6H9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6H9"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ADD01592.1"
FT                   /translation="MNNNANLKRSERKKHKVKGKNKSTAVVILKFIIYAVIILIFAGIG
FT                   AIGGKVLAIIKNTPPISQEALTAQRQSSIVYAKDSNGQWQRVAILHGADNRLWVPIEKI
FT                   PKDLQNAFVAIEDQRFYKNNLGIDPKRIIGALIADIKAGGKPVQGASTITQQLVKNTML
FT                   SSEKTLTRKIQEAILAWQLEQKYSKQQILEAYLNTIYLGGPDVNAYGVQAAALAYFGKD
FT                   VSQLSLAECAMIAGITNNPSLYSPYANLEAATKRQHLVLQKMLEQGYITKEQYDEAIAE
FT                   KLEFKKTDFTTYDHKYFIDQVINDVAEELSKKLSISHDEAINKIYNGGLRIYSTMDLKI
FT                   QSYIEEAFKNPELFPVNSKIKEEVQGAMVVMDWKTGEVKGIVGGRDSSNIVRGFNRATQ
FT                   AYRQPGSSIKPLTVYGPALESGLTAATVVDDVPTSFGNWTPHNYESSTYRGLVTLREAL
FT                   TDSLNVPAVKVVDRIGIATSANYGKKFGLTITDNDMYLPALALGGLYKGITPLQEAAAY
FT                   GAIANGGVYTTPITFTKVTDSEGNLILENKPLRHVVLSEQSAYILTSMMQDVVKYGTGS
FT                   RAKLPNMPVAGKTGTTDKYTNAWFSGFTPYYVATVWMGYDNNSISLYDSRTARNVVGGT
FT                   YPAQLWKTVMLQIHKDLPYKDFVRPPGIISATVCKDSGELPTDLCHLDPRGGRAYTEIF
FT                   AQGTQPTTYCSVHVAVKINSQNGKLATDLTPPDLVKDAVFIDPPGRTPEQNAVARDGKY
FT                   VVPTEYDDTTSILPENNEPTNETVPPDNSQQPSSDNNNNNAQPPDEQLPNTPPNNNGNT
FT                   QTNPDNTQDTNSNSNILQKLFPNRGNGRP"
FT   gene            315153..316316
FT                   /locus_tag="Thit_0274"
FT   CDS_pept        315153..316316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0274"
FT                   /product="aminopeptidase-like protein"
FT                   /note="KEGG: tex:Teth514_0244 aminopeptidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01593"
FT                   /db_xref="GOA:D3T6I0"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I0"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0244"
FT                   /protein_id="ADD01593.1"
FT                   /translation="MKSIYYLKELTKFGHRGSATKNEKQAADYILNELKKMGYKVEIQT
FT                   FKTTRDNLYMLPLQVGVLLFICGLFSLMYGRPLEIAAFLLSLFAISLLLLEVSGKPIET
FT                   SIMPRHLSQNVFTTFDESRSKRIIVSAHYDTQRGSLMYHPKIVDKLSIIYNICYVGFGL
FT                   VPIGILLKALKLNVIAYISLYLGLFIVFVTVIFMAICEVTGRYTQGANDNGTGTALTLA
FT                   LANCYINNKDKFPDNVDVIFLFTGSEEAGERGMKNFIKKYGKKLPKDTQFIILDNLGSG
FT                   KITYLEGEGIVFYKRASELLFDVAEDMAKGHADKVQKMKNLLLPTDALPAMAAGFDAIA
FT                   FLAKDEKGRLGNYHWYTDTIENVDTELLDYEEEFFKEYLLKVAQRLN"
FT   gene            316644..317228
FT                   /locus_tag="Thit_0275"
FT   CDS_pept        316644..317228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0275"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tpd:Teth39_1964
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01594"
FT                   /db_xref="GOA:D3T6I1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADD01594.1"
FT                   /translation="MGDSVKEKIVMSTLKLISEKGYKSTTTKNIAEEAGVNEVTIFRCF
FT                   GSKKDIVLYALKELELLKPVNEKILDKCIWNLKEDLIMLAHEYHKNFTEEKAKIMMGLR
FT                   SPEIFEEVKEYLMKIPKGFKEVLIKYFEKMYEKGLLNTDNFELLAFAFMSLNFGFILMN
FT                   VSYGNKLIGFGDSEFVKKTIEIFVRGVEKSD"
FT   gene            317278..318276
FT                   /locus_tag="Thit_0276"
FT   CDS_pept        317278..318276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0276"
FT                   /product="Protein of unknown function DUF2229, CoA enzyme
FT                   activase"
FT                   /note="PFAM: Protein of unknown function DUF2229, CoA
FT                   enzyme activase; KEGG: tpd:Teth39_1963 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01595"
FT                   /db_xref="InterPro:IPR018709"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I2"
FT                   /inference="protein motif:PFAM:PF09989"
FT                   /protein_id="ADD01595.1"
FT                   /translation="MKIGIPKALMYYFYYPFWKTLFESLGFEVVTSGDTSKSVLDAGVK
FT                   EAVAEICVPMKVYTGHILNLLDKNVDYIYIPRFVSLRRGIFMCPKFMGLPDMIKGLFDG
FT                   IEDKILTHSIVAKSTDIAEFHNYTVFIDKLGVSRRDLKNALKKARSKWLEFRVLNKQGY
FT                   DLNELLTNEEPKKYDGDITIGLIGYVYNVYDRFVNMDLLNVFRKLNIKVVTFDMMEEKV
FT                   IQRQLKKFKKNMFWEFTNMLLGTAYEFMERDDIDGIVHITAFGCGPDSILEPFLIIDSE
FT                   KYKKPFMTLRIDEQTGESHIITRVEAFTDLIKLKKHKDSVIAEEKSKEGVI"
FT   gene            318277..319374
FT                   /locus_tag="Thit_0277"
FT   CDS_pept        318277..319374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01596"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I3"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0250"
FT                   /protein_id="ADD01596.1"
FT                   /translation="MKITFPYMGSPYIYEKLFSLLGHEVVTPPRPSQKTINYGVKYSPE
FT                   FACFPLKVILGTYLEAIELGADTIVTSGGNGPCRAGYYGEAQKKILKNMGYDIEFIIFD
FT                   EPKRDLKEFMDNVKKIKGNNSWGKVLKTVKTVYDMAKSMDKVEKIVEVKRAYECNKGEF
FT                   TKAWHEIAEEYRKIKTSEDVKVIEEKAIKRLNSIKTCEVPEEERIRIGIVGEIYVVMEP
FT                   SVNGNIEEVLNSYGAEVERSHYISEWIDFNLIPLPSYKEKEHEILKKAEKYIEIIIGGH
FT                   AKQSVGAIIDFMERGFDGVIHLKPFGCLPELISQSVIDKIMREYDYPILSLSVDEQMAI
FT                   ANVLTRIEAFLDVIKLKKHRKRIAR"
FT   gene            319381..320343
FT                   /locus_tag="Thit_0278"
FT   CDS_pept        319381..320343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0278"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="KEGG: tpd:Teth39_1960 putative
FT                   CoA-substrate-specific enzyme activase; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase; PFAM: ATPase
FT                   BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01597"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I4"
FT                   /inference="protein motif:TFAM:TIGR00241"
FT                   /protein_id="ADD01597.1"
FT                   /translation="MEKIYIGVDVGSVSINVVAIDENNEVLFKSYVRNVGQPIDTVKDE
FT                   LAKLHNELANKEIGGVGVTGSGRQLLGYVLGADVVKNEITAHATATLHFHPDVSTIFEI
FT                   GGQDSKLIIINDGTIADFAMNTVCAAGTGSFLDHQAQRLGIKIEEFGEIALTAKREVRI
FT                   AGRCTVFAESDMISKQQYGFSKAEILRGLSKALVRNYMNNLVRGRKLRPVFVFQGGVAA
FT                   NIAIKKAFEEEVGHEVIVPKYYNVMGAIGIAMLAKDEMKRTGNHTRFKGFGVSEEKFET
FT                   TSFICKACPNECEIIQIKANGKVIAMTGDRCGRWSNSVI"
FT   gene            complement(320566..321054)
FT                   /locus_tag="Thit_0279"
FT   CDS_pept        complement(320566..321054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1959 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01598"
FT                   /db_xref="GOA:D3T6I5"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1959"
FT                   /protein_id="ADD01598.1"
FT                   /translation="MNVKFLTRTAILLAITLIFQFLKMPQLITGSIVNAMLLIAAGTVG
FT                   MWSGVTIGLLTPIIASLVGIMGFPLMIPFIMIGNGLYVILFSTQKNKIIGMITGAIVKF
FT                   IWLALSVKYIMQLFSVKVPLKIVQAFTTPQLITALIGGILGIIVIALLENYFKKAKEQ"
FT   gene            321291..322016
FT                   /locus_tag="Thit_0280"
FT   CDS_pept        321291..322016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0280"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tex:Teth514_0253 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01599"
FT                   /db_xref="GOA:D3T6I6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01599.1"
FT                   /translation="MNKIEFKEVSYSSFGKEILKDISVKFEGGAIHTIVGPSGAGKSTL
FT                   IKLINRLIDPTYGSILIDDVDIKTIDVIDLRRRIGMVFQQPHLFEGTVKDNIEYGPMLK
FT                   GEKNVNVEYYLSIVGLNSEYATRDVKNLSGGEQQRVSIARTLANNPEALLLDEPTAALD
FT                   PTSTEIIEELIVKLKEEMNLTVIWITHNMEQAKRIGDYTALLNKGILIEYAKTYDFFTN
FT                   PQNEITKLFIQGKLKEEVK"
FT   gene            322013..322768
FT                   /locus_tag="Thit_0281"
FT   CDS_pept        322013..322768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   tex:Teth514_0254 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01600"
FT                   /db_xref="GOA:D3T6I7"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I7"
FT                   /inference="protein motif:PFAM:PF03649"
FT                   /protein_id="ADD01600.1"
FT                   /translation="MSVLSLTLASSLVLISIFVSYYQKLGIEKEIVIGTIRAVVQLTIV
FT                   GYILHYIFAANNALFTLAMVTLMIIVAGNNASKRGKGIPNVFYFITFSIALSAAITISL
FT                   LILFGNIHFRPQEVIPVSGMIIGNSMVASGLAVSRLKDEIKNKSEEIEAYLSLGATSRQ
FT                   AAQKVIKTAIKTGMIPTVDSMKTLGIVQLPGMMTGLILGGVDPIDAVKYQIMVTFMLAS
FT                   TVAISCFSVTFLTYREFFTSNHQLKEVGN"
FT   gene            complement(322810..324813)
FT                   /locus_tag="Thit_0282"
FT   CDS_pept        complement(322810..324813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0282"
FT                   /product="peptidase S9B dipeptidylpeptidase IV domain
FT                   protein"
FT                   /note="PFAM: peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; KEGG: tte:TTE0322 periplasmic component of the Tol
FT                   biopolymer transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01601"
FT                   /db_xref="GOA:D3T6I8"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I8"
FT                   /inference="protein motif:PFAM:PF00930"
FT                   /protein_id="ADD01601.1"
FT                   /translation="MKEKDIEKNLEKLKEHIPVNYQLKEKLKKEFKKNTKKSYKFIAIA
FT                   ASLLLSVGFALASFLSHNNYSPNYITSPSPFISKANAADLKIANQISFFDIGKGNTGRI
FT                   AEYNGTLYIAIPEKGLFEYNKNGFRQIVGEKSKNVPIGVGDVAVSPDGKKLLYSLNYQY
FT                   YIKDLSTDKTEKIRVTGNGLDIFYESPFFSPDGNKIIFTKNVYTPREGGHGFEKKATLW
FT                   EYDLKTSQLTEIAEGSYGSYVKNQNAIVFEKDNKIIYKDLKTGEEKTVDEGRFPSVSPD
FT                   GNYIAYVKSEIKNSTIDGVEVTEHISNVWVTDAVGFATKKQVTENFSKPNLKSLVESVK
FT                   EKNKNSPIKSDLVTGGEYGYYLPSWSNDSNSIYVLKNLNEDVRGNMMTLMKIDLSKEKL
FT                   SADYTVRRFLQALIARDDDFAKMLMKNPPSFLTISNPHPVGYNILGTGKEGEKTYVDAE
FT                   LYMGYWGDTYYSIEKQRYYVTPSENGYIIDSIKGLETLEFYDKNNTFYERINREKGKSL
FT                   FRETDIPKEYLPEGNFRFTASAFDAKTNTLYFTVLGLDNRQSKLLSYNLDTKTFKLVNS
FT                   IDNGAFAELKLDGNGNFLAANFFSDDGKQKVYLYNLKTGEKTDLETLFKDTKIDEIEAN
FT                   FWNQDKLMFKISTYGISLMYEYNPVKSQISIP"
FT   gene            complement(324817..325305)
FT                   /locus_tag="Thit_0283"
FT   CDS_pept        complement(324817..325305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0283"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: tte:TTE0323 DNA-directed RNA polymerase
FT                   specialized sigma subunits, sigma24 homologs; TIGRFAM: RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01602"
FT                   /db_xref="GOA:D3T6I9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6I9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADD01602.1"
FT                   /translation="MKDGFLSFYETFFDDVYRYVYFKVGNSWDADDIVSEIFKKAYENY
FT                   STIRTNPKSWLFSIARNTVTDFYRKKKEIVTNDELEKYYYPDIWEDKFNKEVELNCLKK
FT                   SIYSLPKNEIEIINLKYFSGMTHKEISQLIEKTEDAVKMKAHRIIQKLKNLVIKCLEG"
FT   gene            325776..328226
FT                   /locus_tag="Thit_0284"
FT   CDS_pept        325776..328226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0284"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="KEGG: tex:Teth514_0255 leucyl-tRNA synthetase;
FT                   TIGRFAM: leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01603"
FT                   /db_xref="GOA:D3T6J0"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J0"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ADD01603.1"
FT                   /translation="MAYSVDVDRKWQKRWEETKLYKFNPENVDKKLYCLEMFSYPSGAK
FT                   LHVGHWYNYGPTDSWARMKRMQGYEVFHPMGFDAFGLPAENYAIKTGIHPYDSTMENIR
FT                   TMEKQLREMGATFDWDYEVITCLPEYYKWTQWIFLKLFEAGLAYRKKAPVNWCPSCQTV
FT                   LANEQVIDGKCERCGTEVTKKDLTQWFFKITAYAEELLEKLDELDWPEKTKIMQRNWIG
FT                   KSDGAEIEFKVDGKGLTFKVFTTRADTLYGATYVVIAPEHEIVDLITTEEYKQAVEEYK
FT                   EYARKQSEIERLSTEKEKTGVFTGAYAIHPLTGEKLPIWIADYVLATYGTGCVMAVPAH
FT                   DERDYEFATKYNLPIKRVIKGIEDIDDSLPFVEYGVLKDSGEFTGMKSEEARIKIVEKL
FT                   KQEGRAEFKVNYRLRDWLVSRQRYWGAPIPVIHCERCGIVPVPEEDLPVLLPYDVEFAP
FT                   TGESPLKKHEGFMNVTCPKCGGKALRDPDTLDTFVDSSWYFLRYPDNKNDKEPFNKEWI
FT                   NKMLPVDKYVGGAEHATMHLLYARFVTKALRDLGYLDFDEPFKSLVHQGTILGPDGSRM
FT                   SKSKGNVISPDEYIKEYGSDVFRLYLMFGFAYSEGGPWNDDGIKAISRFVNRVERFIDK
FT                   FIETRNNPGKTKDEMGKDENELNYVRHYAIKGVTEDAERFQFNTAIARIMELVNALYKY
FT                   DTDVEVKNIEFYEDVVADLIRLLAPFAPHFSEEMWEKLGYEYSVFNQKWPKWDEKALQK
FT                   DVVEIAVQVNGKVRGRLEVPSNVPDEEVQRIALSDDKIKSYLDGKEIKKVIVVKGRLVN
FT                   IVVK"
FT   gene            328292..328993
FT                   /locus_tag="Thit_0285"
FT   CDS_pept        328292..328993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0285"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: tex:Teth514_0256
FT                   AzlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01604"
FT                   /db_xref="GOA:D3T6J1"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J1"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ADD01604.1"
FT                   /translation="MIVDSDVKKSINGIKSALPIVLGYLPIGFAYGLVGVKSGFTISQV
FT                   VALSLFVYAGSAQFIAISLLSAGTNIVTLVSTIFIVNLRHFLYSTSLSQYMKHISRKHI
FT                   PILSFFITDETYAVAITDLQSNSKYTESYFYQLFLTSYTAWVFASFLGAVSATLIGGSI
FT                   NIGLDFALPAMYIALLFMQISGYKKVFISVFSGLLSITLMFILPGNTNVIVAALIGAGM
FT                   GVLLDKWVRNL"
FT   gene            328975..329298
FT                   /locus_tag="Thit_0286"
FT   CDS_pept        328975..329298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0286"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   tpd:Teth39_1954 branched-chain amino acid transport"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01605"
FT                   /db_xref="GOA:D3T6J2"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J2"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ADD01605.1"
FT                   /translation="MGTKFIISVIGMFLVTYIPRFMPVYGLTKIELPQAVKSFLEYVPV
FT                   AVLSALLFPVIFIKDGKLFLDLSNIYLLSAIPTFIAAYFTRKLFTPVVVGIVSYVILSF
FT                   FIK"
FT   gene            329391..329720
FT                   /locus_tag="Thit_0287"
FT   CDS_pept        329391..329720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0287"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: tte:TTE0325 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01606"
FT                   /db_xref="GOA:D3T6J3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J3"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADD01606.1"
FT                   /translation="MNEAENIINEIKEKLIDTINPKAIILFGSTAKNDNDENSDIDLLI
FT                   IWDGAEDLNNVQRRIKLREIIGFVNKPLDILTCTSDELKQVIKDDRSFTATIIKEGKII
FT                   YGGFN"
FT   gene            329704..330096
FT                   /locus_tag="Thit_0288"
FT   CDS_pept        329704..330096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0288"
FT                   /product="HEPN domain protein"
FT                   /note="PFAM: HEPN domain protein; KEGG: gur:Gura_0237 HEPN
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01607"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J4"
FT                   /inference="protein motif:PFAM:PF05168"
FT                   /protein_id="ADD01607.1"
FT                   /translation="MADSTDYKKWLKRAEQDYKIAETIKKEGIEGLEDSFCYICHQAAE
FT                   KLLKAFLLYNSDFVPKTHDLVFLLGKCKTYDATLEKFFDKINILNEYAVSARYPIDFDT
FT                   LRTVEEAKEAFQIVSSLREEILRKLE"
FT   gene            330197..331300
FT                   /locus_tag="Thit_0289"
FT   CDS_pept        330197..331300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0289"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: PfkB domain protein; regulatory protein MarR;
FT                   KEGG: tpd:Teth39_1953 ribokinase-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01608"
FT                   /db_xref="GOA:D3T6J5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J5"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ADD01608.1"
FT                   /translation="MALTQREKEILRFIKKNPMISQEELAQLMGISRSAVAGHIANLMK
FT                   KGFILGRGYVVRDFKGITVIGGANIDIKGKPYSELKQHTSNPGHINIAPGGVGRNIAHN
FT                   LAQLSLPVTLLSVVGNDDEGRRLLEETRQAGVNVEQIVISNTRRTGIYLAILNAIGDMD
FT                   VALSGMDILEELNIQYLESKMEVIKNSEIVVFDTNIPKDSIKYIVELCYNNNIPVVAEP
FT                   VSIDKAKKLIGVLDKIDYVTPNKEELESISGVKIANDEDMKKAVKYLRQKGVKNVIVTL
FT                   GERGVYISSEEVEKFIEPYQAEIVDATGAGDALTAGLVYGIFNGYTLDVSAKLGLAAAS
FT                   LTISSPYTVNPFLNENQLKNIVKEIVK"
FT   gene            331297..332220
FT                   /locus_tag="Thit_0290"
FT   CDS_pept        331297..332220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0290"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   tpd:Teth39_1952 indigoidine synthase A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01609"
FT                   /db_xref="GOA:D3T6J6"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J6"
FT                   /inference="protein motif:PFAM:PF04227"
FT                   /protein_id="ADD01609.1"
FT                   /translation="MNKFIDLSKEVKEAMEERKPVVALESTIISHGMPYPENIETAKTL
FT                   ENIVREHGAIPATIAIINGRIKIGLSEEELEFMGTSKEILKASRRDLPVVLAKGLSAAT
FT                   TVSATMICANLAGIKVFVTGGIGGVHRGAEQTFDISADLQELANTDVAVVCAGAKAILD
FT                   LPRTLEYLETFGVPVVGFKTWEFPAFYTRESGLKVDYKVDDEIEAAKIIKTKWDLGLKG
FT                   GVLIANPIPEEYALDKAYIDKAIEDALYEAEKRNIKGKEITPFLLDKIKDLTQGKSLKA
FT                   NIELVKNNAHVGAKIAIELNKLYKEA"
FT   gene            complement(332236..332493)
FT                   /locus_tag="Thit_0291"
FT   CDS_pept        complement(332236..332493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0291"
FT                   /product="small, acid-soluble spore protein tlp"
FT                   /note="TIGRFAM: small, acid-soluble spore protein tlp;
FT                   KEGG: tpd:Teth39_1951 small acid-soluble spore protein Tlp"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01610"
FT                   /db_xref="InterPro:IPR017524"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J7"
FT                   /inference="protein motif:TFAM:TIGR03090"
FT                   /protein_id="ADD01610.1"
FT                   /translation="MAKENDKYTKLPKPDDRSDNVEKLQQMIHDTIENYREAEDYLKLH
FT                   AEELSPEEIERIKQKNKNRLTSIQNMREEIIDEVHDNDRK"
FT   gene            332701..332898
FT                   /pseudo
FT                   /locus_tag="Thit_0292"
FT                   /product="hypothetical protein"
FT   gene            333055..335760
FT                   /locus_tag="Thit_0293"
FT   CDS_pept        333055..335760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0293"
FT                   /product="PTS system transcriptional activator"
FT                   /note="KEGG: tpd:Teth39_1949 PTS system transcriptional
FT                   activator; PFAM: sigma-54 factor interaction
FT                   domain-containing protein; PRD domain protein; PTS system
FT                   fructose subfamily IIA component; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01611"
FT                   /db_xref="GOA:D3T6J8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J8"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADD01611.1"
FT                   /translation="MKRIDKVYNCVKELCSKQFAERGEIIGVSAMEIAHALNIQRTNAS
FT                   SDLNTLFREGKVIKVEGKPVLYKVKELDMISDESDMVVKDVFDSIIGANLSLKNAVQQA
FT                   KAAIIYPPNGLHTLLLGETGTGKSMFAEVMYSFAKEIGRIKRNAPFVTFNCADYANNPQ
FT                   LLMSQLFGVKKGAYTGADKDRMGLVEKADGGILFLDEVHRLPPEGQEMLFYLIDKGLYR
FT                   RLGESETQHKANVLIVCATTENIESTLLRTFIRRIPMVIKLPALAERTYEERFELIKNF
FT                   FREEAAIINTDIMITSNALKALLLYECPNNIGQLKSDIKLSIAKAYLGYMMKRDKGVCV
FT                   HTEDLPEYVRRGLFRYKESKDEIDKFITGDIIKFSADNATPVIQQNNQIFNFYEALEEK
FT                   RKALEQKGLNESDIRLIMSIDIETYLKKYLLNLDKNNLEELYKVVDKKIVDIVNDFLNY
FT                   ASKKLKRSFSEKTLYGLSMHVASSVERILSGKDIVNHQLENIKKVYEKEFEVANALRER
FT                   VQKEFNIKVPDDEVGFVTMFLCLDEETKEKDERVGIIVAMHGEAAATSIAEVSNRLLGD
FT                   NYVIGYNMPLDQKPEIALNNLTNIVKRVDKGRGVLLLVDMGSLVLFGDMIYERTGIPVK
FT                   TIEMVSTPMVLEAARKAILNASLDEVYDAVVNFSPYVGRIYKDSVKFEDSLKKNVIITA
FT                   CITGEGTAVKLKSILEKNLDLKEKDIDVIPIEIESKKEFRRKLLNIKEEKNILAVVSAI
FT                   NPEDDSVLYISTSDVFDNDKLSVLRNKIEALSQIEIIDNMKDVIKENIKIDSEKYISSF
FT                   KKFYAALIREGVNLNEDITIGLILHLACVIERILQGKQLIHMKDTQEYIKNYPKEFDII
FT                   KKAIRIIEEGCNVKISDEECVSMMKIIYSL"
FT   gene            335991..336311
FT                   /locus_tag="Thit_0294"
FT   CDS_pept        335991..336311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0294"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   tau:Tola_2992 phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01612"
FT                   /db_xref="GOA:D3T6J9"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6J9"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADD01612.1"
FT                   /translation="MKILLVCAAGMSTSLLVEKMKKAVKPEYGEVIINAVPIDQFEEVV
FT                   KDYDVVLLGPQIRYKQKDFEKITNELGIPMEVINIADYGMVRGDKVLELALKLVKDKKK
FT                   EN"
FT   gene            336348..337673
FT                   /locus_tag="Thit_0295"
FT   CDS_pept        336348..337673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0295"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="TIGRFAM: PTS system, lactose/cellobiose family IIC
FT                   subunit; KEGG: vha:VIBHAR_03624 PTS system,
FT                   cellobiose-specific IIC component; PFAM: phosphotransferase
FT                   system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01613"
FT                   /db_xref="GOA:D3T6K0"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K0"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ADD01613.1"
FT                   /translation="MTFYDRLNSVLERYLLPIAGVISNQRHLKAMRDGLIYAIPFTILG
FT                   GLSLILAFPPIGENVEATNVFLKFMVAWRDWASANMSAILLPYNLTMGFMALFVAVGVA
FT                   YSLARHYKMDALSASTISAAVFLMVAAPLQDGKLAVNFMDAKGVFTAIIIGLLTVEVTR
FT                   FLKSKNITIRMPEGVPPAVSSSFDALIPLGVNVILFYSISLIIQKICGMIIPQAILTTL
FT                   APAVKAVDSLPVIFIFSTLAQLFWFAGIHGAALVGAVLDPFKYANVAANAEAYLAGQPL
FT                   PHIFTDTFWAYYIVLGGSGATLGLTLLYLRSKSKQLNGIGKVALLPAIFNINEPIIFGT
FT                   PMVLNPIMFIPFVFVQGINSVVAYLVIKLGLVRASFASVPWTTPAPIGAFLATLDWKAV
FT                   VLVFALLVLDTVLYYPFFKIYEKQLIKEESGKEDIEAELETN"
FT   gene            337853..338185
FT                   /locus_tag="Thit_0296"
FT   CDS_pept        337853..338185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0296"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG: tte:TTE0336
FT                   phosphotransferase system cellobiose-specific component
FT                   IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01614"
FT                   /db_xref="GOA:D3T6K1"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K1"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ADD01614.1"
FT                   /translation="MDLEQIVFTIISHAGNARSNSFEALKYAREGNFEEAKKCLDKASE
FT                   ELLEAHHVQTDMIHKEAQGEKQEVTLLLVHAEDHLMNAILAKELITEMIDLYKLIYQTK
FT                   GAAFDV"
FT   gene            338178..339488
FT                   /locus_tag="Thit_0297"
FT   CDS_pept        338178..339488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0297"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG:
FT                   tex:Teth514_0266 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01615"
FT                   /db_xref="GOA:D3T6K2"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K2"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ADD01615.1"
FT                   /translation="MFKKDLKIAVIGGGSSYTPELIEGFIKRYNELPVKDLYLVDIEEG
FT                   KEKLEIVGGLAKRMVEKAGVGINIHLTLDRREAIKDADFVVTQFRVGRIDARIRDEKIP
FT                   LKYDVIGQETTGPGGFAKAQRTIPVILDVCKDIEELAPNAWLINFTNPSGVITETVLKH
FT                   TNVKAIGLCNVPIGMVYGVAEMLEVNPKRVYIDFAGLNHLVWGTHIYLDGEDITEKLID
FT                   SFAGGKSLSMKNIPELPWDPDFIKSLGMYPCPYHRYYYLTDKMLEKQKEEAATVGTRGE
FT                   VVKKLEQELFELYKDPNLNIKPPQLEKRGGAHYSDAACSLISSIYNDKKDIHVVNVRNN
FT                   GTIADLPDDVVIETNAIIDRNGAHPINIGHVPAKIRGLMQAVKAYEELTIEAGVKGDYY
FT                   TALQALTLHPLVPSATIAKKILDDIIEQNNEFLPQYK"
FT   gene            339540..340349
FT                   /locus_tag="Thit_0298"
FT   CDS_pept        339540..340349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0298"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: cac:CA_P0070 HAD phosphatase superfamily
FT                   protein; TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01616"
FT                   /db_xref="GOA:D3T6K3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K3"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADD01616.1"
FT                   /translation="MRYKMIVLDVDGTLINDEKIITPKTKDALIAVQRQGVIVVLASGR
FT                   PAPGLKRESDALELEKYHGLLLSYNGGKVIDVTTKKVIYQKSIPRETATRLLKHLETFP
FT                   VTPIVDDGTYIYTTDEDGYQIRYESQNNNLKIKIVNNLADDINFCPIKILIAAPNEVLL
FT                   SASKKIMAPFENELSFTLSAPFYLEATMKGVSKASSLRIICNILNIKPEEVMAFGDAQN
FT                   DILMIEFAGLGVAMGNACEELKAIADEVTLSNNEDGIAHTLKKYYEI"
FT   gene            340605..342014
FT                   /locus_tag="Thit_0299"
FT   CDS_pept        340605..342014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0299"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   gyc:GYMC61_3481 glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01617"
FT                   /db_xref="GOA:D3T6K4"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K4"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ADD01617.1"
FT                   /translation="MVHQNMKPFPKDFLWGASTSAYQVEGAWNEDGKGPSVIDMKKHPE
FT                   GTSDFKVASDHYHRYKEDIALFAEMGLKAYRFSIAWTRIYPNGTGEINQKGIDFYNNLI
FT                   NELLSYNIEPIVTMYHFDLPYALQQKGGWSNRETIDAFENYARTLFKYFGDRVKYWLTI
FT                   NEQNMMILHGSAIGTLDPNMKNPQKELYQQNHHMFLAQAKAINLCHEMCPNAKIGPAPN
FT                   IAYVYPASSKPEDILAAQNFSSIRNWLYLDMPVFGRYNSVAWSYMEEKGCTPTIQEGDM
FT                   EILESAKPDFIAFNYYATSTVAESKNNTSDKNPIGDQQITIGEPGFYRGVANPYLEKTQ
FT                   FGWEIDPIGFRITLCELNDRYNLPLLVTENGLGAYDKLEEGDVVNDDYRIEFLRKHIEQ
FT                   ARLAISDGVNLIGYCPWSAIDLVSTHQGFSKRYGFIYVNRDEFDLKDLRRIKKKSFYWY
FT                   KNVIATNGERL"
FT   gene            342468..343415
FT                   /locus_tag="Thit_0300"
FT   CDS_pept        342468..343415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0300"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: tpd:Teth39_1877
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01618"
FT                   /db_xref="GOA:D3T6K5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K5"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADD01618.1"
FT                   /translation="MQTFLSSVQGVLTIVFMLALGYYLAKVGWFDRTISDLFAKLVVNI
FT                   SLPLSMIVNITSTFSKKQLERSGRGLLISFLSILISYLIAYILAEIFKVKRERKGVFTA
FT                   IFSLSNSIFVGLPMSQALFGEVATPYTLLYYMANTTIWWTLGVYGISCDTNGKGQKIFT
FT                   SDMLKKIFNPSLLGFIIGVIFVFGNIRLPTFIFDSFKMIGGLTTPLSIFYVGITIYEMS
FT                   FDKFKLDKDALMVFIGRFLVTPALVWILDLFIPIPKLMRDVFIIMSAMPVMVNSAIIAR
FT                   VYGADYEFATSMITYTTILSVIIMPFLMVLIKIV"
FT   gene            343524..343763
FT                   /pseudo
FT                   /locus_tag="Thit_0301"
FT                   /product="hypothetical protein"
FT   gene            343917..345362
FT                   /locus_tag="Thit_0302"
FT   CDS_pept        343917..345362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0302"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="KEGG: tpd:Teth39_1942 PTS system, mannitol-specific
FT                   IIC subunit; TIGRFAM: PTS system, mannitol-specific IIC
FT                   subunit; PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; phosphotransferase
FT                   system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01619"
FT                   /db_xref="GOA:D3T6K6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K6"
FT                   /inference="protein motif:TFAM:TIGR00851"
FT                   /protein_id="ADD01619.1"
FT                   /translation="MQNTNALITGGGSVKAKLQRLGGFLAGMVIPNIGAFIAWGLITAF
FT                   FIPTGWIPNEHLAKLVGPMITYLLPILIGYTGGRLVYDVRGGVVGAIATAGIIIGSSIP
FT                   MFLGAMLMGPLGGYVIKKFDELVEGKIPAGFEMLVNNFSAGILGGLLAILAFLFIEPVV
FT                   NGISVGLGAAAQWVTNKGLLPLIAIFIEPGKILFLNNAINHGILAPLGVAEVKEFGKSI
FT                   FFLLETNPGPGLGVLLAYWLFGKGDAKQSAPGAIIIHFFGGIHEIYFPYVLMNPSLLLA
FT                   VIGGGMAADATFVLTKAGLVATPSPGSIFAEIAMSPKGGLLPVLAGITVGAVVSFLIAS
FT                   VIVKRASEESMSAESMTFARSVVSGLKAQSKGQKVEEIKPNAQKIEGMPKMIVFACDAG
FT                   MGSSAMGETILKKKLKEAGLDIAVKHSAVNQIPKEADVVFTQENLAERASQVVPNAKIV
FT                   TVKNFLDNTVYDEFVKSLVKNQK"
FT   gene            345366..347420
FT                   /locus_tag="Thit_0303"
FT   CDS_pept        345366..347420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0303"
FT                   /product="PTS modulated transcriptional regulator, MtlR
FT                   family"
FT                   /note="PFAM: PRD domain protein; Helix-turn-helix type 11
FT                   domain protein; phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   tex:Teth514_0269 transcriptional antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01620"
FT                   /db_xref="GOA:D3T6K7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K7"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ADD01620.1"
FT                   /translation="MVKIMDELTVRQKFILKTLLEKGPFNIKDLSKLMDVSERTIMREI
FT                   ASINNNLKKYKAVIIEDNGQIILKGEEEALNKIHASLGAIPLQWLLTPEQRQILMTIQL
FT                   LLSEEPIKAAYFSYQFNVVEGTISLYLDKIEEWLKMRNLSLIRRRGYGIKVEGSELDKR
FT                   NAIVELFYNYKPIEELLAFVYNDEKDKYVYTFFSTVFDNELVQLVKRIAQQIKNVIHDH
FT                   LSDLNYFGMFIHLLVSIYRTKIDKPIQLNDEFVKDILLSKEFIFMKDVEKILKENEVYL
FT                   PDAELAYLAIHLSPKKYVYKQNRFEELGISLQDLSKEVVEEVSRLLNININCDEQLIVG
FT                   LSQHFEPALYRLTMGLQTTNPLVEEIKNYYGDLFKAVNRACKLIFSKYNLMIPEEEIGY
FT                   ITMHIGAAIERQQALSKKLRVFVICPNGMGTARILSAKLKALFREIDTIDIGSIWEYKK
FT                   KGDDYDLIISTVKLEDLKDNVIVVSPFLTEEDIKKIKEFIEKYVVKKEKESPRNLPMVE
FT                   RRRNFEIADEILRNLQLKYVEAKTIADLIKFIAKDLYDLMLTEDAKEIEELIFKREAMG
FT                   NVVIPNTHIALIHTRSDKMVMPFVGVYKLKTPLKMKSAGFSYEEVDTFLVMLARKTESS
FT                   EILEMLGKISISLIEDKAFNEILRFGDIKDIRNSLVKILNDTQEALEDE"
FT   gene            347413..347853
FT                   /locus_tag="Thit_0304"
FT   CDS_pept        347413..347853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0304"
FT                   /product="phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: tpd:Teth39_1940
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01621"
FT                   /db_xref="GOA:D3T6K8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K8"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADD01621.1"
FT                   /translation="MNKEILNENNIVLNVPSESKIQAIERVGNLLFKNGYVEKEYIEGM
FT                   KKREEDVTTYIGNGIAIPHGVSEYVKYIKKSGIVIAQYPEGVDFGDGNIAYIVIGIAGK
FT                   GEEHLEILSKIALTCQYEENVEKLKKARTKQEIIEILQKGDE"
FT   gene            347855..349021
FT                   /locus_tag="Thit_0305"
FT   CDS_pept        347855..349021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0305"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: tex:Teth514_0271
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01622"
FT                   /db_xref="GOA:D3T6K9"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6K9"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ADD01622.1"
FT                   /translation="MLKAVHFGAGNIGRGFIGYLLYKSGYEITFVDISKELVESINTYK
FT                   RYNVIILKDNVEKEEVKNIKAIHIEDEKKLSKAIVDADIITTSVGANNLKGIGEKLINY
FT                   IKIRKANIDKPLNIMACENALFATNILKNSILEKGDKDFIDYVNQKIGFPNTAVDRIVP
FT                   NVDIKKELPIDVAVEDFYEWDIEKKAIIGDLNIKGAELVDDLEPYIERKLFLLNGAHAT
FT                   TAYLGYLKGYKYIHEAIEDDFIRNIVSGMQEEASLALSKKHNIKKDVLSQYASKVIKRF
FT                   KNSYLKDEVVRVGREPTRKLAGNDRLIMPAKFCYEIGVMPKFILYGIAAGFLFDYKEDP
FT                   KACEIQDDIRNLGLEKTISKVTGLEENSGLLQEIVKKYKELKEAFGKR"
FT   gene            349687..353355
FT                   /locus_tag="Thit_0306"
FT   CDS_pept        349687..353355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0306"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="KEGG: tpd:Teth39_1938 5'-nucleotidase,
FT                   2',3'-cyclic-nucleotide 2'-phosphodiesterase; PFAM:
FT                   5'-Nucleotidase domain protein; SH3 type 3 domain protein;
FT                   metallophosphoesterase; SMART: SH3 domain protein; Capsule
FT                   synthesis protein, CapA"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01623"
FT                   /db_xref="GOA:D3T6L0"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L0"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ADD01623.1"
FT                   /translation="MFRSRSRILAILVAAIMVLSMFFSAIPQIAFAATSKTFDFIEVTD
FT                   FHGYLQNDGKLSDGTTYKQQIAGVLAKQIKDIKAQNPDRTVILSGGDMFQGTPLSNVLK
FT                   GQPVIDMMKKIGFDAVTLGNHEYDWGIDSVIDTQNATLKNSTIPVLAANVYDKTTGKPV
FT                   SYTKPYVIIERDGVKIGIIGIVDNKEFPNIIMPAYIQNVDFRDPVPIVNDLAKQLRQQG
FT                   AQIVVVLAHMGAYQDKSGNATGNLIDFAKQVKGVDAIFGGHTHTIVTTKVNGIPVGVAA
FT                   NYGKGFINLKITLNDDGTVTTGDMQYIDITGLYSTQNPIVDPEVQAIVDKASKDVGPIF
FT                   NEVIGQAAIDLTRTQSAEPYGDSLLGNWAAQVTKDAVGADFGFANNGGLRIDIPKGDIT
FT                   VGMMYQLMPFDNTIVTMKMTGAQIKTILEQAVQDGGKGIQVAGLSFKYDPTRPSMHRVF
FT                   DMKKSDGTLIVMDKTYLVATNNFMGTGGDGFKGFTDPDVAKTYVDTYKLVRDAFIDAVK
FT                   AQKVVTSKIDNRIAPGTNNSILVTVLATSDMHGNIFPWDYNTAKPANRGLAKVATYVKQ
FT                   VREQYPYVALVDNGDSIQGTPLSYYYDKIDITTEYPLAKVMGAMKYDTWTLGNHEYNYG
FT                   LDVLNRVIKDMRSEGIHVLSANTYKDDGTNFVDPYYIKTFDTPQGTVKVGILGLTTKTI
FT                   PSWEDKDHYAGLHFNDLVEEANKWVPKLREAGADIVVVTMHSGEEKPTDTIPENQVIAV
FT                   ATQVNGIDAIVAGHTHANIPQHTYTNPAGNTVIITQPGKWGEYVSQIYFDIVKNAEGKW
FT                   VVGDKWSTTVKMDDSIQADPDIIKLAQPYQDATLKYIGTKIGIAAGDFLGTEQTVKETA
FT                   IMDLINKVQKYYAKTDLSIAAPLSSSAKILKGDITIQDIMGVYVYENYLYGIKMTGKQL
FT                   KDWMEWSARYYKQVSSPNDPITKDPTLNIPDYNLDQLYGASYVIDLTQPAGHRIKNLKV
FT                   NGKLVKDDDVFTVAINNYRFNGGGGFMQAAGITNPEIVFDSAKAYGDDGQVRNLMIKYI
FT                   QEHGTITPTIENYWYVSTTPVAEETPVPQPQPTPQPQPLPQPVYNYGIVTASALNVRAG
FT                   ASTSSKIIGVLPAGKVVTLLEEVNSWYKIDYNGKTGYIYGKYVAATPNPSNVTVLKAVK
FT                   VTAKSGLNVRVGNSINAKNIGAVPYGTELKVVGEYNGWYQIQYNGGFGYVYSKYTK"
FT   sig_peptide     349687..349785
FT                   /locus_tag="Thit_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.950 at
FT                   residue 33"
FT   gene            353501..354466
FT                   /locus_tag="Thit_0307"
FT   CDS_pept        353501..354466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0307"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="KEGG: tpd:Teth39_1937 nifR3 family TIM-barrel
FT                   protein; TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01624"
FT                   /db_xref="GOA:D3T6L1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L1"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ADD01624.1"
FT                   /translation="MKIGNVILKNNVFLSPMAGVTDKPFRLICQEMGCGLAYTEMVSAK
FT                   GLYYGSENTKMLTDIGEEEKVALQIFGSDPDIMGEIARKLNDSKALILDINMGCPTPKI
FT                   VKNGDGAALMLKPELAEKVMEAVVKASNKPVTVKIRKGWDDNHVNAVEIAQIAEKAGVK
FT                   AVAVHGRTREQFYSGKADWSIIKKVKESVKIPVMGNGDIFTPQDAKRMFEETGCDAILI
FT                   GRGAQGNPWIFKRTLHYLENGELLPEPTIQEKIEVIIRHLEMMIEYKGERTGILEMRKH
FT                   IAWYLKGLYGSAKLREAVFKMEKYEQIKEFLLNIAKTYAN"
FT   gene            354745..355506
FT                   /locus_tag="Thit_0308"
FT   CDS_pept        354745..355506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0308"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   tex:Teth514_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01625"
FT                   /db_xref="GOA:D3T6L2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L2"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ADD01625.1"
FT                   /translation="MSIEYIVALCGIGFAAAFIDSIAGGGGIISLPGLLVLGVPPAFAL
FT                   GTNKFAASCASFTSSLTFIKYRVYDGDLLKYLVFGTLLGAILGVKTVLLLDSSQLRIII
FT                   IILMIFVAIYTLFVKNIGNENKVKGVNKKTIAIGLIISIILGFYDGFFGPGTGSFYIFL
FT                   FLTLLNYDFKMSAGNGKILNFVSNITSLIMFALHGKILYSIAIPMALAMILGARLGTKL
FT                   AIKNGARLIRPILISVTLLYAVKMIFDVTNH"
FT   gene            355568..356314
FT                   /locus_tag="Thit_0309"
FT   CDS_pept        355568..356314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01626"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1935"
FT                   /protein_id="ADD01626.1"
FT                   /translation="MWEENRGKKYKGIDIIEFYQKEATKRKNTIPKKTFYNRFLKIEDC
FT                   IMISKPYEEKFEEKRYKISLYELLKNVYYEEAFGINISSKRKKEVYRNNISFENFTIGD
FT                   IVLATSPGFHIQGAIRHAAIFDSRRYHGSVDDECLLTAEPNKGVIYESIRFYHENFGEA
FT                   WGLYVPNTTLQQRISVVDELTKHLGERYYWSAHKNNSRTWYCSLVPWRGYYNITGIDID
FT                   YNGGYWVLPIDIFMSEYTEVFEYSRG"
FT   gene            356714..357799
FT                   /locus_tag="Thit_0310"
FT   CDS_pept        356714..357799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0310"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: tpd:Teth39_1934 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01627"
FT                   /db_xref="GOA:D3T6L4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L4"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADD01627.1"
FT                   /translation="MNSKDIARIAGVSRSTVSRVINNYPNVPPETKEKVLKVIREYNYV
FT                   PHASARMLRGKSSKTIGLVIVDLKKNSDIHKVYDNVYFGPFTTAVIDFANQLGYNVLVI
FT                   TVYKARDYKKVREVFYNKTINGAIFIGVKNDDPDIKNLIEAGLKTAVIDQEIREDEDDA
FT                   FNKSIIVNMDNVNGAYKATKYLINLGHTEIAHITGDMEKLSGFARLEGYKKALKEEGIP
FT                   FKSSLVVKGDFVEESGYKAAYRLFKKAKPTAIFASNDQMAIGAMQALEEMGYKVPEDVS
FT                   IIGFDDITISRYLKPALTTMSASLLQMAELAVENLIKSIEEEIAITAKFVVPVKLVERE
FT                   SCKRIEIQREKMNDEYALSMK"
FT   gene            357889..358095
FT                   /pseudo
FT                   /locus_tag="Thit_0311"
FT                   /product="hypothetical protein"
FT   gene            358177..358347
FT                   /locus_tag="Thit_0312"
FT   CDS_pept        358177..358347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0312"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01628"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01628.1"
FT                   /translation="MVIYVTLRCKILKNPSNNKHVFINLIQNQFYDSLKQEAERPFVLK
FT                   NSKKGGILGVK"
FT   gene            358398..360155
FT                   /locus_tag="Thit_0313"
FT   CDS_pept        358398..360155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0313"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   Entericidin EcnAB; KEGG: tpd:Teth39_1933 extracellular
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01629"
FT                   /db_xref="GOA:D3T6L6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L6"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADD01629.1"
FT                   /translation="MRRLLSLLLVLMLIMGALAGCGQKSQETSDKSNQQNANTQQIAQD
FT                   TTYQRNETVYFGGGLWSPPSNWNPLTPWNAVTGTVGLIYETLFNYDPLKNEFIPWLAEE
FT                   GEWTSDNTYQIALKDGLTWQDGKPLTSEDVKFTFEIAKQYSEIYYSPMWQWLQSIETPD
FT                   NKTVIFRFSTANYHEWAYNLYQIPIIPKHIWADKSKDDILNGANEKAIGSGPYLFDTYS
FT                   NDRMVYKRNDNWWGIKAMNMTPAPKRIVYLIVPSNNVALGMLMKGELDLSNFFLPGIKT
FT                   LKANYGITTFYDNPPYMIPDNTVFMFINTTKFPLNNVELRRAMAYAINPKVIAEKVYEN
FT                   QVEPANPLGFVPAKAWEEYYDKNVVDKYGYTYNPEKAKSILDAAGFKLGSDGVRTTPDG
FT                   KKFKLEISVPYGWTDWMEAAKIVADQLKAVGIDAEAKFPDYSKYYEDLTKGTFDLSFNN
FT                   FGSQVTSTPWTLYNWLFNKVQENGPQNNGNFGRFDVPGLQDLIAKFNQTKLGSPEAKQA
FT                   AAQLEEIFLKNMPAIPLWYNGLWFQASNAAWENWPTEHDPYAYPVTWGGRWQTGGTMML
FT                   MKIKPKASQ"
FT   sig_peptide     358398..358457
FT                   /locus_tag="Thit_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.951) with cleavage site probability 0.444 at
FT                   residue 20"
FT   gene            360173..361165
FT                   /locus_tag="Thit_0314"
FT   CDS_pept        360173..361165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0314"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_1932
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01630"
FT                   /db_xref="GOA:D3T6L7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01630.1"
FT                   /translation="MLRYLIKKLYIYILTFFFAVSIDWLIPRFMPGDPILVLVSRFSGL
FT                   PESARVMYGYLTKAFGLDLPLWKQYLNFWIAVFKGDLGVSIYMYPKPVLDVIAQAIPYT
FT                   LVVLLPSILLSWIVGNYIGAVAARHRSLDSRMLPIFYIITSIPYMWLGILLAWALGVVL
FT                   GIFPIAGAYSFSMRPNWSWRFVVDFLRHWILPFLSLFIVQIGGWAIGMRNLIIYELEAN
FT                   YSRYLEALGASERLIRRYAFKNAILPQITGLALQLGTIVAGSIATEVVFSYPGVGYLLL
FT                   QGILNQDYFLVQGTFLFIIIGVLVANFVVDILYMVFDPRIRLSLGGESA"
FT   gene            361162..362004
FT                   /locus_tag="Thit_0315"
FT   CDS_pept        361162..362004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0315"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tpd:Teth39_1931
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01631"
FT                   /db_xref="GOA:D3T6L8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01631.1"
FT                   /translation="MKEFTHFALKNTKFKIGLVVLLFFIILAIIGPNISPYKDPLEYVS
FT                   MSNLPPSKENWLGTTTFGQDVFTQFVYGLRSTFFIGMFGGGLATIIGLLIGFIAGYKGG
FT                   LLDDLLMMLTNILIVIPTLALLIIIAAYLPYRGIGIQSVIIGLTAWPWTARAVRAQTLS
FT                   LKSREFVNLAKITALRPLKIVLEEIAPNMMSYVVMVFILQFAGAILAAVGLDFIGLGPT
FT                   RGISLGLMMQYSVLWNAIQLGMWWWFVPPGLAITMIVSSLYFLNIGLDEIFNPRLREE"
FT   gene            362010..362963
FT                   /locus_tag="Thit_0316"
FT   CDS_pept        362010..362963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0316"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_1930 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01632"
FT                   /db_xref="GOA:D3T6L9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6L9"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADD01632.1"
FT                   /translation="MIQIEGLQIYYKTLHGDAKALDDVTFTINDKEILGIAGESGCGKS
FT                   TLGNSLILLKPPMKYVSGDVKVNGEKLPIDNNNEMRKYRYKKISLIPQYAMDALNPTRK
FT                   IKGIIKDLVEEHRIKYEEIEKRLHERLNMVKLSKDVLNMYPFELSGGMKQRLVLVISTL
FT                   LNPDLLIADEVTSALDVSSQKAVSLMFKEFRDREIVNSIIFITHDIAVLYQIADRIVIM
FT                   YAGKVAEIGLTEEIIANPLHPYTKALIKSLPNAGVRHTKERLEGIPGHPPDLLDPPAGC
FT                   RFKDRCPIADESCLKEPPLQEINKGRFVACWKVKDL"
FT   gene            362960..363898
FT                   /locus_tag="Thit_0317"
FT   CDS_pept        362960..363898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0317"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   KEGG: tpd:Teth39_1929 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01633"
FT                   /db_xref="GOA:D3T6M0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M0"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADD01633.1"
FT                   /translation="MIKAKNLTKIFNSGFLFTKNVVAAVDDVNFEIGKGEILALVGESG
FT                   SGKSTIGKMMLKLLKPSGGQILLDDKDIWSLSNNKEFYSRVQGIFQDPFSSFNPIFKVN
FT                   RVFKLVRQSFKKEVPAAEWNDRVENVLKKVGLNAGDVLNKYIHQLSGGQLQRLLIARAL
FT                   LMDVEVLVADEITSMLDASTRVDVLEALLSLKEIGAAIMFITHDLSQAYYISDKIVVLY
FT                   RGSVVEMGSIEKVFSNPRHPYTQMLLDSIPQLDRKWETDKFDIEDSSKNQTIWKEGFCK
FT                   YVDRCPIADTTCINPPLKLVEEDHYVACAKL"
FT   gene            363928..366399
FT                   /locus_tag="Thit_0318"
FT   CDS_pept        363928..366399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0318"
FT                   /product="glycoside hydrolase family 2 sugar binding
FT                   protein"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   KEGG: tpd:Teth39_1928 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01634"
FT                   /db_xref="GOA:D3T6M1"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="InterPro:IPR041625"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M1"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ADD01634.1"
FT                   /translation="MEKHISLNGAWHFKEADSKKWYEGEVPGCVQLDLIRLGKIEDPYY
FT                   RMNEIKFHKLEEKEWVYKKEFDFNAKDKNEYDAIKLVFEGIDTFADIYLNGIHLGKAQN
FT                   MFIPYEFDIKGIVKDGNNVLEVHFDSITKTIKAMEQTSPVNLAWSGESGRPYVRKAQYS
FT                   YGWDWGPRIVQVGLWRGVYLSLVKYAEIKNPYFYTQEIEQDKAYVVISAEVESYTQKDL
FT                   EAEIEIIHKDISYGKKRVKIQKSKIKASMIIDNPKLWYPNGFGEQPLYDIRIRLLAGEE
FT                   IIDEKSFRSGIRTVKLVRERDEEGETFIFEINGIKVFAKGANWIPADNLLPRLTKEDYY
FT                   EYIRLAKDANMNMLRIWGGGIYEDPAFYDACDEMGIMVWQDFMYACAQYPDQFEWFQEL
FT                   AKEEAEKVILSLRNHPSIVLWCGNNENNWGFHSWWDNKDPKYLGNYIYKEILPKVCARL
FT                   DPSRPYWVSSPYGGEDPNSETEGDRHQWNVWSGWVDYEEYTKDKGRFLSEFGFQSMPDW
FT                   KTVLSYTAPGDRKILSPVMISHNKMVEGMERLIRFMVGHLGFPKDLKSFVYLSQFNQAE
FT                   AIKTGVEHWRSRKFKTAGTLYWQFNDCWPVASWSCIDYYKRKKALYHYSKKFYAEILPY
FT                   IKKGDGGITIYGISDLTCDEEVDVAIKVFKLNGEKIAEKHLKTKLIANDVTKIAHYQIE
FT                   ELNIGYRAKEMPRAIPGCTLPIEENGELLNSVIYVEIIANEKTYENYKVFDRFRNLSLL
FT                   QPRISYEIVENKIVLETDIPAFGVFIETDNDVELSDNCLNMMPDKKYEIKCSQDPENVK
FT                   VFDITQLVANI"
FT   gene            366449..367792
FT                   /locus_tag="Thit_0319"
FT   CDS_pept        366449..367792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0319"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="TIGRFAM: beta-galactosidase; KEGG: tpd:Teth39_1927
FT                   beta-glucosidase; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01635"
FT                   /db_xref="GOA:D3T6M2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M2"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ADD01635.1"
FT                   /translation="MIKFPKDFVWGVATSSYQIEGAVDEDGRTPSIWDTFSKTEGKTYQ
FT                   GHTGDVACDHYHRYKEDVEIMKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDFYKRLVDE
FT                   LLKKDIMPAATIYHWDLPQWAYDKGGGWLNRDSVKWYVEYATKLFEELGDAIPLWITHN
FT                   EPWCASILSYGIGEHAPGHKNYREALIAAHHILLSHGKAVKAFREMNIKRSKIGITLNL
FT                   TPVYPASEKEEDKLTAQYADGFSNRWFLDPIFKGNYPQEMMELYSKIIGEFDFIKEGDL
FT                   ETISVPIDFLGVNYYTRNIIKYNENSMLKGENVPGPGKRTEMGWEISPESLYDLLKRLD
FT                   REYTKLPIYITENGAAFKDEVTEDRRVHDDERIEYIKEHLKAAAKFIEEGGNLKGYFVW
FT                   SLMDNFEWAHGYSKRFGIVYVDYETQKRILKDSAWWYKGVIQRSVIEE"
FT   gene            complement(367850..368644)
FT                   /locus_tag="Thit_0320"
FT   CDS_pept        complement(367850..368644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0320"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: tex:Teth514_0276 ABC-3
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01636"
FT                   /db_xref="GOA:D3T6M3"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M3"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ADD01636.1"
FT                   /translation="MIDIFSYEFMRRAFIAGSIISIIAPLTGSFLVLRRLSQIGDTLSH
FT                   VALAGVAAGLLLGINPTVGSIIVVLLASFGIERLRKTYLRYSEISIAIVMSAGMAIAII
FT                   LLSLSRGGAANIMNYLFGSIVSVTNTDVLLILTLGIIVVASIVLLYKELLYITFDEEAA
FT                   KISGIPVGYINFFFTILVALTVALAMRIVGALLVSSLMVIPAAASLRIAKSFKQTIFYA
FT                   ILFSFISVFSGIFLSFYLNLSPGGSIVLISLLIMGLVSLKKR"
FT   gene            complement(368637..369401)
FT                   /locus_tag="Thit_0321"
FT   CDS_pept        complement(368637..369401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0321"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1925 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01637"
FT                   /db_xref="GOA:D3T6M4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01637.1"
FT                   /translation="MEFVELKNVSFAYDTKKVLNNVSLKINKGEFVAIIGPNGSGKSTL
FT                   VNIMVGNLIPTSGEVLYEGVKLQNIKNRSFISYVPQKSYSFNASFPASVEEVVSMGLYA
FT                   KKGIFKKLSKKDWEEVYEALRIVDMLDYKHSLIGRLSGGQLQRVFIARSLVVKPEILFL
FT                   DEPTTGIDAKSEKALYAILEKLNKEKGITIVMVTHDVWAITDKVSRIICMSEGKINEKC
FT                   EAVDLDEGDLAEVYGYPVKITKHHHNGSVNND"
FT   gene            complement(369408..370289)
FT                   /locus_tag="Thit_0322"
FT   CDS_pept        complement(369408..370289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0322"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   tex:Teth514_0278 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01638"
FT                   /db_xref="GOA:D3T6M5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M5"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ADD01638.1"
FT                   /translation="MKKFSMAILLIIAVIVGITSCSTKTEESSKPVIYASFYPIYDLAS
FT                   KIGGNKITVKTIIPPGVEPHDWEPTTKDVASMTKAKTILYLGLGMDSWIDKIKANAPNV
FT                   AFYEVSKGVTPIVEGSITNPHIWLSPKESLIMTKNINEALQKSFPTYKDYFEKNYQNLK
FT                   TTLEALDKEYTDALSQTKHKIFIVYHSAFDYLARDYGLKQEALVGSDEEAEVSPARMTE
FT                   IINLIKSKNIKYIFTEPLTSPKPIQTIAKETGVQVLPLSTIEGLTKENIKKKEDYISLM
FT                   KQNLENLKKALE"
FT   sig_peptide     complement(370218..370289)
FT                   /locus_tag="Thit_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.579 at
FT                   residue 24"
FT   gene            complement(370295..370723)
FT                   /locus_tag="Thit_0323"
FT   CDS_pept        complement(370295..370723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0323"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   tex:Teth514_0279 ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01639"
FT                   /db_xref="GOA:D3T6M6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M6"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ADD01639.1"
FT                   /translation="MRKQEAVKKLKEHNYKLTPQRELILDIMLNQQGYLSVREIYEKVK
FT                   EVFPQVSIDTVYRNLSLLKDINILNETTIGNNIMYVMRKEIHNHTMKCLNCGQIFELDI
FT                   CPLELWINQIKDFEIVDHKIEIVGYCKNCRVDKTHFRR"
FT   gene            370918..371856
FT                   /locus_tag="Thit_0324"
FT   CDS_pept        370918..371856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0324"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="KEGG: tex:Teth514_0280 ATPase; PFAM: ATPase
FT                   associated with various cellular activities AAA_3; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01640"
FT                   /db_xref="GOA:D3T6M7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M7"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ADD01640.1"
FT                   /translation="MEYAKILEDIRNNIEKVIVGKREVIDLMLTALISSGHILLEDVPG
FT                   VGKTTIAKALAKSINCEFKRVQFTPDLLPSDLTGINVYNQKLNEFEFKKGPLFTNILLA
FT                   DEINRATPRTQSSLLECMEERQVTVDGVTYPLDKPFFVIATQNPIESYGTFPLPEAQID
FT                   RFLMKIKMGYPKREEEQRIIDLFDKGSPLENIQPVCSKEDIIKMQKEYTNVYVEKDVAN
FT                   YILDIIERTREDGEIELGASPRATLALYKSSQAYAYIKGRDFVTPDDVRYIAPFVLSHR
FT                   IILKGVGKLKNLKAEDVVKRILEEVPIPLEK"
FT   gene            371876..373018
FT                   /locus_tag="Thit_0325"
FT   CDS_pept        371876..373018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0325"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   tpd:Teth39_1921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01641"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M8"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ADD01641.1"
FT                   /translation="MNALWFILVVAFVLAMQANLYKKYIFKDLKIERKFENPAIFPGEK
FT                   TTLKVTLVNKKIFPITYLKLQQKIPVELQMVKSSMVENNDKVKYFHTTVLSMMPFQRIT
FT                   RKFEIVGIKRGVYNLFDPVKVFSTDLFGSEEYESEILAHARLVVYPNLIDLNSSFVVAD
FT                   SLQGDVFVRRWIIEDPIMISGIRDYTPSDNYKDINWKATAKNQTLKVNKYDYTADKKIM
FT                   ILFNIDFHRYLFKTIDLQEFEKAVEVAASLSVDLLKKGIPVGFSTNAICLFEGDYSIIE
FT                   PSAGESQISKLLEVFAGLSFFKRYDLEEILRLMTNHLSWGTDLVVVTPFVDDKVVNALS
FT                   DIGNTKISIVSIKPNEIGHLPTNIKLFFYNEEGKQLETVG"
FT   gene            373002..374327
FT                   /locus_tag="Thit_0326"
FT   CDS_pept        373002..374327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01642"
FT                   /db_xref="GOA:D3T6M9"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6M9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1920"
FT                   /protein_id="ADD01642.1"
FT                   /translation="MKLWDREKFVRTFLTVLDGMMVFLIYTLLNGLFIREKGISFGIIL
FT                   LVSLISGVFNNAEIEMKEKTYKQLNLTIGVVISILLSAIISENYYQLVAIFIVFLYIWS
FT                   RGVKNRGIFVNEMLNVEQFYKQLIGLFVINIANYFMPLEGILIIPKYSIIYILLSIFLL
FT                   LEVKNLRYADNSSNKRVSAFEWAAVSLIILTMILLSSPAVRGFIYHYLYEGIVKIFVYG
FT                   ASYLAYGLFLMLSKLFSLLPIDEEYFKKAMEEALKQDSSKGNMFEEQIPQDYAWLVHMI
FT                   NGIATLLAVVIIIALMVYIVKAITKLQKEKHERDFTEEKEIDIKIGDLQTYKRLKGISQ
FT                   KIAENVRERVKIYRDSRERVRYYYKRFLKHLYENKILVKGNHSSEDVYKKVVEVFPFVH
FT                   SAMEEITALYEKVRYGNYYPQYEEVKEFEIKLREIIKNLKQI"
FT   gene            374403..374975
FT                   /locus_tag="Thit_0327"
FT   CDS_pept        374403..374975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0327"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: tpd:Teth39_1919
FT                   LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01643"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N0"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ADD01643.1"
FT                   /translation="MKNPLIITLIVLAVIAVLVFGTIYGTYNQLVALDENVNSKWSQID
FT                   NQLQRRADLIPNLVETVKGYAAHEKEIFDSVNKAREKLLSANTVAEKAASNDELNTALG
FT                   RLLAIAENYPNLKADANFRQLSDELAGTENRIAVARMDYNNAVQAYNTKIRSFPTSIIA
FT                   NMFGFKEREYFKADEAAKTVPKVDFSK"
FT   sig_peptide     374403..374468
FT                   /locus_tag="Thit_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.669 at
FT                   residue 22"
FT   gene            complement(375122..376006)
FT                   /locus_tag="Thit_0328"
FT   CDS_pept        complement(375122..376006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0328"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: tex:Teth514_0284 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01644"
FT                   /db_xref="GOA:D3T6N1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ADD01644.1"
FT                   /translation="MTLRDIEIFVTVCELKSMSAAAKKLYMSQPAISQAISQMEGELQV
FT                   RLFDRIGRKLSLTYAGEILYSYGKRILNLVKEAESTLDDVRNMRMGRLRVGTSTTVGIY
FT                   LLPEIIGEFRKKFNIDVYFTIGNTAEIEKLILDNSIDLGIVEGPVHSRDIVVTPYIDDE
FT                   LYLVCSKSHRWAKKKNISPAEIENEDIIMREKGSGTREVFEETMARNNVKYRIKYVLNN
FT                   TEAIKKAVEANIGVSVISRLAVKKEIRGGRLLKVDIENIRFKRKFSIVYHKDKFKSNLF
FT                   EEFIKHLYNCSIR"
FT   gene            376330..377379
FT                   /locus_tag="Thit_0329"
FT   CDS_pept        376330..377379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0329"
FT                   /product="sulfite reductase, subunit A"
FT                   /note="TIGRFAM: sulfite reductase, subunit A; KEGG:
FT                   tex:Teth514_0285 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01645"
FT                   /db_xref="GOA:D3T6N2"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR014259"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N2"
FT                   /inference="protein motif:TFAM:TIGR02910"
FT                   /protein_id="ADD01645.1"
FT                   /translation="MSYCVSIKRMNEILKELQKEYKIYAPVRFEKRGRYSDTDLIRYAE
FT                   INSIEDVVYDEKSDFSPKEVIYPITQALFYFTEYEYMESKIDDKKILIFVRPCDINGFR
FT                   RLDTIFLKNGGTEDIYYKRLREKVKFILMECKEGGWDSCFCVSMGSNKTDDYSLAVRFG
FT                   DDNILVEIKDDEFANLFADEREVEFTPEFVTSNPTKVNIPEIDSHELLEKIYDLDMWKS
FT                   YNSRCISCGACTAVCITCSCFTTLDVTYTENGKVGERRRVQASCMHEDFTTMAGGLSFR
FT                   KTAGERMRFRTLHKIYDYKLRFKDEHMCVGCGRCDERCPELISFPATINRLYDEVEKLK
FT                   KAETTKDIR"
FT   gene            377407..378198
FT                   /locus_tag="Thit_0330"
FT   CDS_pept        377407..378198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0330"
FT                   /product="sulfite reductase, subunit B"
FT                   /note="KEGG: tpd:Teth39_1916 anaerobic sulfite reductase
FT                   subunit B; TIGRFAM: sulfite reductase, subunit B; PFAM:
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   Dihydroorotate dehydrogenase, electron transfer subunit,
FT                   iron-sulphur cluster binding domain; Oxidoreductase
FT                   FAD-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01646"
FT                   /db_xref="GOA:D3T6N3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR014260"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N3"
FT                   /inference="protein motif:TFAM:TIGR02911"
FT                   /protein_id="ADD01646.1"
FT                   /translation="MSENIMRPTPHKIIDIIRETGNEYTFKIETNAKVKHGQFFQVSLP
FT                   KVGEAPISVSAMGDGWVELTIRKVGKVTNEIFNLKPGDKIFMRGPYGNSFPVDDFKGKD
FT                   LVVIAGGTGVSPVRSLLKYFYEHPDEIHSLYFIAGFKDEESILFKEDLNNFRSRFNTIY
FT                   TLDKDKIEGFEVGFVTEHIKKIPFDSFENYNVVIVGPPVMMHFAALECLKNGVSEEKIW
FT                   LSFERKMSCGVGKCGHCKINETYVCLEGPVFNYTKAKNLLD"
FT   gene            378215..379228
FT                   /locus_tag="Thit_0331"
FT   CDS_pept        378215..379228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0331"
FT                   /product="sulfite reductase, subunit C"
FT                   /note="KEGG: tpd:Teth39_1915 nitrite and sulphite reductase
FT                   4Fe-4S region; TIGRFAM: sulfite reductase, subunit C; PFAM:
FT                   nitrite and sulphite reductase 4Fe-4S region; 4Fe-4S
FT                   ferredoxin iron-sulfur binding domain protein;
FT                   nitrite/sulfite reductase hemoprotein beta-component
FT                   ferrodoxin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01647"
FT                   /db_xref="GOA:D3T6N4"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR014261"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N4"
FT                   /inference="protein motif:TFAM:TIGR02912"
FT                   /protein_id="ADD01647.1"
FT                   /translation="MSYDIDIKKIRRNCYRQSKVRGEFMLQIRVPGGVIDAKYLSFFQH
FT                   IAETWGNGEFHLGVRQTISIPRIKYEYIDEVNKYIRPYIEEIEVNLCGVDMVVDDNGYP
FT                   TIGARNIMACIGNRHCIKANIDTTDLARKIEKIIFPSDYHIKLNIAGCPNDCAKAHVSD
FT                   IGIIGITKTEYDYERCIGCKKCVEACAHHATRVLSVEKGKIVKDTCCCVGCGECVLVCP
FT                   TGAWTRNPKKFYRVLIGGRTGKQTPRMGKIFLNWVTEDVVLGVLKNWETFSAYVMNNKP
FT                   EYIHGGHLIDRVGYNKFKEMILKDVKLNPEAMVAERVLWTETEYRSNFNVKPVTQR"
FT   gene            379533..380294
FT                   /locus_tag="Thit_0332"
FT   CDS_pept        379533..380294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0332"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   csc:Csac_1647 TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01648"
FT                   /db_xref="GOA:D3T6N5"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012022"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N5"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ADD01648.1"
FT                   /translation="MKEIVDSHVHVSLLPFEGWESMALAGVRKIIGYSLFFGAKHAETL
FT                   FDHFHQMLTLSMSNAAKNGIKLYVAIGIHPMGIPDDWPRVIGALPSYLKMSGVIGLGEI
FT                   GLHEGNKREQEVLHEQLKIAKEYRVPAIIHTPPQNRVEITEKTIEIAASVGMEPGKMII
FT                   DHANLDIIDLIEDFGAVPGLTIRQEGFTSQLLLNHLERFQRGVLNSDYSNLKPNDPLSV
FT                   PKTVRYLELNGASPEVIARIARYNAEEVFGV"
FT   gene            380382..380708
FT                   /locus_tag="Thit_0333"
FT   CDS_pept        380382..380708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0333"
FT                   /product="Protein of unknown function DUF2250"
FT                   /note="PFAM: Protein of unknown function DUF2250; KEGG:
FT                   csc:Csac_1648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01649"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N6"
FT                   /inference="protein motif:PFAM:PF10007"
FT                   /protein_id="ADD01649.1"
FT                   /translation="MPVNNDQEEFLDLTILAYLKKLGPEYAKFLARRLGLSLEESRKRL
FT                   QSLEERGLIKRVERRIVKYYHQQRKSVKHRNHTYYELTREGELFLRQARKKIDINLDIE
FT                   YPNR"
FT   gene            380879..382109
FT                   /pseudo
FT                   /locus_tag="Thit_0334"
FT                   /product="hypothetical protein"
FT   gene            382106..382519
FT                   /locus_tag="Thit_0335"
FT   CDS_pept        382106..382519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0335"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="KEGG: tpd:Teth39_1910 NifU family SUF system FeS
FT                   assembly protein; TIGRFAM: SUF system FeS assembly protein,
FT                   NifU family; PFAM: nitrogen-fixing NifU domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01650"
FT                   /db_xref="GOA:D3T6N7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N7"
FT                   /inference="protein motif:TFAM:TIGR01994"
FT                   /protein_id="ADD01650.1"
FT                   /translation="MSDLNQLYSEVIMEHYENSPHEKELKDATHKERGYNPLCGDNITL
FT                   YLKMNGDIIEDASFTGHGCAISQASTSMMIDLIKGKDKKEALRLVQQFIDMIHKKDVNL
FT                   DELGDAQVLQGVSDFPARVKCALLAWKTLQEIL"
FT   gene            382786..383586
FT                   /locus_tag="Thit_0336"
FT   CDS_pept        382786..383586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0336"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   tpd:Teth39_1909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01651"
FT                   /db_xref="GOA:D3T6N8"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N8"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ADD01651.1"
FT                   /translation="MKGRIFLIAIAFLLLFFNSIAFSAPDVPPKPIQFRYVYDYAGLMS
FT                   QNDIEEIERVGKALDDATKAQIIVVTVDTIGDYPIEEYSLALFRNWGIGDKEKNNGVLF
FT                   LVVKDRLLKGQDGKVRIEVGYGLEGAIPDSVAGRILDDFVLTSWAKGEYSKGIYAGYMA
FT                   IASRVAKEYNIDLQGLDVSEYSVNTSSNDSGISWEDIAAVIILILIFIIFGRGGRNIKR
FT                   NWWGPGSFGSGGFGDFRGGGFGGGGFGGGGGFGGGSAGGGGASR"
FT   sig_peptide     382786..382857
FT                   /locus_tag="Thit_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 24"
FT   gene            complement(383640..384212)
FT                   /locus_tag="Thit_0337"
FT   CDS_pept        complement(383640..384212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0337"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   tex:Teth514_0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01652"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6N9"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADD01652.1"
FT                   /translation="MPLPEKNKKYTYADYLTWSEEERWEIINGVPYLQAAPTWQHQAVL
FT                   LELARQFANYLQDKSCRVFTAPFDLRIPEANEKDEETTNVVQPDIIIICDNSGLKKTGY
FT                   YGVPELIIEVVSPSTGQKDKIEKFNLYEKAGVKEYWIVEPDEKVVMVFTLEEGRYGRPQ
FT                   MYSEEDKVKVSIFDNLVIELKPVFERI"
FT   gene            384370..385503
FT                   /locus_tag="Thit_0338"
FT   CDS_pept        384370..385503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0338"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: tex:Teth514_0293 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01653"
FT                   /db_xref="GOA:D3T6P0"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P0"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ADD01653.1"
FT                   /translation="MSKIEFIASTLFGVEAITARELKELGYQDFAIEDGKVTFVGDEMA
FT                   LCRSNLWIRTAERIYVKIGEFTATTFEELFEGTKALPWEDWIPEDGRFPVEGYSIKSKL
FT                   FSVSDCQAIVKKAVVERLKKKYKKEWFEENGATYKIKFSLMKDKVTLMIDTSGDGLHKR
FT                   GYRVISNAAPLRETLAAAMIMLSFWKPDRPLIDPFCGSGTIPIEAAMIGINLAPGLKRQ
FT                   FVSEKWGRISSKLWKQAREEAHNAIKKDASLNIRGYDINENAIKLSKDNARKAGVEKYI
FT                   TFKNIPLKDLKTDDKYGVIICNPPYGERMGKLKEVEKLYKEMGKVFKKLDTWSFYILTS
FT                   HERFEKLFGREASKKRKLYNGMLKAYYYQYYGPKPEN"
FT   misc_binding    385772..385964
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 122.82"
FT   gene            386080..387027
FT                   /locus_tag="Thit_0339"
FT   CDS_pept        386080..387027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0339"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   tex:Teth514_0296 periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01654"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P1"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ADD01654.1"
FT                   /translation="MRNFKGLLALLLVFVLAFYLAACSTNTATKPENTSQTATETVKTQ
FT                   FPLKVTDFLGKEVTIEKEPQRIVSLAPSITELIYALGAGNKVVGVTDFDNYPPEVKDVP
FT                   KVGGFKGPNVEAITAQKPDIIFASTLSGKEQMESLEKMGIPVVMLEAKNIAQIYQSIRI
FT                   IGQITGTEKKGEELIKQMQDKIKEINDKVKELPKVSVFYLVSLDGNWTAGKGTFIDELI
FT                   NLAGGKNVAEDVNGWAQYSVEELVKKNPDVIITSPHAGNVKDIKNMAGYKDTNAVKNDK
FT                   IFVISNDDIISRASNRIVLGLEEIAKFLHPEAFK"
FT   sig_peptide     386080..386148
FT                   /locus_tag="Thit_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.629 at
FT                   residue 23"
FT   gene            387029..388021
FT                   /locus_tag="Thit_0340"
FT   CDS_pept        387029..388021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0340"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   tex:Teth514_0297 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01655"
FT                   /db_xref="GOA:D3T6P2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P2"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ADD01655.1"
FT                   /translation="MKFKRGIYFGTAFSLLVFTMILSISAGAVKIPLREILNIFFGGGS
FT                   ETSRTIILNLRLPRVIESAVVGMGLSVVGAFFQGLLRNPMADPYVLGISSGAAFGATIA
FT                   IILGLGIFGLSFMAFVTSLMTVFFVYTISRTSTRVSMTTMLLAGIAISAFMSAIISLMM
FT                   LLNHDEFSRIVFWTMGGFSLINWNSVVFTTPIIVIGSFVMYVFSRDVNAILTGEEVAEH
FT                   LGVNTELVKKIILVTGSLVTATAVSVGGIIGFVGLIVPHISRLIVGPDNRVLVPFSAIS
FT                   GAIFLTFADLLARVILKPMEIPIGIITAAFGGPFFLYLLIKSKQKSEGM"
FT   sig_peptide     387029..387115
FT                   /locus_tag="Thit_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.649 at
FT                   residue 29"
FT   gene            388026..388826
FT                   /locus_tag="Thit_0341"
FT   CDS_pept        388026..388826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0341"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1902 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01656"
FT                   /db_xref="GOA:D3T6P3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01656.1"
FT                   /translation="MAILKVDKLYFSYGERKVLRGIDFTINKSIVIGIIGANGSGKTTL
FT                   LKNISGYLTPTYGNVFVLGKNIKDFTIKEKAKYIGYVPQDIVYDFEFSCYDIVMMGRIP
FT                   YLKRFQSEKKEDRDIVRECMEITNTWQFKDKSIKELSGGERQRVYIARALAQKARILLM
FT                   DEPVSQLDIKYQVEILSLVKDLSLKGILVIVVLHDINLASQFCDEIFIMKEGKIIASGS
FT                   PRNVLTLNNINSAFSIDVEVFENPITHTPYVIPSLNGKEQLKVV"
FT   gene            388819..390201
FT                   /locus_tag="Thit_0342"
FT   CDS_pept        388819..390201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0342"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="KEGG: tex:Teth514_0299 cobyrinic acid a,c-diamide
FT                   synthase; TIGRFAM: cobyrinic acid a,c-diamide synthase;
FT                   PFAM: Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01657"
FT                   /db_xref="GOA:D3T6P4"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P4"
FT                   /inference="protein motif:TFAM:TIGR00379"
FT                   /protein_id="ADD01657.1"
FT                   /translation="MCKAVMIAGPHSGAGKTTVSLGLMGVLSKRYKVQPFKVGPDYIDA
FT                   AYHRYVTGNFSCNLDLYLLGEQNLKSLFYKNACNADISIIEGVMGMYDGIDTTKKGSSA
FT                   HIAKILDIPVILVVDASSMATSVSALIMGYMHYDREVKIAGVILNKVGSEKHYALLKEC
FT                   ITRDLGIEVFGYLPKDPKLDLPERHLGLVPIYEMPEIKHKFDTLYDYIEKYIDIEKILN
FT                   VGVIDCSNTFRNTIGEGHDLKRVKIGYAFDEAFNFYYKESLELFEEMGAELVPFSPLKD
FT                   YKLPDGISGLYIGGGFPEVFAERLNKNKKILKSVKDAIDSGMPAYAECGGFMYLTKSIT
FT                   DLQGNTFEMAGIYDFETVMTKRLQRFGYVEAEVIEDNVLFRKGDKIKGHEFHHSIIKGF
FT                   SQKASYVVHKPGKEEAWECGFVHKNCLATYVHINLYTYKEAVKRFVDKCVQYRNSNAFQ
FT                   ED"
FT   gene            390203..391726
FT                   /locus_tag="Thit_0343"
FT   CDS_pept        390203..391726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0343"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="KEGG: tex:Teth514_0300 cobyric acid synthase;
FT                   TIGRFAM: cobyric acid synthase CobQ; PFAM: CobB/CobQ domain
FT                   protein glutamine amidotransferase; Cobyrinic acid
FT                   ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01658"
FT                   /db_xref="GOA:D3T6P5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P5"
FT                   /inference="protein motif:TFAM:TIGR00313"
FT                   /protein_id="ADD01658.1"
FT                   /translation="MALKLMIQGTASSVGKSLLVAAFCRIFKQDGYRVAPFKSQNMALN
FT                   SYITDEGLEIGRAQAMQAEAAGVKPSYHMNPILLKPSSDKKSQVVLRGKVYKNMSAAEY
FT                   HQFKPQLLKFIKEDFDFLASQNDIVVIEGAGSPAEINLRDRDVVNMGMAEMVNAPVLLV
FT                   GDIDKGGVFASIAGTLLLLKENERNRIEGVLINKFRGDIEILKPGLEMLENIVHKKVLG
FT                   VVPYMDVHIDEEDGATERFYRRSTEGDIEIAVINLPHISNFTDFEPLAKVPGVKLRYVN
FT                   KGERIGDCDVVIIPGTKNTIGDLQALKKYGLDKEIFEMRKKGKFIVGICGGYQILGKVI
FT                   KDPGRIESTTSEIEGLGLLDVETVIENEKTTTQIKAVIRNNLPSILSPLRNIAVEGYEI
FT                   HMGKSRILGDCQPFSVITHRNGEKIEVYDGCISDDGKVFGTYIHGIFENREFVREFINI
FT                   VRKSKGLSPIEEIIDYKEFKEREYDRLADIVRKSIDMKEVYEIMERYRD"
FT   gene            391726..392664
FT                   /locus_tag="Thit_0344"
FT   CDS_pept        391726..392664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0344"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="KEGG: tpd:Teth39_1899 cobalamin biosynthesis protein
FT                   CobD; TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01659"
FT                   /db_xref="GOA:D3T6P6"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P6"
FT                   /inference="protein motif:TFAM:TIGR00380"
FT                   /protein_id="ADD01659.1"
FT                   /translation="MEVVLAYLLDLLIGDPEGYPHPVRIIGKVVSHLESILRKYAKSNR
FT                   ALKIAGFILCGLTVTLAFAATYVLLYIAGLIHPYLKYALDVLIIYTCLATKDLDKAAGK
FT                   VYEALTKGDIVEARRRLSYIVSRDTDRLDVENISRGAIETVAENISDGIIAPMFYAFIG
FT                   GAPLAVFYKAASTLDSMVGYRNEKYLDLGFASAKLDDILNFIPARITGFLIVVAAFLLG
FT                   YDYKNSWRIFLRDRLKHQSPNSAHGEAAVAGALNIQLGGLNYYFGKPEIKPTLGDGKEK
FT                   ITPQHMKDSIKIMYMTSSLGLVVFYIGRRLI"
FT   gene            392661..393146
FT                   /locus_tag="Thit_0345"
FT   CDS_pept        392661..393146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0345"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01660"
FT                   /db_xref="GOA:D3T6P7"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P7"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1898"
FT                   /protein_id="ADD01660.1"
FT                   /translation="MKEKANALKNVKTLTLVAMLIALSAVGALIKIFNTVAFDSMPGYF
FT                   AALYLGSWYGALVISLGHMLTAITSGFPLGLTNHIYIAVQMALYAYLFRFFYRKFNIYI
FT                   AVIVATILNGPVATLLFVPIFGWGFFAAWVLPLTIASFANVFLAALIYKAIPKRSRE"
FT   sig_peptide     392661..392744
FT                   /locus_tag="Thit_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.878 at
FT                   residue 28"
FT   gene            393150..393881
FT                   /locus_tag="Thit_0346"
FT   CDS_pept        393150..393881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01661"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P8"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1897"
FT                   /protein_id="ADD01661.1"
FT                   /translation="MIERYRDLVVIYENDVAYVISCDSLGAIGNKENDVLKVDEEIVGR
FT                   TTVKVALSEVLCVGAKPLVISDTLSVEMNPTGEKILKGIKNELEDNGLLDVVFTGSTEE
FT                   NFPTSMTGIGITVIAKAYVCDLKIKKVKAGMHVSLLGYPRVGSEVLSSKDVLTLKDYIK
FT                   ISNSKEIIEAIPVGSKGIKYEIGILEKISGLKVEANFPQYLDVLKSGGPSTCCLVVHNE
FT                   EDTVSIKGLTDKPLTYIGVLI"
FT   gene            393905..394990
FT                   /locus_tag="Thit_0347"
FT   CDS_pept        393905..394990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0347"
FT                   /product="L-threonine-O-3-phosphate decarboxylase"
FT                   /note="KEGG: tex:Teth514_0304 putative
FT                   L-threonine-O-3-phosphate decarboxylase; TIGRFAM:
FT                   L-threonine-O-3-phosphate decarboxylase; PFAM:
FT                   aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01662"
FT                   /db_xref="GOA:D3T6P9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005860"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6P9"
FT                   /inference="protein motif:TFAM:TIGR01140"
FT                   /protein_id="ADD01662.1"
FT                   /translation="MKPYEHGGNVYDYEREIIDFSSNINPLGVPEWIFDIIKKVDLTKY
FT                   PDIKYRKLKEAVSQYVGYSQENIIIGNGATELIHLFVRAFKVKRPLIPSPAFLEYERAV
FT                   HINGGEPIYFRLEEDYGFKMNLEKLLSQMEKADSLIIGNPNNPTGQAIIREEIGILLKK
FT                   AEILNMPVMIDEAFIEFMKDYKNYEALPLVKKHDKLFVVRAVTKFFGMPGIRLGYGIAN
FT                   SSLIQKLEEYKEPWTVNAFADAVGREIFKDKAYIEKTREYVSKEIDYMLYALRKIDYLV
FT                   AFDTKVNFILLKLKTGRVNDLKQILLKKGILIRDASNFRYLDKSFFRVAIKRHEDNEKL
FT                   IQALKEIDIKDLVEDKERVVI"
FT   gene            394991..395545
FT                   /locus_tag="Thit_0348"
FT   CDS_pept        394991..395545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0348"
FT                   /product="Adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="KEGG: tex:Teth514_0305 adenosylcobinamide
FT                   kinase/adenosylcobinamide-phosphate guanylyltransferase;
FT                   PFAM: cobalbumin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01663"
FT                   /db_xref="GOA:D3T6Q0"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q0"
FT                   /inference="protein motif:PRIAM:2.7.7.62"
FT                   /protein_id="ADD01663.1"
FT                   /translation="MSLVMITGGVRSGKSEFAEKLALEKGGNSVLYIATSIPFDEEMKE
FT                   RVRRHKERRPPFWQTKEVYKDLYDVISKSNAKVALIDCLTVMITNLLMEVDLTWENAGM
FT                   DEIDNIENQIADEVDEILTAKKDFKGDIILVTNEVGMGLVPEYKLGRIFRDIAGRMNKK
FT                   VADAADEVYLMVSGIPLKIKG"
FT   gene            395568..396320
FT                   /locus_tag="Thit_0349"
FT   CDS_pept        395568..396320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0349"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="KEGG: tpd:Teth39_1894 cobalamin synthase; TIGRFAM:
FT                   cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01664"
FT                   /db_xref="GOA:D3T6Q1"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q1"
FT                   /inference="protein motif:TFAM:TIGR00317"
FT                   /protein_id="ADD01664.1"
FT                   /translation="MEEIKRLVLAMQFMTRLPIPIEIDAEKSEFYRIASYFPIVGIVIG
FT                   GILSLLYIALKNFFSREIVMTFIVAFSYVLTGAMHIDGLADTFDGLFSNKDKERILEIM
FT                   RDSRLGTNGVLALVFMVVLKILFLTNIHENITLTALLITPIIGRLSIVFSMMITKSARG
FT                   GEGLGGLMLGKVGIREFVIAFVISIATSYFILPLAVFVKILTISLFVTYIVSKYISLRI
FT                   GGMTGDTLGAVNELAELTVLICFVSVSL"
FT   gene            396337..396702
FT                   /locus_tag="Thit_0350"
FT   CDS_pept        396337..396702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0350"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: tex:Teth514_0307 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01665"
FT                   /db_xref="GOA:D3T6Q2"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q2"
FT                   /inference="protein motif:PFAM:PF01903"
FT                   /protein_id="ADD01665.1"
FT                   /translation="MGKGLLIIAHGSRVEETKDVVTKVVEKIKNLKNTKNVKAGFMEFN
FT                   EPDISTSIREFVEEGIYDIIAVPMFLFEGNHVLHDIPEVFGKEKEKYPGLKIKFAKSIG
FT                   YDDRIVDIMLERAKEVE"
FT   gene            396733..397356
FT                   /locus_tag="Thit_0351"
FT   CDS_pept        396733..397356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0351"
FT                   /product="Precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="KEGG: tex:Teth514_0308 precorrin-8X methylmutase
FT                   CbiC/CobH; PFAM: Precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01666"
FT                   /db_xref="GOA:D3T6Q3"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q3"
FT                   /inference="protein motif:PRIAM:5.4.1.2"
FT                   /protein_id="ADD01666.1"
FT                   /translation="MNYITDPKEIEKRSFEIISKNIDEMKFEKRELMIVKRVIHATADF
FT                   DFAHIIKISDGAIDAGLKALKEGCTIVTDTKMAEAGINKKALKSIGAGVKCYIDIPQVE
FT                   ELSKTYAITRSMASMVIASKDGRNKIFAIGNAPTALFKLCELVNSGEVMPYLIIGVPVG
FT                   FVGAEEAKEEVKKLGVPYIITEGRKGGSTIAAAIVNALLYMMGD"
FT   gene            397389..398489
FT                   /locus_tag="Thit_0352"
FT   CDS_pept        397389..398489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0352"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="KEGG: tex:Teth514_0309 cobalamin biosynthesis
FT                   protein CbiD; TIGRFAM: cobalamin biosynthesis protein CbiD;
FT                   PFAM: cobalamin (vitamin B12) biosynthesis CbiD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01667"
FT                   /db_xref="GOA:D3T6Q4"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q4"
FT                   /inference="protein motif:TFAM:TIGR00312"
FT                   /protein_id="ADD01667.1"
FT                   /translation="MEVYTIKEGKKLRYGYTTGSCAAAASKAATYMLFTGEKIDTVEID
FT                   TPKGWHLILDVLDVTSGEGWVKCGIRKDGGDDPDATHGLIIYSKVELKEGEGIDVYGGE
FT                   GVGVVTKPGLPVNPGKPAINPVPMSMILNEVKKVLPEGKGVKITISVPGGEKVALKTFN
FT                   PRLGIVGGISILGTSGIVEPMSEEALKSSLELELSILSAEGHKKVVFAPGNYGKDYAMK
FT                   EGLEERLIISYGNFLGFMLEKAVEYGFAHVVLAGHIGKLVKVAAGIFNTHSHVADARAE
FT                   IMAAYAAHFGADKKTVDKVLDSNTTEEALDIIEKAGVNIKDFSQFIADRVYMKCKQYVY
FT                   DKLNIEVHLISLKRGIIAKAGEKVEW"
FT   gene            398483..399094
FT                   /locus_tag="Thit_0353"
FT   CDS_pept        398483..399094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0353"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /note="KEGG: tex:Teth514_0310 precorrin-6y
FT                   C5,15-methyltransferase (decarboxylating), CbiE subunit;
FT                   TIGRFAM: precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01668"
FT                   /db_xref="GOA:D3T6Q5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q5"
FT                   /inference="protein motif:TFAM:TIGR02467"
FT                   /protein_id="ADD01668.1"
FT                   /translation="MVTIVGIGPGNKKFITPYALEKIKKADVLVGGRRHLEEFEDIDCE
FT                   KIVINASTDYQSILSREGNIVILASGEPSLYGITEVILKYVDKSQLEIIPGISSIQYMC
FT                   AKLKITMNDFTVVSLHGRSEDLVKKVKENKKVAVFTDNTHTPQFIAALLKEGNLRDRKI
FT                   HVGENLSYDIERIYSFTVEELLNCNKKFDLNVVVITCGNT"
FT   gene            399079..399663
FT                   /locus_tag="Thit_0354"
FT   CDS_pept        399079..399663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0354"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit"
FT                   /note="TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; KEGG: tex:Teth514_0311
FT                   precorrin-6Y C5,15-methyltransferase (decarboxylating),
FT                   CbiT subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01669"
FT                   /db_xref="GOA:D3T6Q6"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q6"
FT                   /inference="protein motif:TFAM:TIGR02469"
FT                   /protein_id="ADD01669.1"
FT                   /translation="MWQYMTPGIPDEYFVRGNVPMTKEEIRALSISKLKLKEDSVIWDI
FT                   GAGTGSISIEAALISKKGVVYSIEKEEDGIKRINENIKRFNVENIVVVAGEAPDALLDL
FT                   PSPDRVFIGGTGDKMYQIFDIATTKLKEEGVVVVNGITLDTAYSANHYFKQKGYSVETI
FT                   CVNISVSKEAGNKTMMIARNPVYIITAKREG"
FT   gene            399665..400339
FT                   /locus_tag="Thit_0355"
FT   CDS_pept        399665..400339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0355"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="KEGG: tex:Teth514_0312 precorrin-2
FT                   C20-methyltransferase; TIGRFAM: precorrin-2
FT                   C20-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01670"
FT                   /db_xref="GOA:D3T6Q7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q7"
FT                   /inference="protein motif:TFAM:TIGR01467"
FT                   /protein_id="ADD01670.1"
FT                   /translation="MAKLYGIGVGPGEESLITLKAVKILQKVDVVIAPTSKGEGSIAYE
FT                   IAKPYIKGDVIFMEFPMTYSKEDLKTKWEENVKKIKELLDEGKDVAFITIGDPMIYSTY
FT                   IYILKGIEDYEVETIPGITSYSAAASRLNIPIAEGNETFAVISSGDVTEISKALDMFDN
FT                   VVLMKISRRYDEIVNLLKEKSFKGYLVIKCGHKDEKISCDLDRYIGKKIDYLSLIIAKK
FT                   VK"
FT   gene            400342..401097
FT                   /locus_tag="Thit_0356"
FT   CDS_pept        400342..401097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0356"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; KEGG:
FT                   tex:Teth514_0313 precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01671"
FT                   /db_xref="GOA:D3T6Q8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q8"
FT                   /inference="protein motif:TFAM:TIGR01465"
FT                   /protein_id="ADD01671.1"
FT                   /translation="MIYFIGAGPGDPELITLKGMKIIQACDVIIYAESLVNKEILKYAK
FT                   PEAEIYNSALMNLDEIIELMVKSHKEGKDVARIHTGDPAIYGAIHEQIVRLEEENIDYE
FT                   VIPGVSSFLAAAAVLKKELTVPEITQTVIITRIGGRTKVPPKENLKDLSRHKATMAIFL
FT                   SVQDIDKVVLELKEGYQETTPVAVVYKATWEDQVIVTGTLNDISQKVKSKGINKTAMIL
FT                   VGDFLKDVKSYSKLYDREFSHSFRKKENL"
FT   gene            401094..402143
FT                   /locus_tag="Thit_0357"
FT   CDS_pept        401094..402143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0357"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: tex:Teth514_0314 cobalamin biosynthesis
FT                   protein CbiG"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01672"
FT                   /db_xref="GOA:D3T6Q9"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Q9"
FT                   /inference="protein motif:PFAM:PF01890"
FT                   /protein_id="ADD01672.1"
FT                   /translation="MKVAIIALTKNASKLANEIGQKLKGDVYVKEKYSTPEGYAIEGDF
FT                   IDFVHKIFRKYQGLVFVMATGIVVRAIAGVVKDKFTDPAVVVVDEKGKFAISLLSGHVG
FT                   GANRLALKVASIIGAQPVITTATDVEGVISLDVIAKDYGYQIENKEDLKKVSAAFVNGE
FT                   NVRFILDEDAEKIPLLKDYLKNRDDRHADAFVYITDKEIKKPLEKPYVILRPKNIVIGL
FT                   GCKKGIAFEDLFLFVSETFKKLNLSLKSIKSIATIDIKKEEKGIQHLAKFLKVPLVFYT
FT                   KEDLKKVEDKFPISDFVFHTVGVGSVARPSAYLASGGGKEIAYLKKNGMTLAIYKKEGL
FT                   TWDGLKSWE"
FT   gene            402116..402847
FT                   /locus_tag="Thit_0358"
FT   CDS_pept        402116..402847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0358"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="KEGG: tex:Teth514_0315 precorrin-3B
FT                   C17-methyltransferase; TIGRFAM: precorrin-3B
FT                   C17-methyltransferase; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01673"
FT                   /db_xref="GOA:D3T6R0"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R0"
FT                   /inference="protein motif:TFAM:TIGR01466"
FT                   /protein_id="ADD01673.1"
FT                   /translation="MGWIKVVGIGPGDINDMTLKAYNVLKECDVVVGYTTYINLIKPLI
FT                   EDKEVISLGMRKEIDRAKKAVELALQGKNVCIVSSGDAGIYGMAGLMFEVVHKENIDLK
FT                   IEVIPGVTALNAAAAILGAPVMQDFAVISLSDHLVPWQVIEKRLALSAQADFVIVLYNP
FT                   KSKERPENLMKAQKIIMKYKKEDIPVGIVKNASREGQQVIITTLKEMANYEIDMRTIVI
FT                   IGNESTYVENGKMVTPRGYVL"
FT   gene            402844..403593
FT                   /locus_tag="Thit_0359"
FT   CDS_pept        402844..403593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0359"
FT                   /product="precorrin-6x reductase"
FT                   /note="KEGG: tex:Teth514_0316 precorrin-6x reductase;
FT                   TIGRFAM: precorrin-6x reductase; PFAM: Precorrin-6x
FT                   reductase CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01674"
FT                   /db_xref="GOA:D3T6R1"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R1"
FT                   /inference="protein motif:TFAM:TIGR00715"
FT                   /protein_id="ADD01674.1"
FT                   /translation="MILVLAGTKDGREIAERLKLKGFEVIASTVTDYGASLFSEGIKVH
FT                   KGAMDELSLVNFIYKNNIDIVVDATHPFAKDVSINAINACNKTGIKYIRYERESLYYYK
FT                   AIVVKSFEEAAEECKKYDSIFLTVGSKNLEKFRVLWEIGKKVTARVLPLSSVIKKCENL
FT                   GLKPKNIIAMEGPFTKELNYQMFKERNAEVIVTKESGIVGGVLEKFEAAKMLGIPVILI
FT                   KRPDVNYPVVVTDVDSLINEVTKSGHK"
FT   gene            403580..404767
FT                   /locus_tag="Thit_0360"
FT   CDS_pept        403580..404767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0360"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="TIGRFAM: glutamyl-tRNA reductase; KEGG:
FT                   tex:Teth514_0317 glutamyl-tRNA reductase; PFAM:
FT                   Tetrapyrrole biosynthesis, glutamyl-tRNA reductase-like;
FT                   Shikimate/quinate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01675"
FT                   /db_xref="GOA:D3T6R2"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R2"
FT                   /inference="protein motif:TFAM:TIGR01035"
FT                   /protein_id="ADD01675.1"
FT                   /translation="MDINNIKMVGVDKDTPLELREKVSFKDIGEALIKLKELGLEEVVI
FT                   LSTCHRSEIYFYSQKISTDEVKDFFINYFGLKEDFIKYLRQIYGLDAVEHIFRVACGLE
FT                   SMVVGEDQILSQVREAIDTAQTFNSSGKIFFKLFRDAVTLGKKARTDTGIKDLALSISY
FT                   IAVKFVQEVFEDIKGKKAFVIGLGEMGQNAMKNLIDKGADVFVTNRTFSKAIQLKEQIP
FT                   EIHVVPYEQKYLYIASSDIVISATNAPHYTISYEKFKEVYNGRKICMVDIALPRDIDPR
FT                   IGQIEGVSLYTIDDLKKTAEENKKERLSLIPVIEKMVKEEVNKFEKWYKTLEIEPYIKE
FT                   VSRYANEVCNTEFQRIVNKLTDVSEKDKENIKIALKRVANKMANKMIAYLKENAY"
FT   gene            404783..405682
FT                   /locus_tag="Thit_0361"
FT   CDS_pept        404783..405682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0361"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="TIGRFAM: porphobilinogen deaminase; KEGG:
FT                   tex:Teth514_0318 porphobilinogen deaminase; PFAM:
FT                   Porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01676"
FT                   /db_xref="GOA:D3T6R3"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R3"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ADD01676.1"
FT                   /translation="MKKVIKVGSRSSELALVQTQMVINEIKKFRQDFEFEIVKITTQGD
FT                   ALIDKPISEIGGKGVFVKEIESALLKGEIDMAVHSLKDMPYETPEGLKLIPVLKREDPR
FT                   DVFISKDGTQFMNLKEGAKIGTSSLRRQVQLKDLRSDMQTIPIRGNIKTRLRKIEELNL
FT                   DGIVLSAAGLHRLGLESIITEYFPPDVVVPAPCQGILAVEIAESFDNIFQEFYSYIVDR
FT                   RTFFEASIERELLKVFGVNCRQPFGAYAQYRKERDEEKINIKVVYQKEDKLLKSEVTGL
FT                   IEETDKMIEKLIEEFGGI"
FT   gene            405682..407175
FT                   /locus_tag="Thit_0362"
FT   CDS_pept        405682..407175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0362"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="KEGG: tpd:Teth39_1890 uroporphyrin-III
FT                   C-methyltransferase; TIGRFAM: uroporphyrin-III
FT                   C-methyltransferase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01677"
FT                   /db_xref="GOA:D3T6R4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R4"
FT                   /inference="protein motif:TFAM:TIGR01469"
FT                   /protein_id="ADD01677.1"
FT                   /translation="MSGIVYLIGAGPGDIGLLTLRAVELIKNADVLVYDRLINEDILKM
FT                   AKKDAELIDVGKFPDNHKVPQSKINEIIAKKALSGKKVARIKGGDPFVFGRGGEEAEYL
FT                   SQKRIPYEVVPGITSAVAVLSYAGIPVTHRDLSSSFHVITGHEREGKDKNLDWEVISKL
FT                   EGTLVFLMGIKNIEKIVQKLLNYGKDPHTPAAVVMEGTTPEQKVVTGKLIDIPSLVRKE
FT                   GIKNPGVFAVGDVVALRDRLKWYENKKLFGKRILLTRTYEQSQQMKKILSEEGADVVVC
FT                   PTIKITPFLDNIVKFLEEIHKFDYAVFTSVNGVWSFIEASREKRFDLRNLSIKVVAIGS
FT                   KTAEALENIFIYPDIIPEEYTSYSLANALKKHVEGKNIALLTSQIGGDILLESLGNYAN
FT                   VQKIVAYKNEPNYEIKGNLISELRKGVDIAVFTSSSTFNYMHQLIRDEINLLKNSKIAA
FT                   IGPVTKKAIEDKGFNVDIMPSEYTTEKLIEEILKNHQSL"
FT   gene            407193..408167
FT                   /locus_tag="Thit_0363"
FT   CDS_pept        407193..408167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0363"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="KEGG: tpd:Teth39_1889 delta-aminolevulinic acid
FT                   dehydratase; PFAM: delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01678"
FT                   /db_xref="GOA:D3T6R5"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R5"
FT                   /inference="protein motif:PRIAM:4.2.1.24"
FT                   /protein_id="ADD01678.1"
FT                   /translation="MNLVKRPRRLRMNSILREMIRETSLDVGDLIYPLFVVPEDNIKEE
FT                   IDSMPGVYHFSINLLVEEVKEVRDLGIPAILLFGVPSYKDELGSEAYSEEGIVQKAVRE
FT                   IKEKVPEIVVITDVCMCGYTTHGHCGIVENGQVLNDKTVDYIAKIALSHVEAGADIVAP
FT                   SDMMDGRVAAIRKLLDSKGFVNTPIMAYSAKYASSFYGPFREAANSFPQFGDRKSYQMD
FT                   YGNSNEALREIALDIEEGADIVMVKPALSYLDIIRRVKDNFNIPIAAYNVSGEYSMVKA
FT                   AAKMGWIDEKSVVLEILTSIKRAGADMIITYFAKDVAKWLITL"
FT   gene            408149..408721
FT                   /locus_tag="Thit_0364"
FT   CDS_pept        408149..408721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0364"
FT                   /product="siroheme synthase"
FT                   /EC_number="1.3.1.76"
FT                   /note="KEGG: tpd:Teth39_1888
FT                   glutamate-1-semialdehyde-2,1-aminomutase; TIGRFAM: siroheme
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01679"
FT                   /db_xref="GOA:D3T6R6"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042518"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R6"
FT                   /inference="protein motif:TFAM:TIGR01470"
FT                   /protein_id="ADD01679.1"
FT                   /translation="MAYYPIMLNIKNKKCLVVGGGKVALRKILSLVEGEALVTVISSSF
FT                   DEGIIELAAKGKVELIKREYQQGDVRGFFVVIAVTNDEKVNKLVASDGEKYNVLVNVVD
FT                   DKDLSSFIVPAIVKRGDLIISISTSGKSPLLSRMIKEKLESIFNDDYEKLLQNLYQKRI
FT                   ELKEKDFAEEEKIAIYRKIIEKSGLLK"
FT   gene            complement(408713..409114)
FT                   /locus_tag="Thit_0365"
FT   CDS_pept        complement(408713..409114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0365"
FT                   /product="PilT protein domain protein"
FT                   /note="KEGG: ate:Athe_1987 PilT protein domain protein;
FT                   PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein PINc"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01680"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R7"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADD01680.1"
FT                   /translation="MEKIWIDANVILRYLLKDNEEFYAKAYEIMKKADSGELKLLVSPL
FT                   TIAEVVWTLESFYKISKDQISDTLITFICSEAVEAEERDTLILSLNSYRENNVDFIDAY
FT                   IAAHAINSGNKKVFTFDKKHFSRLNVELF"
FT   gene            complement(409095..409379)
FT                   /locus_tag="Thit_0366"
FT   CDS_pept        complement(409095..409379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0366"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: ate:Athe_2482 transcriptional regulator, AbrB
FT                   family; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01681"
FT                   /db_xref="GOA:D3T6R8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R8"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADD01681.1"
FT                   /translation="MIHATSTITGKGQIQLPAEIRKAIGADIGDNVIFIVQDNKEVVLK
FT                   LIKKKKLSQLGGTLKSQVKFKSIDEETENTKEIWVNKRVRRNNNGENMD"
FT   gene            409502..410803
FT                   /locus_tag="Thit_0367"
FT   CDS_pept        409502..410803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0367"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="KEGG: tex:Teth514_0321
FT                   glutamate-1-semialdehyde-2,1-aminomutase; TIGRFAM:
FT                   glutamate-1-semialdehyde-2,1-aminomutase; PFAM:
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01682"
FT                   /db_xref="GOA:D3T6R9"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6R9"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ADD01682.1"
FT                   /translation="MKTDKSQKLFEKAKKLMPGGVNSPVRAFKSVGATPVFIKKGQGSH
FT                   IWDEDGNEYIDYVLSWGPLILGHSHPQVVEAIKKQAQLGTSFGACTELEVKMAEKIIEA
FT                   VPSVEVVRMVNSGTEATMSAIRLARGYTERDIIVKFEGCYHGHSDSLLIKAGSGALTFG
FT                   TPDSKGVTKEVAKDTIIARYNDIKMVEDIFERYGENIAAVIVEPIAGNMGTVLPEEGFL
FT                   KGLREITARYKSLLIFDEVMTGFRVSYSGAQGLYNIMPDITTLGKIIGGGLPVGAYGGR
FT                   EEIMRMVSPDGPVYQAGTLSGNPLAMIAGFETLKILSETSNIYEKLDKKAEKLCKGLKE
FT                   SMVQNGIDVTINRIGSMMCMFFNKESVHDYDSALKSNTTLYAKYFREMLKRGIYMPPSQ
FT                   FETFFLSTAHTDDDIEKTIETSFEVAKIISQQLE"
FT   misc_binding    410930..411179
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 128.75"
FT   gene            411302..412045
FT                   /locus_tag="Thit_0368"
FT   CDS_pept        411302..412045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0368"
FT                   /product="cobalamin biosynthesis protein CbiM"
FT                   /note="KEGG: tpd:Teth39_1886 cobalt transport protein CbiM;
FT                   TIGRFAM: cobalamin biosynthesis protein CbiM; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiM protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01683"
FT                   /db_xref="GOA:D3T6S0"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S0"
FT                   /inference="protein motif:TFAM:TIGR00123"
FT                   /protein_id="ADD01683.1"
FT                   /translation="MKRLMLLATFVLLLIAPQIAYSMHIMEGFLPLKWCIIWNIVSLPF
FT                   VVIGLIAINKKVKENPKLKMLLGFAGAFAFVLSALKIPSVTGSCSHPTGVGLGAILFGP
FT                   FAMSVLGLIVLLFQALLLAHGGITTLGANTFSMAIVGPIASYYIFKGVKKAGGPNWLAV
FT                   FLAASVGDLLTYVTTSFQLAIAFPAEVGGFTASFLKFMGIFAVTQVPLAISEGLLTVLV
FT                   INMLTAYSKEELIELKVLEKEGKAI"
FT   sig_peptide     411302..411370
FT                   /locus_tag="Thit_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.500 at
FT                   residue 23"
FT   gene            412042..412335
FT                   /locus_tag="Thit_0369"
FT   CDS_pept        412042..412335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0369"
FT                   /product="Cobalt transport protein CbiN"
FT                   /note="PFAM: Cobalt transport protein CbiN; KEGG:
FT                   tpd:Teth39_1885 cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01684"
FT                   /db_xref="GOA:D3T6S1"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S1"
FT                   /inference="protein motif:PFAM:PF02553"
FT                   /protein_id="ADD01684.1"
FT                   /translation="MKDKKFLMKNLILGLLIILLVVFPLVSIKNAEFAGADDRATEAIA
FT                   QVDKNYKPWFKPIWEPPSGEIESLLFALQAATGAGFLGYYIGVAKGRKNANR"
FT   sig_peptide     412042..412131
FT                   /locus_tag="Thit_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.561 at
FT                   residue 30"
FT   gene            412322..413089
FT                   /locus_tag="Thit_0370"
FT   CDS_pept        412322..413089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0370"
FT                   /product="cobalt ABC transporter, inner membrane subunit
FT                   CbiQ"
FT                   /note="KEGG: tpd:Teth39_1884 cobalt ABC transporter, inner
FT                   membrane subunit CbiQ; TIGRFAM: cobalt ABC transporter,
FT                   inner membrane subunit CbiQ; PFAM: cobalt transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01685"
FT                   /db_xref="GOA:D3T6S2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S2"
FT                   /inference="protein motif:TFAM:TIGR02454"
FT                   /protein_id="ADD01685.1"
FT                   /translation="MLIDSYAYTNRMYNVHPVEKLLFAFLTMILCFEFDAYTNIAVIIL
FT                   IFVITVFKAKIPAKVYIKLMLIPFSFLIISIITLIINVIGNKSAALISFNIFGVTLGIT
FT                   AQGINTAVILFFRALAIVSCLYFLVLTTPVVDIINILKKLKIPSLFLELLQLIYRFIFV
FT                   LMQAADEIYISQDSRLGYATLKNGYRSLGLLISSLFIKSYKNSEDLYVALEARGYNGEI
FT                   KVLSKDYKFCYKNIIFIVLIELILISASMLLRR"
FT   gene            413093..413923
FT                   /locus_tag="Thit_0371"
FT   CDS_pept        413093..413923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0371"
FT                   /product="cobalt ABC transporter, ATPase subunit"
FT                   /note="TIGRFAM: cobalt ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; KEGG: tpd:Teth39_1883 cobalt
FT                   ABC transporter, ATPase subunit; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01686"
FT                   /db_xref="GOA:D3T6S3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S3"
FT                   /inference="protein motif:TFAM:TIGR01166"
FT                   /protein_id="ADD01686.1"
FT                   /translation="MKEQFILEAIDITFEYSDGTKALDEVNMSIEEGKKIAVLGPNGAG
FT                   KTTLFLHFNGILKPKSGKILYKGEEINYSHSELVKLRKNVGIVFQNPDIQLFSASVYQE
FT                   ISFGPMNLGYPENIVKEKVENAMKETRIIGLKDKPTHFLSYGQKKSVSIADIIVMEPEV
FT                   IILDEPTVYLDPKHVQEIMGLFDKLVEKGKTIILSTHDVDFAYSWADYIYVMKNGKVVA
FT                   KGEPTAVFANAKELDRSDLKKPMLLEIYEILKEKGIISGSNIPKNIEELKKYIK"
FT   gene            complement(414144..415355)
FT                   /locus_tag="Thit_0372"
FT   CDS_pept        complement(414144..415355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0372"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="TIGRFAM: isocitrate dehydrogenase, NADP-dependent;
FT                   KEGG: tpd:Teth39_1882 isocitrate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01687"
FT                   /db_xref="GOA:D3T6S4"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S4"
FT                   /inference="protein motif:TFAM:TIGR00127"
FT                   /protein_id="ADD01687.1"
FT                   /translation="MIGKIQMKVPLVEMDGDEMTRIIWKLIKEILLEPYIDLKTEYYDL
FT                   GIKNRDETEDQVTIDAAYAIKKYGVGVKCATITPNAQRVEEYNLKKMWKSPNGTIRAIL
FT                   DGTVFRAPIIVSSIKPLVKTWKKPITIARHAYGDIYKDVEYRIENRGKAELVFTSETGE
FT                   VSRQTIHEFEGPGVILGMHNTDESIKSFARACFNYALDTKQDLWFATKDTISKTYDHRF
FT                   KDIFQEIYENEYKEKFEEAGIEYFYTLIDDAVARIIRSEGGMIWACKNYDGDVMSDMVA
FT                   TAFGSLAMMTSVLVSPDGKYEFEAAHGTVTRHYYKYLKGEETSTNSIATIFAWTGALKK
FT                   RGELDGIDSLVDFADKLEKASLQTIEKGIMTKDLAALSDLPNKIVVNTESFLLEIKKNL
FT                   EEII"
FT   gene            415677..416207
FT                   /pseudo
FT                   /locus_tag="Thit_0373"
FT                   /product="hypothetical protein"
FT   gene            416293..416499
FT                   /locus_tag="Thit_0374"
FT   CDS_pept        416293..416499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0374"
FT                   /product="abortive infection protein"
FT                   /note="KEGG: amt:Amet_3349 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01688"
FT                   /db_xref="GOA:D3T6S5"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S5"
FT                   /inference="similar to AA sequence:KEGG:Amet_3349"
FT                   /protein_id="ADD01688.1"
FT                   /translation="MSQEYYFNIIGNAIQFLDSHLSRKLDYLSSHITRIGEILTMTNWL
FT                   LFLLFIVLCINTFINWKRYKNGK"
FT   gene            416898..417236
FT                   /locus_tag="Thit_0375"
FT   CDS_pept        416898..417236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01689"
FT                   /db_xref="GOA:D3T6S6"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S6"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0334"
FT                   /protein_id="ADD01689.1"
FT                   /translation="MHLKKIFYNYLFKFGWLLPILTLAINISVYKYLPDNIALQKDAFG
FT                   NINYWINKLEFIFFIPVLQLFAYIAVKYPQAKRKKQIFHGVFDIGGGIILLFLDIFLIY
FT                   LFIKQSSV"
FT   gene            417594..418235
FT                   /pseudo
FT                   /locus_tag="Thit_0376"
FT                   /product="hypothetical protein"
FT   gene            complement(418393..418826)
FT                   /pseudo
FT                   /locus_tag="Thit_0377"
FT                   /product="hypothetical protein"
FT   gene            419060..419500
FT                   /pseudo
FT                   /locus_tag="Thit_0378"
FT                   /product="hypothetical protein"
FT   gene            419509..420275
FT                   /pseudo
FT                   /locus_tag="Thit_0379"
FT                   /product="hypothetical protein"
FT   gene            420757..420915
FT                   /locus_tag="Thit_0380"
FT   CDS_pept        420757..420915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0380"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SMC6; structural maintenance of chromosomes 6"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01690"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01690.1"
FT                   /translation="MKVKRQDEGVKTRIKKQDLDVKTWLDLTEEELKIISDVCNCMYGR
FT                   KNTIGDG"
FT   gene            421073..422434
FT                   /locus_tag="Thit_0381"
FT   CDS_pept        421073..422434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0381"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   kol:Kole_0769 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01691"
FT                   /db_xref="GOA:D3T6S8"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADD01691.1"
FT                   /translation="MFKSKYIHECFINSKLLLFHTLTFSYEILTGEDIVLWEKNKFDFI
FT                   SNKKLGKLISKLFIVEDKGSDEALLNKAITLLGNKGRLKPQFFIYVTTECNLNCPYCYQ
FT                   RDYKSKNITISKKHVDSVVTTIDLLSKKENKHLVIFGGEPLLPQNKQIIEYMFDRFKTI
FT                   DATVEIVTNGIYLKQYDDVLSSNKQMIKILRFTLNGPKKIHNFIRDNSNFDTFRIITDN
FT                   IRYVLNKYDHIQVIINFLLDKLNCDSISDLFNELEINDILGKQNCRIEFGRIQSRKHPE
FT                   NNFYKNELPYTEYYPVLLRTKLKDKRITDEMLIGSEVSILGKIYRQFLKKEIAIPNLKG
FT                   CKAIYPGVFAFYPDGKIYPCDEIAGDVSYAIGQYYPYFMFYKEKENWSSYSVLDNEKCL
FT                   KCKFIGMCNGGCLVSNLAVNGDINSPYCLDIENSLNNFLVELELEGFFNGQDYS"
FT   gene            422415..422606
FT                   /locus_tag="Thit_0382"
FT   CDS_pept        422415..422606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Plasma membrane t-SNARE involved in fusion of
FT                   secretory vesicles at the plasma membrane ; K08486 syntaxin
FT                   1B/2/3/4"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01692"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6S9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01692.1"
FT                   /translation="MDKIILNQYQSYYDISEKKGAVVDFLVGKINYISKTSANLEIYEE
FT                   FSHLYEEKSNILQKNCRE"
FT   gene            422603..423697
FT                   /locus_tag="Thit_0383"
FT   CDS_pept        422603..423697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0383"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   kol:Kole_0769 radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01693"
FT                   /db_xref="GOA:D3T6T0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T0"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADD01693.1"
FT                   /translation="MISNRINFTIIPTYLCNMNCEYCYEGDLKRIKKIVDIDYAEAIVK
FT                   LLKEILKDERNKDIEFNILGGEPIMQRNMKFYDYLFKNIQNLSVSYKLNFITNGLEIKK
FT                   YIKNLKKYGITTCQITLDGSVETHNKRRIPIDTTINSFERVCESIDCLLENNIYTYVRV
FT                   NIDEQNINDLPELSEVVISKKWNNFKNFHIYLYPISFSGHNPNKIYLEECEILNKVLSI
FT                   FKSMPQKNRLFGLDFHGISFIDALRGNETPPLKFVFCDACRNQYVFDALGYIYSCWWGA
FT                   GRDEFKIGEKFGNEYVLDDNRINKWRNRNITTISNCIKCKFKYICGGGCSYKAILRKGD
FT                   LFKGNCYSFDKIIESYLRYLNDYQ"
FT   gene            424098..425129
FT                   /locus_tag="Thit_0384"
FT   CDS_pept        424098..425129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0384"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: gwc:GWCH70_0486 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01694"
FT                   /db_xref="GOA:D3T6T1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01694.1"
FT                   /translation="MRVIEVKNLTKVYCAYEGKSLGRIFKRLWSREGVKEVKALDNVSF
FT                   SIDLGESVGLIGVNGAGKSTTIKILTGILEPTEGVVRVFGNIPSKHRMKNNYRIGAVFG
FT                   QRTQLRWDLPAYESYGLLKEIYNVDDKVFKERLDYFSEVLDIKKIMHRPVRTLSLGEKM
FT                   RAELCAAFLHGPEVVFLDEPTIGLDIFSKEALLHFLKEIKEEKKVTIILTTHDLSDIEE
FT                   VSDRIIILDRGKILFDASKDEVLNTLEVGSQIIFTLKNKEAVIPQSVKSLPFSISKNFL
FT                   KVDNVSKDLVPQVLTDVFSYNTVLGVEINYPDFKDIVKQIYLQNKDRGRKNGDNLYKGK
FT                   IGF"
FT   gene            425092..425898
FT                   /locus_tag="Thit_0385"
FT   CDS_pept        425092..425898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0385"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01695"
FT                   /db_xref="GOA:D3T6T2"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T2"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADD01695.1"
FT                   /translation="METISTKARLGFKLIKIGFESQYIYRLGTFFSFLSGLLYLIMQYF
FT                   LWQAIYHSGDIKQYSFNDIIFYIFLAQIISYVFPTDVSSKIAFHVRTGDIIHLLLKPVK
FT                   IETQLFYESLGKSAYRLLINGGFIFIVLLVLLPYKLELTVLRFFQFALILLLSYVFVFF
FT                   FELLMGIIAFYTTSTWGIQSFKYVIVGIFSGRLMPISLYPPVFRKIVDWLPFRIIYFTP
FT                   IEFIMNKANYDFCNVVKYQTVSIALLLLLYVLVYRNALKKIKVQGG"
FT   gene            425902..426699
FT                   /locus_tag="Thit_0386"
FT   CDS_pept        425902..426699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0386"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; KEGG:
FT                   protein of unknown function DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01696"
FT                   /db_xref="GOA:D3T6T3"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T3"
FT                   /inference="protein motif:PFAM:PF06182"
FT                   /protein_id="ADD01696.1"
FT                   /translation="MKNMLLRYIKLYIHFTKINISSFMEYDADFLFGIVALILKNLINL
FT                   LIIFFIFHLIDNIKGWDFNQILFLYGFSSTSFAIWHCFFINTISLPFYTRTGLLDSFLL
FT                   KPVDVIFQIMADSFDEDGIGDLIFGIIVLTIAIVRLKIVSIKLIFLPVLLLSGSLIYAS
FT                   LGLISSSISFFTIGETGISNLVMDFFEFSKYPITIYNDILKIVFTVLIPIGFTAFYPSL
FT                   FYIANYKYGLVLVLITPVVSILFFLISYKVWNLALRHYSSTGN"
FT   gene            426898..427680
FT                   /locus_tag="Thit_0387"
FT   CDS_pept        426898..427680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0387"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: tpd:Teth39_0419 transcriptional activator of
FT                   acetoin/glycerol metabolism-like protein; PFAM: regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01697"
FT                   /db_xref="GOA:D3T6T4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T4"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD01697.1"
FT                   /translation="MNFLCPQEELISSYERCREIGIDPSITLPLVILNPEDLQKKIHKN
FT                   KELIEAFHMSVEEDWVKGEYLFLLTDVEGYLLETKCSIKEERCIKDSGFRLGISFEEES
FT                   CGTNAISMAMQLKRIVYIRPQEHYCDIFKKWHCIASPIIVEDGEIMGYIDISTIDKKIA
FT                   DEVSMVKKLLAEKIASEYEKIVKEKELNEIKIKLNDNQIKILALEAKGYRELDIAEALG
FT                   IGVVTVKYHKRKIVEKLGVKNIKEAVAKAIKLGLIDED"
FT   gene            428283..428486
FT                   /locus_tag="Thit_0388"
FT   CDS_pept        428283..428486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0388"
FT                   /product="UTP20"
FT                   /note="KEGG: UTP20; UTP20, small subunit (SSU) processome
FT                   component, homolog (yeast); UTP20, small subunit (SSU)
FT                   processome component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01698"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T5"
FT                   /inference="similar to AA sequence:KEGG:417933"
FT                   /protein_id="ADD01698.1"
FT                   /translation="MKEITKLSKIWLNIEKPVKKGLKISNELTLESNIKKLIRKEIDSE
FT                   IDIVETILDVGCHPSAPRRMIS"
FT   gene            428778..430295
FT                   /locus_tag="Thit_0389"
FT   CDS_pept        428778..430295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0389"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: nfa:nfa34430 hypothetical protein; PFAM:
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01699"
FT                   /db_xref="GOA:D3T6T6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADD01699.1"
FT                   /translation="MNAKVLWENREVSSFSRLYALFFILIILFFISLKRIIYLASDITV
FT                   VSWINDIVRKEFISGVGLKFFVLGLLPEIPYWIKFKREKNGIVIYNIRKNLFYRSNSLL
FT                   LYLILKMLSKNYSVEQIVEIISEDNKISFLKAKEKVDHYLTQLQKIIIGENREGNNTNY
FT                   SIDHIYEFESPLVLSLLLTYKCNLKCKHCLVGSLRHYQIKELELDDIKKLAEQMEKYEI
FT                   FKIILNGGEPTVRKDFFKILEIFNKHKIPIELVTNGINLSKEKIEIMNSYHVVGYSLSI
FT                   EGSNSETHDFIRGEGTFKKVISSISNLKKFSIAFQVDVEVIYGKHNMMQIEEIVKLLSN
FT                   LGVTSVKFARLKPWDWGQQLSNIVPNKEEIKKVNEKIWNIEGKYKGIKIMGDVPKSIED
FT                   QKVPGCNINVGFEIQPDGNVLPCRIFEQRVDDKIILGNIKSQDIFEIWNSEKAKRIRSY
FT                   SKRLSKKFLCTKCEFARFCSTNYCIAENFLTFGKFIPSEEDLNKCKI"
FT   gene            430283..431482
FT                   /locus_tag="Thit_0390"
FT   CDS_pept        430283..431482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0390"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   tte:TTE0395 major facilitator superfamily permease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01700"
FT                   /db_xref="GOA:D3T6T7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD01700.1"
FT                   /translation="MQNLKRNERFFLTVTLFSSFFTSLMAPFWVIYFNKINLDFSQISL
FT                   LIIINHIAVILFEIPTGAFADTYSRKFSVLLSLLIGSLTSIGIYFNTSFTVLLFLYFLS
FT                   GVGATLNSGAFESWFADSFLFGQKEMDLTKYWGRLTSFNYLGSTIGFLGGSVLVRYNIF
FT                   REIWLIEGIGIFLVFIYVFLAGKEAKLQKKTDEYSYREYFNKIAKGTVYLFKHRILLSI
FT                   TVGSFFFFFSSGIMSMLWQPYFERAGIPVELFGIILALTMVLSIFVPRYADRIAERFGG
FT                   AARTLMIVSITSALFIFMMYAIPKYSFIPYIIYTAVYSAHTPIFMSYFNKLIPSSERAT
FT                   IISIYSLFISVSTILCTYSFGILSDKKGLYAALFLSLITALISSIPFKRAIGLEKELCL
FT                   "
FT   gene            431750..432094
FT                   /locus_tag="Thit_0391"
FT   CDS_pept        431750..432094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0391"
FT                   /product="ATP-dependent transcriptional regulator,
FT                   MalT-like, LuxR family"
FT                   /note="KEGG: tte:TTE2750 regulatory proteins; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01701"
FT                   /db_xref="GOA:D3T6T8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T8"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD01701.1"
FT                   /translation="MYYHGYVDISTINKKITNEVSMVIKLLAEKIAVEYEKILKEKEIN
FT                   EIKIKLNDDQIKILTLEAKGYRELDIAEALGIEVVTVKYNKRKIVEKLEVKNIKEAVIR
FT                   AVKLGLIDVD"
FT   gene            432442..432642
FT                   /pseudo
FT                   /locus_tag="Thit_0392"
FT                   /product="hypothetical protein"
FT   gene            432941..433525
FT                   /locus_tag="Thit_0393"
FT   CDS_pept        432941..433525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcg:BCG9842_B2869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01702"
FT                   /db_xref="InterPro:IPR032624"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6T9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01702.1"
FT                   /translation="MMKKIVIIMSIIALFTLVLSVPVQARELERGNEKNSLNSSLLIKS
FT                   PMRIDEKVCEYLKTVKENYEEEILESKTVQSFAAAPPLTYLQVYAVISSQHPTYEYFSE
FT                   NQLSSVEDHGGDEMYIVTIEIGYGHLRFAKMNGSLLNSVQSQPIDLDNDSIIDGWFYWW
FT                   DASGYDSGDFTYQNTSSNYPWNTMSDFIHIK"
FT   sig_peptide     432941..433018
FT                   /locus_tag="Thit_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            433561..434001
FT                   /locus_tag="Thit_0394"
FT   CDS_pept        433561..434001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0394"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dhd:Dhaf_3180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01703"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01703.1"
FT                   /translation="MMIMPLCYQQQIRYDGEITKHDKRQEISNTFVIKNNDKANNSSDI
FT                   WKELSGKYNIRNASFSDIKNISYELYKAGQISLLDYGILTFDPSESPQRIKPNIFLTQF
FT                   DSNGRMDWIAEYEARVNRDLKIGNTTGYLNNKRILNILKRLL"
FT   gene            434438..434754
FT                   /pseudo
FT                   /locus_tag="Thit_0395"
FT                   /product="hypothetical protein"
FT   gene            434956..435211
FT                   /pseudo
FT                   /locus_tag="Thit_0396"
FT                   /product="hypothetical protein"
FT   gene            435247..435960
FT                   /locus_tag="Thit_0397"
FT   CDS_pept        435247..435960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0397"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tex:Teth514_0346 ABC transporter related;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01704"
FT                   /db_xref="GOA:D3T6U1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01704.1"
FT                   /translation="MNSVLSIKNLKKYYGKIKAVDGITFELYPGEVVGLIGPNGAGKST
FT                   TLKTIMGLLRKTEGEIKVCGYDYKDKEARKKLSYIPEIPDIYPMLTVWEHMKFIALAYN
FT                   LDNWEKEALRYLEAYDLLDKKDELGANLSKGMRQKVMVICGLLYKPEVMLFDEPFVGLD
FT                   PKAIRELKDTIRELKKEGKSVLLSTHMLDSVQNLGDRVLILKAGKLIYEGTLEEVMEKA
FT                   GPNGTLEDLFLEVTK"
FT   gene            435957..437549
FT                   /locus_tag="Thit_0398"
FT   CDS_pept        435957..437549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01705"
FT                   /db_xref="GOA:D3T6U2"
FT                   /db_xref="InterPro:IPR031584"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U2"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0347"
FT                   /protein_id="ADD01705.1"
FT                   /translation="MTEIKALLTLDLLRFKNFVKDIIKNPKRIFIYLLQFIWYVFILIP
FT                   VITNRGKTFNEISTIKFEVFNAVLIAVMLLGVFASLFTSLRQPGIILSPGDTAFLLSSP
FT                   IRERMIFFWYMVRSIFKNLFIAVLFIIYLPFLSVTMEIFKYSQNLIWGYLGVFTFYLAL
FT                   SPLSFLFYSISMKFNAKEIIKYILWSVLVLLLGSAVYFAYKEQNIYSFIEYFDLKGWDY
FT                   VPIIGPSKGLILSYFTGNSHNAIIQIILQLVTIVLLVFIGLYFATDYYEEVVTYNEKIR
FT                   KIREKADKGDLSGTEENIKKKKRKVEVKFSPKGPWAFIWLKMVENKRQIGSIYFNFYNL
FT                   FLLVISIAFGYFLPKNDSTIIFVLAFMYAYMGWLLSMVSAIGAELNRMYIYIIPGEGIE
FT                   KLIAVNFVPLLKSFITAILLIVPASIFIKPGLLNTIAAILFIISLSVLQNFSYAFLLTF
FT                   MPSKEDIKIAIPFFRLFGLLFVLIPVGLVSIPLGIATKSMGIGILSASIIMLLEAGMFL
FT                   LFANYIFERLELK"
FT   gene            437562..438335
FT                   /locus_tag="Thit_0399"
FT   CDS_pept        437562..438335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0399"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="KEGG: tex:Teth514_0348 regulatory protein, LuxR;
FT                   PFAM: regulatory protein LuxR; SMART: regulatory protein
FT                   LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01706"
FT                   /db_xref="GOA:D3T6U3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U3"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ADD01706.1"
FT                   /translation="MGDIKSNEILFSYKKCLEIGLTKSIVTPLISLEEEELKRKLQENK
FT                   KLIEVFRKCVNKVRAQLKKRYIFLLVDSEGYLLDVLCNRKIYKDITDLGIKRGTSFKEE
FT                   SCGTNAISLAMKLKQPIYLKPEEHYCDIFKQWYCIATPFHIDNQIVGYLDISIIEHNMA
FT                   DEMMGFIDLLVYKIANEYKREMDLESQEDLEKLTDKQIEIIKKCAKGYTELAISMELGL
FT                   KPATVKYHKKEIIKKLRVKNLQQAIAKAIKLNLID"
FT   gene            438711..439472
FT                   /locus_tag="Thit_0400"
FT   CDS_pept        438711..439472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0400"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cce:Ccel_1396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01707"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01707.1"
FT                   /translation="MRFFPVVLLFILILIIFTACNGGNWMSYHVKETKQISKQLSGIEK
FT                   IKIYNGVGEIICIPSNDSEVKVYITKKVSGQDKSYAQDVCNRISFSFSVENSTLSINAK
FT                   IDDKEFWKWKSDNYKGDISIDYRIEIPKEIKNVTCETGVGDIEVKDIRARFYLKTGVGE
FT                   IKVSGIEPMLNSKIESGIGDVKAKLANIENVTELYVKSDLGDINLSIPKNSKCKIDAVV
FT                   NNHKCDFESDNNAKVVVTVRTGLGDIKLNKF"
FT   sig_peptide     438711..438779
FT                   /locus_tag="Thit_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.390 at
FT                   residue 23"
FT   gene            439515..439676
FT                   /locus_tag="Thit_0401"
FT   CDS_pept        439515..439676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0659 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01708"
FT                   /db_xref="InterPro:IPR027601"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01708.1"
FT                   /translation="MKYIIKPIKEITRGYCIWCFGKSCGNVCTNNCGRVCLVDCVVNDA
FT                   GDMEVNNK"
FT   gene            440693..440800
FT                   /locus_tag="Thit_0402"
FT   CDS_pept        440693..440800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01709"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01709.1"
FT                   /translation="MIASKFVQNIAKRGKKSIKRMRKTEIQFIAKAKKA"
FT   gene            complement(440870..441901)
FT                   /locus_tag="Thit_0403"
FT   CDS_pept        complement(440870..441901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0403"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Insertion element
FT                   protein; KEGG: tpd:Teth39_0240 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01710"
FT                   /db_xref="GOA:D3T6U7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR003220"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6U7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADD01710.1"
FT                   /translation="MQNIVPLKCPKCNNTSLFYKYGKTKDGYQKYLCRKCHHQFAPDKP
FT                   SSKKTPKYPRCPVCGKASFLHHDYEYYSNYRCCDKKCNHSFFVPKPTAIPSTSMSKLVG
FT                   KTNFKRMRYPVHIILSALSMFFLGKNSFRNISLILKTTFNVEVSHTTISNWCRKFAPLF
FT                   HNISLELIPMLNFNSDEWHVDETVVKIAGEKYYIWFVIDSETRFILGFHLTPYRDSRQA
FT                   FALLNSVRNLGTPSAIVSDRYSAYKVPVKSLFGYSVKHIRVESFKNDISNNLIESFHHQ
FT                   FKAWYKAKQGFASFESANNLISMFVFFYNFVRPHSSLNGWTPAQVAGLNLTPKEKKKYL
FT                   LVA"
FT   gene            442026..443378
FT                   /locus_tag="Thit_0404"
FT   CDS_pept        442026..443378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0404"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: cbf:CLI_0660 radical SAM domain-containing
FT                   protein; PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01711"
FT                   /db_xref="GOA:D3T6X9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027622"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6X9"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADD01711.1"
FT                   /translation="MKASKYNIILTMDDGTKIAFNSMTCALAEINDDFIEIIEKIDSLQ
FT                   YEKLDAKQKLLVDKMLEGNYIVHDNIDELKLIKYKHLSGKFNNESLGLTIAPTLSCNFE
FT                   CPYCYENPKQSFIKEDVVKGILEMVSEAAKRKKDIYITWYGGEPLIAKDILFDMSQKMI
FT                   NICRENETNYSSYIVTNGYLINDDIVNKFREIKISGAQITIDGPPYIHNKRRKLKGSDK
FT                   GTFDVILSNVKKLSEAGINVTIRVNIDKTNIDKLEELLDILEINGLKNIQLALGQVTAY
FT                   TEACASVAETCLDTEEFAKVNIIFQNILHKRGFISHGYPYYPGTKANYCTADTIGSFVV
FT                   DPDGYMYKCWNDIGNIKRAVGNVKNFKEILDHDMYTRYINYILWSPFDHKECIECKLLP
FT                   ICMGGCPYNGEKNGSTPDCEKWKYNLEEILKLTYMQKKDMLEENLEQKRSV"
FT   gene            443390..443992
FT                   /locus_tag="Thit_0405"
FT   CDS_pept        443390..443992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbl:CLK_3789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01712"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y0"
FT                   /inference="similar to AA sequence:KEGG:CLK_3789"
FT                   /protein_id="ADD01712.1"
FT                   /translation="MNINLNFKDIRMLKYLLSDDVWIKKLQKIREVFDFYSSVDVLLFE
FT                   SVKEISIYLGLEVPEWVVGTYFDKTIIMLDYEIWKNKGVGTFGQILLHEFVHVVITKIT
FT                   KNRCPVWLNEGIAMYFAEQQVNIFKKTNEDFYCENIFELTYDNEELYFISAITVDRLIK
FT                   VYGIETILFRIKNVSNYKEDYILGVDNIKRISYQYCI"
FT   gene            444005..444493
FT                   /locus_tag="Thit_0406"
FT   CDS_pept        444005..444493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0406"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cbi:CLJ_B0672 acetyltransferase, GNAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01713"
FT                   /db_xref="GOA:D3T6Y1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADD01713.1"
FT                   /translation="MDYLIRVANINDLDSIVKLWEKLSIDQMSKDPYYKGDLVFSGGYS
FT                   QFKQALNSDNCCIFVAEVNNIVIGFIEVWLYQKDFYFFIDDYAYILHFFIDPDARRSEN
FT                   ILSIIYNLFEAALNWAIEKGSQYIIADAFAHNIRIMKLLEKVGFESYRIRYVKELGSK"
FT   gene            444521..446242
FT                   /locus_tag="Thit_0407"
FT   CDS_pept        444521..446242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0407"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cbl:CLK_3791 putative ABC transporter,
FT                   ATP-binding protein/permease protein; PFAM: ABC transporter
FT                   related; ABC transporter transmembrane region; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01714"
FT                   /db_xref="GOA:D3T6Y2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01714.1"
FT                   /translation="MKCLLRRIIPLIKPYLFFEILGAILTILYTFAVFATPLVSKYLID
FT                   EVIPAKSIYKLYLGLGIFLIVCIAQPIVGYLKDLLFLHITEIITLKIRKKLFLKLIYAP
FT                   LKFFDDTHKGEIISRIINDSRGASEFITNFFVIFVKNVFLIIVVIGGMLYLSPMITGIV
FT                   IILFLLFFIVNWILSRRFSILQAKVQQNYDMICTNVEQMADSILTIKSFLAENKIFDKY
FT                   EQVVTNAYRNNKKIGHLSILLNNLTGVIVILSLVVIYGVGALQVMNEHMTLGTIIAIGL
FT                   YFQILVQPTYELLNNNIHLRKVIPIFDRLYEYFDLENEPLKDEIISLDGEISVERVSFY
FT                   YNENVCALNDISFIIEPKSFVALVGRSGSGKSTFVKLLLGFYRPTSGKIKIGGKDILDM
FT                   GVNVLRKNISFVPQDIELFNTSIKENIRFGKPNTSDEEIFEICKKLKLHEKIISLPEGY
FT                   DTIISERVNLSGGEKQRVAIARALIKKPKIFILDEPASSLDPENEMILSEILKEISKNC
FT                   TVIVIAHRITTVVDADKIIVFEKGKVVEEGTHSTLINKNGLYSKFVLNNKNLKQVI"
FT   gene            446285..448753
FT                   /locus_tag="Thit_0408"
FT   CDS_pept        446285..448753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0408"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cbb:CLD_0167 putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01715"
FT                   /db_xref="GOA:D3T6Y3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y3"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADD01715.1"
FT                   /translation="MRALFKLALRNIIAKKVRFFILFLTFILSAVTLMAAIFFRNAAIE
FT                   SREEQLRNNTLNSQIVILSSNDRDIYFKPEDVLNKIKNIEGIKYTVERCGGVAAYQDEK
FT                   INVVGVDFNKQSQVYSFNYINHIQLPASENQIVVSKVFSKKYGLNIGDVILLSTQNNEI
FT                   KFKVSGIAEDKGIFQEGNIVFVNIDAAQRLFKKEGMVYSIGITLKNLDSISDVANDIKK
FT                   AIGSGYIVEERYDIESYKAYVGTISMALSIFSAFAIFITLFLTYSTFKTVLYERISQIG
FT                   TLRSLGATKMEIFISTYIESFIIITISTIIGLIVGFPFLHFILKLIVEDEIIMKFSILK
FT                   FMLVFFMLLVTGLLSVILSVLRIFKISVVDIIKGNVEKHTKKKNILKNYAGAVMIFVSI
FT                   ILLILSEKMDNGIFYLISGIILFSFSFILLIEFLHILINNTLLKFINLLGPEARLLNKE
FT                   FKRDFSRSAESIILISIIIGIAYLSFTLSYLVKESVDKVYKGVDIVINTDSSMGSLDEK
FT                   LSSISGVDKVVSQLRVKERIRDMDVEISGIDPEKYKDFSFEIYKNGSIDELFKQLNYGK
FT                   NIIITNTFAKNTNTKVGDYIQIKSKTKEKGEKYKVIGVVSSFENMGKVLFISKDNFIKD
FT                   IGSNDYTLYLLKIKKNYNVSQVENGITEMLGEKAYYSINSLEEMKKLNAEDNNRLFLIV
FT                   NALFLISVFISIFSLNNNLIINVLTQVRYFAIKRTVGMSLKQLLFSIIGEGVIIGFEGG
FT                   IFGLLFGFCLNLFIVKILSYYVGDLSFGYNYLVYLILLLSSIFIGFISSIYPFIKIRKI
FT                   NIVEAIKGIE"
FT   sig_peptide     446285..446392
FT                   /locus_tag="Thit_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.465 at
FT                   residue 36"
FT   gene            448786..449454
FT                   /locus_tag="Thit_0409"
FT   CDS_pept        448786..449454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0409"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: cbf:CLI_0667 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01716"
FT                   /db_xref="GOA:D3T6Y4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01716.1"
FT                   /translation="MVILKTEKLFKEYNVEGNVTKVLNGIDLEINEGEFVSIMGPSGSG
FT                   KSTLLYVLSGLEKPTSGSIFFKGEDLTLLNDDKLSKLRRREFGFIFQFYNLIPNLNVEE
FT                   NITLPLEFEGINRKEYNSNIDKILERVGLIEKKQNFPYQLSGGQQQRVAIARALIIDPK
FT                   IIFADEPTGNLDSKAGEEILKLLYNLSKENNKTVLMVTHDNYAASFSDRIIKIKDGVIE
FT                   "
FT   gene            complement(449739..450686)
FT                   /locus_tag="Thit_0410"
FT   CDS_pept        complement(449739..450686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0410"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: tpd:Teth39_1877
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01717"
FT                   /db_xref="GOA:D3T6Y5"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y5"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ADD01717.1"
FT                   /translation="MQTFLSSVQGVLTIVFMLILGYYLAKAGWFDRTISDLFAKLVVNI
FT                   TLPLSMIVNITSTFSKKQLERSGRGLLIPFLSILISYLIAYILAEIFKVKRERKGVFTA
FT                   IFSLSNSIFVGLPMSQALFGEVATPYTLLYYMANTTIWWTLGVYGIARDTNGKDQKILT
FT                   LDTLKRIFNPPLIGFIGGVILVFVNIKLPTFIFDSFKMIGGLTTPLSIFYVGITIYEMS
FT                   FDKFKLDKDAFMVFIGRFLVTPALVWILDLFIPIPKLMRDVFIIMSAMPVMVNSSIIAR
FT                   VYKADYEFATSMITYTTIFSVVIMPFLMVLIKVI"
FT   gene            450788..451450
FT                   /locus_tag="Thit_0411"
FT   CDS_pept        450788..451450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0411"
FT                   /product="protein of unknown function DUF1648"
FT                   /note="PFAM: protein of unknown function DUF1648; KEGG:
FT                   tpd:Teth39_1876 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01718"
FT                   /db_xref="GOA:D3T6Y6"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="InterPro:IPR026272"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y6"
FT                   /inference="protein motif:PFAM:PF07853"
FT                   /protein_id="ADD01718.1"
FT                   /translation="MHENYDVKQEMKKDWWLIGIILLIWIFTFAVFGHLPDKIPMHWNI
FT                   SGQVDSYGPKQDVFILPSVITVIYFLMVFVPLIDPKKANYSKFAGAYRMIRAVLVIILS
FT                   ILYFAATYSALGYKVNMDRLGSAVIPVMLIAFGSAMGKLRHNYFVGIRTPWTLADEEVW
FT                   NKTHQLGGKLWLIAGIIGLFASFFSGTWVAVLMFVLLITAVIVPIVYSYIIFKNEEK"
FT   gene            451683..452723
FT                   /locus_tag="Thit_0412"
FT   CDS_pept        451683..452723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0412"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   tpd:Teth39_1875 peptidase M42 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01719"
FT                   /db_xref="GOA:D3T6Y7"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y7"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADD01719.1"
FT                   /translation="MDYKNLLKKLCESHGVSGHERGIYDLLKEEFATISDEVAEDKFGN
FT                   LFFLKKGTKGKYKVMLAAHLDEIGLIVKDIDDKGFIKFTTVGGVDQRTLPSQEVIVHGK
FT                   KNILGVIGSKPPHLLSSGDMEKAIKIEDMYIDVGMSKKEIEELIKIGDVITIKREFREL
FT                   LNDYVSGKALDDRAGIAVMAICLEELKKLYHYHDVYAVATLQEEVGLRGATTSAYNVEP
FT                   DIAIAIDVTHGKARGVSTEIELARGPAIGKGPNIHPAVYKGLVDTAKEYNINHQIEPLP
FT                   GPSGTDAWAIQISRGGVPTGLVSIPLRYMHTSVETVNMKDIINSGKLLAYYIANLPEEL
FT                   EGQLCY"
FT   gene            452714..453736
FT                   /locus_tag="Thit_0413"
FT   CDS_pept        452714..453736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0413"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="KEGG: tpd:Teth39_1874 cellulase; PFAM: peptidase M42
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01720"
FT                   /db_xref="GOA:D3T6Y8"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y8"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADD01720.1"
FT                   /translation="MLLKELTDLMGASGDEKEVREKIKEIVKPYVDELYVDKMGNLIAC
FT                   KKGKKEKPKVMLAAHMDEVALMVKSINEDGTLSFSPVGGVDNRILVSKTVKVGEKRVNG
FT                   VIGAKPIHLQKREEQQKPLDFDALYIDIGATSKEEALKHVSVGDYVYFDANFELLGNGY
FT                   VKSKALDDRIGCNVLIEILKRDYEYPVCAAFTVQEEVGLRGAGVAAYNIEPDFAIVVEG
FT                   TVAADVSDSEPHLVSTELGKGPAISLMDRTTLYDKKIINKIVKIAEENGVPYQFRRIAS
FT                   GGNDAGKIHLTKGGIKAIAVSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIAKEALI
FT                   "
FT   gene            453733..454716
FT                   /locus_tag="Thit_0414"
FT   CDS_pept        453733..454716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0414"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG:
FT                   tpd:Teth39_1873 peptidase M42 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01721"
FT                   /db_xref="GOA:D3T6Y9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Y9"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ADD01721.1"
FT                   /translation="MSLNIELIKKLTQTYGPSGSEEKVLQVIKEEVKNFCDEITYDALG
FT                   NMICRKTGKGKKIMVAAHTDEIGLMITHIEDEGFLRFTTIGGVSVEQIVGRRVVFKNGV
FT                   QGAIGVEYLEDKKDFRVEKLYIDIGAKNKEEAQKYVNIGDSASFAGEFIEAGDRLISKA
FT                   FDDRIGCYVVIEALKNLKTENEVYFVFTVQEEVGTRGAAAAAYNIHPDFAVAVDVTSTG
FT                   DTPKAKKMAVSLGKGAAIKVMDRSIIVSPSVREMMIEVAKENNIPYQLEILEFGGTDAG
FT                   PIHLTKGGIPAGVISIPTRYVHSISEMVDKNDIEASIELLKKVLEK"
FT   gene            complement(454850..455938)
FT                   /locus_tag="Thit_0415"
FT   CDS_pept        complement(454850..455938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0415"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125
FT                   transmembrane; Rubrerythrin; KEGG: tpd:Teth39_1872
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01722"
FT                   /db_xref="GOA:D3T6Z0"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR039376"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z0"
FT                   /inference="protein motif:PFAM:PF01988"
FT                   /protein_id="ADD01722.1"
FT                   /translation="MNPIDQAINFYKEEVEAAELYTYLAKIEKNPQTKSNFDALAKMER
FT                   VHAKFWHQFLKTRNIEIQEGKFHKFKLFTYKILRTLLGSKLFVTILEMNEVISTESYYR
FT                   YFHEASLTEKEKAILSKIIEDELEHEKIFSRQKDKFSIENIRDFILGMNDGLVEILGTV
FT                   TGLSAVYPKSPITVGTAGLVVGVAGALSMAIGAYTSVRSQRQVNEGIKSKMELLFKVSK
FT                   DRAKEEFVSKLLESGIPEDVGTEILGKLSDNEDAMINLLTEEISENEIKSALYTGIAYL
FT                   VGLLFPVLPYFIITSSSLVALLFSVIFAAIALSIVGIVVSVASESLSVKGKVLEMVTTG
FT                   LGAAALSYLFGTLVQYVFGIQA"
FT   gene            complement(456085..459612)
FT                   /locus_tag="Thit_0416"
FT   CDS_pept        complement(456085..459612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0416"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; Pyruvate-flavodoxin
FT                   oxidoreductase, EKR domain; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; Pyruvate/ketoisovalerate
FT                   oxidoreductase; KEGG: tpd:Teth39_1842 pyruvate
FT                   flavodoxin/ferredoxin oxidoreductase domain-containing
FT                   protein; SMART: Pyruvate-flavodoxin oxidoreductase, EKR
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01723"
FT                   /db_xref="GOA:D3T6Z1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z1"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ADD01723.1"
FT                   /translation="MAKVMKTMDGNTAAAHVAYAFTEVAAIYPITPSSPMAEVVDEWSA
FT                   HGRKNIFGQPVKVIEMQSEAGAAGAVHGSLAAGALTTTFTASQGLLLMIPNMYKIAGEL
FT                   LPGVFHVSARAVATHALSIFGDHSDVMACRQTGFAMLASGSVQEVMDLASVAHLSAIKG
FT                   RVPFLHFFDGFRTSHEVQKIEVLDYEDLAKLVDYEALKAFRKRALNPEHPVTRGTAQNP
FT                   DIFFQGREAANRFYNAIPEIVEYYMNEIKKLTGREYKLFNYYGAPDAERIIIAMGSVTE
FT                   TIEETVDYLMKKGEKVGVVKVHLYRPFSAKHLLDVIPKTVKKIAVLDRTKEPGSIGEPL
FT                   YEDVKTALFDSELRPVIVGGRYGLGSKDTTPAQIIAVFDNLKADKPKDHFTIGIIDDVT
FT                   FTSLPVGEEVDTTPEGTTSCKFWGFGSDGTVGANKNAIKIIGDNTDLYVQAYFSYDSKK
FT                   SGGVTVSHLRFGKKPIRSTYLINKADFIACHKQSYVYNYDILAGLKDGGTFLLNCNWKV
FT                   EELDKKLPASIKRYLARHNINFYIINAVDIAKEIGLGGRINMIMQSAFFKLTNIIPIEE
FT                   AVKHLKEAIVKEYGHKGEKIVQMNYEAVDRGINSLVKVEVPASWTDAEEEPKSERQAPD
FT                   FVKNVADVMNRLEGDKLPVSAFLGREDGTFPPGTAAYEKRGIAVDVPEWQIDNCIQCNQ
FT                   CAFVCPHAAIRPFLLTEEEAKNAPEGFKVKKAIGKGFEGLYYRIQVSVLDCTGCGVCAN
FT                   ECPAKEKALVMKPLETQMEEAKNWEYAMTLSPKENPMNKETVKGSQFEKPLLEFSGACA
FT                   GCGETPYAKLVTQLFGDRMMIANATGCSSIWGASAPSTPYCTNHEGKGPAWANSLFEDN
FT                   AEFGLGMALAVKQQRAKLADIVKELLELNITPELKEALQFWLDNMMDGKKSKEATIKLL
FT                   PILQNYKTEDTKVKELINEVLERKDYLIKKSQWIFGGDGWAYDIGYGGLDHVLASGEDI
FT                   NVLVFDTEVYSNTGGQSSKATPVGAVAQFAAAGKPIGKKDLGRMAMTYGYVYVAQVAMG
FT                   ASQTQLIKALVEAESYPGPSLIIAYAPCIAHGIKQGMSCSQLEEKKAVEAGYWVLYRYN
FT                   PLLKKEGKNPFILDSKPPKLSVRDFLQGEVRFSALEKTFPEKAQKLFEEAEKQAQERYK
FT                   IYEKLAKDE"
FT   gene            460101..460706
FT                   /locus_tag="Thit_0417"
FT   CDS_pept        460101..460706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0417"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tpd:Teth39_1840 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01724"
FT                   /db_xref="GOA:D3T6Z2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z2"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADD01724.1"
FT                   /translation="MEVYNYNEYYLIKHLITSLKHYHYTTYLHSIRVAKLTYLVSKKLE
FT                   LPKDEQIYNCKGGLLHDIGKVLVPVTILDKAGSLTELEYEFVKIHPTYGSEMLKIFPSL
FT                   KDLVPGVLYHHERLDGSGYPFGVSIIPLSAQIIGICDSFDAMTTRRPYNEKRLRNIQEA
FT                   IFELKTQSQKYNYKIVEALEEVLWEKKEKQQRFISIYR"
FT   gene            complement(460901..462319)
FT                   /locus_tag="Thit_0418"
FT   CDS_pept        complement(460901..462319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01725"
FT                   /db_xref="GOA:D3T6Z3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z3"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1189"
FT                   /protein_id="ADD01725.1"
FT                   /translation="MKIKAKQLSLSDIYDDVQSFFEEDKPKFIKLFDSFIDLSELIPPS
FT                   FYAHYYSHFGRHRDFSLESMLTALIIQKILSIPTVQLLVHVLKLSKELRELCGFKRVPH
FT                   PSQFSRFKSIFLKDLENFFNNLVNLTEPICQAINPSISNILIADTTGFEPYVRENNPKF
FT                   FDSLYRNIKKFSKSNPDFDAHSYACSKMPKFAHSNPDAKFSYINGHYCYSIKATILTNG
FT                   LGIIQHISFYDDDSLNVNTAKSAAESKDLYDSKTLIPSLKEFFNLHPNFSYRYFLGDAG
FT                   FDSFDNYKYLFSKLGIIPIIPINPRNSKNLPQPTFNSDGIPTCPRDPSLKMSYDGIVRE
FT                   KGRATRIKWLCPMSKKVRLNGKTTYILQCDNPCTSSKCGRIFYTTLDIDFKKNTFVPRN
FT                   SKKWSKLYEKRPIIEKSISLLKSSIAVDSFKLINTRSIKADVFLGAITQHIGLIITAKL
FT                   GTFEHPLSLKKLLA"
FT   gene            462474..464456
FT                   /locus_tag="Thit_0419"
FT   CDS_pept        462474..464456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0419"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: tpd:Teth39_1838 methyl-accepting chemotaxis
FT                   sensory transducer with cache sensor; PFAM: chemotaxis
FT                   sensory transducer; Cache domain protein; histidine kinase
FT                   HAMP region domain protein; SMART: chemotaxis sensory
FT                   transducer; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01726"
FT                   /db_xref="GOA:D3T6Z4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z4"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADD01726.1"
FT                   /translation="MKSIRTKLLVFTILVIFIPLVITGYFSTNIAESILKSKINNSNQA
FT                   ALNVLNKHISYFKQNTESTLLMISESDTIMNYDGSSTSDEAVLRELEEVKKSMPDAMYV
FT                   YFGTPDKKYILYPPDPSLKDYDPTERPWYKDAEKAGESIVWTDPYQDFGTKVPMITIAK
FT                   AVRNSDGKLLGVLGIDISLEQLSKNLSSIKIGDSGYIYIITKDGTVISHPDSKQLFTSV
FT                   KKYDFGKKLLNLNNTTIHYVSGNTYKFASVRNLDSFGWKAVVTMEDSGLTKDVMKIRNF
FT                   VITVSIIVLLIGFLVTYFFTNSISSGIKRVVTAMSLAAKGDVTVKADVKAKDEVGILAN
FT                   SFNTMIEGIKKLIFDIKSVSESVNHSAENMAVASEQAAQATQDVAKAIEEIAQGASSQA
FT                   KETEESANATFLLGQLIDKSIKNADEINQEVSNVSMVSNEGLMIIDDLIKKTQLTVEAN
FT                   NNVKESTDYLLEKSTEISKIVETITGIADQTNLLSLNAAIEAARAGEAGRGFAVVADEV
FT                   RKLAEQSSQAARNIANLISEIQSTINNTYKTVEDSTKSIEEQSNAVNTTKDVFEGILHA
FT                   VNFIVEKIDNLDKSLKEIESHKNKIVDSIQNIAAVSEEAAASAEEVSATSEEQSAIVEE
FT                   MASTANELKNYANTLIEAIKQFKVE"
FT   gene            464642..465538
FT                   /locus_tag="Thit_0420"
FT   CDS_pept        464642..465538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0420"
FT                   /product="glutamate formiminotransferase"
FT                   /EC_number="4.3.1.4"
FT                   /note="TIGRFAM: glutamate formiminotransferase; KEGG:
FT                   tex:Teth514_0390 glutamate formiminotransferase; PFAM:
FT                   Formiminotransferase domain protein; Formiminotransferase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01727"
FT                   /db_xref="GOA:D3T6Z5"
FT                   /db_xref="InterPro:IPR004227"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR013802"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="InterPro:IPR037064"
FT                   /db_xref="InterPro:IPR037070"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z5"
FT                   /inference="protein motif:TFAM:TIGR02024"
FT                   /protein_id="ADD01727.1"
FT                   /translation="MNQIIECVPNFSEGKDQEKIAQLVKEVVSTEGVKLLDYSSDKDHN
FT                   RTVITFCGDAKGVKEAAFKLIKRASEIIDMRYHKGEHPRIGATDVVPFIPVKNVTMEEC
FT                   VQIAREVGERVGKELNIPVYLYEEAATTPERKNLENIRRGEYENFFEKIKQPEWKPDFG
FT                   PQEMNPKSGATAIGARNFLIAYNVNLATDNIEIANKIAKAIRFSSGGYRYVKAIGVNLK
FT                   ERGIVQVSMNLTDFNKTPIYRVFETIKAEAERYGVNVIGSEIIGLVPAKALFDVADYYL
FT                   RIENFSENMVLENKIYE"
FT   gene            465547..465780
FT                   /locus_tag="Thit_0421"
FT   CDS_pept        465547..465780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0421"
FT                   /product="imidazolonepropionase"
FT                   /note="KEGG: tex:Teth514_0391 imidazolonepropionase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01728"
FT                   /db_xref="GOA:D3T6Z6"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z6"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0391"
FT                   /protein_id="ADD01728.1"
FT                   /translation="MGTDLLIYNIKKIYAHLDNRPLCGNDMEKVEEIEDAYIAIKDGKI
FT                   LAAGKSPAAISAKEKIDAKGMIAILCDVYTLE"
FT   gene            465883..466143
FT                   /locus_tag="Thit_0422"
FT   CDS_pept        465883..466143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01729"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z7"
FT                   /inference="similar to AA sequence:KEGG:TTE0452"
FT                   /protein_id="ADD01729.1"
FT                   /translation="MYSVSEKLTNICKKYNIALVYLFGSQKENALKLLKEEKVVIDDPL
FT                   TDIDVGIVFLENIEFMKDRYKIYANFKYVYDKYNEEVLEKY"
FT   gene            complement(466383..468053)
FT                   /locus_tag="Thit_0423"
FT   CDS_pept        complement(466383..468053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0423"
FT                   /product="alpha amylase catalytic region"
FT                   /note="KEGG: csc:Csac_2428 alpha amylase, catalytic region;
FT                   PFAM: alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01730"
FT                   /db_xref="GOA:D3T6Z8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z8"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ADD01730.1"
FT                   /translation="MQRKWWKEAVVYQIYPRSFYDTNGDGIGDLQGIITKLDYLKELGI
FT                   DVIWLNPIYQSPNADNGYDISDYYDIMDEFGTMSDFDELLSQAHKRGIKIVMDLVVNHT
FT                   SDEHKWFLESRKSKDNPYREFYFWKKGKNGRPPNNWTSFFSGSAWEYDPLTNEYYLHLF
FT                   AVKQPDLNWDNPKVRQEIYKMMKWWLDKGIDGFRMDVINLISKVEGLPDDIEGERQGGL
FT                   VGTKYYANGPKVHQYLQEMNKEVLSKYDIMTVGETPFVTPEIAKLYVEYDRNELNMLFH
FT                   FELMDIDCGNSKWDIKPWKLTDFKKIMYKWYLALKDKGWNSLYLNNHDQPRMVSRFGND
FT                   KEYRVESAKLLATFLHTWQGTPYIYQGEEIGMTNCKFESIDEFRDIETLNWYNDMKKQG
FT                   KSDEKLLDILNKRSRDHARTPMQWDDTKNAGFTTGIPWIKVNPNYKEINVKKALEDKNS
FT                   IFYYYKKLIELRKKYPVIVYGDITMLYEDDEKIFSYTRSYGNQRLLVVLNFSEDNVNFA
FT                   VPKEMFTNSPQLLISNYPVNDNIQEKVILRPYEARVYKI"
FT   gene            complement(468097..468930)
FT                   /locus_tag="Thit_0424"
FT   CDS_pept        complement(468097..468930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0424"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tex:Teth514_0395
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01731"
FT                   /db_xref="GOA:D3T6Z9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T6Z9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01731.1"
FT                   /translation="MKFKNIVNQIVFYVFLIIFLVYIIFPFLWQLLTSFKTPQELFSIP
FT                   PTWIPSKIYTGYYINVFTKRPFLTYLKNSFIVASSTTLFSLFVSSFASYALARLKFKGK
FT                   AIILSLVLSVSMFPGIAIVSPLFLFLRKINLLNSYLGLILTYTTFAIPLSLWILTSFFK
FT                   EIPFELEESAKVDGATPMQAFLKIIMPLATPGMFTTAILTFIAAWNEFLFALVFNTQDS
FT                   MRTVPVGIAMFPGEHDLPWGDIAAASVVVTVPLIIMVLLFQKRIISGLTAGAVKG"
FT   gene            complement(468940..469863)
FT                   /locus_tag="Thit_0425"
FT   CDS_pept        complement(468940..469863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0425"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tex:Teth514_0396
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01732"
FT                   /db_xref="GOA:D3T700"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T700"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADD01732.1"
FT                   /translation="MVEQKNLTSPTKQSKYQLSEAALGYILVAPALLCIIAIALYPVLN
FT                   TFKLSLYYMKLQLPGLTHFVGFQNYVALFHDPRFWSATSNTIVFTVVSVALELVLGMIM
FT                   ALLMNKKFKGTGLVRAAVLIPWAIPTIVSALMWKFIYNDQFGVLNDILMKMGLIDSYRA
FT                   WLGSPSLAIGSAIFADVWKTAPFMALLLLAGLQNISHDLYEAAKVDGAGSIRQFFSITL
FT                   PLLKPTILVALIFRTLDAFRVFDLIFVMTGGGPGNSTETLSIYAYKTLFRNLDFGIGSA
FT                   IAVIIFVFVFIFAMIYIKLLDKNILE"
FT   gene            complement(469936..471222)
FT                   /locus_tag="Thit_0426"
FT   CDS_pept        complement(469936..471222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0426"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tex:Teth514_0397 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01733"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D3T701"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADD01733.1"
FT                   /translation="MGKKNKILTLIVSLALIVTLIAGCGSNTSTSTSSNTSKDEPVTIT
FT                   YSAGKDSTPATQKLIEAFEKKYPNIKVKFQELPNSTDDQHNSYVTALSAGDSSIDVLAM
FT                   DIIWTPEFAAADWLLPLDDKFTEEMREKFLPGPVEAVTYNGHVWAVPRFTDAGVLYYRK
FT                   DIIDTPPKTWDELIQMSKENVGKGGTKYGIVFQGNQYEGLVCDALELIGSNGGSVLEGD
FT                   KVTINTPQAVAGLQYLIDLVKIAPPGVTTYQEEEARNVFQQGEAIFMRNWPYAWSLVNG
FT                   DDSPIKGKVGIAPIPKGKNGQAGTPVLGGWNLGISKYSKHPEEAWKFIEFVTSEEGQKI
FT                   TALEGGNLPTIKFLYQDEEVLAKNPYWADFYDAFITAKPRPVSPFYPQMSDSMQINFHK
FT                   ALTGEITAQQAIQNIEKDLNDIIKNEGKK"
FT   sig_peptide     complement(471127..471222)
FT                   /locus_tag="Thit_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.232 at
FT                   residue 32"
FT   gene            471396..473099
FT                   /locus_tag="Thit_0427"
FT   CDS_pept        471396..473099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0427"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: tex:Teth514_0398 histidine kinase internal
FT                   region; PFAM: histidine kinase internal region; histidine
FT                   kinase HAMP region domain protein; ATP-binding region
FT                   ATPase domain protein; Cache domain protein; SMART:
FT                   histidine kinase HAMP region domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01734"
FT                   /db_xref="GOA:D3T702"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3T702"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADD01734.1"
FT                   /translation="MLYKKILLSYILIIVIPLIMVAAITGNITSRYINEEVRKSTFQTL
FT                   NQANKNISKMLENMKNTILYVSMNKELQYNLSRNDKETPFQINREVTAIRNSILYPGIF
FT                   NKNYSSIEIFALRKNQYPLRLEQNDVMSSKVVEDKEWYKKTIQLNGRLYWYINNDFGKQ
FT                   MISVSRLVFDVKNFTKPIAVISVDMDMSKIASIISDIHLGKTGKVYLVDDKGELIYSED
FT                   KGFLYPYTTKLYNSSSRSNFITMNGNKIMVIYNTLPQNGWKLVGMIPLNELNEKAKMIR
FT                   NFIYLTALLSVVIAALISLYFSYSISQPIIKLATEMKRVEKGNFNISVEENWDGEIGVL
FT                   YSSFNYMIKRINELIHEVYLSKIKEKDAELKALQAQINPHFLYNTLDTVNWLAVKHNAP
FT                   EISKIVNSLASILRYSINKGNDVTTVDKELKHVESYITIQKIRFKDKFEVSFNIDKRIL
FT                   HYKTIKLILQPLVENAIIHGIETYEGKGKILINGYLDDGKIVFEVINNGNPIDLDVVNK
FT                   LLDSPSEDKDSYGIQNVNERIKLYYGEEYGLYYQVIDNNTVARIVIPAVL"
FT   gene            473110..474207
FT                   /locus_tag="Thit_0428"
FT   CDS_pept        473110..474207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0428"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="KEGG: tex:Teth514_0399 response regulator receiver
FT                   protein; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01735"
FT                   /db_xref="GOA:D3T703"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D3T703"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD01735.1"
FT                   /translation="MKILIVDDEPIVREGLKNNVNWQELDLRVVGCEANGKSALHVFDR
FT                   EQPDIILTDIRMPFMDGLQLTREVKKIDPLVVVILLSAYDDFKYAQEAIRLGAFDYILK
FT                   PIDIDTLKETVRRAVLKRKELLDKKKEPLPSLNKEDLKFFKAEYYKYPLKLEEKLSKAI
FT                   KRGDKDLALNIFNEIWNEFRDKNYTEDFIKRWGLELVAVITRSLIEIGENADILFKETD
FT                   PWRQISELSTKENLREWMGNIIEVVCEYVSLTKNSKNRKLIDEAIKLIQENYSDVNISL
FT                   NSIAEKLYITPNYLSTLFKSEMGVTFSDYLTACRIEKAKELLKDVKVKIYEVAEAVGYT
FT                   DQHYFSKVFKNITGFTPKEYREKIL"
FT   gene            474298..474939
FT                   /locus_tag="Thit_0429"
FT   CDS_pept        474298..474939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0429"
FT                   /product="Formimidoyltetrahydrofolate cyclodeaminase"
FT                   /EC_number="4.3.1.4"
FT                   /note="KEGG: tex:Teth514_0400
FT                   formiminotransferase-cyclodeaminase; PFAM:
FT                   Formiminotransferase-cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01736"
FT                   /db_xref="GOA:D3T704"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:D3T704"
FT                   /inference="protein motif:PRIAM:4.3.1.4"
FT                   /protein_id="ADD01736.1"
FT                   /translation="MLINDSLKEYIEKVASESPTPGGGSVAAVSASLGIALSSMVYNLT
FT                   IGRKFYEDYTDDIKEKIQQGLSICRRLLAEYVKLIDEDTVAYDEVIKALKMPKDTEENR
FT                   KIRSEALQKAYINAMNVPLKLARLCGEAFTPTMLIAEYGNPNAISDAAVGAILLYAAIE
FT                   GAVLNVKVNIPYIKDREITESANKECDEILAKYKNIRDDIVNKVLNKISG"
FT   gene            475223..476278
FT                   /locus_tag="Thit_0430"
FT   CDS_pept        475223..476278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0430"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   tpd:Teth39_1833 basic membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01737"
FT                   /db_xref="GOA:D3T705"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3T705"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ADD01737.1"
FT                   /translation="MKKWRVVLAFVVIMVLSVSVLLSGCSSRTKQEGTQPEATQETKNK
FT                   DFRVGLVTDVGGINDRSFNQMAYEGLQKAAKELGITVNVIQSKKMEDYVPNLSNFAQQG
FT                   YNLVIAVGFMMHDAVEEVSQKFPDTKFLIIDSEITDRPNVSSAMFKEEQVGYLVGAMAG
FT                   LVEKEKVGKVKGTNTIGVVGGMQIPPVDRFIAGYQQGAKAVNPDIKILLNYTNNFDDPA
FT                   TGKQMALTQISQGAEIVFQVAGGTGEGVIKAAQEKNVYAIGVDADQSYLAPDHVLTSAV
FT                   KRVDVATYDVIKDTLNGNFKSGIVYFDLKNDGVGIGKVNKDVPQSIIDKVNQLAQDIKD
FT                   GKITVSDKVSK"
FT   sig_peptide     475223..475315
FT                   /locus_tag="Thit_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.433 at
FT                   residue 31"
FT   gene            476339..477868
FT                   /locus_tag="Thit_0431"
FT   CDS_pept        476339..477868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0431"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1832 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01738"
FT                   /db_xref="GOA:D3T706"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T706"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01738.1"
FT                   /translation="MSAILEVKNITKVFPKVVANDNVNLTVEKGEIHAILGENGAGKST
FT                   LMNIIYGLYKPDSGKLIFDGKELNLSGPHEAIEKGIGMVHQHFMLIPVLTVAENIVLGA
FT                   EPKGITYDRKKANELIREISKKYHLEIEPEAKVKDLSVGLQQRVEILKAFYRKAKLLIL
FT                   DEPTAMLTPQEIEKLFEIMRGLVKQGMSIIFISHKLEEVLEISDRVTVMRRGKTVGTLN
FT                   TKETNEQELANLMVGREVVLRIEKSEYKPGDVVLSVKNLNVVDQQNVPKVKNVSFEIHE
FT                   GEIFGLAGIDGNGQLELVEAIMGLRPKKSGNILFYGKDVTNFTTRQLYREGISYIPQDR
FT                   QADGLVLDFTIAENLILREYKDSAYSRHGVIQYKKVYENAERKVKEFDIRPPEYMLKAR
FT                   GLSGGNQQKVILAREVGYNPKLLIAVQPTRGMDVGAIEYIHKRILELRDRGAAVFLISL
FT                   ELEEIMSLSDRIGVIYNGQLMDILDGKTATREQIGMLMAGSRFDKTTLEAR"
FT   gene            477868..478926
FT                   /locus_tag="Thit_0432"
FT   CDS_pept        477868..478926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0432"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tpd:Teth39_1831 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01739"
FT                   /db_xref="GOA:D3T707"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3T707"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADD01739.1"
FT                   /translation="MKNLLKELYIPAAAVLIAIIVGSIIMLITGFNPITAYISLFIGAF
FT                   GTINNIANTLAAAVPLILTGLGVAISFKAGLFNIGAEGQYWIGAIVGVWVGYSFTGLPW
FT                   YIHIPFAVIAAMIAGGLWAGLIPGLAKAHTGANEVITTMMMSYIAIYFSHFLLQFGPMM
FT                   EKGGTIPQSPRINESAVIPVLIKNTQLSYGIFIALIAAVFVYWLIFKTTWGFEMRAVGY
FT                   NQRAARYAGMNVPLNMVLSLGLSGAFAGLAGAVQMLGVQHRLYDSFTSGYGYTAIVVAL
FT                   LANNNPLGVIFSAILFAALDTGSQYMQLNAQVPGQMADVITGLIVFFVAAHRVAEVIKN
FT                   KFAKNRKKEAQA"
FT   gene            478926..479846
FT                   /locus_tag="Thit_0433"
FT   CDS_pept        478926..479846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0433"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   tpd:Teth39_1830 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01740"
FT                   /db_xref="GOA:D3T708"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D3T708"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ADD01740.1"
FT                   /translation="MEIFLNPQLWAATLAMATPLALPALGGTFSERSGVVNIAMEGIML
FT                   IAAFFAVVFAHATGSAWLGLLGAMIVGLIVALIFAWAAVSLTANQIILGMAINIFASGI
FT                   TAYLLNTIYGFTGTPVDTPMLPTLDIPAIKSIPFLGQVLSGHSVIVYLMIIILFISNYF
FT                   LFHTNLGLRLRAVGENPEAAETAGINVIKLRYLGVALSGILSAMGGAYLSIGALNSFIP
FT                   DMTSGRGYIALAAMIFGKWTPFGSFGAALLFGFATALSMQLQNTAFSKNIIMMLPYIVT
FT                   ILALVGIGGKSVPPAADGVPYTPKK"
FT   sig_peptide     478926..479006
FT                   /locus_tag="Thit_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.851 at
FT                   residue 27"
FT   gene            479856..480587
FT                   /locus_tag="Thit_0434"
FT   CDS_pept        479856..480587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0434"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="KEGG: tpd:Teth39_1829 GntR family transcriptional
FT                   regulator; PFAM: UbiC transcription regulator-associated
FT                   domain protein; regulatory protein GntR HTH; SMART: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01741"
FT                   /db_xref="GOA:D3T709"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T709"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ADD01741.1"
FT                   /translation="MSMLLPEKKPLYELALRKMEELIKTGQWKEGSKLPSESQLAKQFG
FT                   ISRATLREAMRILEEEGLIIKQQGVGTFVKRKPLIKSGLEELFSVTTLIERQGMVPGTK
FT                   DFTVYKLPATENEANHLKLKPGEIIYKVERVRTADEVPVVYCIDRLPQSIVGESFTGFE
FT                   QSIFSYLENEHSITITYAISNIRVIKHDPVVEKKLMMDKNDSILLLEQVHYDENNTPIL
FT                   YSSNYFNASKFDFYIIRKRIL"
FT   gene            480603..481010
FT                   /locus_tag="Thit_0435"
FT   CDS_pept        480603..481010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0435"
FT                   /product="cytidine deaminase"
FT                   /note="KEGG: tpd:Teth39_1828 cytidine deaminase; TIGRFAM:
FT                   cytidine deaminase; PFAM: CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01742"
FT                   /db_xref="GOA:D3T710"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D3T710"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ADD01742.1"
FT                   /translation="MEHKDYEKLIELAKEAREKAYVPYSHFKVGACVLTEDGKTYQGCN
FT                   IENASYGLTNCAERTALFSAYANGERKLKAIAVVADTEGPVSPCGACRQVMMELGGEDM
FT                   VVVLSNMKGDYAVVTVKDLLPGAFTSKDLEK"
FT   gene            481043..482212
FT                   /locus_tag="Thit_0436"
FT   CDS_pept        481043..482212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0436"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="TIGRFAM: phosphopentomutase; KEGG: tpd:Teth39_1827
FT                   phosphopentomutase; PFAM: Phosphopentomutase domain
FT                   protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01743"
FT                   /db_xref="GOA:D3T711"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/TrEMBL:D3T711"
FT                   /inference="protein motif:TFAM:TIGR01696"
FT                   /protein_id="ADD01743.1"
FT                   /translation="MFKRVILIVLDSVGVGELPDAYRFGDEGSNTLGHVTEKTGVELPN
FT                   MGQLGLGNIIPLKSVPENPNAIGGYGKMAEKSAGKDTTTGHWEIAGLFINKPFPTYPNG
FT                   FPDEIIKEFEKRIGRKVLGNKPASGTEIIKELGEEHVKTGFPIVYTSADSVFQVAAHED
FT                   VIPPVELYRICEIAREILKGDHAVGRVIARPFTGSSGNFVRTENRRDFSLKPFEPTILD
FT                   MLKEAGYEVFAIGKIEDIFAGQGITGKNHTTNNDEGITATIKAMDEVKDGLIFTNLVDF
FT                   DMLYGHRNDVEGYAKALKNFDDRLPEMMEKLTKEDLLIITADHGCDPATESTDHSREYV
FT                   PLLVYSPLMKHGVNLGVRSTYADIAATIAEIFEVGSTKHGTSFLRELPL"
FT   gene            482228..483523
FT                   /locus_tag="Thit_0437"
FT   CDS_pept        482228..483523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0437"
FT                   /product="pyrimidine-nucleoside phosphorylase"
FT                   /EC_number="2.4.2.2"
FT                   /note="TIGRFAM: pyrimidine-nucleoside phosphorylase; KEGG:
FT                   tpd:Teth39_1826 pyrimidine-nucleoside phosphorylase; PFAM:
FT                   glycosyl transferase family 3; Pyrimidine nucleoside
FT                   phosphorylase domain; Glycosyl transferase, family 3-like"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01744"
FT                   /db_xref="GOA:D3T712"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:D3T712"
FT                   /inference="protein motif:TFAM:TIGR02644"
FT                   /protein_id="ADD01744.1"
FT                   /translation="MRMYDLIMKKRNGGVLTKEEIDFIISSYTKDYIPDYQMSALAMAI
FT                   YFRGMTPEETAHLTMAMAYSGDVMDLSAIKGIKVDKHSTGGVADTTTLVLAPMVAACGA
FT                   PVAKMSGRGLGHTGGTIDKLESIPGMRVELSEEEFIDNVNKYGIAIIGQTKNLTPADKK
FT                   LYALRDVTATVDSIPLIASSIMSKKIAAGADGIVLDVKVGRGAFMKDLERAKALAKLMV
FT                   DIGNSVGRKTVAHVTNMDYPLGLAIGNALEIVEAIQVLKGHGSKDLLEVCMLLGSDMLQ
FT                   IAGIAKDDKEARAKLKEALDSGKALQKFKEFIKAQGGDERVVDDVSLLPQAKYVRPWTA
FT                   DRNVYIKDLMALELGLIAMKLGAGREKKEDKIDLAVGIMLGGKVGDIIRKGEPIATIYA
FT                   NDESKLEWAFDEIKKYILLSDEPVERPTLIFE"
FT   gene            483636..485288
FT                   /locus_tag="Thit_0438"
FT   CDS_pept        483636..485288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0438"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: tex:Teth514_0410 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01745"
FT                   /db_xref="GOA:D3T713"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D3T713"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADD01745.1"
FT                   /translation="MQMGKTIRAQLIRSFVIIGILIAILTFTINVGLINTIQNIENLRK
FT                   YVVNQVINVSNAQVQIAVLSGNIQQTLNDYMHGNATNFSVGVPISSIETYVSNIQNSLD
FT                   DYRNTKNYELLKKNLSAINEVIQNLKKAVNELPERYDSVNDSDKVVTIGYYLNHIQSSL
FT                   NDFSSTYSQGFLPYFNQMIEDNKKNFYVSLSISIAIIVIILIYAAVIVRKLRKFAKLIN
FT                   SEIDKAVKQSEEVMNYAVDIKNKSEENTTNITSSKQGLEDLVNGINVISENVNEVADSI
FT                   TKVSETNENLSQVSDKLMRDMNEAMMKIKEMEENAHRQGEEVKSLIESLQESLETSKNT
FT                   SKQLNELEKRMGGIKDILYSISDIAEQTNLLALNAAIEAARAGENGRGFAVVAEEIRKL
FT                   AAQSTESVERIGEIIESLTQFTRETVDNVIKNIDTSTKASIEVNKVLDIFEQTKEGFDK
FT                   VSDIISEISVAAEETAVSSNQTLQAMKNVMAASQNISAQVEELLASSQQLLAEINVVDE
FT                   NNLKNLDHIKEQVEYTEEQKANMQKITNIVKQL"
FT   gene            complement(485469..486044)
FT                   /locus_tag="Thit_0439"
FT   CDS_pept        complement(485469..486044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0439"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   tex:Teth514_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01746"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D3T714"
FT                   /inference="protein motif:PFAM:PF05685"
FT                   /protein_id="ADD01746.1"
FT                   /translation="MPLPKEGKVYTYGDLLMWPEEERIELINGQPFMMTPPSRIHQEIS
FT                   RELLTAFSVYLKDKGCRVYSAPFSVRFPSGNEKSDKEIKTIVEPDIVVVCDESKLDDEG
FT                   CKGAPDLIVEIVSPSTARKDKVEKFNLYEKAGVKEYWIVEPEQKVVMVFILEDGRYRIV
FT                   KTYSEDDSIKVSIFDDLTINLKEIFKRI"
FT   gene            486330..487730
FT                   /locus_tag="Thit_0440"
FT   CDS_pept        486330..487730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0440"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_1823 PTS system,
FT                   N-acetylglucosamine-specific IIBC subunit; TIGRFAM: PTS
FT                   system, N-acetylglucosamine-specific IIBC subunit; PTS
FT                   system, glucose-like IIB subunint; PFAM: phosphotransferase
FT                   system EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01747"
FT                   /db_xref="GOA:D3T715"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D3T715"
FT                   /inference="protein motif:TFAM:TIGR01998"
FT                   /protein_id="ADD01747.1"
FT                   /translation="MKWLTSVQKLGKALMLPVAVLPAAALLLRLGAPDVFNIPFIMQAG
FT                   AAVFDNLPLIFAIGIAIGFAEGDGVAALAAAVGYFVLTKGATTINKDINMGVLGGILMG
FT                   IIAGYLYNKYHDIKLPDFLGFFGGKRFVPIVTAFVAIVLAFAMGYVWPPIQNGIYAVGE
FT                   WIIGAGVLGVFVYGVLNRLLIPFGLHHVINSLVWFVFGTFKTASGKVVTGDLNRFFAGD
FT                   PTAGTFMAGFYPIMMFGLPVAALAMLAAAKPNQRKAVSGVLISAALTAFLTGITEPIEF
FT                   SFMFLAPVLYVIHALLTGLSLAITYVLGIKDGFGFSAGLIDYILSYGIATKPLLLLLIG
FT                   IIYGAIYYLIFYYIIVKFNLPTPGRLEEEAVDQYADMSKSELGDIAVQYVEVLGGTENI
FT                   QSLEACITRLRLTVKDDTIIDDDKLKKLGATGVIRMGKNALQVIVGTKADLIAQEMRKH
FT                   MKKAGGKI"
FT   gene            487843..488328
FT                   /locus_tag="Thit_0441"
FT   CDS_pept        487843..488328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0441"
FT                   /product="PTS system, glucose subfamily, IIA subunit"
FT                   /note="KEGG: tpd:Teth39_1822 PTS system, glucose subfamily,
FT                   IIA subunit; TIGRFAM: PTS system, glucose subfamily, IIA
FT                   subunit; PFAM: sugar-specific permease EIIA 1 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01748"
FT                   /db_xref="GOA:D3T716"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:D3T716"
FT                   /inference="protein motif:TFAM:TIGR00830"
FT                   /protein_id="ADD01748.1"
FT                   /translation="MFNIFKKKKYVDIYSPINGILLKIEDVPDPVFSQKMVGDGVALEP
FT                   TEGIVYSPVNGTIIQLFPTKHALGLKTEEGLELLIHIGMDTVEMKGNGFESFVSEGEKV
FT                   KVGDKLIKFDMELVKKEHPLTSPIIITNMDIVDKIVKEPDGEEVRAEKTKIMRVYLK"
FT   gene            488346..489173
FT                   /locus_tag="Thit_0442"
FT   CDS_pept        488346..489173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0442"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: CAT RNA-binding domain protein; PRD domain
FT                   protein; KEGG: tpd:Teth39_1821 transcriptional
FT                   antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01749"
FT                   /db_xref="GOA:D3T717"
FT                   /db_xref="InterPro:IPR004341"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036650"
FT                   /db_xref="UniProtKB/TrEMBL:D3T717"
FT                   /inference="protein motif:PFAM:PF03123"
FT                   /protein_id="ADD01749.1"
FT                   /translation="MYQVVKVLNNNVCMAKDDKSVECVVIGKGIGFGKRPGDIIEEDKL
FT                   EKIFYVQEDVNKIKFSELMEEIRGDVIGITEEIITMAEKIKGKKLNEHIHIALADHIAF
FT                   AIERVNMGIDIKNPFNMEIKALYKDDYNIALKALELINQRLNISLPEDEAGFIALHLHA
FT                   ALENAGLSNTLKNTRLISQLVSIIENQLGKHIDRDSIDYLRLVTHLRFAIDRLEKNTPI
FT                   ANELLASIKKKFKRAYKIAMQVSKVIENTLGKRVPEEEVGYIAIHIQRLINTI"
FT   gene            489306..490457
FT                   /locus_tag="Thit_0443"
FT   CDS_pept        489306..490457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0443"
FT                   /product="homocitrate synthase"
FT                   /note="KEGG: tpd:Teth39_1820 trans-homoaconitate synthase;
FT                   TIGRFAM: homocitrate synthase; PFAM: pyruvate
FT                   carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01750"
FT                   /db_xref="GOA:D3T718"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T718"
FT                   /inference="protein motif:TFAM:TIGR02660"
FT                   /protein_id="ADD01750.1"
FT                   /translation="MALKKGKKVYIVDTTLRDGEQTAGVVFANNEKIRIAQMLDEIGID
FT                   QLEVGIPTMGGDEKETVAKIAKLGLNASIMAWNRAVVKDVQESLECGVDAVAISVSTSD
FT                   IHIEHKLKKTRQWVLDNMTEAVRFAKKEGVYVSVNAEDASRTDMDFLIEFAKCAKQAGA
FT                   DRLRFCDTVGFLDPFKTYDMVKTIKEAVDIDIEMHTHNDFGMATANALAGMRAGANFIG
FT                   VTVNGLGERAGNAALEEVVMALKHVYKIDLGIDTTKFREISEYVALASGRQLPAWKAIV
FT                   GTNVFAHESGIHVDGALKNPHTYEIFDPDEVGLERQIVIGKHSGTAALINKFKEYGRVL
FT                   TEEEANQLLPHVRKLAIQLKRPLFDKELMYLYEDVIKNREKAI"
FT   gene            490482..492407
FT                   /locus_tag="Thit_0444"
FT   CDS_pept        490482..492407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0444"
FT                   /product="aconitate hydratase"
FT                   /note="KEGG: tpd:Teth39_1819 aconitate hydratase; TIGRFAM:
FT                   aconitate hydratase; PFAM: aconitate hydratase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01751"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D3T719"
FT                   /inference="protein motif:TFAM:TIGR01342"
FT                   /protein_id="ADD01751.1"
FT                   /translation="MNLTQKILSSHLVEGEMVKGREIAIKIDQTLTQDSTGTMAYLQLE
FT                   ALGIDRVKTELSVAYIDHNTLQQGPENADDHRYIQTVAAKYGIYFSRPGNGICHQVHLE
FT                   RFGRPGKTLLGSDSHTPTAGGLGMLAIGAGGLDVALAMAGEPYRIIMPSIVNVRLTGKL
FT                   RPWVSAKDVILELLRRLTVKGGVGKIFEYSGDGVKTLSVPERATITNMGAELGATTSIF
FT                   PSDERTYEFLKAQGREDAFVPLAADEDAEYDEVIEINLDELEPLVALPHSPDNVVKVKD
FT                   AGRPKVDQVAIGSCTNSSYADLMKVASILRGKVIPEHVSLVIAPGSRQVLNMLAKNGAL
FT                   SDLISAGARILESACGPCIGMGQAPATGAISVRTFNRNFYGRSGTKSASVYLVSPEVAA
FT                   AAALTGYLIDPRELGEAPEVPYVEKFEINDNMIIKPPEDREKVEIIKGPNIKPFPLNTP
FT                   LSDIEKKVLIKVGDDITTDHIMPSNAKLLPLRSNIPELAKHCFEIIDENFSKRAIEWGG
FT                   GIIVGGVNYGQGSSREHAALAPLYLGVKAVIAKSFARIHKANLINSGILPLTFVDEKDY
FT                   DNIEVGDVLKIENAVEQVKRGGRITVKNQTKGTTFEVDLEVSDRNREVLIAGGMINYVK
FT                   SKNKIN"
FT   gene            complement(492447..492800)
FT                   /locus_tag="Thit_0445"
FT   CDS_pept        complement(492447..492800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0445"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="TIGRFAM: aspartate 1-decarboxylase; KEGG:
FT                   tpd:Teth39_1810 aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01752"
FT                   /db_xref="GOA:D3T720"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:D3T720"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ADD01752.1"
FT                   /translation="MQRFMMKSKIHRAIVTESNLNYQGSITIDKNLMELADILPNEKVQ
FT                   VLNINSGARFDTYAIEGERGSGTICINGAAARLCQVGDIIIIISYAIMDDEEAKNYKPK
FT                   VIFVDENNKPVNK"
FT   gene            complement(492800..493651)
FT                   /locus_tag="Thit_0446"
FT   CDS_pept        complement(492800..493651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0446"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="TIGRFAM: pantoate/beta-alanine ligase; KEGG:
FT                   tex:Teth514_0426 pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01753"
FT                   /db_xref="GOA:D3T721"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D3T721"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ADD01753.1"
FT                   /translation="MIVTEKISDVRNVIKEQKLSGKKIGLVPTMGYLHEGHLSLVRIAK
FT                   KHSDFVAVSIFVNPIQFGPNEDFDRYPRDLERDLKLLEKEGCDLVFAPSVHEMYPSELL
FT                   TTVNVDKITEKLCGAFRPGHFKGVTTVVAKLFNIFTPDIAVFGQKDAQQVAVIKKMVED
FT                   LNFPVEIIKAPIVRESDGLAMSSRNVYLNPKERKAATILSKSLKEAEKLLLDGERNANT
FT                   IVKKVNEVLNSEPLCKVQYVSCVHPDTLEDLTYIKDKALIAIACFIGTTRLIDNLLWGE
FT                   NI"
FT   gene            complement(493648..494472)
FT                   /locus_tag="Thit_0447"
FT   CDS_pept        complement(493648..494472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0447"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="TIGRFAM: 3-methyl-2-oxobutanoate
FT                   hydroxymethyltransferase; KEGG: tpd:Teth39_1808
FT                   3-methyl-2-oxobutanoate hydroxymethyltransferase; PFAM:
FT                   Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01754"
FT                   /db_xref="GOA:D3T722"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D3T722"
FT                   /inference="protein motif:TFAM:TIGR00222"
FT                   /protein_id="ADD01754.1"
FT                   /translation="MEEKVTTLTLRKFKKEGRKIVALTAYDFPTAKILDNCGIDMILVG
FT                   DSLGMVVLGYQSTIPVTMEDMIHHTKAVSKAVNRAFVVADMPFMSYHISKEQAMTNAAK
FT                   LIAEGGAEAIKLEGGEEIAPIVKAIVDAGIPVVGHLGLTPQSVHQLGGYKVQGKEKEKA
FT                   KKIFNDAKVLDQAGICALVLESIPMELAKDITENIQVPTIGIGAGPYCDGQILVTHDML
FT                   GITQGHRPKFVKQYADIEKIMIEGINAYIKEVQQGLFPDEEHSFSLEKRENK"
FT   gene            complement(494432..495322)
FT                   /locus_tag="Thit_0448"
FT   CDS_pept        complement(494432..495322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0448"
FT                   /product="Domain of unknown function DUF2520"
FT                   /note="PFAM: Domain of unknown function DUF2520; NADP
FT                   oxidoreductase coenzyme F420-dependent; KEGG:
FT                   tpd:Teth39_1807 oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01755"
FT                   /db_xref="GOA:D3T723"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:D3T723"
FT                   /inference="protein motif:PFAM:PF10728"
FT                   /protein_id="ADD01755.1"
FT                   /translation="MKIGFVGAGVVGTSLAFLLSKNGINISGFLSRNLESAKKSAEFTQ
FT                   SKAFYNYEEIITNADVIIISTNDSSIPEVVNNLSQHKEILKEKIFAHLSGALNLEVLNP
FT                   LKDENNFIMVMHPIQTCPSVSAALELLPKSYFTLEGDEKAVEIGKEIVNKISGKYIVLN
FT                   NIVRPLYHAACVVASNYLVALSKFSLLLLKESGFPFENYPDALIPLMEGTLKNIKEKGT
FT                   TDALTGPITRGDVNTVKLHLENIKDPSLEELYKSLGKLTLEIAYERGSFNDEKYFELEG
FT                   ILNGRKSDNSHTKEI"
FT   gene            complement(495525..496289)
FT                   /locus_tag="Thit_0449"
FT   CDS_pept        complement(495525..496289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0449"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="KEGG: tpd:Teth39_1806 tRNA(1-methyladenosine)
FT                   methyltransferase and related methyltransferase-like
FT                   protein; PFAM: tRNA methyltransferase complex GCD14
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01756"
FT                   /db_xref="GOA:D3T724"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3T724"
FT                   /inference="protein motif:PRIAM:2.1.1.36"
FT                   /protein_id="ADD01756.1"
FT                   /translation="MTSPITTKRVIIGPDNFKKVVDLSSPSKIGLPKGQIDTEFLSQIK
FT                   PGNSFEVQGVKYYVLNCDTIDYIMHYLKRQTQIVYPKEANYIAMRLDIFPGKRVGEAGT
FT                   GSGAFTVYLSRILGPYGRVYTYEQREEFYKLAQKNLREFSEFDNVIMYNKSINEGIKER
FT                   DLDAFFLDVRKPWEVLEEVRKALKPAGHLGILVPTTNQVSESLAALEKVGFYISEVSEI
FT                   ILRKYKLNPQRLRPEDLMVGHTGYLIFARKLK"
FT   gene            complement(496365..496748)
FT                   /locus_tag="Thit_0450"
FT   CDS_pept        complement(496365..496748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01757"
FT                   /db_xref="GOA:D3T725"
FT                   /db_xref="InterPro:IPR025373"
FT                   /db_xref="UniProtKB/TrEMBL:D3T725"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1800"
FT                   /protein_id="ADD01757.1"
FT                   /translation="MRYVVPLMISVVIFIVLLDIISFKYLDKTSENLNKMLTKVQQNIE
FT                   KEHWEEAQKNIKTVEKEWKNINKKWAMLIEHREIDEIEINMEKLKSYVDTKNKDLSSAQ
FT                   LKAIKMLIRHIPQNEKPILENIL"
FT   gene            complement(496751..497425)
FT                   /locus_tag="Thit_0451"
FT   CDS_pept        complement(496751..497425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0451"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   tpd:Teth39_1799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01758"
FT                   /db_xref="GOA:D3T726"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D3T726"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ADD01758.1"
FT                   /translation="MLILFFRTLILYALIVIFMRISGKQQIGQLQPYELVVAIMIADLV
FT                   AIPMQNKGIPLLSGIIPILTLLVSQLFLSYLSMKSLRARAIICGTPTILIEKGKILTSQ
FT                   LQKERYNINDLLEELRVKGYPNIADVEYAILETNGSLSVIPKSDKRPVTPQDLNLTPQY
FT                   EGLPLPIIIDGRIMHQNMQKAGIDMEWLNEQLKMWKIQNVKEVLFASLDTNKVLTVYRK
FT                   ED"
FT   gene            497647..498468
FT                   /locus_tag="Thit_0452"
FT   CDS_pept        497647..498468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0452"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: tpd:Teth39_1798 Cof-like hydrolase; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01759"
FT                   /db_xref="GOA:D3T727"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D3T727"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADD01759.1"
FT                   /translation="MYKLFVTDADGSLLNSNSEISDKNKEAIREVISKGVIFTIATGRM
FT                   FSSILPYALKLNINAPVISYNGALIKDIYTKKVYYYNPIQTEDAIFAIRLLKESGYHIN
FT                   LYIDDELYVEEITDRVEWYLSFNNVTVNAVGNLEEFLEKTGSVTAKIYAINDIKNPISI
FT                   DAQVYDEIAKRLTISTSGGGHLEINAKGVSKGNALKTLANMYNIKRDQVVAVGDNLNDL
FT                   SMIEYAGLGVAMGNAPDIVKIKADYTTLSNDEDGVAHVIDKFFLNKKSVAV"
FT   gene            498775..499791
FT                   /locus_tag="Thit_0453"
FT   CDS_pept        498775..499791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0453"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: tpd:Teth39_1797 LacI family transcription
FT                   regulator; PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01760"
FT                   /db_xref="GOA:D3T728"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3T728"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADD01760.1"
FT                   /translation="MSATIKDVAREAKVSIATVSRVLNNSAVVTDETRQKVLEAIKKTG
FT                   YKPNALARSLKIQKTHTIGLIIPDISSTFYPEVVRGIEDIAAMYNYNIFLCNTDQKEEK
FT                   EIKYIEILGEKQVDGIIFMGDIVRDSVIQTFNEFGVPVVLAGTQDKDKRFPSVMIDNEK
FT                   AAYDAVKYLISLGHKKIAMISGPMNDPIGGLQRIEGYKKALQEHGIKYDPDLVVEGEFK
FT                   TRKAYLAMLKLLEYKVDAVFAASDDMAAAAINAIFDSNLKVPEDIHVVGFDNTYISTIF
FT                   KPTITTIQQPAYDIGAVSMRLLTKLLAKEPIEEMHVILPHQLIVRESTGFGEEKNSR"
FT   gene            499845..500522
FT                   /locus_tag="Thit_0454"
FT   CDS_pept        499845..500522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0454"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: tpd:Teth39_1796 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01761"
FT                   /db_xref="GOA:D3T729"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D3T729"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADD01761.1"
FT                   /translation="MERLLIIDDEEMFVKGLKLSLEEEGFEVDTAYDGEEGLDKVRLGN
FT                   YDLVILDIMLPKLDGFSVCREIRTFSNIPIIMLTARGEDVDRIVGIEIGADDYLAKPFN
FT                   TRELIARIRALLRRATNPYTKKKDEIKRGELYISIPERAVYKRGKRIELTNKEFEILVL
FT                   LASNPGKVYTKDKLLDLVWGFDFYGDTNTVTVHVRKLREKIEDDPANPQYIFTKWGAGY
FT                   YMK"
FT   gene            500533..501933
FT                   /locus_tag="Thit_0455"
FT   CDS_pept        500533..501933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0455"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: tpd:Teth39_1795 integral membrane sensor
FT                   signal transduction histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01762"
FT                   /db_xref="GOA:D3T730"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3T730"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADD01762.1"
FT                   /translation="MSLRWKIFSLYLTILIISLALTGIYLYRYIERSYLDNVRVNNLMQ
FT                   ANMVSNFVSRFVGTASSHLIEPTIMEYAKQINSRILFTNINGKVLVDSASSKEFEGKVI
FT                   KDYNDIKEALNGKGSTSIHDINGVGWAMYTAVPVIAKNNVVGAILISSSIDNIIDLLKS
FT                   IKYRMIYTFTGIGFLVSFLSLLVASYITNPLKRLTEAANILSQGKLDYKVEVKSNDEIG
FT                   KLANAFNKMSFSLMKIDEERKRFVSDASHELKTPLASVKALIESLINSKNQDITFYKEI
FT                   LKDVDGELDRMTRLVNDLLELARMDKIKAVKVKKSEISEIILDVIESLFPLAKTKDINL
FT                   KFEGKNNVFAEVDPDRFYRMVYNIVENGIKYTNEGGNVMVSLEEDENNIYLTVADNGIG
FT                   ISEENLPKIFERFTRVDTARSKKSGGFGLGLAIAKEIIDIHEGKVTVVSKVGEGTVFKI
FT                   SLPKKKRD"
FT   gene            502016..503455
FT                   /locus_tag="Thit_0456"
FT   CDS_pept        502016..503455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0456"
FT                   /product="Spore germination protein-like Gmad2"
FT                   /note="PFAM: Spore germination protein-like Gmad2,
FT                   bacteria; Lipoprotein LpqB, GerMN domain; KEGG:
FT                   tpd:Teth39_1794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01763"
FT                   /db_xref="InterPro:IPR018911"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:D3T731"
FT                   /inference="protein motif:PFAM:PF10648"
FT                   /protein_id="ADD01763.1"
FT                   /translation="MKRIALVLIVMFVLTLAGCFAKVNNSEKNSPINPKPIVQDVSKEI
FT                   SLYFLNDKMNGLILERRLISKDADVLKQVVAEMIKGPTDEYAKPVFPNGTKLISIELQE
FT                   GIAFVSFSKEFLQDSEDKGIDKLRVAALVNALTDIPGVESVQILVEGNKIDAVGKYKIG
FT                   LDPLKRMILVGDVYNNPDRIKKLQERADLGKETWRFDPIQLLRQEGGIIGIGSEDELTL
FT                   KNENNGVAYVEAIHNNKMYSITLIQPLGKGDNYIWVIDNVKAKFTEIPETNPAEGETFI
FT                   YGIVKAIDYENRIITIEREYQDSQDMKNQVGPDIKVLPDAIIHFQAKVGYDSQGGFKYA
FT                   EKDINFAEIKIGDELGIILTKDKEARAIIVSDRSNISYEPNIKVVSPVKNDVVTSPFKV
FT                   IGKARVFEGNVNIRLVDSNGNILSETVVQATAGAPSWGDFEAIISYKALKEPQNGILQV
FT                   FSLSPKDGSVQNLVSVPLKLK"
FT   sig_peptide     502016..502081
FT                   /locus_tag="Thit_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.899 at
FT                   residue 22"
FT   gene            complement(503458..503967)
FT                   /locus_tag="Thit_0457"
FT   CDS_pept        complement(503458..503967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0457"
FT                   /product="sporulation protein YyaC"
FT                   /note="KEGG: tpd:Teth39_1793 hypothetical protein; TIGRFAM:
FT                   sporulation protein YyaC; PFAM: protein of unknown function
FT                   DUF1256"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01764"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D3T732"
FT                   /inference="protein motif:TFAM:TIGR02841"
FT                   /protein_id="ADD01764.1"
FT                   /translation="MEELRLKYDDSNAIYFISNFLSTCLSPNSIFLCIGTDRFISDSLG
FT                   PIVGNLLIKSLPPTYHVYGTLKSPIHAMNLEENIKYIKKKHPNSKIIAIDASLGGKESI
FT                   GKISIKKATLYPGKGVGKILPSVGDVSIVGIVDVYDSFLLNSVRLGFVFEIAEVIAKSI
FT                   QLALRC"
FT   gene            504060..504611
FT                   /locus_tag="Thit_0458"
FT   CDS_pept        504060..504611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1792 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01765"
FT                   /db_xref="GOA:D3T733"
FT                   /db_xref="UniProtKB/TrEMBL:D3T733"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1792"
FT                   /protein_id="ADD01765.1"
FT                   /translation="MLKRLKFYLVVVIVIALFTTMFMFKTNFEEPIYFSQQSLWEKNKE
FT                   QLTKEENNSYREEQPIDSKKDKEKKEMARLENQQKEEEAYDLENNKKTQKENSNDDSVI
FT                   VTLEKILQIRNEMDPSQKARVINILLKLGKDDMSEIMKMAQKGLTQEDSDKIMEILKNK
FT                   LSSEEISYLVEIANEYFAKK"
FT   gene            complement(504655..507018)
FT                   /locus_tag="Thit_0459"
FT   CDS_pept        complement(504655..507018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01766"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:D3T734"
FT                   /inference="similar to AA sequence:KEGG:TTE0486"
FT                   /protein_id="ADD01766.1"
FT                   /translation="MNIKKILSLGVSILLLLLTFPTQNVKANTYTILDRKEFTQNLSKG
FT                   VVHKNIIYFTTEGWINVNVLKVDLTDKYTDVSVIFNPSGIKNRMSVRDMANTYGAVASV
FT                   NGNFFDTTTGFVIGATVKDGRLITDPSNIGKLATFSIDANGIPSIEYWSKSMSVTLPNG
FT                   TKLPLAAINKISSTFEYLVMYTRDWFSTSPGANENVPQLVEVVVDGNDRVLEVRQGQPP
FT                   VEIPQDGYVLAGAGYVGQNLLTLKPGDVIQKDIMTNPPFENLKMAVSGGTILVKDGKIA
FT                   PFTHEIKGYTARSAIGYTQDKKYLIIATVDGSSTRGMTQQEMANLMISLGAYDALNLDG
FT                   GGSTQMAVRPLGDTEAKLANHPPEGYERKVANGIGIFNTAPQGNLYALKLEASDTNVFK
FT                   GLHRTITVKGYDENYNPVTINPEEVLFSVNGITGIFIGNTFMPTSVGEGVITARVGNAI
FT                   GTIKITSLDKPVDIRFNPSNIVIDKNKSIPITVTAKNIKGYRALIEPQDITWEVYNNVG
FT                   NIDKSGVFVSSNLDVTGALVANVLGEKAILPVKVGQGSEFDTSLLPHVTEFTQIDPYNK
FT                   EVIVKNTYDSFKFMVFGDTKYNTLLKLHISLKAADIANAEYPLAIFLGDVNEKVLKNLK
FT                   VKYITTGDKYTMYNYNNSTFIVLNNRSGSLLNPDKNQWSWFKEQLNNVKGDNLFIILPK
FT                   PVWGSDGFKDVKEATLFEETLKEFKKNTSKNVWIIYNSKSKFYTTLNDEIRYITTYGTD
FT                   VEGNTNDIYNDFGFISIMVNGKEVNYQFKNLINK"
FT   sig_peptide     complement(506935..507018)
FT                   /locus_tag="Thit_0459"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.873) with cleavage site probability 0.821 at
FT                   residue 28"
FT   gene            507318..507393
FT                   /locus_tag="Thit_R0015"
FT                   /note="tRNA-Pro1"
FT   tRNA            507318..507393
FT                   /locus_tag="Thit_R0015"
FT                   /product="tRNA-Pro"
FT   gene            507398..507473
FT                   /locus_tag="Thit_R0016"
FT                   /note="tRNA-Val1"
FT   tRNA            507398..507473
FT                   /locus_tag="Thit_R0016"
FT                   /product="tRNA-Val"
FT   gene            507495..507580
FT                   /locus_tag="Thit_R0017"
FT                   /note="tRNA-Tyr1"
FT   tRNA            507495..507580
FT                   /locus_tag="Thit_R0017"
FT                   /product="tRNA-Tyr"
FT   gene            507722..508225
FT                   /locus_tag="Thit_0460"
FT   CDS_pept        507722..508225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0460"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; Rubredoxin-type Fe(Cys)4
FT                   protein; KEGG: tpd:Teth39_1791 rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01767"
FT                   /db_xref="GOA:D3T735"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D3T735"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADD01767.1"
FT                   /translation="MRKMTKHNLEEAYAGESQAHMRYQIFADVAEKEGKPNIARLFRAI
FT                   SYAELVHATNHYKTLGEVGNTVENLEKAIEGETFEVEEMYPAYNAVAELQEEAGAKKSI
FT                   HYAIEAEKIHAKLYTEAKEVALKGEDIKISQVYICPVCGYTSVDVLPEKCPVCGVPKEK
FT                   FVAF"
FT   gene            508472..508666
FT                   /locus_tag="Thit_0461"
FT   CDS_pept        508472..508666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0461"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: tte:TTE2469
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01768"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D3T736"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ADD01768.1"
FT                   /translation="MTIIFVGKNNQVTIKGAKSVEKLAKELNISLESHVFVKNGEIVTP
FT                   DEILQDEDTVEVISVISGG"
FT   gene            508686..509588
FT                   /locus_tag="Thit_0462"
FT   CDS_pept        508686..509588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0462"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: csc:Csac_0104
FT                   PP-loop domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01769"
FT                   /db_xref="GOA:D3T737"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D3T737"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ADD01769.1"
FT                   /translation="MKCVRCKKKAVIVLRRHNAAFCADCFLHYYKNQVLKNIRKNRMFE
FT                   KGEKVLAVVSGGKDSMALWDILVKEGYNVVAMYINLGIGEYSNRSQEVVEKFAKENNLP
FT                   LIVKDIKKEFGLDIYKLSKTLRRSPCSVCGSIKRYLFNKVAYDGGFSAVATGHNLDDEA
FT                   ATLFGNVLSWEEGYLARQGPVLPQTHPKLIKKVKPLYTLTERENMYYVLLNKIEFLHEE
FT                   CPHSVGARSILYKELLNKLEEESPGTKQRFLSGFLKKGKKHFQDVREKLELKECKNCGQ
FT                   VTTTEECSFCRFVKICNQQ"
FT   gene            509813..510418
FT                   /locus_tag="Thit_0463"
FT   CDS_pept        509813..510418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0463"
FT                   /product="thiamine biosynthesis protein ThiF"
FT                   /note="KEGG: ate:Athe_0371 thiamine biosynthesis protein
FT                   ThiF; TIGRFAM: thiamine biosynthesis protein ThiF; PFAM:
FT                   UBA/THIF-type NAD/FAD binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01770"
FT                   /db_xref="GOA:D3T738"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012729"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:D3T738"
FT                   /inference="protein motif:TFAM:TIGR02354"
FT                   /protein_id="ADD01770.1"
FT                   /translation="MNLFDMMLKNYFDEKMLEKLSKVKILIIGCGGLGSNIAVMLVRSG
FT                   IKNLTIVDFDKVDILNLNRQNYFFYQVGEEKVSALKDILSKINPSVNVKAKNIKIDESN
FT                   LDELILQHDIIVEAVDNELTKTLIFRKAHEHSKKVVLASGIAGFGDCENIKIKRGKDFT
FT                   IIGDFVTSINDKKPFAPKVIAVAAMQADEVLRIVSELE"
FT   gene            510717..511904
FT                   /locus_tag="Thit_0464"
FT   CDS_pept        510717..511904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0464"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="TIGRFAM: S-adenosylmethionine synthetase; KEGG:
FT                   tpd:Teth39_1790 S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01771"
FT                   /db_xref="GOA:D3T739"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D3T739"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ADD01771.1"
FT                   /translation="MRKLFTSESVTEGHPDKICDQISDAILDEILKKDPYARVACETAV
FT                   TTGLVLVMGEITTECYVDIPKVVRKVIEEIGYTRAKYGFDADTCAVITSIDEQSPDIAL
FT                   GVDKALEAKRGELSDSEIEAIGAGDQGLMFGFACDETEELMPMPIMLAHKLARRLAEVR
FT                   KNGTLSYLRPDGKTQVTVEYEDDRPVRVDSVVVSAQHAPDIDYKTIERDIIEHVIKVII
FT                   PENMLDDKTKIFVNPTGRFVIGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTKV
FT                   DRSASYAARYVAKNIVAAGLAKKCEVQLAYAIGVATPLEIGVDTFGTGKIPDEKISEIV
FT                   KQVFDLRPAAIIRDLDLRRPIYRQVAAYGHFGRHDLDLPWEKTDKVDILKKLAGI"
FT   gene            512108..514315
FT                   /locus_tag="Thit_0465"
FT   CDS_pept        512108..514315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0465"
FT                   /product="helicase, RecD/TraA family"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: helicase, RecD/TraA family; KEGG:
FT                   tpd:Teth39_1789 RecD/TraA family helicase; SMART: AAA
FT                   ATPase; Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01772"
FT                   /db_xref="GOA:D3T740"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:D3T740"
FT                   /inference="protein motif:TFAM:TIGR01448"
FT                   /protein_id="ADD01772.1"
FT                   /translation="MVDIEGVVEEIIFRNEQNGYTVLELSTRGLAVTAVGYMPFVNIGE
FT                   RIKIEGEWIEHPDYGEQIKVLNYQTLAPTTLEGIEKFLSSGLIPGIGPVTARKIVKKFG
FT                   VDSLNIIETAPERLKEIKGLSDEKIKRICEAYEMQKGIKEVMVFLQGYGISTAMAIKIY
FT                   KEYGNNAIEIIKQNPYRLADDIFGIGFKTADKIAESLGVDPHSLYRISSGTRYVLMQYA
FT                   SNGHTYVPKELLKKETANLLEVSEEEVEDSFVLLIQSKKVHIETFEDGTVGVYYVPYYM
FT                   AELHTAERLFEMTLIENENFDIDIKKEIINFEKETGILLAENQKLAVEEAVKNSVVVIT
FT                   GGPGTGKTTIINCIIRIFEKAGKKVALAAPTGRAAKRITEATGKEAKTIHRLLEYTYSE
FT                   EDGKGFNKNEKDPLKYDVIIVDEASMVDILLMNALLKAIPIGAKLILVGDADQLPSVGA
FT                   GNVLRDIIDSGIVKVIRLKEIFRQQKQSLIVVNAHKINNGEYPTYNDKNSDFFFINANT
FT                   QEDILKTILELVTNRLPKAYGFHPINDIQVLTPMRKGIIGVHNLNLELQKALNPHDKTK
FT                   AEKIMKEFVFRVGDKVMQIKNNYKIKWKKGDEEGEGVFNGDIGIIQSIDEELQELTVYF
FT                   DDEKFVTYDFSDLDELNLSYAITVHKSQGSEFPVVIIPITYGPPMLLTRNLLYTAVTRA
FT                   RKLVILVGQEKYLKFMIDNNRISKRYSGLLSRLKKTLLYVN"
FT   gene            514414..515103
FT                   /locus_tag="Thit_0466"
FT   CDS_pept        514414..515103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0466"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   tpd:Teth39_1788 phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01773"
FT                   /db_xref="GOA:D3T741"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D3T741"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ADD01773.1"
FT                   /translation="MIFLDLLFPPKTTCIICKAAIKTGYLCDKCKTALKFIEDDRCNIC
FT                   GKPIDYEGTCLDCLEHGHEFKQNISPFEYDGVVKDLIGQFKYFKKRELAPFFADYMADA
FT                   VKKMNWPIDVIVPVPLHKIRLDERGYNQSELLARELSYRLNIFMSKALRRVRNTTTQTA
FT                   LHKEERMENVKGAFKVTYKDTIIGKNVLLVDDVLTTGATLDECAKVLKENGAKDVYVAT
FT                   IATGKNM"
FT   gene            515142..515558
FT                   /locus_tag="Thit_0467"
FT   CDS_pept        515142..515558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01774"
FT                   /db_xref="InterPro:IPR022258"
FT                   /db_xref="UniProtKB/TrEMBL:D3T742"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1787"
FT                   /protein_id="ADD01774.1"
FT                   /translation="MEIRNCKRCGRLYTYTGIDLCPVCYRQDEEDFMKVRDYLDAHPSA
FT                   TMLEISQNTQVSPKKIMDFLKEGRLILTSNNVNIGLKCEKCGKPILTGRFCDECKTKLA
FT                   KELMKGYSIQSENKEEEKQTGERLYLYENHKNKK"
FT   gene            515616..515891
FT                   /locus_tag="Thit_0468"
FT   CDS_pept        515616..515891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0468"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="PFAM: Anti-sigma-28 factor FlgM family protein;
FT                   KEGG: tpd:Teth39_1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01775"
FT                   /db_xref="GOA:D3T743"
FT                   /db_xref="InterPro:IPR007412"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:D3T743"
FT                   /inference="protein motif:PFAM:PF04316"
FT                   /protein_id="ADD01775.1"
FT                   /translation="MKIYNNNIEKMMSLYRVDPVEKVTSKEAEMKDKVEISEEAIKLAQ
FT                   SSNEFEKIRNQKIENIKAMLSAGTYNVKAEDVADAILKGILLNKKI"
FT   gene            515909..516385
FT                   /locus_tag="Thit_0469"
FT   CDS_pept        515909..516385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0469"
FT                   /product="FlgN family protein"
FT                   /note="PFAM: FlgN family protein; KEGG: tpd:Teth39_1785
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01776"
FT                   /db_xref="GOA:D3T744"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D3T744"
FT                   /inference="protein motif:PFAM:PF05130"
FT                   /protein_id="ADD01776.1"
FT                   /translation="MANSQKLVDVLRGETEIYKVLLDLAIKKTDVIIAGKIKELDKIVQ
FT                   MEKQLVKKLMELEGQREDILEKVDIEGKMTITDVIESVSSEEAENLKHIKYNLTNILKE
FT                   LEERNKLNAALIEQALEYVNYSIQTISNALESNDGVYGNNGNMKKYTSLIDKKA"
FT   gene            516396..517838
FT                   /locus_tag="Thit_0470"
FT   CDS_pept        516396..517838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0470"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="KEGG: tpd:Teth39_1784 flagellar hook-associated
FT                   protein FlgK; TIGRFAM: flagellar hook-associated protein
FT                   FlgK; PFAM: protein of unknown function DUF1078 domain
FT                   protein; flagellar basal body rod protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01777"
FT                   /db_xref="GOA:D3T745"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:D3T745"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ADD01777.1"
FT                   /translation="MSTFQGLEIAKTGLFVSQKALDVTGHNIANANTPGYTRQVVDMVS
FT                   IAPPTTFGMYDQWGKAIGEGVKIQDIRQIRDQFLDNQYRRENKFLGKWETKAQVLAAIE
FT                   NIFNEPSDSGINTVLNNFFNSLQELSKNPESLTVRAEVRERAIALADTFNTVYQHLYDK
FT                   LNELNSTIQSRIAEINSYAERISKLNNEIYRFELTGQTANDLRDQRNLLVDQLSKLINI
FT                   TTYEDSNGNFRIDIAGQALVAGSTAFTMSLNNTGEVVWDLTGTPVNPSSGVLKGLLDMR
FT                   DGDSTNGVKGVPYYINEWNKLAYSMAQAINEVHKSGYGLDGSTGIPLFTDFTTPYDSTV
FT                   QYAQLIKVSSHILADDGLQKIAAASSDATLPGDNTNALKLIALRDQAISELDGATFDDF
FT                   ARSLISNLGVDAEQANLMQKNQKFMIKQIDLNRQSISGVSLDEEMTNMLKYQKSYAASA
FT                   RMITAIDELLDTLINKMGIVGR"
FT   gene            517855..518748
FT                   /locus_tag="Thit_0471"
FT   CDS_pept        517855..518748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0471"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="KEGG: tpd:Teth39_1783 flagellar hook-associated
FT                   protein FlgL; TIGRFAM: flagellar hook-associated protein 3;
FT                   PFAM: flagellin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01778"
FT                   /db_xref="GOA:D3T746"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:D3T746"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ADD01778.1"
FT                   /translation="MRVTDGMLITNFLNNYHNNLEKLQKNQNMLSTGKKISRPSDDPVA
FT                   VATSLRIRTDMARNDAYTKNADEVQSWLNITDTALDQLGDLLQRTRELAVEGANGTLTQ
FT                   ADMQKIAKEIEQLKAQMIQVGNTQYNGRYIFAGFKTTTQPFSEDNNSYNGDNGLIEFEV
FT                   GAGGNKISVNVPGDKVFDVDLTGTSQLLVMMDNLKSALDSGDHQAVSNLIADVDRQLEN
FT                   VLAVRAEVGAKSNRVDLIKNRLQDDNYNFTVLLSKNEDADLAQVITNLKMDENVYRASL
FT                   AAGARIMQPSLIDFLR"
FT   gene            518753..519310
FT                   /locus_tag="Thit_0472"
FT   CDS_pept        518753..519310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01779"
FT                   /db_xref="UniProtKB/TrEMBL:D3T747"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0453"
FT                   /protein_id="ADD01779.1"
FT                   /translation="MNIVINQTFGRIGIDTTPAQISIQSPKADLEIKQIPAKMEIDKKL
FT                   PQVHIDQYQCFYEAGLKSIFDLVYDEAQRSKQIALEAIGKIAEDGDILASIENHQDAIV
FT                   KLSEEALIQDIDFNVDLIPKSRPKIWFEGYLKINWELGGVKIKAIPHKPQISVTPAHVN
FT                   IYMRQYPSIKIQYVGNNVDRRI"
FT   gene            519400..519852
FT                   /locus_tag="Thit_0473"
FT   CDS_pept        519400..519852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0473"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   tex:Teth514_0454 flagellar assembly protein FliW"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01780"
FT                   /db_xref="GOA:D3T748"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/TrEMBL:D3T748"
FT                   /inference="protein motif:PFAM:PF02623"
FT                   /protein_id="ADD01780.1"
FT                   /translation="MQINTKNFGIVEYNPEDVIYFEEGIPGFEDLHNFLIITDNNEDMP
FT                   FKWLQSIDNTDIAFAIIDPRVFKPNYTFEIDDELIQALRIENVNHLLIYVIVVIPDEIE
FT                   KMTANLKAPIIINAKNNKGKQVILDNDEYLIKHPILEELKNAYSNA"
FT   gene            519833..520060
FT                   /locus_tag="Thit_0474"
FT   CDS_pept        519833..520060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0474"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="KEGG: tpd:Teth39_1780 carbon storage regulator,
FT                   CsrA; TIGRFAM: carbon storage regulator; PFAM: carbon
FT                   storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01781"
FT                   /db_xref="GOA:D3T749"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/TrEMBL:D3T749"
FT                   /inference="protein motif:TFAM:TIGR00202"
FT                   /protein_id="ADD01781.1"
FT                   /translation="MLILTRKVGQAIIIGEDIEIKILEIEDGQIKLGITAPKNISVLRK
FT                   ELVEIKDENLKAATVNKEALSQLENFIKKH"
FT   gene            520188..521042
FT                   /locus_tag="Thit_0475"
FT   CDS_pept        520188..521042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0475"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: tte:TTE0499
FT                   flagellin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01782"
FT                   /db_xref="GOA:D3T750"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:D3T750"
FT                   /inference="protein motif:PFAM:PF00669"
FT                   /protein_id="ADD01782.1"
FT                   /translation="MIINHNLSALNAWRALSVNTANTQKVLEKLSSGYRINRAGDDAAG
FT                   LAISEKMRAQIAGLNQAQRNAQDGISLIQTAEGALNETHAILQRMRELTVQAANSTNTL
FT                   TDRQNIQKEIDQLKKEINRIASTTQFNTRNLLNGSLAAGKATLTFQIGANSQQVLKLNI
FT                   ATMTASALKGTAAGAMSMASINVATNNASVISAQINSIDAAINKVSGQRADLGAAQNRL
FT                   EHTINNLGTAAENLTAAESRIRDVDMAQAMMEFTKDNILNQAATAMLAQANQLPQTILQ
FT                   LLR"
FT   gene            521129..521482
FT                   /locus_tag="Thit_0476"
FT   CDS_pept        521129..521482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbt:CLH_0788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01783"
FT                   /db_xref="UniProtKB/TrEMBL:D3T751"
FT                   /inference="similar to AA sequence:KEGG:CLH_0788"
FT                   /protein_id="ADD01783.1"
FT                   /translation="MANELMKETMEESFKYIPKLINGIDKEIEYISNGDYTNALSLLTY
FT                   ILEGLDWSIQAIVLTAPLHGFSIDISKTNESLNLLLSAIENSDYQLISDVLNYEIKDIL
FT                   YGYVSHCQKGEFN"
FT   gene            521482..523305
FT                   /locus_tag="Thit_0477"
FT   CDS_pept        521482..523305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0477"
FT                   /product="protein of unknown function DUF115"
FT                   /note="PFAM: protein of unknown function DUF115; KEGG:
FT                   cbt:CLH_0787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01784"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="UniProtKB/TrEMBL:D3T752"
FT                   /inference="protein motif:PFAM:PF01973"
FT                   /protein_id="ADD01784.1"
FT                   /translation="MDLFEIVKARDGHDTLAVTDGNKKYFLHSLYYPEKEGQEWADMVQ
FT                   FDDEAIILVYGIGLGYHINFLARKLSLSNRLILVEPSKEIFEYALVNGYYDEFKERPNT
FT                   FFINEGSDENMRNLLSMYIPWDNFENLVYRDFKQYPKIFEDHYRMFSKCLIETINAMRI
FT                   NRNTALYFASQWQSNFMENIEFVFKSVPVKSFFNSFKNVPAVIVSAGPSLDKNIRLLKE
FT                   AKGKSIIICVGTALKALLKEKIEPDFVVSIDGSEKNFRHFEGCSVNIPLLYDLTVYPQI
FT                   LKEYKGPLIIGQIASEFSALFEGKLSLEFGSLNAGPSVANLSLDFAYKMGCNPIIFIGQ
FT                   DLAYLNNRTHASGTTYEKDRIKGSSDEKEYIYVDGNYGEKVLTDRVLLSFKTWFENYIC
FT                   KHPNRIYINATEGGAFIKGTEVMDFKNVIDKYMKKNLHISQKINEIVANKKIALKPEQI
FT                   NFLYTELEGTIKRLKIIKWDCLRGAKLSKKMYNEYEKDINADTTRILKILDKIDAKLRD
FT                   SKESFLLISSILNIVTTKILKGFKTEKDETEKEKKLRISMMSYTLYYGIYEAILQSEKG
FT                   LEKALNTIKSINSTNITSLNIIREDKYENRR"
FT   gene            523289..524275
FT                   /locus_tag="Thit_0478"
FT   CDS_pept        523289..524275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0478"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   mta:Moth_0751 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01785"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026390"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T753"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADD01785.1"
FT                   /translation="MKIEGKKVLVTGAGGFIGSHLVERLIERGAEVRAFVRYNSKNNWG
FT                   WLETSPYKDEIEIYTGDIRDYDSVKDSMKGIEIVFHLAALIGIPYSYISPLAYIKTNVE
FT                   GTYNVLQSARELGVERVIHTSTSEVYGTAKYVPIDESHPLQPQSPYSATKISADNIALS
FT                   FYNAFNLPVTIVRPFNTYGPRQSARAVIPTIITQIMSGKKQIKLGNLRPTRDMNYVIDT
FT                   VNGFIKIAECDELLGEITNIGSGKEISIGDLARLISQLMGVKIEIEQEEQRFRPEKSEV
FT                   ERLLCDNTKMKKFTDWEPQYTLEEGLIQTINWMKTHLNMYKPEVYNV"
FT   gene            524268..525395
FT                   /locus_tag="Thit_0479"
FT   CDS_pept        524268..525395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0479"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   pmx:PERMA_1629 DegT/DnrJ/EryC1/StrS aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01786"
FT                   /db_xref="GOA:D3T754"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:D3T754"
FT                   /inference="protein motif:PFAM:PF01041"
FT                   /protein_id="ADD01786.1"
FT                   /translation="MSELYLDSPNLSELEKEYILKALDSNFVSTVGPFVREFEEKFARY
FT                   LGVTSCVAVQSGTAAIHVALYEVGIKEGDEVIVPAITFVATVNPIVYCGATPVFVDIDK
FT                   DTWNIDPKEIEKAITSKTKAIIPVHLYGNPCDMDEIMKIAEKYGVYVIEDATESLGAEY
FT                   KGRMTGTIGHIGCFSFNGNKIITTGGGGMISTNNEKWASHIKFLVNQARDASQGYFHPE
FT                   IGFNYRMTNLEAALGLAQLERLPEFLKKKRIYFEAYKKIFEGIDEIVLQKEYEGAISSA
FT                   WLPSIKINCKKVDMTIPEIQNKLKERGIPTRRVFNPIIDFPPYVKYKKGNYHNSYEIFE
FT                   NGLSLPASTLNTLENVEYAAKTLLDILGIKKEVVL"
FT   gene            525392..526546
FT                   /locus_tag="Thit_0480"
FT   CDS_pept        525392..526546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0480"
FT                   /product="UDP-N-acetyl-D-glucosamine 2-epimerase,
FT                   UDP-hydrolysing"
FT                   /EC_number="5.1.3.14"
FT                   /note="TIGRFAM: UDP-N-acetyl-D-glucosamine 2-epimerase,
FT                   UDP-hydrolysing; KEGG: cbl:CLK_2100 UDP-N-acetylglucosamine
FT                   2-epimerase; PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01787"
FT                   /db_xref="GOA:D3T755"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR020004"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D3T755"
FT                   /inference="protein motif:TFAM:TIGR03568"
FT                   /protein_id="ADD01787.1"
FT                   /translation="MKKIAVVTGTRAEYGLLYWTMKEIENDPELELQLIVTGMHLSPEF
FT                   GLTVQEIEKDGFKIDEKIEILLSSDTGQGVAKAIGLGVIGFTQAFVRLNPDILMILGDR
FT                   FEIFAAATAAMAMNIPIAHIGGGESTEGAIDEQIRHAITRMAHIHFTSCDYYAKRIKKM
FT                   GEEEWRIFNVGAPGLENIKRLKLLNREEVEKLLNVDLSETTLLVTYHPVTLEMQTLKEQ
FT                   MDNLLGALMQTGYQIIFTYPNSDSGGRYIIKRINEFIKNYNKAKAFVNLGQQKYLSLLQ
FT                   YVNAMVGNSSSGIIEAPSFKLPVVNIGDRQKGRLRAENIIDVGYSKEEILNGINKALQD
FT                   EEFRAKLEDIKNPYGDGDTSKKIIKILKEINTKQENFLKKKLTY"
FT   gene            526589..527632
FT                   /locus_tag="Thit_0481"
FT   CDS_pept        526589..527632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0481"
FT                   /product="N-acetylneuraminate synthase"
FT                   /EC_number="2.5.1.57"
FT                   /note="SMART: SAF domain protein; TIGRFAM:
FT                   N-acetylneuraminate synthase; KEGG: mae:Maeo_0420
FT                   N-acetylneuraminate synthase; PFAM: N-acetylneuraminic acid
FT                   synthase domain; SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01788"
FT                   /db_xref="GOA:D3T756"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020007"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:D3T756"
FT                   /inference="protein motif:TFAM:TIGR03569"
FT                   /protein_id="ADD01788.1"
FT                   /translation="MIKIGSKTISDNSPVFIIAEAGVNHNGDIEIAKKMVDAACEAGAD
FT                   AIKFQIFKIDSLVIKNADKAEYQKLNTGIDETQYDMLKKLELSYEEHFKIMEYCKERNI
FT                   VYLSTPFDYESVDVLEDLNIPAYKISSGDITNLPFLKYVASKGKPIIVSTGMSNLGEVE
FT                   DAIEAIKSTGNEKIILLHCTSNYPAEYNEVNLKAMITLRNAFQIPVGYSDHTLGIEVPI
FT                   AAVSLGARIIEKHFTLDRTMPGPDHKASLEPAELKQMIISIRNIEKALGDGIKKCTKSE
FT                   ENVKKIARKSIVAASYIPKGSIIDENMLTIKRPGTGIPPKFIDYLIGKKAKIDILKDTV
FT                   LDLSMFE"
FT   gene            527661..528320
FT                   /locus_tag="Thit_0482"
FT   CDS_pept        527661..528320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0482"
FT                   /product="sugar O-acyltransferase, sialic acid
FT                   O-acetyltransferase NeuD family"
FT                   /note="TIGRFAM: sugar O-acyltransferase, sialic acid
FT                   O-acetyltransferase NeuD family; KEGG: cbf:CLI_2771
FT                   hexapeptide repeat-containing transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01789"
FT                   /db_xref="GOA:D3T757"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:D3T757"
FT                   /inference="protein motif:TFAM:TIGR03570"
FT                   /protein_id="ADD01789.1"
FT                   /translation="MKKIILIGAGGHAKAVIDILKKNNQGIEIVGLITKDADDIGKKIL
FT                   GVSVIGTDKQLSELFKRGIEYALIAVGSAGDNFLRKKLYEKVANIGYTFVNAFHPSSII
FT                   SDHVKFGAGNVVMPGVLVGPDTIIGNNVILNTGSIIEHDCVIEDHVHIAPGVKIAGGVK
FT                   IGEASHIGIGSVIIQGIKIGKNALIGAGTIVLKDVPDNAVVVGVPGKIKKFRETND"
FT   gene            528333..529391
FT                   /locus_tag="Thit_0483"
FT   CDS_pept        528333..529391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0483"
FT                   /product="Nucleotidyl transferase"
FT                   /note="KEGG: mta:Moth_0757 nucleotidyl transferase; PFAM:
FT                   Nucleotidyl transferase; CBS domain containing protein;
FT                   SMART: CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01790"
FT                   /db_xref="GOA:D3T758"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3T758"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADD01790.1"
FT                   /translation="MEKIKSVLIKEESLIKEAIKQLNENTLQILLVIDDNYRLIGTVTD
FT                   GDIRRAILNNISFDEPVGKIMNRVPKFVYIGEEENAKELMIKHRIKTIPVLDREKRVVD
FT                   LILMENLLETRYEYPEKSNYVFIMAGGKGTRLDPFTKILPKPLIPIGDIPIIEVIIKNF
FT                   KKFGFNNFLISVNYKAEIIKLYFSENPDGYNINFIHEKDFLGTAGSLRLAEEKLKDTFI
FT                   VSNCDVIIDIDFDELLKYHKKNNNHATIVGVVKNMQIPYGVIDVNNGELVNMIEKPEYN
FT                   FVINSGVYVLEPELINLIPQGKPINMPDLLLKSKEVGYKVGVYPVSSKWFDVGQWEEYR
FT                   NTLEYFKKVDGI"
FT   gene            529394..530095
FT                   /locus_tag="Thit_0484"
FT   CDS_pept        529394..530095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0484"
FT                   /product="N-acylneuraminate cytidylyltransferase"
FT                   /EC_number="2.7.7.43"
FT                   /note="KEGG: mta:Moth_0758 acylneuraminate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01791"
FT                   /db_xref="GOA:D3T759"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3T759"
FT                   /inference="protein motif:PRIAM:2.7.7.43"
FT                   /protein_id="ADD01791.1"
FT                   /translation="MYKGETILALIPARGGSKGVPRKNIKLLLDKPLIAYTIETALQVD
FT                   FIDKVIVSTEDLEIAQISREYGAEVPFLRPYELATDEAKSIDVILHAMDWMEKKHGAFN
FT                   LILLLQPTSPFRSSEDIKTALDIFFKKNAKAVVSVCEAEHSPLWMNTLNDDLNMKDFIR
FT                   KDILNKNRQELGKYYRINGAIYIAEWDYLKQNKTFFGDKTYAYIMPKERSIDIDTEMDF
FT                   KFAEFLINRYG"
FT   gene            530286..531248
FT                   /locus_tag="Thit_0485"
FT   CDS_pept        530286..531248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0485"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="TIGRFAM: DNA adenine methylase; KEGG:
FT                   tpd:Teth39_1777 DNA adenine methylase; PFAM: D12 class N6
FT                   adenine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01792"
FT                   /db_xref="GOA:D3T760"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3T760"
FT                   /inference="protein motif:TFAM:TIGR00571"
FT                   /protein_id="ADD01792.1"
FT                   /translation="MQALNLIETSDKILSILNNAKPFLKWAGGKTQLLDELCKRLPSSL
FT                   IQSGEIERYVEPFVGGGAFFFFLKRNFKVKESFLIDINKELIIGYKVIQNNVNELIDEL
FT                   SSMEEKYLKLSEEQRKDFYYNIRDEYNRQKGNFDYVNYNLDWVKRAAYLIFLNKTCFNG
FT                   LYRLNKKGEFNVPFGKYKNPTICDVDNLIEVSKALENTEVICADFEESKKYIHKNTLVY
FT                   LDPPYRPLNNTSNFTSYNEDGFDDDDQRRLAQFFKEMDKRDAYLILSNSDPKNEDVDDN
FT                   FFDELYAGFIIERVKAKRYINSNGDKRGDISELIIRNYE"
FT   gene            531259..532182
FT                   /locus_tag="Thit_0486"
FT   CDS_pept        531259..532182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0486"
FT                   /product="Type II site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.4"
FT                   /note="KEGG: tpd:Teth39_1776 type II site-specific
FT                   deoxyribonuclease; PFAM: DpmII restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01793"
FT                   /db_xref="GOA:D3T761"
FT                   /db_xref="InterPro:IPR007637"
FT                   /db_xref="InterPro:IPR021191"
FT                   /db_xref="UniProtKB/TrEMBL:D3T761"
FT                   /inference="protein motif:PRIAM:3.1.21.4"
FT                   /protein_id="ADD01793.1"
FT                   /translation="MKELYIEFLNVENEESVIEKFHDTLVDTNRSYDFFVDWDKVRKHV
FT                   EEHKIEFNILNSLIGSNQFDNDLRKILLNYPRVLPVIPILLAIRDLNFKVIRNFTDKNL
FT                   DIMTYDFNTRTLTSEEIDNIIEFFDKTGLKRFFLEMGTKSVQDYVIGVEVGMDTHARKN
FT                   RSGDAMELLLKPIIEDIVTKEKGFERVLFQKNFEYLETNYGIEVNSSIKNRKADFILIK
FT                   DNKKVINIEVNFYSGTGSKPQEIVDSYIERQNELKNNGFEFIWITDGEGWRGQKNQIHK
FT                   GFEKIDYLLNLHFVRIGLLEEILCRI"
FT   gene            532170..532949
FT                   /locus_tag="Thit_0487"
FT   CDS_pept        532170..532949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0487"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   tpd:Teth39_1775 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01794"
FT                   /db_xref="GOA:D3T762"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3T762"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ADD01794.1"
FT                   /translation="MQDIDFKKEITTVWSFPERGKWKTHKGDYRGNFAPQIPRNVILRY
FT                   SQEGDFVLDPMVGSGTTLIETKILNRRGIGFDINPDSVELTKRNLDFDGDYKYEQIVRV
FT                   GDVRNLKEISDSSIDLIITHPPYLNIIKYSNGRIEGDLSNISDVKKFCDELEKGVIELY
FT                   RVLKEDRYCAILIGDTRKSGHYIPLSYYVMRLFLKNGFVLKEDIIKVQHNCKSTPYWEK
FT                   QVEKYNFYMIMHEHLFIFRKPKKDENLNKIKYSTGLY"
FT   gene            complement(532991..534832)
FT                   /locus_tag="Thit_0488"
FT   CDS_pept        complement(532991..534832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0488"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); KEGG: tpd:Teth39_1774 asparagine
FT                   synthase (glutamine-hydrolyzing); PFAM: asparagine
FT                   synthase; glutamine amidotransferase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01795"
FT                   /db_xref="GOA:D3T763"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D3T763"
FT                   /inference="protein motif:TFAM:TIGR01536"
FT                   /protein_id="ADD01795.1"
FT                   /translation="MCGITGWVNFDMDLSLQNEVIEKMTNTLKERGPDGSGIWLSKHCA
FT                   LGHRRLIVIDPQGGSQPMIKKYGEKNFVIIHNGELYNMDELKNELISLGYIFKTRSDTE
FT                   IILTSYIEWGPECVKKFNGIFAFAIWDEVQNRLFIARDHLGIKPLFYTIKNGSLIFGSE
FT                   IKAILAHPHVKPEIDSQGLAEIFVMGPSRTPGCGVFKDIKELKAGHYLIFTKNGVNINK
FT                   YWSLQSIPHEDSLEKTAEKIRYLLKDSSVRQLVSDVPLCSLLSGGLDSTAVSAFANEEL
FT                   KQKGQKLITYSVDYVGNDKYFTPNKFQPNSDADWVKFVAKKLDTNHNYVFIDNEELVYA
FT                   LKPALYARDLPGMADIDSSLYLFLKEVKKGATVALSGEGADEVFGGYPWFRNKEAIEAN
FT                   TFPWIRMINERMKLLLPEVVKYIRPIEYLNDRYNEALNEVPKLTGEDPKNTRMREMFYL
FT                   NLTRFMPMLLDRMDRMSMAVGFEARVPYLDYRLVEYVWNIPWEMKNLNGREKGILRYAL
FT                   KGYIPNEVIERKKSPYPKTHNPVFKNIVKKWLKQIVDDSTSPLLQLVDKKAIITLIETD
FT                   AKAYDPAWFSQLMGSAQLFAYLVQINMWLKDYKISIV"
FT   gene            534973..535158
FT                   /locus_tag="Thit_0489"
FT   CDS_pept        534973..535158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0489"
FT                   /product="Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase"
FT                   /note="PFAM: Sporulation stage 0, Spo0E-like regulatory
FT                   phosphatase; KEGG: tpd:Teth39_1773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01796"
FT                   /db_xref="GOA:D3T764"
FT                   /db_xref="InterPro:IPR018540"
FT                   /db_xref="InterPro:IPR037208"
FT                   /db_xref="UniProtKB/TrEMBL:D3T764"
FT                   /inference="protein motif:PFAM:PF09388"
FT                   /protein_id="ADD01796.1"
FT                   /translation="MGKVIKEHYYEENDIAERIKFLKKKLNESNLELPKSLELSRELDE
FT                   LIVIYMKKEKQVKQVK"
FT   gene            535297..535638
FT                   /locus_tag="Thit_0490"
FT   CDS_pept        535297..535638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0490"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   tpd:Teth39_1772 flagellar protein FlaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01797"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:D3T765"
FT                   /inference="protein motif:PFAM:PF03646"
FT                   /protein_id="ADD01797.1"
FT                   /translation="MLEGINTARTGQVNSQFRKDSGILEEIKAVKDILSKPVDDDKLNS
FT                   ALNKENRKISINDHTYFEFSVHKPTNTIVVKIVDSYTNEVIDEIPPEKILDLVAGLWEI
FT                   AGLFVDRKI"
FT   gene            535652..537436
FT                   /locus_tag="Thit_0491"
FT   CDS_pept        535652..537436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0491"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated 2 domain protein;
FT                   flagellin hook IN repeat protein; flagellar hook-associated
FT                   protein 2 domain protein; KEGG: tpd:Teth39_1771 flagellar
FT                   hook-associated 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01798"
FT                   /db_xref="GOA:D3T766"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:D3T766"
FT                   /inference="protein motif:PFAM:PF07195"
FT                   /protein_id="ADD01798.1"
FT                   /translation="MDSISMNSYNVSNLLRISGLATGLDTDSIVQQLIRAASIPLDRLE
FT                   QQKQWYQWQQEDLRDINTQLMSLRNDIVFKLKLQGTFMAKTVTSNTAVATATAGANAVN
FT                   GVYNLNVTQVATAATYTSGVIGVGTNTSTVLNNTGSTINLTLNGQTIAINDNATINDVV
FT                   TAINASTSTTGVSASYDSSLDRMFLISNTTGVNSKIDFTGTNVDGANFLVNKLKINVSQ
FT                   LSSSDALGLGGSNGIINNTGSDISLQLNGKTIIVADGATVQDFVDAINAAGANVTASYD
FT                   STSDKVILTADSGYSIDFTGTGLDGMNMLNNTLKLAISSTLAQGQNARFTFNDVQMESS
FT                   TNNVTVAGINITLTGTGTTTLSVSTDVDKIYNAIKSFVDSYNDIITKINAKLTEKRYYD
FT                   YPPLTSEQKQAMKDSDIELWEEKARSGNLNNDETLMRVYYSMRNVVSSAVPGVGSLSSI
FT                   GITTGQWYEGGKLYIDETKLRDAIANNPDTVMKIFSGVYETDSTLVTPGIAQKLYDTLE
FT                   QGIDAITRKAGSTTQLYDTSFIGNRIREIDERIAQMQDYLNNLEERYYSQFTVLEMYVG
FT                   QMNSQSMWLSQQIGVMMG"
FT   gene            537450..537836
FT                   /locus_tag="Thit_0492"
FT   CDS_pept        537450..537836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0492"
FT                   /product="flagellar protein FliS"
FT                   /note="KEGG: tex:Teth514_0465 flagellar protein FliS;
FT                   TIGRFAM: flagellar protein FliS; PFAM: flagellar protein
FT                   FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01799"
FT                   /db_xref="GOA:D3T767"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:D3T767"
FT                   /inference="protein motif:TFAM:TIGR00208"
FT                   /protein_id="ADD01799.1"
FT                   /translation="MVNPYQQYKENAILTASPEELVLMLYNGIIRFIEEAKGAIEKKDY
FT                   MAANNNIQKAQDIITELMLTLDMNYDISKNLYSLYDYMLRRLIDANVKKDVAILEEVKG
FT                   FAVELRDTWSIALNKVREKVYAKG"
FT   gene            537841..538311
FT                   /locus_tag="Thit_0493"
FT   CDS_pept        537841..538311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01800"
FT                   /db_xref="GOA:D3T768"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:D3T768"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1769"
FT                   /protein_id="ADD01800.1"
FT                   /translation="MHNNIEKLTRIVEDKIERLKEFYEVTEKIGISITSNNLEELKNLL
FT                   ATKQKIIEEIDKLDADFIPLYNAFKKENKVESIFALEGKITREISKLKALFIEAKNLLE
FT                   KIKEKDDKNLQNITAAFEKTKNKLEELSKSKEGYIEYLKYYTPDSYFLDKKR"
FT   gene            complement(538587..538673)
FT                   /pseudo
FT                   /locus_tag="Thit_0494"
FT                   /product="hypothetical protein"
FT   gene            complement(538675..538783)
FT                   /pseudo
FT                   /locus_tag="Thit_0495"
FT                   /product="hypothetical protein"
FT   gene            539085..539370
FT                   /pseudo
FT                   /locus_tag="Thit_0496"
FT                   /product="hypothetical protein"
FT   gene            539490..542213
FT                   /locus_tag="Thit_0497"
FT   CDS_pept        539490..542213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0497"
FT                   /product="PTS system transcriptional activator"
FT                   /note="KEGG: cbe:Cbei_3875 sigma-54 factor interaction
FT                   domain-containing protein; PFAM: sigma-54 factor
FT                   interaction domain-containing protein; PTS system fructose
FT                   subfamily IIA component; PRD domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01801"
FT                   /db_xref="GOA:D3T769"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:D3T769"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ADD01801.1"
FT                   /translation="MTNKEKVLNYIRDKLKNISDSDVLKSRNFGITAEDLSETLGISRA
FT                   NISHILNKLVRDKLLVKLVSRPVYYLTREKAEELIGESIGESISLNDFIALIKKANRKS
FT                   STDIFENLIGYNGSLKKQVEQAKAAILYPPYGLHTLIIGPPGSGKSYLAELMYEFGKQI
FT                   GKYSNFETLNCADYYNNPQLLMSYLFGHVKGAFTGADSDNIGLVEKANNGILFLDEVHR
FT                   LPPEGQEMLFYLIDKGIYHRLGDAMIRKAKLMIILATTENPESSLLKTFLRRIPIVIKM
FT                   PAWNDRPFEEKIEIIKELLKKEAKQLAKKFIISPEIITIMANCDFNGNVGELKSTIQLL
FT                   CAKAFLRNYNTTDSDGELKIDITLLPENMKIKMYEENTKNKKYYEDPLIILPDGKEKLL
FT                   EKYDLYDFIIEKYKILEQQGFDKNDINERIELYIDSLYKHIINKFKSPNVKEIEKLVDK
FT                   EIIDFSAEVKDFAERKLNIKLNDNFLYAFSFHLEALIKRIKNGQPITNLRLNEIRNKYI
FT                   NEFKISEEIVKMIRDKFKINVSTEESGFITLFLVSGMRDINEKKSVAIMVLMHGDGVAK
FT                   NIANVVNKLLNITKVAYFDMPLDMNVDDALIKIMNISKEIHEGKGILYLVDMGSLKNIP
FT                   DSIEKFTGIRTRVIDNVSTPIVLEAARKAYFLDEDLDEIYNSICNRTFSNENKKRCIVT
FT                   ICSTGEGTADKLKNYIESNYELENLAIYSLSFFDITERTEKYYNIIRENDVLCVIGALD
FT                   PEINGIPYVPTDKIIKDKNYLATNFGIKLKHNFLVENEYKEIKETLEEFLTYINPSKVI
FT                   EAYKLFIKDIEKYNIALKREKKIKLGIHMGCVVERLFTNNFIKHHAKNEVINKNNGLYQ
FT                   ILKNALTVFNTMFNININDDEICFIIDIINYDELYV"
FT   gene            542393..542860
FT                   /locus_tag="Thit_0498"
FT   CDS_pept        542393..542860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0498"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: cbe:Cbei_2498
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01802"
FT                   /db_xref="GOA:D3T770"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D3T770"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ADD01802.1"
FT                   /translation="MARKLHELLNEDLIFFDVEATNWQEVLKYLADNLLRKGYVNDSFY
FT                   NAVVEREKKFPTGLPTGKINVAIPHTDPIHVIKDGIAVALLKQPVLFREMGKFEGEVAC
FT                   DIVFMLAIKNPDGQIKVLQNFMDIFMDSNLLLKIKNAKSKKEIIDIISKSN"
FT   gene            542878..543174
FT                   /locus_tag="Thit_0499"
FT   CDS_pept        542878..543174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0499"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01803"
FT                   /db_xref="GOA:D3T771"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D3T771"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ADD01803.1"
FT                   /translation="MGQRKKIVVACGSGVATSKSVAERVKELCKQRKIDVETLAVDFRS
FT                   VKSHLKDADLFISIAPYDPTDYGVPVVSGIPFMTGIGMDKAMDEIEKILKNAK"
FT   sig_peptide     542878..542946
FT                   /locus_tag="Thit_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.809 at
FT                   residue 23"
FT   gene            543189..544565
FT                   /locus_tag="Thit_0500"
FT   CDS_pept        543189..544565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0500"
FT                   /product="PTS system Galactitol-specific IIC component"
FT                   /note="PFAM: PTS system Galactitol-specific IIC component;
FT                   KEGG: PTS system galactitol-specific IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01804"
FT                   /db_xref="GOA:D3T772"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR013853"
FT                   /db_xref="UniProtKB/TrEMBL:D3T772"
FT                   /inference="protein motif:PFAM:PF03611"
FT                   /protein_id="ADD01804.1"
FT                   /translation="MLKTIIQYILDLGPSVFLPILMIIIGLIVRMKPSKAISAALTLGV
FT                   AFAGMSVILNFMFDQISPAAQAFVKATGLKLNALDLGWTPVAAIAWSWPYAFLMFPIQI
FT                   IINLIMLAFKWTDCLNIDMWNVWNKVLTAVLVQGVTGSVTLGLVVGAIEVVLELKNADL
FT                   LHNQIYELTKIPGISLPHALGLTAVILAPLNRLLDFIPGINRINLNSEALKEKLGIFGE
FT                   NHILGFIIGVLIAIFARYDLKHTLILGVSSAAALTLFPMVATLFITALLPISDAAAEFM
FT                   KKRFPGRQFYIGLDWPFLAGQPSLWVTTILLVPVILLMAIILPGNIVLPFGGILNICLA
FT                   ATAVVVTGGNLLRMLILGIITTPLYMYVATYFAPMITNLAKQVKTIEIPAGQLITWNGM
FT                   EAPEFRYVFSVAAKMFKGDILPGLPLLIGYALLYWWYFKYMLKKEKEAAERISATSQSL
FT                   "
FT   gene            544689..545621
FT                   /locus_tag="Thit_0501"
FT   CDS_pept        544689..545621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0501"
FT                   /product="1-phosphofructokinase"
FT                   /note="KEGG: 1-phosphofructokinase; TIGRFAM:
FT                   1-phosphofructokinase; PFAM: PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01805"
FT                   /db_xref="GOA:D3T773"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D3T773"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ADD01805.1"
FT                   /translation="MIATVTLNPAIDKIIVVDEIKNFSNNKIKQIKLDIGGKGTHVSSV
FT                   LSDLGLKNVATGILGGYTGSILESLLGKKNIQCQFIHPPNYETRTSYIIIEENKNNHFM
FT                   LTERGNKVDEKSINELVEMIIKLSSSCEFMVFSGGVSPGFNIDIYKKLIELANKNGCKT
FT                   FLDASGDYLLEGIKARPFMIKPNIDEICDIIGHRPENIKEIVFHAQKLIKSGIKVVAVT
FT                   LGSDGSLIVSENEAFRIYPPKVKAINTVGCGDVFFGSSIFKLYHKSTLREAFKFATAVS
FT                   ASKAMKLMTSEFDINEALRLLDDVLIKDV"
FT   gene            545643..546332
FT                   /locus_tag="Thit_0502"
FT   CDS_pept        545643..546332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0502"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: class II aldolase/adducin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01806"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D3T774"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ADD01806.1"
FT                   /translation="MRLSYIEERKKICQLVKDMFDRMMTNAAGGNVSLRVDDNKVLLTP
FT                   AKMAENDRCRLEPEDLLLVDLEMNVLEGTRSLTREANMHLGILKEFPAVNACIHAHPRN
FT                   IMTFVAFELPMPSVTEATAKFGNIECLPYHPATTKELADAVVEYFKTKKNVLEKHACAV
FT                   MLARHGIIIAGKSLEEAYNALERIETNAYIVLNSKLLVDNPVLKVAKLQEKFQPSTFVA
FT                   ENKVIYE"
FT   gene            complement(546450..546956)
FT                   /pseudo
FT                   /locus_tag="Thit_0503"
FT                   /product="hypothetical protein"
FT   gene            complement(547031..547192)
FT                   /pseudo
FT                   /locus_tag="Thit_0504"
FT                   /product="hypothetical protein"
FT   gene            547451..549127
FT                   /locus_tag="Thit_0505"
FT   CDS_pept        547451..549127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0505"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: tte:TTE1121
FT                   N-methylhydaintoinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01807"
FT                   /db_xref="GOA:D3T775"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D3T775"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ADD01807.1"
FT                   /translation="MIIGLDVGGTNIDGVVVEKGKIIKTIKKPTNRDNLFNSIWTALKE
FT                   LLSGYDNTKIERINLSTTVSTNAIVENKLSPVGMIIQPGPGLPYDFLACGDGNVFISGY
FT                   IDHRGEIIKDFNLLEIKNAIKLFKEKNIKAYAVVTKFSIRNPSIEMKIKEILENDIPNS
FT                   FITMGHTISGKLNFPRRVYTSYLNSAVHSIFDEFLNNIKKSLEKEGINASVFILKADGG
FT                   TMNMSTAEKKPVETILSGPAASLMGINAMLPTDKDAILLDIGGTTTDIFFLADGVPLFE
FT                   PWGIRIGKYKTLVRAIYSVSIGLGGDSSICVRNGRIKIGPQREGVPYAFGGPKPTPTDA
FT                   MITLELIDENAFRLTHENVKKAYEAMTLLGKELNLSAKDMAKLILSTMGDIIKNKVDEL
FT                   LHEINSRPVYTVKELLYGKRIKPKLINIIGGPSKVLAPVLEEKFNLPCYYPKNYSVANA
FT                   IGAALARPTTEITMFVDTSKKTLFVPELGLYEKISGNYTLDKAKEKALELVKKSALSLG
FT                   ASIEEIEAEIVEESSFNMVRGFYTIGKNMRIKAQIKPGLIQ"
FT   gene            549146..550453
FT                   /locus_tag="Thit_0506"
FT   CDS_pept        549146..550453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0506"
FT                   /product="Histone deacetylase"
FT                   /note="KEGG: tte:TTE1122 deacetylase; PFAM: histone
FT                   deacetylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01808"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D3T776"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ADD01808.1"
FT                   /translation="MIKAKNRLGVVFFPAFDWAINPTHPEREERLLYTQDQIFEEGIED
FT                   IEGIKFYNPIIAEEKDINRVHFVVPDVKSTVTQSHLISAGGAIKALQAVMEKEVDKAFA
FT                   LVRPPGHHAQRVVYGDRGFCIINVEAVMLERIRQEYGSLRVAIVDTDCHHGDGTQDIYW
FT                   NDKDTLFISLHQDGRTLYPGTGFIEEFGGPAAYGYNINIPLPPGTGEEGFLYVLDNVVI
FT                   PILDEYKPDIILNSAGQDNHYTDPLTNMNFTAQGYAKLNERLNPNIAVLEGGYSIEGAL
FT                   PYVNLGIILAMAGIDYSRVSEPDYDKEKLKQPKDITEYIKKLSEIVYNRWKNKDDLRLK
FT                   EFKDVNYVKRPRRVYYDTDGILETQVQNFKICNNCSGVNTIESKSDRGYHIFAITIPRD
FT                   ACPNCIDEGYKLYKNASSHYTNVYLQDRVNDEYYSR"
FT   gene            complement(550700..552793)
FT                   /locus_tag="Thit_0507"
FT   CDS_pept        complement(550700..552793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0507"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="KEGG: tpd:Teth39_1768 methyl-accepting chemotaxis
FT                   sensory transducer with cache sensor; PFAM: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; Cache domain protein; SMART: chemotaxis sensory
FT                   transducer; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01809"
FT                   /db_xref="GOA:D3T777"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D3T777"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADD01809.1"
FT                   /translation="MKKQKDYYKKEKFKLSLKIPKANVRLKFFNSASGIFAKLMTFIAF
FT                   VIIVPLAFTGYMSTSKSVEILQDTINISNTDTLGLINNYVDLFKNDIETQLIILSTNPQ
FT                   ILNFGQRDFETDKKNLQDLFTTILKAKSTKISLIYLATPDKKIIQSPDLPLDPNYDPTK
FT                   QEWYKKAIENPDAIIWTGPYSNDGTNGGVVTVSKAVRSSLTNVASDIVGVLAFDINLDS
FT                   LSNMISSIKVGKTGNVYLISNEGIIIADKDKKNLFSYITKYDYGKKILSMQEGSFEYND
FT                   NGTNKFASVKTLNNFGWKAAITMDSSELAEKTSQIKDNTIIFSLISLLIGILIAYFFSK
FT                   NITSKIGKVMTAMNKAANGDMTQKVEVKSNDEIGKLASSFNLMIDGIKRLVADVLSAAN
FT                   SVYEYSKKVSFASNKAEQITNEVVAAMEEIAKGAQEQAKEAEKGATITNLLSQNLDVTM
FT                   ENSKNINKETTSVIKAANTGLENIKELSEKTKVTEQMHSKVKESTSYLKKKSHEIGKIV
FT                   ETITTIADQTNLLSLNAAIEAARAGEAGRGFAVVADEVRKLANQSSEAAKNIEAIIKEI
FT                   QQNIDDTYKVVEEASASIEQQNESLAKTVHTFYGIQQAVNRIVEELNKLNESMLKISQS
FT                   RSEMLDSIQNIAAVTEEAAASTEEISSATEEQKTAIEEISKSAQDLSNIANTLMSIISK
FT                   FKI"
FT   gene            553003..553200
FT                   /locus_tag="Thit_0508"
FT   CDS_pept        553003..553200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01810"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="UniProtKB/TrEMBL:D3T778"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1767"
FT                   /protein_id="ADD01810.1"
FT                   /translation="MYQDKMIVCKDCGKEFVWTAGEQQFYAEKGFQNEPVRCKACRDAK
FT                   KRRNHQYNARKNKRAFGIER"
FT   gene            553541..554323
FT                   /locus_tag="Thit_0509"
FT   CDS_pept        553541..554323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0509"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="KEGG: tex:Teth514_0468 extracellular solute-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   3; SMART: extracellular solute-binding protein family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01811"
FT                   /db_xref="GOA:D3T779"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D3T779"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ADD01811.1"
FT                   /translation="MNKKSFTALLIITLVLSLFLAGCGSKPTNTLEKIKQKGVIVMGTS
FT                   ADFPPFEFHKVEGNKDTIVGFDIDIANAIAKRLGVKLEIKDMDFKGLIPALQSGRIDMI
FT                   VAGMTPTPDRAENVDFSDLYYNSQQVVVVKNDSPILKFDDLKGKTVAVQIGTTSEEAAK
FT                   KIPDVNLKQLNRVGDAFMDLKNGRCDAIVLEDTVANAYLKEYKDMKILSMKEINTEEGG
FT                   MAVAVAKGNKELVNIINEVIKDLKASGEYDKLVDKWFK"
FT   sig_peptide     553541..553609
FT                   /locus_tag="Thit_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.432 at
FT                   residue 23"
FT   gene            554391..555053
FT                   /locus_tag="Thit_0510"
FT   CDS_pept        554391..555053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0510"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="KEGG: tpd:Teth39_1764 polar amino acid ABC
FT                   transporter, inner membrane subunit; TIGRFAM: polar amino
FT                   acid ABC transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01812"
FT                   /db_xref="GOA:D3T780"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3T780"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ADD01812.1"
FT                   /translation="MSVNFLSMLKYSHLFVSGLLMTLKLTFLAVTIGVILGLIVALIKM
FT                   SSIKPISFVGASYVEIIRGTPLLVQLLLIYNGLMQFGIDIPAFIAGVSALAINSAAYVA
FT                   EIIRAGIQAVDPGQNEAARSLGMTHTMAMRYVIIPQAIKNILPALGNEFIVMLKESAIV
FT                   SVIGFADLTRQADIIQSVTYKYFEPYIIIAAIYFIMTFIFSRLLGIFERRLRAGDTR"
FT   gene            555040..555762
FT                   /locus_tag="Thit_0511"
FT   CDS_pept        555040..555762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0511"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1763 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01813"
FT                   /db_xref="GOA:D3T781"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D3T781"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01813.1"
FT                   /translation="MIRVNEVYKTFGNLEVLKGVSLSVNKGEVVVIIGPSGSGKSTLLR
FT                   CINLLEVPTRGEIYIEGIKINDRKVNINKIRQKVGMVFQHFNLFPHLTALENVTLAPIK
FT                   VKRMDKKTAENIALGLLEKVGLLDKKDEYPIKLSGGQKQRLAIARALAMQPDIMLFDEP
FT                   TSALDPEMVKEVLNVMKGLANEGMTMVVVTHEMGFAREVGDRVIFMDDGMVIEEGTPED
FT                   IFYNTKNERTKEFISKIL"
FT   gene            556145..556690
FT                   /locus_tag="Thit_0512"
FT   CDS_pept        556145..556690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0512"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="KEGG: tex:Teth514_0471 sigma 54 modulation
FT                   protein/ribosomal protein S30EA; TIGRFAM: ribosomal subunit
FT                   interface protein; PFAM: sigma 54 modulation
FT                   protein/ribosomal protein S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01814"
FT                   /db_xref="GOA:D3T782"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D3T782"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ADD01814.1"
FT                   /translation="MNITVSGKNGMAVTDGLRDAVVKKVSKLSKYFTEDTEVRTVLSVQ
FT                   KNHHIAEITIPFKGIIFRAEEVSDDMYGSIDRVVDKIERQILKHKTKLKNRFGANESIR
FT                   FEIPSVYQEAKEEEEETSFEIVKTKRFPIKPMSAEEAILQMNLLGHNFFVFTNADTDTI
FT                   NVVYKRKDGKYGLIEPIE"
FT   gene            556819..557460
FT                   /locus_tag="Thit_0513"
FT   CDS_pept        556819..557460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01815"
FT                   /db_xref="UniProtKB/TrEMBL:D3T783"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1761"
FT                   /protein_id="ADD01815.1"
FT                   /translation="MGEITKDMVTSMEGYINKIQGVLSSRVVAENGEITEIHVLADSTR
FT                   NAKQIARDVQSVIMAQFEIDINYKIISVAQIDTGEKLQGEHRLVFSSYSFINNGLTSEA
FT                   RVILTRGDEVFEGYAEGPNTASNKYKIIANATLDSISKLIPKNHLFLLEDIDIFNIAKS
FT                   RIIVIGVTHVTNNQEELLTGSCLIKKDEGEAVVKATLDAVNRRVMSITSL"
FT   gene            557684..558958
FT                   /locus_tag="Thit_0514"
FT   CDS_pept        557684..558958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0514"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; KEGG:
FT                   tex:Teth514_0473 metal dependent phosphohydrolase; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01816"
FT                   /db_xref="GOA:D3T784"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D3T784"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ADD01816.1"
FT                   /translation="MLNKRVKVYISIVIGLGLSFIVYSIINVPTKKIVDIILFAFFAFL
FT                   AESMPIYTTKEVTVSVAFAIDLMAILIFGPYEGALIAAIGIGFQIGKYMDGRVRHIFNF
FT                   PYYKTLFNISQIALSVGIGGLIYGYTGGVPGAYIYPNHLLSAILAAMIYYLLNTSIVAV
FT                   LLSLLTNKSLTYVLTKEIKWMVPNFLFLAFLGIIMSEAFVRIGYVSLILLFIPLFMIRY
FT                   MFKLYMDSKQSYYDTINVLVKALDAKDKYTAGHSKNVEKIAALLCREFGFSESHTEMVK
FT                   IAALLHDIGKIGVKEEVLNKPGKLSDEELSIIREHPQKGYEILKEVPALKEVSLWVKYH
FT                   HEWYNGNGYPDGIKGEEIPLEAQILSLADVFDALVSDRPYRKAFSQEGAYEIIVGNEGT
FT                   QFSPKIIKAFKKAFEKHREEFKHDI"
FT   gene            558948..559514
FT                   /locus_tag="Thit_0515"
FT   CDS_pept        558948..559514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01817"
FT                   /db_xref="GOA:D3T785"
FT                   /db_xref="InterPro:IPR035168"
FT                   /db_xref="UniProtKB/TrEMBL:D3T785"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0474"
FT                   /protein_id="ADD01817.1"
FT                   /translation="MIFDSLGVSLIYGTLKKGKISGIADIEIKKPSLFIAAFVLEFGML
FT                   NFSNKFYGVIKYQSYIHFFVYLLLFIGLWYNRNNKYFRIISVGVFLNFIVIFANGGRMP
FT                   VSIDALKAAGLNNLILQLQANRIATHQVLKSSTRLKFLADVLVLPKPYPLPKAFSIGDF
FT                   IMATGTFLLVTNAMLKKVKSHDGTR"
FT   gene            559498..560010
FT                   /locus_tag="Thit_0516"
FT   CDS_pept        559498..560010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0516"
FT                   /product="3H domain protein"
FT                   /note="PFAM: 3H domain protein; Helix-turn-helix type 11
FT                   domain protein; KEGG: tpd:Teth39_1758 3H domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01818"
FT                   /db_xref="GOA:D3T786"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T786"
FT                   /inference="protein motif:PFAM:PF02829"
FT                   /protein_id="ADD01818.1"
FT                   /translation="MTAQDRRDKIVEILKNAKEPISGSDLAKRFGVTRQVIVQDIAILR
FT                   AKGIKILSTPQGYIIDTVKENTVKRVFAVKHGYDRTEEELNLIVDNGGKVLDVIVEHPF
FT                   YGEIKGLLMLSSRYDVSKFMEFVKEGKATLLSSLTDGVHLHTVEGESEEVLDRIQKALE
FT                   QKGFLIE"
FT   gene            560122..560622
FT                   /locus_tag="Thit_0517"
FT   CDS_pept        560122..560622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01819"
FT                   /db_xref="GOA:D3T787"
FT                   /db_xref="UniProtKB/TrEMBL:D3T787"
FT                   /inference="similar to AA sequence:KEGG:Teth514_0476"
FT                   /protein_id="ADD01819.1"
FT                   /translation="MKTREITIGGLLAALALVIPLAFGGVLGIVIPPFSATLASHVPVM
FT                   LAMLISPATAVFVGVVSAIGFLIKLGPVIAARAAVHAVFGYVGAKMMQRRYSFPVALAV
FT                   TLPIHAVLEAIVVMPFGFDFYKAFVVVGVGTILHHTIDSVIALVVFYALNPILKFKAVD
FT                   IKN"
FT   sig_peptide     560122..560196
FT                   /locus_tag="Thit_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.939 at
FT                   residue 25"
FT   gene            561074..563767
FT                   /locus_tag="Thit_0518"
FT   CDS_pept        561074..563767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0518"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="KEGG: tpd:Teth39_1755 preprotein translocase subunit
FT                   SecA; TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SecA DEAD domain protein; SEC-C motif domain protein; SecA
FT                   preprotein cross-linking region; SecA Wing and Scaffold"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01820"
FT                   /db_xref="GOA:D3T788"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D3T788"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ADD01820.1"
FT                   /translation="MLGLVEKIFGSYSEREVRRLEPIVDKVLSYEDQMARLTDAELRAK
FT                   TDEFKNRLKNGETLDDILPEAFAVVREAAWRTLKMKHFKVQVIGGIVLHQGRIAEMKTG
FT                   EGKTLVATLPAYLNALEGKGVHIVTVNDYLAKRDRDWMGKIYEFLGLSVGVILHDMGPE
FT                   ERKKAYAADITYGTNNEFGFDYLRDNMVIYKEDMVQRGLNYAIVDEVDSILIDEARTPL
FT                   IISGVGEKSTDMYKLADRFVRTLKKDEDYVVDEKAKAVSLTEKGVVKAEKFFGIKNLAD
FT                   IENMEISHHINQALKAHAIMKRDIDYVVKDGQVIIVDEFTGRLMFGRRYSEGLHQAIEA
FT                   KEGVKVERESKTLATITFQNYFRMYKKLAGMTGTAQTEEQEFRAIYGLDVVVIPTNKPM
FT                   IRIDHPDVIYKTEEAKFRAVVEDIVEHHKKGQPVLVGTISIEKSEKLSAMLKKRGIPHQ
FT                   VLNAKYHEKEAEIIAQAGRKGAVTIATNMAGRGTDILLGGNPEFIAKKKMLEEGYSKEI
FT                   INEAAGYGPVSDEEVKKARERYFELLEEAKKETEKEHDEVVKLGGLYIIGTERHEARRI
FT                   DNQLRGRAGRQGDPGETRFYISLEDDLMRLFGSERVKNMMDTLGIDDDQPIEHKILTKQ
FT                   IEQAQKKVEGINFDTRKHVLQYDDVMNKQREIIYAQRRKVLEGENLKESIFDMIRSIIE
FT                   RNVEVYTAGSKYPEEWDIKGLLDYLYDMFLEKDSVVIDVDIDRLDKEVLTNIIYEEAVK
FT                   QYEKKEAEIGPEQMRELERIVLLRVVDTKWMDHIDEMDQLRQGIGLRAYGQVDPLIEYK
FT                   KIAFDMFEDLVQSIQEETVKFLYHIQIDKNNMIQREQVAKPVSTNADTQEKKQPVVKGK
FT                   KIGRNDPCPCGSGKKYKYCCGANLKY"
FT   gene            563783..564890
FT                   /locus_tag="Thit_0519"
FT   CDS_pept        join(563783..563851,563853..564890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Thit_0519"
FT                   /product="hypothetical protein"
FT                   /note="manually curated"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01821"
FT                   /db_xref="GOA:D3T789"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D3T789"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01821.1"
FT                   /translation="MLQDYKAEVSKMFEEIKEMGVSLDIEGVKREVEEIDKKMADPDFW
FT                   NDIKKSQELAKRQKELKELLEEYNSLVRKWEDLTTLIELGLEEGDESITEEVDKEYKEL
FT                   KKKLEDLKIKTLLNGPYDKNNAILSIHAGSGGTEAQDWAEMLLRMYTRWANDKGFDVET
FT                   LDYLQGEEAGIKSVTLMIKGPFAYGYLKSEAGVHRLVRISPFDAAGRRHTSFALVEVLP
FT                   ELEDDIEVEIRPEDLRIDTYRASGAGGQYVNKTESAVRITHLPTGIVVSCQNERSQIQN
FT                   RETAMKMLKAKLLDLMMKEKKEKIEDLKGEHKEAAWGNQIRSYVFQPYTLVKDHRTNFE
FT                   VGNVQAVMDGEIDDFINAYLKQKSQGIS"
FT   gene            564943..567081
FT                   /locus_tag="Thit_0520"
FT   CDS_pept        564943..567081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0520"
FT                   /product="Tex-like protein"
FT                   /note="KEGG: tpd:Teth39_1753 RNA-binding S1
FT                   domain-containing protein; PFAM: Tex-like protein-like; RNA
FT                   binding S1 domain protein; SMART: Resolvase RNase H domain
FT                   protein fold"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01822"
FT                   /db_xref="GOA:D3T790"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D3T790"
FT                   /inference="protein motif:PFAM:PF09371"
FT                   /protein_id="ADD01822.1"
FT                   /translation="MDRIKEALKREFGLKDFQVENTIKLIDEGNTIPFIARYRKEATGS
FT                   LSDEVLRNFYERLTYLRNLEEKKQDTIRLIDEQGKLTEEIKEKIDNATTLQEVEDIYRP
FT                   FRPKRRTRATIAKEKGLEPLAKIISSNEVIDGDVKEYAKPYLNENVLTVEEAYQGAMDI
FT                   IAEDISDDAEIRKYIRNFTWNNGIIVTQALKKEKSPYEMYYDYKEAVKTIPPHRILAIN
FT                   RAEREKYISVKIEVDSERIINRLIESKVNKASIFAEYYKRAIEDSYKRLIAPSIEREIR
FT                   NALTEKAEEKAIIVFKENLKSLLLQPPIKGHVVMGFDPAYRTGCKIAIVDETGKLLDTA
FT                   TIYPTPPQNDIDNSKKVLKELIEKYNVTLIALGNGTASRESEMFIADLIKELSREVKYV
FT                   IVNEAGASVYSASPIGTEEFPDINVSLRGAISLARRLQDPLAELVKIDPKSIGVGQYQH
FT                   DVDQKKLGEALNGVVEDCVNSVGVDLNTASVSLLKYVSGINTVIAKNIVEYRNQIGKFT
FT                   SREQLKNVKRLGEATFTQCAGFLRILEGDNIFDSTAVHPERYETLEKLLKKFGYKKEKL
FT                   DRKKLKDFANSLEEYGLERISEEYDIGLPTLYDIVSELKKPGRDPREDLPKPVLRSDVM
FT                   TINELKPGMELMGTVRNVTDFGCFVDIGVHTDGLVHISEMSQSYIKHPLDVVAVGDIVK
FT                   VKVLSVDLERNRISLSMK"
FT   gene            567172..567864
FT                   /locus_tag="Thit_0521"
FT   CDS_pept        567172..567864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0521"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   tte:TTE0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01823"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:D3T791"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ADD01823.1"
FT                   /translation="MKKILAFVLTGLLIFSSVLTVYAKPDKVKHQVNVKAQTTLKAKGN
FT                   TKNKVEVQTQTKLEASVKAKEFKGKVSVNKKEIKFDIPPVIKEGRTLIPVRAIMNGFGA
FT                   KVDWDEETKTVTITKGDITIQLVLGESKVLINGKEDTLEVPAMEISNRTFVPLRFILEI
FT                   FGAKVIYNEETGDIEIEEEEDIEIEEGDQTEIENNEESTVSQDVYANTDETVSNSVYGT
FT                   NEEVEEND"
FT   sig_peptide     567172..567243
FT                   /locus_tag="Thit_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            568015..568272
FT                   /locus_tag="Thit_0522"
FT   CDS_pept        568015..568272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01824"
FT                   /db_xref="UniProtKB/TrEMBL:D3T792"
FT                   /inference="similar to AA sequence:KEGG:TTE0525"
FT                   /protein_id="ADD01824.1"
FT                   /translation="MPKAKWVGGNKDKVGFIFGVFGPGSQNVVKRSIRKIIIYGIGTGL
FT                   MLGAGKKYGKRVLPFVCGKGREYLNYAGRAVSQLYDYFVK"
FT   gene            568443..570398
FT                   /locus_tag="Thit_0523"
FT   CDS_pept        568443..570398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0523"
FT                   /product="PTS modulated transcriptional regulator, MtlR
FT                   family"
FT                   /note="PFAM: PRD domain protein; Helix-turn-helix type 11
FT                   domain protein; M trans-acting positive regulator;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; KEGG: tex:Teth514_0823 transcriptional
FT                   antiterminator, BglG"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01825"
FT                   /db_xref="GOA:D3T793"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:D3T793"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ADD01825.1"
FT                   /translation="MLNSREKKILIALKEAKKPLTISNLSAITGVTTRTVKKDIEILKQ
FT                   KLDRNKVEIITKPGVGVWIEEKVDDEYLENVLYSSNKIINPIFPDDRVYYIAKRLLETN
FT                   NLMTLEDFSVELYVSKSTVAKDILKVEEFLGKYGIKLYKKPKHGIKVIGDEKSIRLANA
FT                   EILKNVTTKHDEIINDSLKDLLKDVDLNAIQRIIQGSEEKFNYILSDVSFKGLLIHLAI
FT                   SIKRLWEGKKVTLDLKDLNLLKKEKEWEIAKDLAKNIEKRFNVVVDDTEIGYITMHLMG
FT                   AKLQNDIETEKFSENYLKRLDCKLYIILKSIVNDIAEMTGYKFYNDKKLLVGLFLHLKP
FT                   TINRLKNGVKLDNPFLEEIKKECGIAFEISISFWEKLKEFYKINVNEDEIGYVAIHFGA
FT                   SIERLKSVDRNKKTAVIVCATGIGTAQLLTARLTKLFPNIELIKVLPVIKAKSMLKDLS
FT                   PDIVLSTVPFETEEAVVINVSPFLDEEDVDKIERIVKNKKIDTEVKKIKSKILNYISED
FT                   LVFLKIKAKDKFEVLFKMSQRLLALNYVKEGFYESVLQRDSFSSTAVGNLVAIPHPYEG
FT                   FVNLPKISVATLKSPIKWDDDKKVQIVFMIALDLSIKEEFKNIFDELAEAINDKEKILK
FT                   LVDCKDYREFIETFKA"
FT   gene            570412..570876
FT                   /locus_tag="Thit_0524"
FT   CDS_pept        570412..570876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0524"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="KEGG: cbe:Cbei_1844 PTS system, fructose subfamily,
FT                   IIC subunit; TIGRFAM: PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01826"
FT                   /db_xref="GOA:D3T794"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:D3T794"
FT                   /inference="protein motif:TFAM:TIGR00848"
FT                   /protein_id="ADD01826.1"
FT                   /translation="MIKDLTNENLIKLDFEAKTKEEALNFMIEMFYETGVINSKELFAK
FT                   DVFERENLGTTGVGMGIAIPHGKSKAVLKESFAILRLAKPIDWQSLDGQPVIMVIMLAV
FT                   PEKDADTTHLKILSRLAYFLMDDDFRQNLIEANSKKEILKLIERKELEVA"
FT   gene            570881..571198
FT                   /locus_tag="Thit_0525"
FT   CDS_pept        570881..571198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0525"
FT                   /product="PTS system, fructose-specific, IIB subunnit"
FT                   /note="KEGG: fructose specific permease; TIGRFAM: PTS
FT                   system, fructose-specific, IIB subunnit; PFAM:
FT                   phosphotransferase system PTS fructose-specific IIB
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01827"
FT                   /db_xref="GOA:D3T795"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:D3T795"
FT                   /inference="protein motif:TFAM:TIGR00829"
FT                   /protein_id="ADD01827.1"
FT                   /translation="MYIVCVTSCPAGLAHTFMAAANLEKTAKKLGVEIKVERQGIAGIE
FT                   NEITEEDIERADGVILAADVSIAQRERFDGKPIVECGVSEAIKNPEGIINKLIEEVKKN
FT                   G"
FT   sig_peptide     570881..570946
FT                   /locus_tag="Thit_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.749) with cleavage site probability 0.701 at
FT                   residue 22"
FT   gene            571191..572243
FT                   /locus_tag="Thit_0526"
FT   CDS_pept        571191..572243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0526"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="KEGG: tpd:Teth39_0153 PTS system, fructose
FT                   subfamily, IIC subunit; TIGRFAM: PTS system, fructose
FT                   subfamily, IIC subunit; PFAM: phosphotransferase system
FT                   EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01828"
FT                   /db_xref="GOA:D3T796"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:D3T796"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ADD01828.1"
FT                   /translation="MAKIDHGQLIRKALMTGVSYVVPFVVAGGTIMSLALIFGGVEGVK
FT                   VEGSMAYIIRQYGAAIMSLMVPIIAGYISYSLADRIGLAPGMAAGLVAVQTGGGFLGGL
FT                   IGGLIAGYFMMYLKKIKVHRNLMGLMNFFVYPVVGSFVVGLIMLFVIGKPIGAINTGLV
FT                   SWLKGLQGINAILLGAIIGAMTCFDMGGPVNKAAYAFVIGAMGAGIGEPYASMKAAISV
FT                   PDFALALSTLLFPKFYTEEEIEAGKAAWVLGVAGITEGAIPFALADPLIVIPSMMVGGA
FT                   IASAIAMYGGSSILTPGGGLFTLPLMKNVWVFIVAMVIGSLVSAALVSFLKGLKYRKKN
FT                   GVKSVNNGGN"
FT   gene            572245..574881
FT                   /locus_tag="Thit_0527"
FT   CDS_pept        572245..574881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0527"
FT                   /product="glycoside hydrolase family 38"
FT                   /note="KEGG: glycoside hydrolase family 38; PFAM: glycoside
FT                   hydrolase family 38; glycosyl hydrolase 38 domain protein;
FT                   Glycoside hydrolase family 38 central region; SMART:
FT                   Glycoside hydrolase family 38 central region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01829"
FT                   /db_xref="GOA:D3T797"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="InterPro:IPR041147"
FT                   /db_xref="UniProtKB/TrEMBL:D3T797"
FT                   /inference="protein motif:PFAM:PF01074"
FT                   /protein_id="ADD01829.1"
FT                   /translation="MTFVHIIPHTHWDREWYFTFEQARVMLVYFMDELLEVLEKDDEFK
FT                   YFILDGQAVILEDYLEVNPQNKERIINLVKSGRLIIGPWYTQTDELLVSGESIIRNLYY
FT                   GISKCKEFGDYMKVGYLPDSFGQSAQIPQLLRGFGIDKVVFWRGLSERHTKYSEFIWKS
FT                   PDGSEVFAVNMPLGYAVGKYLPHDVKKAHERVSNIIQQLKQKATTQNVLIPNGHDQMPV
FT                   QKDLTYLLSELNKIDSENRYLISNFDEYVDSVLENKEKEEFDVVEGELTHQKYMRIHRG
FT                   IYSTRYDLKKTNFYIENLLTNYVEPILTIAYTLGFPYPHGLVEKAWKEILKNHAHDSIC
FT                   SCCTDNVHKDMEARFKQALEICTSLLELNLRKISEAIPSNEKGEQLLIFNTLPYLRSGV
FT                   VKSTLYTDKEDFEIIDEKGGKICYQVISKRVIDMGKKDRRIAARGEKLFLNEIEILVDA
FT                   QQVPALGYKTLYIVPFEGGKKEDIEIKSNNAIENEYYKVSANDDGTIDIHDKINDKHMK
FT                   GLLVFEDSGDAGDEYNYSPPKKDYVIKSGENDILLKTIYGNLRQELVIEQVLNVPKDLE
FT                   ERGKKLHSVEIPIKTVVSLDKGSKFISVKINITNKACDHRLRVLFKTGIKSEVSFADQQ
FT                   FGIIARKNRLPELEVWESENWQEKPVSIYPMQSFVDLHDGKYGFSVVTNGIKEYEIIGE
FT                   DFDTIAITLFRSVGYVGRSDLLYRPGRPSGVEIETPDSQMLGDLEFELALYPHKGDTVY
FT                   GLVPQVAKEYLTPMISYQKLPYNVFVINEEQQQLPSRYSLLNLVSTAIMSTIKKSEKED
FT                   SIILRIYNPSLQKIDGGEICFVDKKYDGIYVTDLKEDNIRQLSKKDKDSVDIGELQPCQ
FT                   VMSFKFV"
FT   gene            575035..575715
FT                   /locus_tag="Thit_0528"
FT   CDS_pept        575035..575715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0528"
FT                   /product="SNARE associated Golgi protein-related protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   tpd:Teth39_1751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01830"
FT                   /db_xref="GOA:D3T798"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D3T798"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADD01830.1"
FT                   /translation="MKINKCNMVNLILIAIFAIALVWAMATFGRDFVLLIDNPYEFRQW
FT                   IHSFDKFSVIVFIGVQILQVVIFAIPGEIVQIAGGYIFGTLLGTFYSVIGITIGSLICF
FT                   LIARVLGYKFVRSIVSEENLKKFDYIINNPKGETVLFLLFFIPGMPKDALSYIAGITPV
FT                   KFYNFFIITLFARLPGIFFSTYIGANLGSKNYFMAALVAAIAVILFLIGLYKKDFIMEK
FT                   LNKL"
FT   sig_peptide     575035..575124
FT                   /locus_tag="Thit_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.746 at
FT                   residue 30"
FT   gene            575844..576995
FT                   /locus_tag="Thit_0529"
FT   CDS_pept        575844..576995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0529"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: tex:Teth514_0482
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01831"
FT                   /db_xref="GOA:D3T799"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3T799"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ADD01831.1"
FT                   /translation="MYLLKGGKVLTMAGKIYEKGDVLIDNGKIADVGENLIAPLDVEVI
FT                   NVQGLTVMPGLIDAHCHLGMWENAVGFEGADGNEATDPVTPQLRAIDGINPMDKYFEEA
FT                   YQAGVTTVATGPGSANVIGGQFAVIKTYGKRIDDMIVKEPAAVKVAFGENPKSVYHEQH
FT                   KMPSTRMAVAALLRQELIKAQEYMEKMEQAEEDKKPERDLGLEALVKVLKREIPIKAHA
FT                   HRADDIFTALRIAKEFNVDITIDHCTDGHLIVDELVKENVKVIVGPSLSERSKIELVNL
FT                   SFKTAGILSKAGLTVAIMTDHPVIPINYLPLCAALAVKEGMDEMEALKAITINPAKILG
FT                   VDDRVGSIEKGKDADIVVFDGNPLEVKTRTKYVFINGKLVHKV"
FT   gene            577187..577360
FT                   /locus_tag="Thit_0530"
FT   CDS_pept        577187..577360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01832"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01832.1"
FT                   /translation="MTQVLEVLLPILEGRFAGRPWITYVFKRDNGAKGLAQKIYLRKLD
FT                   TDQISKGILTWS"
FT   gene            577419..578564
FT                   /locus_tag="Thit_0531"
FT   CDS_pept        577419..578564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0531"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bwe:BcerKBAB4_2155 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01833"
FT                   /db_xref="GOA:D3T7A1"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADD01833.1"
FT                   /translation="MERLWTRSFILMILGTFFLFTAFYMLYPTLPLFIKHIGGNETHVG
FT                   LSMGIFMLSAVILRPVIGGLLDWFGRRPFIILGLSLFTLAMYMYNWVNGITALIWLRML
FT                   HGVSWAISTTAILTVIADIVPTTRYGEGMGWFGTAMTLAMAIGPMLGMWVVQNLSYHAL
FT                   FLFAVALSITALLLKFGVKMLFQPQSDAKRIEFFEKPVLSVAVSVLFLFISYASITTFV
FT                   PLFADLLKVNSGLFFLVYSATLFLSRPIAGKLSDQYGEMFVVVPALLISILALIVLSVS
FT                   TGLFGMLVSAVLYGIGFGSAQPVLQATIVRLVPPDRRGVANASFSTATDLGIGLGAIIL
FT                   GWISKYTSYQILFTISAVSVIFSLLVFVFFVKHLLKSKGLR"
FT   gene            578821..578937
FT                   /pseudo
FT                   /locus_tag="Thit_0532"
FT                   /product="hypothetical protein"
FT   gene            579055..579996
FT                   /locus_tag="Thit_0533"
FT   CDS_pept        579055..579996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0533"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; KEGG:
FT                   tex:Teth514_0484 ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01834"
FT                   /db_xref="GOA:D3T7A2"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A2"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ADD01834.1"
FT                   /translation="MAFNLKGRSLLTLKDYTPQEIRYILDIAKQVKAERKAGVVHQRFL
FT                   GKTIALIFEKRSTRTRCAFETAFGEEGGHPVFLSTDDIQLGAKESIEDTARVLGRMFDA
FT                   IEFRGFKQETVEILAKYAGVPVYNGLTDEYHPTQVLADLMTIEEEFGSLTGRKLVFVGD
FT                   GRNNMANTLAVGCAKMGMHYVINSPKELWPSQEFIDEIRQMAAENGGTFELTSVPGEGL
FT                   EGADAIYTDVWASMGEEAKAEEREALLRPFQVNEEMMKKTGREDTIFLHCLPAVKGQEV
FT                   TFDVIEGKQSRVWDQAENRKHTIKAVMIATLL"
FT   gene            complement(580206..581624)
FT                   /locus_tag="Thit_0534"
FT   CDS_pept        complement(580206..581624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tex:Teth514_1315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01835"
FT                   /db_xref="GOA:D3T7A3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A3"
FT                   /inference="similar to AA sequence:KEGG:Teth514_1315"
FT                   /protein_id="ADD01835.1"
FT                   /translation="MKIKAKQLSLSDIYDDVQSFFEEDKPKFIKLFDSFVDLSELIPSS
FT                   FYAHYYSHFGRHRDFSLESMLTALIIQKILSIPTVQLLAHVLKLSKELRELCGFKRVPH
FT                   PSQFSRFKSIFLKDLENFFNNLVNLTEPICQAINPSISNILIADTTGFEPYVRENNPKF
FT                   FDSLYRNIKKFSKSNPDFDAHSYACSKMPKFAHSNPDAKFSYINGHYCYSIKATILTNG
FT                   LGIIQHISFYDDDSLNVNTAKSAAESKDLYDSKTLIPSLKEFFNLHPNFSYRYFLGDAG
FT                   FDSFDNYKYLFSKLGIIPIIPINPRNSKNLPQPTFNSDGIPTCPRDPSLKMSYDGIVRE
FT                   KGRATRIKWLCPMSKKVRLNGKTTYILQCDNPCTSSKCGRIFYTTLDIDFRKNTFVPRN
FT                   SKKWSKLYEKRPIIEKSISLLKSSIAVDSFKLINTRSIKADVFLGAITQHIGLIITAKL
FT                   GTFEHPLSLKKLLA"
FT   gene            581778..582719
FT                   /locus_tag="Thit_0535"
FT   CDS_pept        581778..582719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0535"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="TIGRFAM: carbamate kinase; KEGG: tex:Teth514_0485
FT                   carbamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01836"
FT                   /db_xref="GOA:D3T7A4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A4"
FT                   /inference="protein motif:TFAM:TIGR00746"
FT                   /protein_id="ADD01836.1"
FT                   /translation="MKDKIVVALGGNALQDVNMPPTAEAQMEVVKRTAGYLADIIEKGY
FT                   SVVITHGNGPQVGNIVIQNETASKIVPAMPFDVCGAESQGMIGYMIQQALREVLKERNI
FT                   KKEVATIITQVVVDKNDPAFKKPTKPIGPFYTKEEAEVLIKEKGYEMVEDSGRGYRRVV
FT                   PSPDPKEIVELNTIKLLEKNGVIVITVGGGGIPVIRENGNLKGVAAVIDKDLASEKLAE
FT                   DIDADVLLILTAVEKVAINYNKPNQKFLDKMTVKEAIKYMEEGHFAPGSMFPKVKAAVR
FT                   FAKSKVGRRAIITSLDKALEALEGEAGTVITL"
FT   misc_binding    582847..582965
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 120.45"
FT   gene            583057..583641
FT                   /locus_tag="Thit_0536"
FT   CDS_pept        583057..583641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0536"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: tpd:Teth39_1746 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01837"
FT                   /db_xref="GOA:D3T7A5"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1746"
FT                   /protein_id="ADD01837.1"
FT                   /translation="MEKTKTQTIVKVGFLSAIAFILMYLEFQVPLFPGFLKLDFSDVPA
FT                   LVASFAIGPLYGVMVELIKNILHATVTQSGAIGEIANFTVGSIFVYTAGVIYQFNRTRK
FT                   TALISMAIATVVMAVTASLLNYYVFLPLYQRVMGWPMDAIINMSKTANKNIVDVKTLIS
FT                   YGIFPFNILKGIVVSVITFLVYKKLSPFFKH"
FT   gene            583819..584280
FT                   /locus_tag="Thit_0537"
FT   CDS_pept        583819..584280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0537"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   tpd:Teth39_1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01838"
FT                   /db_xref="GOA:D3T7A6"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A6"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ADD01838.1"
FT                   /translation="MEKAYICKNRDETVSLGEKLGKLLRSRDIILLYGDLGSGKTVFTK
FT                   GIAKGLGINEPITSPTFTLVNEHRGRIPLYHFDLYRLDDYTALYDIGYEEYFYDEGVCA
FT                   IEWPERLGPLLPKERLEVIIQKGEKEDERVILFKDFGKRYEELLKEMSQ"
FT   gene            584277..584972
FT                   /locus_tag="Thit_0538"
FT   CDS_pept        584277..584972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0538"
FT                   /product="peptidase M22 glycoprotease"
FT                   /note="PFAM: peptidase M22 glycoprotease; KEGG:
FT                   tex:Teth514_0489 peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01839"
FT                   /db_xref="GOA:D3T7A7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A7"
FT                   /inference="protein motif:PFAM:PF00814"
FT                   /protein_id="ADD01839.1"
FT                   /translation="MKILAIDSSSKTATVALVDEKGIIGEYSINYLRHSVILMPMIDEL
FT                   LKKCEVPINQITHVAVSEGPGSFTGLRIGAATAKGLAHALNIPIVGVSSLLALAYNVSE
FT                   FEGLICPLIDALNENVYGMLIRGGSLEILMDAKVYSLEEIAELVEGYSDKVLFVGEGVY
FT                   SYKDKLREMIRDKALFAKDKDNIARAASIGEIAIQMIKKGEVFSFFDFKPVYIRKSAAE
FT                   IRLSDRGVN"
FT   gene            584972..585418
FT                   /locus_tag="Thit_0539"
FT   CDS_pept        584972..585418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0539"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="KEGG: tpd:Teth39_1743 ribosomal-protein-alanine
FT                   acetyltransferase; TIGRFAM: ribosomal-protein-alanine
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01840"
FT                   /db_xref="GOA:D3T7A8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A8"
FT                   /inference="protein motif:TFAM:TIGR01575"
FT                   /protein_id="ADD01840.1"
FT                   /translation="MDVIIRLMRKEDVEEVLEIEKLSFSTPWSKEAFISEVTKNSCAKY
FT                   IVAEVDNKIVGYGGFWVVVDEGHITNIAVHPEYRSKGIGSKIMEGLIELAKKNGIISMT
FT                   LEVRESNIVAQHLYAKFGFRPLGRRKGYYQDNNEDAIIMWKYDL"
FT   gene            585432..586460
FT                   /locus_tag="Thit_0540"
FT   CDS_pept        585432..586460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0540"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="TIGRFAM: metalloendopeptidase, glycoprotease family;
FT                   KEGG: tex:Teth514_0491 putative DNA-binding/iron
FT                   metalloprotein/AP endonuclease; PFAM: peptidase M22
FT                   glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01841"
FT                   /db_xref="GOA:D3T7A9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7A9"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ADD01841.1"
FT                   /translation="MDKDVIILGIESSCDETAAGVVKNGKEVLSNVIYSQIEVHKKYGG
FT                   VVPEIASRKHIEVISFVVEEALEKARLTLDEVDVIAATYGPGLVGALLVGLSYGKALAY
FT                   AKNKPFIGVNHIEGHIAANYLGGEFAPPFICLVASGGHSHIVFVKDYGEYEVMGQTMDD
FT                   AAGEAFDKVARALGLGYPGGPAIEKAAKLGNMEAIEFPKSFMEEGNFDFSFSGLKTAVL
FT                   NYLNRQKQKREEINVYDVAASFQRNVVEVLVKKLIDAAKKKNINKISIAGGVAANSFLR
FT                   EKLEEEAKKIGIRLHYPDKIYCTDNGAMIAAAAYYDFIKGKTSELDLNAIPYLKIGEKF
FT                   CC"
FT   gene            586627..587577
FT                   /locus_tag="Thit_0541"
FT   CDS_pept        586627..587577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0541"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: tpd:Teth39_1741 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01842"
FT                   /db_xref="GOA:D3T7B0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B0"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADD01842.1"
FT                   /translation="MKNILLFTKLNETYIKEIKERMDEYEVLYVQNEEEAEKYIKDTEI
FT                   IISFDFEFYPNIVDKASNLKWIHLLSAGADTLPFEKLKEMKVLVTNSRDVHKYQISQQV
FT                   IGYMLMFERSLNTFLRNQIKKVWDRSVRVSELTGKTALIIGVGSIGEEIARLLKEFGMK
FT                   VYGIRSSGKPSLYVEKMYTSIEDCDVLSFADYVISILPLTKDTYHLIGENVFSRMKNTS
FT                   YFINVGRGKVVDEKALINALENKVIKGAALDVFEEEPLRKDSPLWDMENVIITPHMAGV
FT                   TPLYMQRAMEILKENLDAYKEGRTLRNIVNLDKGY"
FT   gene            complement(587870..589762)
FT                   /locus_tag="Thit_0542"
FT   CDS_pept        complement(587870..589762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0542"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: tpd:Teth39_1740 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01843"
FT                   /db_xref="GOA:D3T7B1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADD01843.1"
FT                   /translation="MAIITVNNVTKSYGIDIILQNISFIVNEKDKIGVIGKNGAGKSTL
FT                   FNLLAGFTEPDSGAISISANKIGYLQQNTLIDSEKSIYEEVKTVFVEIFQLEKQIKSLE
FT                   EKISQTKDSHLLDKLFLEYSFLTDKYMELDGYSVESKIRGALNGLGFDVSQFDTPVSNL
FT                   SGGQKTRLMLAKTLLSNPDVLLLDEPTNHLDISSIEWLEQYLKFYSGTILIISHDRYFL
FT                   DKIVSRIFEIENTKLSVYEGNYTEYLKRKTLETKAKLKAYEEQQKEIKRIKSIIQIQKN
FT                   RRTEKSVKMAESKQKLLEKMEIIEKPVINNRSFNLHFDFDLESGNEVLTVKNLSLSFDR
FT                   QIFSNVSFEIKKGEKIALLGPNGIGKSSLLKILVGEIDNFEGEIKFGTNIITGYYEQEF
FT                   KSLHDEKTVIDEIWDENPYLTQTEVRTLLASFLFKEEDVFKTVSVLSGGEKARLSLLKL
FT                   ILSKANFLLMDEPTNHLDLKAKEVLEEALLDYSGTLLFVSHDRYFIDKIATKVMVLTPQ
FT                   GVEVYLGNYSYYIEKKNQLNEKQEETIKKTKTQIKNERYKERLAKLKLKQQKEYLKNLE
FT                   NSIYQAEERIKYLEEKMCDVKIYKTGEIVEIQKEYNALKSKLEQMYEEWENLSG"
FT   gene            589888..590712
FT                   /locus_tag="Thit_0543"
FT   CDS_pept        589888..590712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0543"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   tpd:Teth39_1739 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01844"
FT                   /db_xref="GOA:D3T7B2"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B2"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ADD01844.1"
FT                   /translation="MELDIATVVGIVVAVGAIVYGYTLGGGTLDSLIDVGSAILVIGGT
FT                   IGATIVSYSMDDIKKVPRLLVKAFKDQSNNYLEIIKYFAYLAQKARSEGLLSLESEMES
FT                   EKIKNFDPILKECLELVVDGSDMELIKTTMENKIYIEDMEAKKEAGIFEAAGGYAPTMG
FT                   LIGTVVGLIKVLLELDDPSQIGPSVSLAFITTLYGALLANLFFLPIAQKLRNKASIKRI
FT                   EKELILEGSLSLQAGENPRILERKLMTFITQAQLKNTSQKGGVELNEEMGGR"
FT   gene            590690..591409
FT                   /locus_tag="Thit_0544"
FT   CDS_pept        590690..591409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0544"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG:
FT                   tpd:Teth39_1738 OmpA/MotB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01845"
FT                   /db_xref="GOA:D3T7B3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B3"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ADD01845.1"
FT                   /translation="MRRWEEDESKLNTGRWVLTYSDMMSLLLVFFIVLYSISTLNAAKF
FT                   AQLSISLSRAFGGSDYVIGQYMGDSFVQGNSGDKNSLGEIEKQLEGFVKENNLQGMVTS
FT                   YIDERGLVISLQDTILFDLGSADVHPEEKDVLIKIGNMLKTLPNHIRVEGFTDDLPIHN
FT                   NKFDSNWELSVIRATNVVKILVHEAGVDPKKISAVGYGEYRPVVPNDSEEHRRLNRRVD
FT                   IVIMNAEYDKWEPKSPD"
FT   gene            591511..592185
FT                   /locus_tag="Thit_0545"
FT   CDS_pept        591511..592185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0545"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: tex:Teth514_0496 redox-sensing
FT                   transcriptional repressor REX"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01846"
FT                   /db_xref="GOA:D3T7B4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B4"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ADD01846.1"
FT                   /translation="MSKKTIVSMAVVRRLPRYHRYLEELLKNDVKRISSRELSEKMGVT
FT                   ASQIRQDLNNFGGFGQQGYGYNVEELYNNLTKILGLDKTYNTIIIGAGNLGQAIANYTS
FT                   FEKSGFNLKGIFDINPRLFGLKIRDVEVMDVETVEDFIARNKIDIGILCIPKDNAQYIA
FT                   DRLVKAGIKAIWNFSPIDLKVPDDVILENVHLSDSLFTVSYRLNEGELFKKLKGETAKI
FT                   DG"
FT   gene            592376..592834
FT                   /locus_tag="Thit_0546"
FT   CDS_pept        592376..592834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01847"
FT                   /db_xref="GOA:D3T7B5"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1736"
FT                   /protein_id="ADD01847.1"
FT                   /translation="MDKLAIWEVFLFSVPEAAVIISIAFGLAGAEFLPMKILYMSLLTG
FT                   FILYFIRPLISSYIVNVILYIGTLMILFLTFKVMDFFKGMMSIILAVSIYLIIEYLNVT
FT                   AIQFLFDLEPVLLLKDYVLRFECFLPQLLTAILVSFVIRKYKLSLFTE"
FT   gene            592861..593571
FT                   /locus_tag="Thit_0547"
FT   CDS_pept        592861..593571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0547"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="KEGG: tpd:Teth39_1735 LytTR family two component
FT                   transcriptional regulator; PFAM: LytTr DNA-binding region;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; LytTr DNA-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01848"
FT                   /db_xref="GOA:D3T7B6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B6"
FT                   /inference="protein motif:PFAM:PF04397"
FT                   /protein_id="ADD01848.1"
FT                   /translation="MLRIVVAEDDINFRKELTKILLTIEDVSVEYSTGDGKDALEALIK
FT                   IRPNVAILDIGLPRISGIEVARKIREYMPFLEIIFITSFEEYIKDAVKLYASDYIEKPL
FT                   DEKRLRETLERIKEKLFEIENVVPFKTEDGVKLVNPKEIYCVRASKKRSIVYTQREKFI
FT                   CDYSLKEIEELLDSNMFFRTNRSFLVNLFKVELLKDNNRTSFEICFKGSNYKAYLSKEL
FT                   YEEFRRRIKAIYRS"
FT   gene            593591..594454
FT                   /locus_tag="Thit_0548"
FT   CDS_pept        593591..594454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0548"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: tpd:Teth39_1734 signal transduction histidine
FT                   kinase regulating citrate/malate metabolism; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01849"
FT                   /db_xref="GOA:D3T7B7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADD01849.1"
FT                   /translation="MFKDSYKNAMMIYVVQMVLIVILVNNNFMKSLDVFQPKNQELFRI
FT                   FIGILIFILNGLSIFVLRGLYAKNKEERQYLINSIKFKYIEEQNRIYRQNHHDIKNHLI
FT                   VISELVKEKRYSELESYLFSYMEEIDKNLVTINTGINEIDILLYSKISNAKSKGIEVDF
FT                   KCDTQIQCSKKHVLNLVSVLGNLIDNAIEACDEMEKDKYMIIELKEDPIDYIFHVKNRY
FT                   NFQKDIEPSAYFEEGFSTKEGRGRGEGLHIVRNIVEKYRGEIDVQTEEGYFDIIVEIPK
FT                   FSLEGD"
FT   gene            594450..595031
FT                   /locus_tag="Thit_0549"
FT   CDS_pept        594450..595031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0549"
FT                   /product="Accessory gene regulator B"
FT                   /note="KEGG: tpd:Teth39_1733 accessory gene regulator B;
FT                   PFAM: Accessory gene regulator B; SMART: Accessory gene
FT                   regulator B"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01850"
FT                   /db_xref="GOA:D3T7B8"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B8"
FT                   /inference="protein motif:PFAM:PF04647"
FT                   /protein_id="ADD01850.1"
FT                   /translation="MEINIEKLAEMLAQRLFKTQNLTDIEMAKIQYGISLILGVIIEFT
FT                   LVYAISLILGIGFYTAVIMFSALFLRINTGGAHCTTYNRCITFTAFYFIPFSALAKFVD
FT                   VHFSLYLKIFVSLLLYFIVLVMVKNNKFYRAVIMFLIGINILLFFANTIVGVKVLFLIS
FT                   IGFTLQAIMRTTLGETIVEIADAFLKKAGI"
FT   gene            595771..596601
FT                   /locus_tag="Thit_0550"
FT   CDS_pept        595771..596601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01851"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7B9"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1732"
FT                   /protein_id="ADD01851.1"
FT                   /translation="MKVYSLVGESGTGKSHHASFIAGKYGIRYIIDDGILIKGNNIIAG
FT                   VSAKKEATKIGAIKRALFTDSKHVEEVKKAIEEAKPDKILIIGTSDKMVDTIAEKLGLP
FT                   PVSVRVYIEDVVPPKQIEIAREKRLLEGKHVIPAPTFEVKKQFSGYFLDPLRIFRRNKG
FT                   GYFEKTIVRPNYSYLGKYTISESVINSIVAHELILFREVYKVNRVLTEKRPEGIILKID
FT                   VSMKYGCQIMPVLKEAMKNIKKQLEYMTALNVLHMDIYVKNLHIEKANSGEKGV"
FT   gene            596594..597448
FT                   /locus_tag="Thit_0551"
FT   CDS_pept        596594..597448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0551"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Dihydroorotate dehydrogenase, electron transfer
FT                   subunit, iron-sulphur cluster binding domain; KEGG:
FT                   tpd:Teth39_1731 ferredoxin-NADP(+) reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01852"
FT                   /db_xref="GOA:D3T7C0"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C0"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ADD01852.1"
FT                   /translation="MCDMYKIVRKEVLNPVVKLMDIEAPRVAKSAKPGQFVIIRIYDKG
FT                   ERIPLTIADYDPKKGTVTIVFQEVGKSTKLLGALNEGDYILDFVGPLGNSMEVPKEAKK
FT                   ILGVGGGVGIPALYPKLKALHQEGYRVEAILGGRSEEYVIFKKEMEAVCDKVYYATDDG
FT                   TLGKKGFVTDVLKEVLENDKEIDYIITVGPVIMMKNVCEMTKEYNIPTIVSMNPLMVDG
FT                   TGMCGACRIEVGGETKFVCMDGPIFDGHLVNFDLAMTRLNMFKQQEKLSLELYEHGGGH
FT                   HGR"
FT   gene            597438..598829
FT                   /locus_tag="Thit_0552"
FT   CDS_pept        597438..598829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0552"
FT                   /product="glutamate synthase (NADPH), homotetrameric"
FT                   /note="KEGG: tpd:Teth39_1730 glutamate synthase (NADPH),
FT                   homotetrameric; TIGRFAM: glutamate synthase (NADPH),
FT                   homotetrameric; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01853"
FT                   /db_xref="GOA:D3T7C1"
FT                   /db_xref="InterPro:IPR006004"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C1"
FT                   /inference="protein motif:TFAM:TIGR01316"
FT                   /protein_id="ADD01853.1"
FT                   /translation="MAVKDRVPMKEQDPKERIKNFNEVALGYAEEEAILEASRCLQCPK
FT                   PTCVAGCPVHVRIPEFIKAITKKEFEEAYKIIKSTNSLPAVCGRVCPQEEQCEKNCVLN
FT                   KVGKPIAIGRLERFVADYALENNVEEEVKPEKKNKKVAIIGGGPAGLTCAGDLLKMGYD
FT                   VTIFEALHALGGVLTYGIPEFRLPKRIVEAEIERVKKLGAKVETNVVVGRTVTIDQLME
FT                   EEGFEAVFVGTGAGLPKLMDIPGKNLNGVYSANEFLTRINLMKAYKFPEYDTPIAVGKR
FT                   VAVIGGGNVAMDAARSALRLEGVEEVIVVYRRSKEEMPARLEEIEHAVEEGIKFEFLAN
FT                   PIRINGTEDGWVKSMDVIRMELGEPDSSGRRRPIEIPGSEFTIEVDTVIMALGTSPNNL
FT                   IPSTTKDIDVQRWGGIIADETGKTSKPGVFAGGDAVTGAATVILAMGAGKQAAKAIDEY
FT                   LRNKK"
FT   gene            599162..600802
FT                   /locus_tag="Thit_0553"
FT   CDS_pept        599162..600802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0553"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   tpd:Teth39_1729 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01854"
FT                   /db_xref="GOA:D3T7C2"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C2"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ADD01854.1"
FT                   /translation="MTIWSKSNDVLGTVNRGNPSESGLCTLCMADCQGKCETWLSSLLG
FT                   RKMLYPRDFGMVTAGSNNTTSIGVSYNSLRIMGYNYGAYGLDQNISDSSDDCIFPNVNI
FT                   ETEFGSEEKTKSRIPIMTGALGSTFIAAKYWDPLAIGAALVGFPIVIGENVAGIDKEAV
FT                   IENGRIRKAPELDRRINTYLRYFDGYGAIIVQVNVEDLRNGVAEYVIEKYGDKVIIELK
FT                   WGQGAKSIGGEIQVKDIEYATFLKKRGYIVDPDPEKPEIVEGFKNGAVKSFARHSRLGY
FT                   THLSSPEEVREEFMKTVEYLRKIGYKKITLKTGSYSMDSLAMAIKFATEAKLDLLTIDG
FT                   SGGGTGMSPWNMMQTWGVPSILLHSKAYEYASILANKGQKVVDMAFAGGFAREDHIFKA
FT                   LALGAPFTKLVCMGRALMIPAFVGSNIEGVLHPERKGKVNGNWDKLPPTVSQLGLKAEE
FT                   IFAGYYEVKKKVGENEMKNIPYGAIAVWTLADKLAAGLQQLMAGARKFSLKAISREDIA
FT                   SVNRETERETGIPFITDVKNDVARDILNS"
FT   gene            601019..601912
FT                   /locus_tag="Thit_0554"
FT   CDS_pept        601019..601912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0554"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="PFAM: 8-oxoguanine DNA glycosylase domain protein;
FT                   HhH-GPD family protein; KEGG: tpd:Teth39_1728 8-oxoguanine
FT                   DNA glycosylase domain-containing protein; SMART: HhH-GPD
FT                   family protein; Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01855"
FT                   /db_xref="GOA:D3T7C3"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C3"
FT                   /inference="protein motif:PRIAM:4.2.99.18"
FT                   /protein_id="ADD01855.1"
FT                   /translation="MKYSVEEKGTKVIVRGIEDFNLKETFECGQCFRWNEEEDGSYTGV
FT                   AYDRVVNVKLEEDMLIIDNTDLNDFYDIWFDYFDLGRDYKKIKENLSRDPILKEAIQYG
FT                   QGIRILRQDTWETLVSFIISQNNRIPQIKKVIENLASSFGEPIEYKGKIYYTFPKAEEL
FT                   VMFDVDTIAKTKCGFRAKYILDAASKVFSGEIDLLKLFEYSTNEIRDILMNINGVGPKV
FT                   ADCVILYSIGRYDTFPTDVWIKRIVEYLYLKREGTPLEIQLFAIDKFGDLSGFAQQYLF
FT                   YYGREMGKKIFNERKK"
FT   gene            601913..602608
FT                   /locus_tag="Thit_0555"
FT   CDS_pept        601913..602608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0555"
FT                   /product="protein of unknown function DUF554"
FT                   /note="PFAM: protein of unknown function DUF554; KEGG:
FT                   tpd:Teth39_1727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01856"
FT                   /db_xref="GOA:D3T7C4"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C4"
FT                   /inference="protein motif:PFAM:PF04474"
FT                   /protein_id="ADD01856.1"
FT                   /translation="MVGTIVNSIAIIVGGTIGTLLKVGIPDRFKNIVMQGVALSVMIIG
FT                   ISNGLQFSNLMVVIISLVIGGIVGEALNIEEHLNKLGDVLQKKLSKDKSSTISKGFVTA
FT                   SLVYCIGAMAIIGALKDGLSGDHSILFAKSVLDGISSIIFASTFGIGVAFSAVSVFLYQ
FT                   GSISLGASFLQGLLTKTVINDMTAVGGILIFAISLNMLEIKNIKVGNLLPAIFIPIFYQ
FT                   FLLNIIKRF"
FT   gene            602620..603033
FT                   /locus_tag="Thit_0556"
FT   CDS_pept        602620..603033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01857"
FT                   /db_xref="InterPro:IPR015111"
FT                   /db_xref="InterPro:IPR036482"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C5"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1726"
FT                   /protein_id="ADD01857.1"
FT                   /translation="MKQLKSIDVARIAVKMAMSTREEEESLKHKYWQQGVKVAAVNYGG
FT                   EYVNSISKIIERAVVAAKREGIIEETHAAEGAVAGAAHEAAIQVMNKAMGLNVGGKIGI
FT                   AYAGEHLCVCVFFAVGMLNLNEVAIGLGHRSLK"
FT   gene            complement(603046..604284)
FT                   /locus_tag="Thit_0557"
FT   CDS_pept        complement(603046..604284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0557"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: tpd:Teth39_1725 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01858"
FT                   /db_xref="GOA:D3T7C6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C6"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ADD01858.1"
FT                   /translation="MNLIPIIAFSKIAKEIYVSNKIDKRLLKKAVYLRSECVPGILYSH
FT                   LPYYILKEKIEKLGGSIKFELPIIKGWSVNLPCDKLKNLAALKGVYFIAQDSTVKLQLY
FT                   IATQEIASRKANDLGYSGKGVTIAFLDTGIYPHPDFTKPKNRIVAFHDVVNGKKQPYDD
FT                   NGHGTHVAGDATGNGYASGGKYKGVAPEANIVAVKVLDAYGRGLSSDILAGMQWILDNK
FT                   DKYNIRVVSLSIGETPSLPTFLDPLVRGVNTLWRNGLVVTVAAGNSGPNYNTITSPGNS
FT                   KNVITVGAVDDKRTSDVSDDEIAQFSGRGSPYLYKPDIVAPGVKIISTASGNIPFGADE
FT                   IMINKAYRTATGTSMATPMVAGAAALLLEKNPNLTNVQIKNILKATAVKIDDAGLWTQG
FT                   SGMINIEEALKKA"
FT   gene            604445..604561
FT                   /locus_tag="Thit_0558"
FT   CDS_pept        604445..604561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0558"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01859"
FT                   /db_xref="GOA:D3T7C7"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01859.1"
FT                   /translation="MPVDKGGAGWGFGWFWIIIIILLICLFIPGFIVEEPKA"
FT   gene            604597..604782
FT                   /locus_tag="Thit_0559"
FT   CDS_pept        604597..604782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE0577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01860"
FT                   /db_xref="GOA:D3T7C8"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7C8"
FT                   /inference="similar to AA sequence:KEGG:TTE0577"
FT                   /protein_id="ADD01860.1"
FT                   /translation="MAGTSSVFGQSNLLFFFLILVLALGGEWLNVTWSLETLLFFFILL
FT                   VIIMNGGLGWFLNEVK"
FT   gene            605241..606653
FT                   /locus_tag="Thit_0560"
FT   CDS_pept        605241..606653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0560"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: tpd:Teth39_1868 RNA-directed DNA polymerase
FT                   (reverse transcriptase)"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01861"
FT                   /db_xref="GOA:D3T321"
FT                   /db_xref="InterPro:IPR000123"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:D3T321"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ADD01861.1"
FT                   /translation="MDSKDMQRLQTTQQRGYPLNREMEFQKTTEVHSISSASEDGRNEV
FT                   QRYTGKMLEMIVERGNMEAAYKRVVANKGSHGVDGMGVDELLPYLKENWATIKQQLLEG
FT                   KYKPQPVRRVEIPKPDGGKRLLGIPTVLDRLIQQAIAQILNKVYNHTFSDSSYGFRPGR
FT                   SAKDAIKAAEAYINEGYTWVVDMDLEKFFDRVNHDIIMSKLEKRIGDKRVLKLIRRYLE
FT                   SGVMINGIKVSTEEGTPQGGPLSPLLANIMLDELDKELEKRGHKFCRYADDCNIYVRSR
FT                   SAGNRVMKSIKKFIESKLKLKVNEAKSAVDRPWRRKFLGFSFYTKENEVRIRIHEKSIK
FT                   RFKEKVREITNRNKGISMENRIKRLNQITTGWVNYFGLADAKSIMKTLDEWIRRRLRAC
FT                   IWKQWKKIKTKHDNLVKLGVEEQKAWEYANTRKGYWRISNSPILNKTLTNKYFESIGYK
FT                   SLSQRYLIVHNS"
FT   gene            606771..606965
FT                   /locus_tag="Thit_0561"
FT   CDS_pept        606771..606965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0561"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1724 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01862"
FT                   /db_xref="GOA:D3T7D0"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADD01862.1"
FT                   /translation="MSFSGDTLLFFFVVLTLILDVRFELESLLFFFLILVILQEEKPRK
FT                   KAKNLFWLLTGINFSNANL"
FT   gene            607044..608021
FT                   /locus_tag="Thit_0562"
FT   CDS_pept        607044..608021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_1723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01863"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D1"
FT                   /inference="similar to AA sequence:KEGG:Teth39_1723"
FT                   /protein_id="ADD01863.1"
FT                   /translation="MQREILLKILAIELLIVAFVRFQMMGVEGEKNETVPSSGSDDNGK
FT                   FLLPQKDKKSTINVYEMVTKSKNFVESVKPYLCKRDQYYVDIFSKIAEIIEIQKDLMSL
FT                   SQEEIEAMDKTQVDKIGILKAIKPYIAEDKQIIIDKFLKFHEALKNLQQRLEKYTKEED
FT                   KDNFFDKIVDIYEAIRPIIPEEKIEETDKIAKNIKLLEVLNKAEGIMNSMKEEKKQSQQ
FT                   ATRDFYEEITEEEEEKSEEIKEIEVELKEGEKDEEEMEQELPNKEENLLPQGMSEQQLA
FT                   AINNLKSMLTKEQQQYMYNMINYLKQQGLVNLSNKEKSDLEKGE"
FT   gene            608254..608538
FT                   /locus_tag="Thit_0563"
FT   CDS_pept        608254..608538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0563"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: tpd:Teth39_1722
FT                   chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01864"
FT                   /db_xref="GOA:D3T7D2"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D2"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADD01864.1"
FT                   /translation="MRLKPLGDRVVVKVIQAEEVTKGGVILPGTAKEKPQQGEVVAVGT
FT                   GQYIDGKKVELEVKVGDRVIFSKYAGTEVKLDGEEYLLLRESDILAIIE"
FT   gene            608553..610175
FT                   /locus_tag="Thit_0564"
FT   CDS_pept        608553..610175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0564"
FT                   /product="chaperonin GroEL"
FT                   /note="KEGG: tpd:Teth39_1721 chaperonin GroEL; TIGRFAM:
FT                   chaperonin GroEL; PFAM: chaperonin Cpn60/TCP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01865"
FT                   /db_xref="GOA:D3T7D3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D3"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ADD01865.1"
FT                   /translation="MAKQIKYGEEARRALERGVNAVADTVKVTLGPRGRNVVLDKKYGS
FT                   PTVTNDGVTIAREIELEDPFENQGAQLLKEVATKTNDVAGDGTTTATLLAQAMVREGLK
FT                   NLAAGANPMLLRRGIAKAVDAAVEGLKRISKPIDNKESIAHVASISAADEEIGNLIAEA
FT                   MDKVGKDGVITVEESKTLGTTLEVVEGMQFDRGYISPYMVTDAEKMEAVLEEPVILITD
FT                   KKLSNVQDLLPLLEQIVQQGKKLLIIADDVEGEALATLVVNKLRGTFTCVAVKAPGFGD
FT                   RRKEMLQDIAILTGGQVISEELGYDLKDVRLDMLGRARQVKVTKENTTIVGGAGDAAEI
FT                   KKRVNQIKAQIEETTSDYDREKLQERLAKLAGGVAVIQAGAATETELKEKKHRIEDALA
FT                   ATKAAVEEGIVPGGGIALLNVIEDVQKVVDSLDGDFKTGAKIVLRALEEPVRQIAANAG
FT                   VDGSVIIEKIKAAKDPHFGYDAYKEEFTDMFKAGIVDPTKVTRTALQNAASIASMILTT
FT                   EAVVVDIPEKNTTPNPGAGMDMM"
FT   gene            610276..610352
FT                   /locus_tag="Thit_R0018"
FT                   /note="tRNA-Arg2"
FT   tRNA            610276..610352
FT                   /locus_tag="Thit_R0018"
FT                   /product="tRNA-Arg"
FT   gene            610783..612237
FT                   /locus_tag="Thit_0565"
FT   CDS_pept        610783..612237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0565"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="SMART: CBS domain containing protein; TIGRFAM:
FT                   inosine-5'-monophosphate dehydrogenase; KEGG:
FT                   tpd:Teth39_1720 response regulator receiver protein; PFAM:
FT                   IMP dehydrogenase/GMP reductase; CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01866"
FT                   /db_xref="GOA:D3T7D4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D4"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ADD01866.1"
FT                   /translation="MEEKFVKEGLTFDDVLLIPAKSDVLPKDVDLKTKLTKKITLNIPL
FT                   MSAGMDTVTESKLAIAIAREGGIGVIHKNMSIERQALEVDKVKRSEHGVITDPFSLTPD
FT                   HTIKDAAELMARYKISGVPITVDSKLVGIITNRDIRFEDDLNKPIKEVMTKDNLVTAPP
FT                   GTTLEEARQILKKHKIEKLPLVDENNVLKGLITIKDIEKAVEFPNAAKDSKGRLLVAAA
FT                   VGVGKDMMDRVKALVEAGVDAIVIDTAHGHSKGVLDAVSKIKEKYPDLQLIAGNVATAE
FT                   ATRDLIERGADCVKVGIGPGSICTTRVIAGVGVPQITAIYDCAQEADKYGIPIIADGGI
FT                   KYSGDIVKAIAAGASVVMLGSLFAGTEESPGEIEIYQGRSYKVYRGMGSLGAMKEGSSD
FT                   RYFQEDVTKFVPEGVEGRVPYKGPLKDTVYQLVGGLRAGMGYCGVRNIEELRTKTKFVK
FT                   ITQAGLTESHPHDIIITKEAPNYNLR"
FT   gene            612252..613790
FT                   /locus_tag="Thit_0566"
FT   CDS_pept        612252..613790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0566"
FT                   /product="GMP synthase, large subunit"
FT                   /note="KEGG: tpd:Teth39_1719 GMP synthase; TIGRFAM: GMP
FT                   synthase, large subunit; GMP synthase, small subunit; PFAM:
FT                   GMP synthase domain protein; tRNA methyl transferase-like;
FT                   glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01867"
FT                   /db_xref="GOA:D3T7D5"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D5"
FT                   /inference="protein motif:TFAM:TIGR00884"
FT                   /protein_id="ADD01867.1"
FT                   /translation="MGIKREVVLVLDFGGQYTQLIARRIREANVFCEIVPYNISPEEVR
FT                   KKEPKGIVLSGGPASVYAKNAPKCDKGIFELGYPVLGICYGAQLMTELLGGKVAPAPVK
FT                   EYGKTEIVLNNTIPLFKGIERDTIVWMSHTDHIELPPPDFKVVASTDNCPIAAIANVEK
FT                   KLYAVQFHPEVSHTHRGTEIIRNFLFEVCDCAADWTMDSLIEQTVKEIKAKVGKHKAVC
FT                   ALSGGVDSSVAAVLVDRAIHDQLVCIFVDTGLLRKNEGDMVIETFRKNYDMNIIRVDAK
FT                   DRFLSRLKGVTDPEEKRKIIGNVFIEVFKEEALKIGDVKFLVQGTLYPDVIESGNGVSS
FT                   TIKSHHNVGGLPEDIGFELIEPLKMLFKDEVRQVGKELGIPEEILYRQPFPGPGLAVRI
FT                   LGEVTEEKLEILRQADSIVLREMKKFGWYNKVWQSFAVLPGVKSVGVMGDERTYAYAII
FT                   LRVVDSYDGMTADWTKLPYEILESISTSITNEVPGVNRVLYDITSKPPATIEWE"
FT   gene            614169..615551
FT                   /locus_tag="Thit_0567"
FT   CDS_pept        614169..615551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0567"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   tpd:Teth39_1718 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01868"
FT                   /db_xref="GOA:D3T7D6"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D6"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ADD01868.1"
FT                   /translation="MEKVSKMRNKNSLENLANRIWRLENYSTNVKTEILAGITTFITMA
FT                   YIMFVNPIILKEAGMDAGAVFVATCLSAAIGTFMMALYANYPFAQAPGMGLNAFFTYTV
FT                   VLTMGYTWQEALAAVFFSGIIFILITLTGIREMIVDAIPLSLKYAVSAGIGLFIAFIGL
FT                   KNSGIIVPNQATYIGFGDLTNPGTLLAIAGLFITGILMSRNVKGSILLGILITTVLGLF
FT                   TGIVKLPSDFSIIKMPPSLAPTFLKLDIKGLLGVGENIGFISLVTSVLYVVLSFAFVDL
FT                   FDTIGTFIGTGSKAGMLDENGKMPNMKKGLMADAIATTIGSLLGTSTVTTYVESAAGIA
FT                   EGGRTGLTAFVTGILFLVALFFSPIALLVPTEATAPALIIVGVLMMGSIKKISFEDFTE
FT                   AMPAFLTIIAMPFTFSIANGIAAGLVAYPIVKIASGKAKEIHPIVYVLAILFILRFITL
FT                   SE"
FT   gene            615612..616073
FT                   /locus_tag="Thit_0568"
FT   CDS_pept        615612..616073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0568"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; KEGG: tex:Teth514_0517
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01869"
FT                   /db_xref="GOA:D3T7D7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D7"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ADD01869.1"
FT                   /translation="MPKVAIVVGSKSDLPVVERCTKILEEFEISYDVKVLSAHRTPFET
FT                   QEFAVNADKYYDIIIAGAGKAAHLPGVIASYTLLPVIGLPIKSSTLDGLDSLLSIVQMP
FT                   KGIPVATVAIDGAENAALLACHILSLKYTYLKEALADYREKMAEEVLNN"
FT   gene            616093..616800
FT                   /locus_tag="Thit_0569"
FT   CDS_pept        616093..616800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0569"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   KEGG: tpd:Teth39_1716
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01870"
FT                   /db_xref="GOA:D3T7D8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D8"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ADD01870.1"
FT                   /translation="MEKRELLYEGKAKKVYKTEEENFYIIEYKDDATAFNGLKKGTIAE
FT                   KGVVNNKVSAILFALLEKNNVPNHYVKRLSDREMLVKKVEIFPLEVIVRNYAAGSICKR
FT                   LGLEEGLKFKTPVLEFSYKNDELKDPMINEYHIQALELATKEEIEIMTEMTFKVNEILS
FT                   EYFLSKDIILVDFKLEFGKSNEGILLADEISPDTCRFWDKNTMEKLDKDRFRKDLGKVE
FT                   EAYLEILKRLGGM"
FT   gene            616803..617051
FT                   /locus_tag="Thit_0570"
FT   CDS_pept        616803..617051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0570"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS"
FT                   /note="KEGG: tte:TTE0809 phosphoribosylformylglycinamidine
FT                   (FGAM) synthase, PurS component; TIGRFAM:
FT                   phosphoribosylformylglycinamidine synthase, purS; PFAM:
FT                   phosphoribosylformylglycinamidine synthetase PurS"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01871"
FT                   /db_xref="GOA:D3T7D9"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7D9"
FT                   /inference="protein motif:TFAM:TIGR00302"
FT                   /protein_id="ADD01871.1"
FT                   /translation="MLIAKVYITLKKGILDPQGKAVKGALHSLGYEEVKEVRVGKYIEL
FT                   TFEDGDLSLLKDKVDEMCKRILTNPIIEDYTFEIVEG"
FT   gene            617054..617728
FT                   /locus_tag="Thit_0571"
FT   CDS_pept        617054..617728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0571"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: tpd:Teth39_1714 phosphoribosylformylglycinamidine
FT                   synthase I; PFAM: CobB/CobQ domain protein glutamine
FT                   amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01872"
FT                   /db_xref="GOA:D3T7E0"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E0"
FT                   /inference="protein motif:TFAM:TIGR01737"
FT                   /protein_id="ADD01872.1"
FT                   /translation="MKFAVIVFPGSNCDVDCYYAVKDGLGEEVEYVWHQEKNLSKYDVI
FT                   MLPGGFSYGDYLRAGAIARFSPVMEAVREEAEKGKFIIGICNGFQILTEAGLLPGALRK
FT                   NEGLKFICKTVSITVENDKTPFTTRLKKGQEILLPIAHGEGNYYVDDKTLRELKENNQI
FT                   VFRYKENINGSVERIAGVINKKGNVLGMMPHPERAYAPLLGNTDGLYILGSIVDNFVKG
FT                   GV"
FT   gene            617731..619932
FT                   /locus_tag="Thit_0572"
FT   CDS_pept        617731..619932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0572"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /note="KEGG: tte:TTE0811 phosphoribosylformylglycinamidine
FT                   synthase II; TIGRFAM: phosphoribosylformylglycinamidine
FT                   synthase II; PFAM: AIR synthase related protein domain
FT                   protein; AIR synthase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01873"
FT                   /db_xref="GOA:D3T7E1"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E1"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ADD01873.1"
FT                   /translation="MDKIWRELGLTDEEYEKIISILGREPNITELGMYSVMWSEHCAYK
FT                   NSKPLLKYLPTKGERVIQGPGENAGILDIGDNLAVVMKIESHNHPSAIEPYQGAATGVG
FT                   GIIRDIFTMGARPIALLDSLRFGIPEDKRTKYLIENVVAGIGDYGNCIGIPTVGGDTYF
FT                   EESYKGNPLVNAMCVGIVEKDKIKKGIAKGIGNPVMIVGATTGRDGIGGASFASQELSE
FT                   ESEEKRPSVQVGDPFMEKLLLEACLELFETDAVVAIQDMGAAGLTSSSCEMASRGGVGM
FT                   EIDLDKVPLREEGMTPYEIMLSESQERMLVVVEKGKEEDVQKVFKKWGLNAATIGKITD
FT                   DGMIRVIKEGKIVAEVPAKSLTEGAPQYVREEEVPKWQEDVNKLDINEVKPPEDMNKAL
FT                   KDVISSLNIASKEWIYSQYDYMVRTDTVITPGMDAAVVRIKGTKKAVALTTDCNGRYCY
FT                   LDPYIGSQVAVAEAARNLCMVGAKPIGVTDCLNFGNPEKKEIYWQLKNSIFGIAKACET
FT                   LQIPVVSGNVSLYNENEGEAIYPTPVIGMAGLIEDVSKICTMDFKKESDVIIILGKNKG
FT                   ELGGSEYLKVCFGMVKGQPPRIDLEEEKRLQELVLKLIDEGLIKSSHDISEGGFAAALV
FT                   ESAIAGKKGAKISLQTSLREDVELFSESQSRALITASPEKVDEVLKIAYEYQVPAQKVG
FT                   VVEGKDIVIDVNGKRIIDLPLEALEESWRGRIKWEMERN"
FT   gene            619911..621308
FT                   /locus_tag="Thit_0573"
FT   CDS_pept        619911..621308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0573"
FT                   /product="amidophosphoribosyltransferase"
FT                   /note="KEGG: tex:Teth514_0522
FT                   amidophosphoribosyltransferase; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01874"
FT                   /db_xref="GOA:D3T7E2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E2"
FT                   /inference="protein motif:TFAM:TIGR01134"
FT                   /protein_id="ADD01874.1"
FT                   /translation="MGNGEKLKEECGVFGAFSLSTSVTSYIYYGLQALQHRGQESSGIA
FT                   IYDGEKINCIKGLGLVSEVFNKENLKTLEGKMGIGHVRYSTTGSNDIINAQPLVANFKN
FT                   EYMALAHNGNLINAKELRGQLEDDGRIFQTTTDSEIILHLIAKNFQKGLIEALKETIKQ
FT                   IKGSYALVILAANKLIGIRDVNSIRPLCIGKKDDTYFLSSESCAFDVIGAELIRDVEAG
FT                   EIVIIDGKGIESVKLEGEEKKKPCVFEYIYFARPDSVIDRKSVYFTRLEMGKRLAEEAP
FT                   VDADLVVPVPDSGVAAARGYSLKTGIPMGEGLIKNKYVGRTFIAPDQRDRETGVRIKLN
FT                   VLKELIQGKRIVLIDDSIVRGTTMKRLVSLLKNGGAKEVHVRISSPPVKYSCYFGIDTP
FT                   TKKELIAARMSVDKICKVIGADSLQFLSIEGLIKSVGLKFICTGCFDGDYPMYVPKEGN
FT                   KYLFEKT"
FT   gene            621326..622336
FT                   /locus_tag="Thit_0574"
FT   CDS_pept        621326..622336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0574"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine
FT                   cyclo-ligase; KEGG: tpd:Teth39_1711
FT                   phosphoribosylaminoimidazole synthetase; PFAM: AIR synthase
FT                   related protein domain protein; AIR synthase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01875"
FT                   /db_xref="GOA:D3T7E3"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E3"
FT                   /inference="protein motif:TFAM:TIGR00878"
FT                   /protein_id="ADD01875.1"
FT                   /translation="MNYKDAGVNIDEGNKLVEMIKPIAKQTLNEYVLEGIGGFAGLIEI
FT                   KNYKNPVLISSTDGVGTKLKIAFMMDKHDTVGIDLVAMCVNDIIVTGAKPLFFLDYFAT
FT                   GKLKSETAVEVIKGIAEGCKIAGCALIGGETAELPGFYKEGEYDLAGFCVGIAEKEELI
FT                   DTKLIKEGDAIIGLASSGIHSNGYSLVRKIFFEKNNFSVKDFIPELGINLGEALLTPTK
FT                   IYVKSIEALKGLKIKGMAHITGGGFIDNIPRILRKSIAAKINKGSWEIPAIFNLIQRLG
FT                   DIEEREMYRTFNMGIGMVVIVEPSDVDKALEKLNGIGEKAYIIGEIVESEGGVIL"
FT   gene            622333..622941
FT                   /locus_tag="Thit_0575"
FT   CDS_pept        622333..622941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0575"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /note="KEGG: tpd:Teth39_1710 phosphoribosylglycinamide
FT                   formyltransferase; TIGRFAM: phosphoribosylglycinamide
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01876"
FT                   /db_xref="GOA:D3T7E4"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E4"
FT                   /inference="protein motif:TFAM:TIGR00639"
FT                   /protein_id="ADD01876.1"
FT                   /translation="MNLVVMASGNGTDLQSIIDAIEEGYINARIIAVISDKKGAYALER
FT                   AKKHGIATYCLPKKELKENFQEELLKLLEKLSPDGIILAGFLTILSGEIVERFENKIIN
FT                   IHPSLIPAFCGKGFYGMKVHQAVYEYGVKYTGCTVHFVDQGADTGPIILQEVVKIDEED
FT                   TPETIAKKVLEVEHKVLPYAVKLFTEGKLKVEGRKVRIL"
FT   gene            623018..624544
FT                   /locus_tag="Thit_0576"
FT   CDS_pept        623018..624544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0576"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="SMART: AICARFT/IMPCHase bienzyme formylation region;
FT                   MGS domain protein; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; KEGG: tpd:Teth39_1709
FT                   bifunctional phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01877"
FT                   /db_xref="GOA:D3T7E5"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E5"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ADD01877.1"
FT                   /translation="MAKKALISVSKKEGIVEFAKKLNGLGYEVISTGGTYNLLKENGVN
FT                   VIKVSDITGFPEIMDGRVKTLHPKIHGGLLAIRDNEEHIKALKEHDIEPIDIVVINLYP
FT                   FKETILKENVTLEEAIENIDIGGPSMIRAAAKNYKYVTILVDPKDYDTVIEEIKQYGNT
FT                   KEETRFYLAAKAFGHTALYDSLIYNYLIQKNNIEFPEVMAFAYEKAQDMRYGENPHQKA
FT                   AFYKNPIKVYGIAECVKLHGKELSFNNINDANAAIELLREFKEPAAVAVKHTNPCGVAI
FT                   ADNIYNAYLKAYESDPVSIFGGIVALNRTVDVKTAEELIKIFLEIVIAPDFEEEALEIL
FT                   KKKKNLRILRLKEGYEKEYDLKKVEGGLLVQEKDEIDLDENNLKVVTKKAPTQKEMEDL
FT                   RFAWKVVKHVKSNAIVLAKDGATVGIGVGQVNRIWPTEQAIKQAGEKAKGSVLASDAFF
FT                   PFPDVVEVASKAGITAIIQPGGSKNDELSIEAADKGGISMIFTGIRHFKH"
FT   gene            624557..625816
FT                   /locus_tag="Thit_0577"
FT   CDS_pept        624557..625816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0577"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="TIGRFAM: phosphoribosylamine/glycine ligase; KEGG:
FT                   tex:Teth514_0526 phosphoribosylamine--glycine ligase; PFAM:
FT                   Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;
FT                   Phosphoribosylglycinamide synthetase, N-domain;
FT                   Phosphoribosylglycinamide synthetase, C-domain"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01878"
FT                   /db_xref="GOA:D3T7E6"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E6"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ADD01878.1"
FT                   /translation="MKVLVIGGGGREHAIVHKLSQSSKVDKIYCAPGNAGIGLLAECVD
FT                   IKVGDIERLKEFAIKNNIDLTVVGPEMPLVQGIVDEFEKARLKIFGPNKSAAAIEGSKY
FT                   FTKQLLSKYNIPTGRFRAFDKYQEALKFLKEAWYPVVMKADGLAQGKGVFIVKDFIEAK
FT                   EVLDLMMKKRIFGASGDIVIIEEMLFGKEASVFAFTDGENILPMVSAMDYKKVYEGDKG
FT                   PNTGGMGSIAPNPYLKEKTLKEVMDSILKPVVKALQKEGIVYKGVLYAGLMLTEEGPKV
FT                   LEFNARFGDPETQVVLPLLKTDLIDIMEATIEGKLDKIQIEWENKKAVCVVAVSNGYPG
FT                   EYQIGFEITGLEKVKEAFVYHAGTALKDGKITTSGGRVLAVTTIGDSYEEAREKVYKEI
FT                   EKIRFDGMYYRKDIALLSQV"
FT   gene            626056..626850
FT                   /locus_tag="Thit_0578"
FT   CDS_pept        626056..626850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0578"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="TIGRFAM: glutamate racemase; KEGG: tex:Teth514_0527
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01879"
FT                   /db_xref="GOA:D3T7E7"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E7"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ADD01879.1"
FT                   /translation="MDLRPIGIFDSGVGGLTVLKRLVEVLPGEDYIYFGDTKRVPYGDR
FT                   SEEEIKKFAKQILNFMREQKVKAVVIACNTTCAVINKSEYDVVLFDVLKAGAESAALYT
FT                   INKKIGVIATTRTVESKSYEKNIKIIDKNIKVYQKACPEFVPLIEKGLYNSPIAYETAS
FT                   NCLKELKERDIDTLVLGCTHYPLMMEVIEEIVGENVKIVDPAIKLAYDVKDYLLRRDLF
FT                   NIQNIGKTKFFVSGDKDNFIKTAEMLLGEKIENVLHVDIEKY"
FT   gene            626866..628038
FT                   /locus_tag="Thit_0579"
FT   CDS_pept        626866..628038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0579"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="TIGRFAM: amidohydrolase; KEGG: tpd:Teth39_1705
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01880"
FT                   /db_xref="GOA:D3T7E8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E8"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ADD01880.1"
FT                   /translation="MDILREVKKVEKEVIELRRKIHMYPELGFEEIKTSEVVYDYLKNL
FT                   GIEVERIAKTGVIGTLKGNGSRTIAIRADMDALPIQEENDVEYASQIPGRMHACGHDVH
FT                   TAILLGTAKLLANIKDELKGNVKFIFQPAEETTGGALPMIEEGVLENPKVDAIIGLHVD
FT                   PELQVGQIGITYGKAYASSDMIDIIVKGKSSHGAEPHKSVDAIVIAANIVNILQTVVSR
FT                   KANPLSPMVLTIGTIEGGYARNIIADKVRMSGIIRMMEEEKRDEIAKTVERICHNTAKT
FT                   MGGEVEFKRTRGYPCLVNHKGMTDLVKETALTLLGEDNVVEVLPTMGVEDFAYFLQKVP
FT                   GCFYKLGCGNKEKGINKPIHSNQFNVDEGCIKIGVALHLSIVLNYLNSNS"
FT   gene            628184..629227
FT                   /locus_tag="Thit_0580"
FT   CDS_pept        628184..629227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0580"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   tpd:Teth39_2044 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01881"
FT                   /db_xref="GOA:D3T7E9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7E9"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ADD01881.1"
FT                   /translation="MVHNNDTTKKRSFKHLSSYERGEIYALLKEGRSIRYIAKKLNRSP
FT                   STISREIKRGTTTQLRSDLSSYTSYFPETGQAIYEKNRSNCGAKFKVAKAEDFLKYAEN
FT                   KILNEKWSPDAVVGYCKKDPSWNNKTIVCTKTLYNYIDRGLLKVKNIDLPLKLRLKPRK
FT                   KQNRKNKRIMGKSIDFRPKEVESREVFGHWEIDTLIGKKSNDKALLTLIERKTRHEIIF
FT                   LLDAKDNKSVKDALSKLKDMFGDNLSKVFKTITSDNGTEFSDLESALLEYGVEVYYTHP
FT                   YSSWERATNERHNGLIRRFIPKGKSIKDLSIDTIKRVENWLNNLPRKLLNYKTPKEYFY
FT                   EELAKIC"
FT   gene            629673..631229
FT                   /locus_tag="Thit_0581"
FT   CDS_pept        629673..631229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0581"
FT                   /product="stage V sporulation protein B"
FT                   /note="KEGG: tpd:Teth39_1704 polysaccharide biosynthesis
FT                   protein; TIGRFAM: stage V sporulation protein B; PFAM:
FT                   polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01882"
FT                   /db_xref="GOA:D3T7F0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR014249"
FT                   /db_xref="InterPro:IPR024923"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D3T7F0"
FT                   /inference="protein motif:TFAM:TIGR02900"
FT                   /protein_id="ADD01882.1"
FT                   /translation="MHKRSFIRGAFILTIANIIDRSIGFIFRIILSNMLGPEGMGIYQL
FT                   VLPIYFVSITFLTSGTMAVTSRFISEEKAKGNKKNVFKILKITFLIVLIFAFAISSLLF
FT                   FKAKYIAKELLHEPRALLSILIFAPVLIIVASSSVFKGFFQGVINMIPASVSEIVEQIV
FT                   RISITLYLIQLFTGAKLEYLVAIAIFGISAGEIASFLMYILFYKKEVKVINREMPYDGR
FT                   EWEAFSIAKTLVITAIPITFSKLIVNVVDLAESLIIPSRLVASGLSHSEAMSEFGKMLG
FT                   MAIPLAYMPAVITSSLSTTVLPAVSEAAALKKWDAVRLRINQAIGYTTLVAFPAIILFL
FT                   ALPDQISQLLYPSSPGVGNFVRVISLGSIFAFLEAVVASTLHGLGKQNVVLRNSIIWLG
FT                   VCVIGMYYLTSLPHLRLFGYIYSFIFADALILALNMFELIKMTGLKINYLNWFIKPIIA
FT                   STIMGAIVIIIHSKLLETNVNMWINIFLSILTGFLAYLMLCSALQLPYIEELKKIILLK
FT                   N"
FT   gene            631302..632702
FT                   /locus_tag="Thit_0582"
FT   CDS_pept        631302..632702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Thit_0582"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="KEGG: tpd:Teth39_1703 thiamine biosynthesis protein
FT                   ThiH; PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; SMART: biotin and thiamin
FT                   synthesis associated; Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Thit_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADD01883"
FT                   /db_xref="GOA:D3T7F1"
FT